WorldWideScience

Sample records for cadmium 113 target

  1. Separation of no-carrier-added 113,117mSn and 113m,114mIn from alpha particle irradiated natural cadmium target

    International Nuclear Information System (INIS)

    A natural cadmium foil was irradiated by 42 MeV α-particles to produce 113,117mSn, 111,113m,114mIn simultaneously in the target matrix. After the complete decay of short lived radionuclides, long-lived NCA products were separated sequentially from the bulk cadmium by liquid-liquid extraction using di-(2-ethylhexyl)phosphoric acid (HDEHP) dissolved in cyclohexane as organic phase and HCl as aqueous phase. At the optimum condition, 10-2 M HCl and 5 % HDEHP, NCA In along with NCA Sn radionuclides (75 %) were separated from the bulk Cd resulting to high separation factors of 2.7 x 104 (DIn/DCd) and 500 (DSn/DCd), respectively. The NCA In was stripped back completely to the aqueous phase by 6 M HCl leaving NCA Sn in the HDEHP phase with a separation factor (DSn/DIn) of 3.94 x 106. (author)

  2. Cadmium-113m as a biogeochemical tracer for cadmium in Lake Michigan

    International Nuclear Information System (INIS)

    The Lake Michigan watershed has been sampled for 113mCd. This long-lived metastable isotope of cadmium allowed independent evaluation of cadmium distribution in this dynamic ecosystem. 113mCd analysis was not hampered by contamination or loss. These are problems which have plagued stable cadmium measurements. Sensitivity and specificity were necessary concerns. 113mCd has been preconcentrated from large samples in order to obtain sufficient activity for quantification. Specificity for the gross beta activity measured was secured in a rigorous ion exchange decontamination. Confirmation of the suspected 113mCd beta source was checked by reverse tracer analysis and modified Feather analysis range-energy relationships. The 113mCd activities confirm the expected semiconservative behavior for cadmium. This behavior manifests itself in a long residence time for cadmium in Lake Michigan. The inefficiency of outflow removal, the low sedimentation rate and the unquantified sediment resuspension and release of cadmium are factors contributing to this residence time. Steady state concentration of cadmium in Lake Michigan will increase if present input rates persist

  3. Cadmium(II) complex formation with selenourea and thiourea in solution: an XAS and 113Cd NMR study.

    Science.gov (United States)

    Jalilehvand, Farideh; Amini, Zahra; Parmar, Karnjit

    2012-10-15

    The complexes formed in methanol solutions of Cd(CF(3)SO(3))(2) with selenourea (SeU) or thiourea (TU), for thiourea also in aqueous solution, were studied by combining (113)Cd NMR and X-ray absorption spectroscopy. At low temperature (~200 K), distinct (113)Cd NMR signals were observed, corresponding to CdL(n)(2+) species (n = 0-4, L = TU or SeU) in slow ligand exchange. Peak integrals were used to obtain the speciation in the methanol solutions, allowing stability constants to be estimated. For cadmium(II) complexes with thione (C═S) or selone (C═Se) groups coordinated in Cd(S/Se)O(5) or Cd(S/Se)(2)O(4) (O from MeOH or CF(3)SO(3)(-)) environments, the (113)Cd chemical shifts were quite similar, within 93-97 ppm and 189-193 ppm, respectively. However, the difference in the chemical shift for the Cd(SeU)(4)(2+) (578 pm) and Cd(TU)(4)(2+) (526 ppm) species, with CdSe(4) and CdS(4) coordination, respectively, shows less chemical shielding for the coordinated Se atoms than for S, in contrast to the common trend with increasing shielding in the following order: O > N > Se > S. In solutions dominated by mono- and tetra-thiourea/selenourea complexes, their coordination and bond distances could be evaluated by Cd K-edge extended X-ray absorption fine structure (EXAFS) spectroscopy. At ~200 K and high excess of thiourea, a minor amount (up to ~30%) of [Cd(TU)(5-6)](2+) species was detected by an upfield shift of the (113)Cd NMR signal (up to 423 ppm) and an amplitude reduction of the EXAFS oscillation. The amount was estimated by fitting linear combinations of simulated EXAFS spectra for [Cd(TU)(4)](2+) and [Cd(TU)(6)](2+) complexes. At room temperature, [Cd(TU)(4)](2+) was the highest complex formed, also in aqueous solution. Cd L(3)-edge X-ray absorption near edge structure (XANES) spectra of cadmium(II) thiourea solutions in methanol were used to follow changes in the CdS(x)O(y) coordination. The correlations found from the current and previous studies between (113

  4. sup 113 Cd shielding tensors of the cadmium complex of texaphyrin, a novel expanded porphyrin, and its pyridine and benzimidazole adducts

    Energy Technology Data Exchange (ETDEWEB)

    Kennedy, M.A.; Ellis, P.D. (Univ. of South Carolina, Columbia (USA)); Sessler, J.L.; Murai, Toshiaki (Univ. of Texas, Austin (USA))

    1990-03-07

    The cadmium complex of an expanded five-coordinate porphyrin known as texaphyrin and its complexes with pyridine and benzimidazole have been investigated by solution- and solid-state {sup 113}Cd NMR spectroscopy, and the results are reported. The principle shielding tensor elements were determined for each complex and are discussed in terms of reported crystal studies of Cd-texaphyrin and in comparison to cadmium complexes with other porphyrin and similar macrocycle ligands. 18 refs., 5 figs., 1 tab.

  5. Microphthalmia-associated transcription factor as the molecular target of cadmium toxicity in human melanocytes

    Energy Technology Data Exchange (ETDEWEB)

    Chantarawong, Wipa [Department of Molecular Biology and Applied Physiology, Tohoku University School of Medicine, Sendai (Japan); Inter Departmental Multidisciplinary Graduate Program in Bioscience, Faculty of Science, Kasetsart University, Bangkok (Thailand); Takeda, Kazuhisa; Sangartit, Weerapon; Yoshizawa, Miki [Department of Molecular Biology and Applied Physiology, Tohoku University School of Medicine, Sendai (Japan); Pradermwong, Kantimanee [Department of Zoology, Faculty of Science, Kasetsart University, Bangkok (Thailand); Shibahara, Shigeki, E-mail: shibahar@med.tohoku.ac.jp [Department of Molecular Biology and Applied Physiology, Tohoku University School of Medicine, Sendai (Japan)

    2014-11-28

    Highlights: • In human melanocytes, cadmium decreases the expression of MITF-M and tyrosinase and their mRNAs. • In human melanoma cells, cadmium decreases the expression of MITF-M protein and tyrosinase mRNA. • Expression of MITF-H is less sensitive to cadmium toxicity in melanocyte-linage cells. • Cadmium does not decrease the expression of MITF-H in retinal pigment epithelial cells. • MITF-M is the molecular target of cadmium toxicity in melanocytes. - Abstract: Dietary intake of cadmium is inevitable, causing age-related increase in cadmium accumulation in many organs, including hair, choroid and retinal pigment epithelium (RPE). Cadmium has been implicated in the pathogenesis of hearing loss and macular degeneration. The functions of cochlea and retina are maintained by melanocytes and RPE, respectively, and the differentiation of these pigment cells is regulated by microphthalmia-associated transcription factor (MITF). In the present study, we explored the potential toxicity of cadmium in the cochlea and retina by using cultured human melanocytes and human RPE cell lines. MITF consists of multiple isoforms, including melanocyte-specific MITF-M and widely expressed MITF-H. Levels of MITF-M protein and its mRNA in human epidermal melanocytes and HMV-II melanoma cells were decreased significantly by cadmium. In parallel with the MITF reduction, mRNA levels of tyrosinase, the key enzyme of melanin biosynthesis that is regulated by MITF-M, were also decreased. In RPE cells, however, the levels of total MITF protein, constituting mainly MITF-H, were not decreased by cadmium. We thus identify MITF-M as the molecular target of cadmium toxicity in melanocytes, thereby accounting for the increased risk of disability from melanocyte malfunction, such as hearing and vision loss among people with elevated cadmium exposure.

  6. Microphthalmia-associated transcription factor as the molecular target of cadmium toxicity in human melanocytes

    International Nuclear Information System (INIS)

    Highlights: • In human melanocytes, cadmium decreases the expression of MITF-M and tyrosinase and their mRNAs. • In human melanoma cells, cadmium decreases the expression of MITF-M protein and tyrosinase mRNA. • Expression of MITF-H is less sensitive to cadmium toxicity in melanocyte-linage cells. • Cadmium does not decrease the expression of MITF-H in retinal pigment epithelial cells. • MITF-M is the molecular target of cadmium toxicity in melanocytes. - Abstract: Dietary intake of cadmium is inevitable, causing age-related increase in cadmium accumulation in many organs, including hair, choroid and retinal pigment epithelium (RPE). Cadmium has been implicated in the pathogenesis of hearing loss and macular degeneration. The functions of cochlea and retina are maintained by melanocytes and RPE, respectively, and the differentiation of these pigment cells is regulated by microphthalmia-associated transcription factor (MITF). In the present study, we explored the potential toxicity of cadmium in the cochlea and retina by using cultured human melanocytes and human RPE cell lines. MITF consists of multiple isoforms, including melanocyte-specific MITF-M and widely expressed MITF-H. Levels of MITF-M protein and its mRNA in human epidermal melanocytes and HMV-II melanoma cells were decreased significantly by cadmium. In parallel with the MITF reduction, mRNA levels of tyrosinase, the key enzyme of melanin biosynthesis that is regulated by MITF-M, were also decreased. In RPE cells, however, the levels of total MITF protein, constituting mainly MITF-H, were not decreased by cadmium. We thus identify MITF-M as the molecular target of cadmium toxicity in melanocytes, thereby accounting for the increased risk of disability from melanocyte malfunction, such as hearing and vision loss among people with elevated cadmium exposure

  7. Microphthalmia-associated transcription factor as the molecular target of cadmium toxicity in human melanocytes.

    Science.gov (United States)

    Chantarawong, Wipa; Takeda, Kazuhisa; Sangartit, Weerapon; Yoshizawa, Miki; Pradermwong, Kantimanee; Shibahara, Shigeki

    2014-11-28

    Dietary intake of cadmium is inevitable, causing age-related increase in cadmium accumulation in many organs, including hair, choroid and retinal pigment epithelium (RPE). Cadmium has been implicated in the pathogenesis of hearing loss and macular degeneration. The functions of cochlea and retina are maintained by melanocytes and RPE, respectively, and the differentiation of these pigment cells is regulated by microphthalmia-associated transcription factor (MITF). In the present study, we explored the potential toxicity of cadmium in the cochlea and retina by using cultured human melanocytes and human RPE cell lines. MITF consists of multiple isoforms, including melanocyte-specific MITF-M and widely expressed MITF-H. Levels of MITF-M protein and its mRNA in human epidermal melanocytes and HMV-II melanoma cells were decreased significantly by cadmium. In parallel with the MITF reduction, mRNA levels of tyrosinase, the key enzyme of melanin biosynthesis that is regulated by MITF-M, were also decreased. In RPE cells, however, the levels of total MITF protein, constituting mainly MITF-H, were not decreased by cadmium. We thus identify MITF-M as the molecular target of cadmium toxicity in melanocytes, thereby accounting for the increased risk of disability from melanocyte malfunction, such as hearing and vision loss among people with elevated cadmium exposure. PMID:25449283

  8. Solid-state NMR spin-echo investigation of the metalloproteins parvalbumin, concanavalin A, and pea and lentil lectins, substituted with cadmium-113

    Science.gov (United States)

    Marchetti, Paul S.; Bhattacharyya, Lokesh; Ellis, Paul D.; Brewer, C. Fred

    Solid-state 113Cd NMR spectroscopy of static powder samples of 113Cd-substituted metalloproteins, parvalbumin, concanavalin A, and pea and lentil lectins, was carried out. Cross polarization followed by application of a train of uniformly spaced π pulses was employed to investigate the origin of residual cadmium NMR linewidths observed previously in these proteins. Fourier transformation of the resulting spin-echo train yielded spectra consisting of uniformly spaced lines having linewidths of the order of 1-2 ppm. The observed linewidths were not influenced by temperature as low as -50°C or by extent of protein hydration. Since the echo-train pulse sequence is able to eliminate inhomogeneous but not homogeneous contributions to the linewidths, there is a predominant inhomogeneous contribution to cadmium linewidths in the protein CP/MAS spectra. However, significant changes in spectral intensities were observed with change in temperature and extent of protein hydration. These intensity changes are attributed for parvalbumin and concanavalin A to changes in cross-polarization efficiency with temperature and hydration. For pea and lentil lectins, this effect is attributed to the elimination of static disorder at the pea and lentil S2 metal-ion sites due to sugar binding.

  9. High-resolution /sup 113/Cd NMR of solids. Correlation of spectra with the molecular structure of a decanuclear cadmium(II) complex

    Energy Technology Data Exchange (ETDEWEB)

    Murphy, P.D.; Stevens, W.C.; Cheung, T.T.P.; Lacelle, S.; Gerstein, B.C.; Kurtz, D.M. Jr.

    1981-07-29

    The usefulness of /sup 113/Cd NMR in solution as a structural and dynamic probe of macromolecular systems is hampered by fast exchange of Cd/sup 2 +/ with ligands and solvent. This paper demonstrates that recently developed techniques for attainment of high-resoluion NMR spectra in solids can overcome this problem. These spectra provide information about Cd/sup 2 +/ coordination environments which is unavailable in solution and which can be used to interpret NMR spectra in solution. By a combination of /sup 113/Cd-/sup 1/H cross polarization and spinning either at the magic angle or slightly off magic angle, the following solid-state /sup 113/Cd NMR data for each cadmium site in the decanuclear cation Cd/sub 10/(SCH/sub 2/CH/sub 2/OH)/sub 16//sup 4 +/ have been obtained: sigma, the isotropic value of the chemical shift; ..delta..sigma, the shielding anisotropy; and S, a symmetry factor which characterizes the uniformity of shielding with respect to an axially symmetric tensor. The values of sigma and ..delta..sigma are shown to accurately reproduce the static (nonspinning) NMR spectrum of the solid.

  10. Diffusion-based separation methods: dry distillation of zinc, cadmium and mercury isotopes from irradiated targets

    International Nuclear Information System (INIS)

    Diffusion-based separation methods allow the extraction of produced radionuclides with a low loss of target material, which is of special importance when enriched target material is used. We present a simple, non-destructive and rapid method to separate radioactive isotopes of IIB group elements (zinc, cadmium and mercury) from IB group metal targets irradiated with protons. Irradiated target foils were heated to a temperature 20oC below the melting point of the target material. During these conditions at least 90% of the desired radioactivity was evaporated with negligible loss of target material. Separation time was 15 min for mercury, 60 min for cadmium and 120 min for zinc. (author)

  11. Fabrication of a highly selective cadmium (II) sensor based on 1,13-bis(8-quinolyl)-1,4,7,10,13-pentaoxatridecane as a supramolecular ionophore

    Energy Technology Data Exchange (ETDEWEB)

    Ghaemi, Arezoo, E-mail: arezooghaemi@yahoo.com; Tavakkoli, Haman; Mombeni, Tayebeh

    2014-05-01

    A new cadmium (II) ion selective sensor based on 1,13-bis(8-quinolyl)-1,4,7,10,13-pentaoxatridecane (kryptofix5) as a supramolecular carrier has been developed. The membrane solutions containing polyvinyl chloride (PVC), plasticizer, sodium tetraphenylborate (NaTPB) as a lipophilic ionic additive and kryptofix5 as an ionophore were directly coated on the surface of graphite rods. The best composition of the coated membrane (w/w%) was found to be: 30.0% PVC, 61.0% dioctyl sebacate (DOS), 6.0% NaTPB and 3.0% kryptofix5. The sensor indicates a good linear response for Cd{sup 2+} cation over a wide concentration range from 1.0 × 10{sup −5} to 1.0 × 10{sup −1} M with a Nernstian slope of 29.8 ± 0.1 mV/decade and the detection limit is 8.4 × 10{sup −6} M. The response time of the sensor is 15 s and it can be used for 7 weeks without significant drift in potential. The sensor operates in the wide pH range of 1.0–6.0. This sensor reveals a very good selectivity toward Cd{sup 2+} ion over a wide range of alkali, transition and heavy metal cations. The sensor was used as an indicator electrode for potentiometric titration of Cd{sup 2+} using sodium fluoride and ethylenediaminetetraacetic acid (EDTA) solutions with a sharp potential change that occurred at the end point. In addition, the proposed sensor was successfully used for determination of Cd{sup 2+} cation in real water samples. - Graphical abstract: Fabrication of a highly selective cadmium (II) sensor based on 1,13-bis(8-quinolyl)-1,4,7,10,13-pentaoxatridecane as a supramolecular ionophore. - Highlights: • Fabrication of a novel Cd{sup 2+} selective sensor with high sensitivity and selectivity • Using fabricated sensor in a wide pH range with fast response time • Replacing expensive techniques with this low cost sensor with low detection limit • Excellent capability of this sensor for measuring Cd{sup 2+} in real samples.

  12. sup 113 Cd shielding tensors of cadmium compounds. 6. Single-crystal NMR study of the CdCl sub 2 times 18-crown-6 complex

    Energy Technology Data Exchange (ETDEWEB)

    Kennedy, M.A.; Ellis, P.A. (Univ. of South Carolina, Columbia (USA)); Jakobsen, H.J. (Univ. of Aarhus (Denmark))

    1990-02-07

    The {sup 113}Cd chemical shielding tensor and its orientation in the molecular frame have been determined for CdCl{sub 2} {times} 18-crown-6 via a solid-state single-crystal NMR experiment. The shielding tensor elements are found to be {sigma}{sub 33} = {minus}700 ppM, {sigma}{sub 2}2 = 385 ppM, and {sigma}{sub 11} = 414 ppM. The anisotropy and asymmetry parameters are determined to be {Delta}{sigma} = {minus} 1,100 ppM and {eta} = 0.04, respectively. The unique shielding tensor element, {sigma}{sub 22}, lies 2.4{degree} from the 3-fold rotation axis of the crown ligand and was also found to be the most shielded tensor element {sigma}{sub 33}. The structural feature that determines the orientation of {sigma}{sub 33} is found to be the anomalously long Cd-O bond lengths, i.e. 2.75 {angstrom}. The unusually large magnitude of the most shielded tensor element is analyzed in terms of the special geometry and corresponding shielding trend established for a series of cadmium complexes with similar porphyrin and crown ligands. 15 refs., 2 figs., 3 tabs.

  13. Cadmium carcinogenesis

    Energy Technology Data Exchange (ETDEWEB)

    Waalkes, Michael P

    2003-12-10

    Cadmium is a heavy metal of considerable environmental and occupational concern. Cadmium compounds are classified as human carcinogens by several regulatory agencies. The most convincing data that cadmium is carcinogenic in humans comes from studies indicating occupational cadmium exposure is associated with lung cancer. Cadmium exposure has also been linked to human prostate and renal cancer, although this linkage is weaker than for lung cancer. Other target sites of cadmium carcinogenesis in humans, such as liver, pancreas and stomach, are considered equivocal. In animals, cadmium effectively induces cancers at multiple sites and by various routes. Cadmium inhalation in rats induces pulmonary adenocarcinomas, in accord with its role in human lung cancer. Cadmium can induce tumors and/or preneoplastic lesions within the rat prostate after ingestion or injection. At relatively high doses, cadmium induces benign testicular tumors in rats, but these appear to be due to early toxic lesions and loss of testicular function, rather than from a specific carcinogenic effect of cadmium. Like many other metals, cadmium salts will induce mesenchymal tumors at the site of subcutaneous (s.c.) or intramuscular (i.m.) injections, but the human relevance of these is dubious. Other targets of cadmium in rodents include the liver, adrenal, pancreas, pituitary, and hematopoietic system. With the exception of testicular tumors in rodents, the mechanisms of cadmium carcinogenesis are poorly defined. Cadmium can cause any number of molecular lesions that would be relevant to oncogenesis in various cellular model systems. Most studies indicate cadmium is poorly mutagenic and probably acts through indirect or epigenetic mechanisms, potentially including aberrant activation of oncogenes and suppression of apoptosis.

  14. Cadmium carcinogenesis

    International Nuclear Information System (INIS)

    Cadmium is a heavy metal of considerable environmental and occupational concern. Cadmium compounds are classified as human carcinogens by several regulatory agencies. The most convincing data that cadmium is carcinogenic in humans comes from studies indicating occupational cadmium exposure is associated with lung cancer. Cadmium exposure has also been linked to human prostate and renal cancer, although this linkage is weaker than for lung cancer. Other target sites of cadmium carcinogenesis in humans, such as liver, pancreas and stomach, are considered equivocal. In animals, cadmium effectively induces cancers at multiple sites and by various routes. Cadmium inhalation in rats induces pulmonary adenocarcinomas, in accord with its role in human lung cancer. Cadmium can induce tumors and/or preneoplastic lesions within the rat prostate after ingestion or injection. At relatively high doses, cadmium induces benign testicular tumors in rats, but these appear to be due to early toxic lesions and loss of testicular function, rather than from a specific carcinogenic effect of cadmium. Like many other metals, cadmium salts will induce mesenchymal tumors at the site of subcutaneous (s.c.) or intramuscular (i.m.) injections, but the human relevance of these is dubious. Other targets of cadmium in rodents include the liver, adrenal, pancreas, pituitary, and hematopoietic system. With the exception of testicular tumors in rodents, the mechanisms of cadmium carcinogenesis are poorly defined. Cadmium can cause any number of molecular lesions that would be relevant to oncogenesis in various cellular model systems. Most studies indicate cadmium is poorly mutagenic and probably acts through indirect or epigenetic mechanisms, potentially including aberrant activation of oncogenes and suppression of apoptosis

  15. Fabrication of a highly selective cadmium (II) sensor based on 1,13-bis(8-quinolyl)-1,4,7,10,13-pentaoxatridecane as a supramolecular ionophore.

    Science.gov (United States)

    Ghaemi, Arezoo; Tavakkoli, Haman; Mombeni, Tayebeh

    2014-05-01

    A new cadmium (II) ion selective sensor based on 1,13-bis(8-quinolyl)-1,4,7,10,13-pentaoxatridecane (kryptofix5) as a supramolecular carrier has been developed. The membrane solutions containing polyvinyl chloride (PVC), plasticizer, sodium tetraphenylborate (NaTPB) as a lipophilic ionic additive and kryptofix5 as an ionophore were directly coated on the surface of graphite rods. The best composition of the coated membrane (w/w%) was found to be: 30.0% PVC, 61.0% dioctyl sebacate (DOS), 6.0% NaTPB and 3.0% kryptofix5. The sensor indicates a good linear response for Cd(2+) cation over a wide concentration range from 1.0×10(-5) to 1.0×10(-1) M with a Nernstian slope of 29.8±0.1 mV/decade and the detection limit is 8.4×10(-6) M. The response time of the sensor is 15s and it can be used for 7 weeks without significant drift in potential. The sensor operates in the wide pH range of 1.0-6.0. This sensor reveals a very good selectivity toward Cd(2+) ion over a wide range of alkali, transition and heavy metal cations. The sensor was used as an indicator electrode for potentiometric titration of Cd(2+) using sodium fluoride and ethylenediaminetetraacetic acid (EDTA) solutions with a sharp potential change that occurred at the end point. In addition, the proposed sensor was successfully used for determination of Cd(2+) cation in real water samples. PMID:24656367

  16. Characterization of wheat miRNAs and their target genes responsive to cadmium stress.

    Science.gov (United States)

    Qiu, ZongBo; Hai, BenZhai; Guo, JunLi; Li, YongFang; Zhang, Liang

    2016-04-01

    A increasing number of microRNAs have been shown to play important regulatory roles in plant responses to various metal stresses. However, little information about miRNAs especially miRNAs responsive to cadmium (Cd) stress is available in wheat. To investigate the role of miRNAs in responses to Cd stress, wheat seedlings were subjected to 250 μM Cd solution for 6, 12, 24 and 48 h, and analyses of morphological and physiological changes as well as the expression of five miRNAs and their corresponding targets were carried out. Our results demonstrated that miRNAs and their targets were differentially expressed in leaves and roots of wheat seedlings exposed to Cd stress. Furthermore, miR398 may involve in oxidative stress tolerance by regulating its target CSD to participate in Cd stress. Among ten miRNA-target pairs studied, nine pairs showed complex regulation relationship in leaves and roots of wheat seedlings exposed to Cd stress. These findings suggested that miRNAs are involved in the mediation of Cd stress signaling responses in wheat. The characterization of the miRNAs and the associated targets in responses to Cd exposure provides a framework for understanding the molecular mechanism of heavy metal tolerance in plants. PMID:26854408

  17. Subcellular targets of cadmium nephrotoxicity: cadmium binding to renal membrane proteins in animals with or without protective metallothionein synthesis.

    OpenAIRE

    Nordberg, G F; Jin, T; Nordberg, M.

    1994-01-01

    Nephrotoxic effects of cadmium exposure are well established in humans and experimental animals. An early manifestation of such toxicity is calciuria a few hours after injection of CdMT in rats. Protection against calciuria and other adverse effects such as proteinuria (occurring later) is offered by pretreatment with Cd, which effectively induces metallothionein synthesis. In the present experiment, one group of animals was given pretreatment with CdCl2 to induce metallothionein synthesis. T...

  18. Inhaled Cadmium Oxide Nanoparticles: Their in Vivo Fate and Effect on Target Organs

    Directory of Open Access Journals (Sweden)

    Jana Dumkova

    2016-06-01

    Full Text Available The increasing amount of heavy metals used in manufacturing equivalently increases hazards of environmental pollution by industrial products such as cadmium oxide (CdO nanoparticles. Here, we aimed to unravel the CdO nanoparticle destiny upon their entry into lungs by inhalations, with the main focus on the ultrastructural changes that the nanoparticles may cause to tissues of the primary and secondary target organs. We indeed found the CdO nanoparticles to be transported from the lungs into secondary target organs by blood. In lungs, inhaled CdO nanoparticles caused significant alterations in parenchyma tissue including hyperemia, enlarged pulmonary septa, congested capillaries, alveolar emphysema and small areas of atelectasis. Nanoparticles were observed in the cytoplasm of cells lining bronchioles, in the alveolar spaces as well as inside the membranous pneumocytes and in phagosomes of lung macrophages. Nanoparticles even penetrated through the membrane into some organelles including mitochondria and they also accumulated in the cytoplasmic vesicles. In livers, inhalation caused periportal inflammation and local hepatic necrosis. Only minor changes such as diffusely thickened filtration membrane with intramembranous electron dense deposits were observed in kidney. Taken together, inhaled CdO nanoparticles not only accumulated in lungs but they were also transported to other organs causing serious damage at tissue as well as cellular level.

  19. Inhaled Cadmium Oxide Nanoparticles: Their in Vivo Fate and Effect on Target Organs.

    Science.gov (United States)

    Dumkova, Jana; Vrlikova, Lucie; Vecera, Zbynek; Putnova, Barbora; Docekal, Bohumil; Mikuska, Pavel; Fictum, Petr; Hampl, Ales; Buchtova, Marcela

    2016-01-01

    The increasing amount of heavy metals used in manufacturing equivalently increases hazards of environmental pollution by industrial products such as cadmium oxide (CdO) nanoparticles. Here, we aimed to unravel the CdO nanoparticle destiny upon their entry into lungs by inhalations, with the main focus on the ultrastructural changes that the nanoparticles may cause to tissues of the primary and secondary target organs. We indeed found the CdO nanoparticles to be transported from the lungs into secondary target organs by blood. In lungs, inhaled CdO nanoparticles caused significant alterations in parenchyma tissue including hyperemia, enlarged pulmonary septa, congested capillaries, alveolar emphysema and small areas of atelectasis. Nanoparticles were observed in the cytoplasm of cells lining bronchioles, in the alveolar spaces as well as inside the membranous pneumocytes and in phagosomes of lung macrophages. Nanoparticles even penetrated through the membrane into some organelles including mitochondria and they also accumulated in the cytoplasmic vesicles. In livers, inhalation caused periportal inflammation and local hepatic necrosis. Only minor changes such as diffusely thickened filtration membrane with intramembranous electron dense deposits were observed in kidney. Taken together, inhaled CdO nanoparticles not only accumulated in lungs but they were also transported to other organs causing serious damage at tissue as well as cellular level. PMID:27271611

  20. Inhaled Cadmium Oxide Nanoparticles: Their in Vivo Fate and Effect on Target Organs

    Science.gov (United States)

    Dumkova, Jana; Vrlikova, Lucie; Vecera, Zbynek; Putnova, Barbora; Docekal, Bohumil; Mikuska, Pavel; Fictum, Petr; Hampl, Ales; Buchtova, Marcela

    2016-01-01

    The increasing amount of heavy metals used in manufacturing equivalently increases hazards of environmental pollution by industrial products such as cadmium oxide (CdO) nanoparticles. Here, we aimed to unravel the CdO nanoparticle destiny upon their entry into lungs by inhalations, with the main focus on the ultrastructural changes that the nanoparticles may cause to tissues of the primary and secondary target organs. We indeed found the CdO nanoparticles to be transported from the lungs into secondary target organs by blood. In lungs, inhaled CdO nanoparticles caused significant alterations in parenchyma tissue including hyperemia, enlarged pulmonary septa, congested capillaries, alveolar emphysema and small areas of atelectasis. Nanoparticles were observed in the cytoplasm of cells lining bronchioles, in the alveolar spaces as well as inside the membranous pneumocytes and in phagosomes of lung macrophages. Nanoparticles even penetrated through the membrane into some organelles including mitochondria and they also accumulated in the cytoplasmic vesicles. In livers, inhalation caused periportal inflammation and local hepatic necrosis. Only minor changes such as diffusely thickened filtration membrane with intramembranous electron dense deposits were observed in kidney. Taken together, inhaled CdO nanoparticles not only accumulated in lungs but they were also transported to other organs causing serious damage at tissue as well as cellular level. PMID:27271611

  1. Target or barrier? The cell wall of early- and later- diverging plants vs cadmium toxicity: differences in the response mechanisms

    Directory of Open Access Journals (Sweden)

    Luigi eParrotta

    2015-03-01

    Full Text Available Increasing industrialization and urbanization result in emission of pollutants in the environment including toxic heavy metals, as cadmium and lead. Among the different heavy metals contaminating the environment, cadmium raises great concern, as it is ecotoxic and as such can heavily impact ecosystems. The cell wall is the first structure of plant cells to come in contact with heavy metals. Its composition, characterized by proteins, polysaccharides and in some instances lignin and other phenolic compounds, confers the ability to bind non-covalently and/or covalently heavy metals via functional groups. A strong body of evidence in the literature has shown the role of the cell wall in heavy metal response: it sequesters heavy metals, but at the same time its synthesis and composition can be severely affected. The present review analyzes the dual property of plant cell walls, i.e. barrier and target of heavy metals, by taking Cd toxicity as example. Following a summary of the known physiological and biochemical responses of plants to Cd, the review compares the wall-related mechanisms in early- and later-diverging land plants, by considering the diversity in cell wall composition. By doing so, common as well as unique response mechanisms to metal/cadmium toxicity are identified among plant phyla and discussed. After discussing the role of hyperaccumulators’ cell walls as a particular case, the review concludes by considering important aspects for plant engineering.

  2. Neutron resonance spectroscopy on 113Cd to En=15 keV

    International Nuclear Information System (INIS)

    The results of a study of the compound nucleus 114Cd by neutron time-of-flight spectroscopy methods are presented. Targets of both natural cadmium and cadmium enriched in the 113 isotope were used. The neutron total capture and neutron transmission were both measured. A total of 275 new resonances were located. In addition, 102 other resonances which were previously known but not assigned to a particular cadmium isotope were definitively assigned to 113Cd. Resonance parameters E0 and gΓn were obtained for both newly identified and previously known resonances. Of the 437 resonances now known in 113Cd, we identify 104 of them as l=1 based on their small widths. Strength functions and level spacings are obtained for both l=0 and l=1 resonances. Comparisons of the data with Porter-Thomas reduced width distributions, Wigner nearest neighbor spacing distributions, and the Dyson-Metha Δ3 statistic are given. The linear correlation coefficient between adjacent spacings is also discussed. The spectroscopic information obtained is of importance for planning and interpretation of parity violation measurements on the p-wave resonances of 113Cd

  3. Ribosomal genes as early targets of cadmium-induced toxicity in Chironomus riparius larvae

    International Nuclear Information System (INIS)

    Cadmium is a widespread environmental pollutant that causes severe impacts in organisms. Although the effects of cadmium on aquatic insects have been studied in terms of their toxicity and changes in developmental parameters, little is known about its molecular and genetic effects. We have investigated the alterations in the pattern of gene expression provoked by acute exposure to cadmium in Chironomus riparius Mg. (Diptera, Chironomidae), a sentinel organism widely used in aquatic toxicity testing. The early cytotoxic effects were evaluated using immunocytochemistry and specific fluorescent probes in fourth instar larvae after 12 h of 10 mM cadmium treatments; under these conditions no significant effect on larvae mortality was detected until after 36 h of exposure. The changes in the pattern of gene expression were analysed by means of DNA/RNA hybrid antibodies in the polytene chromosomes from salivary gland cells. A decrease in the activity of the nucleolus is especially remarkable, accompanied by a significant reduction in size and the modification in nucleolar architecture, as shown by FISH. The inhibition of rDNA transcription was further evaluated by Northern blot analysis, which showed a marked decrease in the level of preribosomal rRNA (54% 45S 12 h). However, the BR genes, whose products are the giant polypeptides that constitute the silk-like secretion for constructing housing tubes, remain active. Simultaneously, decondensation and activation take place at some chromosomal regions, especially at the centromeres. The changes observed in the pattern of gene expression do not resemble those found after heat shock or other cell stressors. These data provide the first evidence that cadmium interacts with ribosomal genes and results in a drastic impairment of the functional activity of the nucleolus, an essential organelle for cellular survival. Therefore, the depletion of ribosomes would be a long-term effect of Cd-induced cellular damage. These findings may

  4. Ribosomal genes as early targets of cadmium-induced toxicity in Chironomus riparius larvae

    Energy Technology Data Exchange (ETDEWEB)

    Planello, R. [Biologia Ambiental, Facultad de Ciencias, Universidad Nacional de Educacion a Distancia, Senda del Rey 9, 28040, Madrid (Spain); Martinez-Guitarte, J.L. [Biologia Ambiental, Facultad de Ciencias, Universidad Nacional de Educacion a Distancia, Senda del Rey 9, 28040, Madrid (Spain); Morcillo, G. [Biologia Ambiental, Facultad de Ciencias, Universidad Nacional de Educacion a Distancia, Senda del Rey 9, 28040, Madrid (Spain)]. E-mail: gmorcillo@ccia.uned.es

    2007-02-01

    Cadmium is a widespread environmental pollutant that causes severe impacts in organisms. Although the effects of cadmium on aquatic insects have been studied in terms of their toxicity and changes in developmental parameters, little is known about its molecular and genetic effects. We have investigated the alterations in the pattern of gene expression provoked by acute exposure to cadmium in Chironomus riparius Mg. (Diptera, Chironomidae), a sentinel organism widely used in aquatic toxicity testing. The early cytotoxic effects were evaluated using immunocytochemistry and specific fluorescent probes in fourth instar larvae after 12 h of 10 mM cadmium treatments; under these conditions no significant effect on larvae mortality was detected until after 36 h of exposure. The changes in the pattern of gene expression were analysed by means of DNA/RNA hybrid antibodies in the polytene chromosomes from salivary gland cells. A decrease in the activity of the nucleolus is especially remarkable, accompanied by a significant reduction in size and the modification in nucleolar architecture, as shown by FISH. The inhibition of rDNA transcription was further evaluated by Northern blot analysis, which showed a marked decrease in the level of preribosomal rRNA (54% 45S 12 h). However, the BR genes, whose products are the giant polypeptides that constitute the silk-like secretion for constructing housing tubes, remain active. Simultaneously, decondensation and activation take place at some chromosomal regions, especially at the centromeres. The changes observed in the pattern of gene expression do not resemble those found after heat shock or other cell stressors. These data provide the first evidence that cadmium interacts with ribosomal genes and results in a drastic impairment of the functional activity of the nucleolus, an essential organelle for cellular survival. Therefore, the depletion of ribosomes would be a long-term effect of Cd-induced cellular damage. These findings may

  5. Carbon-13 and cadmium-113 nuclear magnetic resonance evidence for a novel transannular oscillation of cadmium(II) in the pendant arm macrocyclic complex (1,4,8,11-tetrakis(2-hydroxyethyl)-1,4,8,11-tetraazacyclotetradecane)cadmium(II)

    Energy Technology Data Exchange (ETDEWEB)

    Clarke, P.; Hounslow, A.M.; Lincoln, S.F. (Univ. of Adelaide, South Australia (Australia)); Keough, R.A.; Wainwright, K.P. (Flinders Univ. of South Australia, Bedford Park (Australia))

    1990-05-16

    A {sup 13}C NMR study of (1,4,8,11-tetrakis(2-hydroxyethyl)-1,4,8,11-tetraazacyclotetradecane)cadmium(II), (Cd(THEC)){sup 2+}, in CD{sub 3}OD shows that the most probable structure for (Cd(THEC)){sup 2+} incorporates the 1,4,8,11-tetraazacyclotetradecane ring in the trans III configuration. In this structure Cd(II) is above the tetraaza plane and is trigonal-prismatically coordinated by four ring nitrogens and two hydroxyethyl pendant arms attached to either end of the same 1,3-diaminopropane moiety. The {sup 13}C CPMAS NMR spectrum of solid (Cd(THEC)){sup 2+} is also consistent with this structure. Dynamic {sup 13}C NMR studies of natural abundance (Cd(THEC)){sup 2+} and of (Cd(THEC)){sup 2+} in which both carbons of each of the hydroxyethyl arms are 99 atom % enriched in {sup 13}C are consistent with a rapid oscillation of Cd(II) through the macrocyclic annulus of THEC. The {sup 13}C-enriched hydroxyethyl arms are characterized by {sup 13}C AB quartets under conditions of slow exchange but show a novel coalescence to a singlet under fast-exchange conditions consistent with the relative chemical shifts of the methylene carbons of the hydroxyethyl arm being reversed when it changes from the mono- to the bidentate coordination state. The pairwise exchange of the hydroxyethyl arm between the monodentate and bidentate environments is characterized by k(298.2 K) = 34,200 {plus minus} 1,800 s{sup {minus}1}, {Delta}H{double dagger} = 44.00 {plus minus} 0.56 kJ mol{sup {minus}1}, and {Delta}S{double dagger} = {minus}10.6 {plus minus} 2.2 J K{sup {minus}1} mol{sup {minus}1}. {sup 13}C and {sup 113}Cd NMR spectra show that intermolecular THEC and Cd(II) exchange on (Cd(THEC)){sup 2+} is a much slower process. 29 refs., 6 figs.

  6. Peculiarities of preparation of cadmium isotopes of high enrichment

    International Nuclear Information System (INIS)

    Cascade equipped by gas centrifuges with regard for requirements to structural materials operating with chemically active compounds (dimethylcadmium) was devised for preparation of high-enriched cadmium isotopes. Solutions of such problems as overcoming of isotope memory, compensation of the effect of isotope overlapping, operative analytical accompanying permitted to optimize separation process and to obtain cadmium isotopes of high enrichment degree: cadmium-116 ∼98.9 %, cadmium-114 ∼98.7 %, cadmium-113 ∼93.3 %, cadmium-112 ∼99.1 %, cadmium-110 ∼95.8 %

  7. Celastrol prevents cadmium-induced neuronal cell death via targeting JNK and PTEN-Akt/mTOR network.

    Science.gov (United States)

    Chen, Sujuan; Gu, Chenjian; Xu, Chong; Zhang, Jinfei; Xu, Yijiao; Ren, Qian; Guo, Min; Huang, Shile; Chen, Long

    2014-01-01

    Cadmium (Cd), a toxic environmental contaminant, induces neurodegenerative diseases. Celastrol, a plant-derived triterpene, has shown neuroprotective effects in various disease models. However, little is known regarding the effect of celastrol on Cd-induced neurotoxicity. Here, we show that celastrol protected against Cd-induced apoptotic cell death in neuronal cells. This is supported by the findings that celastrol strikingly attenuated Cd-induced viability reduction, morphological change, nuclear fragmentation, and condensation, as well as activation of caspase-3 in neuronal cells. Concurrently, celastrol remarkably blocked Cd-induced phosphorylation of c-Jun N-terminal kinase (JNK), but not extracellular signal-regulated kinases 1/2 and p38, in neuronal cells. Inhibition of JNK by SP600125 or over-expression of dominant negative c-Jun potentiated celastrol protection against Cd-induced cell death. Furthermore, pre-treatment with celastrol prevented Cd down-regulation of phosphatase and tensin homolog deleted on chromosome 10 (PTEN) and activation of phosphoinositide 3'-kinase/protein kinase B (Akt)/mammalian target of rapamycin (mTOR) signaling in neuronal cells. Over-expression of wild-type PTEN enhanced celastrol inhibition of Cd-activated Akt/mTOR signaling and cell death in neuronal cells. The findings indicate that celastrol prevents Cd-induced neuronal cell death via targeting JNK and PTEN-Akt/mTOR network. Our results strongly suggest that celastrol may be exploited for the prevention of Cd-induced neurodegenerative disorders. Celastrol, a plant-derived triterpene, has shown neuroprotective effects. However, little is known regarding the effect of celastrol on cadmium (Cd) neurotoxicity. This study underscores that celastrol prevents Cd-induced neuronal apoptosis via inhibiting activation of JNK (c-Jun N-terminal kinase) and Akt/mTOR network. Celastrol suppresses Cd-activated Akt/mTOR pathway by elevating PTEN (phosphatase and tensin homolog). The

  8. 9 CFR 113.113 - Autogenous biologics.

    Science.gov (United States)

    2010-01-01

    ... applicable standard requirement potency tests provided in 9 CFR part 113. If the culture of microorganisms... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Autogenous biologics. 113.113 Section... information. (If any of the data are unavailable, the applicant for authorization should indicate that...

  9. Cadmium in blood and hypertension

    Energy Technology Data Exchange (ETDEWEB)

    Eum, Ki-Do; Lee, Mi-Sun [Department of Environmental Health, Graduate School of Public Health and Institute of Health and Environment, Seoul National University, Seoul (Korea, Republic of); Paek, Domyung [Department of Environmental Health, Graduate School of Public Health and Institute of Health and Environment, Seoul National University, Seoul (Korea, Republic of)], E-mail: paekdm@snu.ac.kr

    2008-12-15

    Objectives:: This study is to examine the effect of cadmium exposure on blood pressure in Korean general population. Methods:: The study population consisted of 958 men and 944 women who participated in the 2005 Korean National Health and Nutrition Examination Survey (KNHANES), in which blood pressure and blood cadmium were measured from each participant. Results:: The mean blood cadmium level was 1.67 {mu}g/L (median level 1.55). The prevalence of hypertension was 26.2%. The blood cadmium level was significantly higher among those subjects with hypertension than those without (mean level 1.77 versus 1.64 {mu}g/dL). After adjusting for covariates, the odds ratio of hypertension comparing the highest to the lowest tertile of cadmium in blood was 1.51 (95% confidence interval 1.13 to 2.05), and a dose-response relationship was observed. Systolic, diastolic, and mean arterial blood pressure were all positively associated with blood cadmium level, and this effect of cadmium on blood pressure was markedly stronger when the kidney function was reduced. Conclusions:: Cadmium exposures at the current level may have increased the blood pressure of Korean general population.

  10. Cadmium in blood and hypertension

    International Nuclear Information System (INIS)

    Objectives:: This study is to examine the effect of cadmium exposure on blood pressure in Korean general population. Methods:: The study population consisted of 958 men and 944 women who participated in the 2005 Korean National Health and Nutrition Examination Survey (KNHANES), in which blood pressure and blood cadmium were measured from each participant. Results:: The mean blood cadmium level was 1.67 μg/L (median level 1.55). The prevalence of hypertension was 26.2%. The blood cadmium level was significantly higher among those subjects with hypertension than those without (mean level 1.77 versus 1.64 μg/dL). After adjusting for covariates, the odds ratio of hypertension comparing the highest to the lowest tertile of cadmium in blood was 1.51 (95% confidence interval 1.13 to 2.05), and a dose-response relationship was observed. Systolic, diastolic, and mean arterial blood pressure were all positively associated with blood cadmium level, and this effect of cadmium on blood pressure was markedly stronger when the kidney function was reduced. Conclusions:: Cadmium exposures at the current level may have increased the blood pressure of Korean general population

  11. Neutron resonance spectroscopy on 113Cd: The p-wave levels

    International Nuclear Information System (INIS)

    Weak levels in the compound nucleus 114Cd were located by neutron time-of-flight spectroscopy techniques. Neutron capture measurements were performed with both a natural cadmium target and a highly enriched 113Cd target. A total of 22 new resonances were located in the neutron energy interval 20-500 eV and were assumed to be p-wave. Resonance parameters, E0 and gΓn, are given for the newly identified levels. The p-wave strength function was determined to be 104S1=2.8±0.8 and the average level spacing left-angle D1 right-angle=14 eV. Comparison of the reduced widths with a Porter-Thomas distribution is consistent with having missed 15% of the p-wave levels

  12. p53 isoform Δ113p53 is a p53 target gene that antagonizes p53 apoptotic activity via BclxL activation in zebrafish

    OpenAIRE

    Chen, Jun; Ng, Sok Meng; Chang, Changqing; Zhang, Zhenhai; Bourdon, Jean-Christophe; Lane, David P; Peng, Jinrong

    2009-01-01

    p53 is a well-known tumor suppressor and is also involved in processes of organismal aging and developmental control. A recent exciting development in the p53 field is the discovery of various p53 isoforms. One p53 isoform is human Δ133p53 and its zebrafish counterpart Δ113p53. These N-terminal-truncated p53 isoforms are initiated from an alternative p53 promoter, but their expression regulation and physiological significance at the organismal level are not well understood. We show here that ...

  13. To problem about construction of cyclotron target for bombardment of metal zinc and cadmium targets on exterior beams of the accelerator U-120

    International Nuclear Information System (INIS)

    Full text: Industrial intrusion of diffusion-and-thermal methods of radionuclides separation it is impossible at use of traditional targets representing a Cu or Ag substrate, on which the starting isotopic enriched material is marked. For embodying these technologies it is necessary to modify a target so that completely to eliminate an opportunity of a physicochemical interaction (diffusion, alloy building) labilized material and target radionuclide with a substrate in requirements of heightened temperatures. One of the possible solutions of this problem - manufacture of substrates of cyclotron targets from high-melting inert materials. For the bombardment of metal Zn or Cd metal targets (production of 67Ga and 111In, basic medical radionuclides) on the on exterior beam of the accelerators U-120 designed the cyclotron target, where as a bottom for drawing a isotopic enriched materials will be utilized a tantalic substrate by a diameter of 28 mm and depth 750 microns. At centre of a substrate are made a dimple by a diameter 16 mm, where (from a melt) are superimposed metal Zn or Cd. For heat removal during bombardment: a) on the part of a tantalic substrate the target is washed by water, b) for refrigerating a obverse surface of a target the gaseous He will be utilized. The evaluation calculations are carried out: a) of the basic characteristics of a helium heat exchanger (for dissecting away of irradiated target from volume of the accelerator the titanium metal foil by depth 50 μm will be utilized), b) of strength of a Ta substrate (will be utilized at pressure of 'frigorific' water 0.5 MPa), c) of operating temperatures of a substrate and targets (Zn or Cd) at the bombardment by their of beams of deuterons (energy - 13/0 Me V, peak current of beam - 20 μA). Is ro tined, that the optimum interval of values of pressures of helium compounds 25-32 mm Hg; the build-up of pressure of helium gives in linear magnification of voltages and down stroke of ultimate strength

  14. Coordination compounds of manganese(2) and cadmium(2) with α-ketoacid thiosemicarbazones

    International Nuclear Information System (INIS)

    Manganese (2) and cadmium (2) coordination compounds with gluoxalic, pyroacemic and benzoyl formic acid thiosemicarbazones are synthesized. ESR spectra of polycrystalline samples of manganese compounds and cadmium compounds activated with manganese at T=113 295 deg K allow to suppose that Mn2+ takes the position of Cd2+ ion which is in a weakly distorted octahedron crystal field

  15. Mercury, cadmium and lead contamination in seafood: a comparative study to evaluate the usefulness of Target Hazard Quotients.

    Science.gov (United States)

    Petroczi, A; Naughton, D P

    2009-02-01

    The aim of this paper is to explore the applicability of Target Hazard Quotient (THQ) estimations to inform on seafood hazards through metal contamination. The food recall data set was collated by the Laboratory of the Government Chemist (LGC, UK) over the period from January to November 2007. Pearson chi-square goodness of fit test, nonparametric correlation (Kendall tau) and Kruskal-Wallis test were used. Descriptive statistics and statistical analyses were computed by using Excel and SPSS 15.0. The vast majority of food alerts/recalls owing to metal contamination occur in seafood and during the summer months. Only swordfish and shark containing produce received over 10 recalls which were mainly for mercury contamination. Seafood produce originating from only 3 countries had over 10 recalls owing to metal contamination (Spain 50; France 11 and Indonesia 11). Based upon the food alert/recall system, the application of THQ estimations of risk in cases of metal contamination of seafood is questionable as THQ implies frequent if not daily exposure over a lifetime. Infrequent recalls owing to metal contamination and the absence of patterns make it highly unlikely that an individual would be subject to multiple exposures to significant levels of metal ions in seafood. PMID:19041361

  16. Reviews of the environmental effects of pollutants: IV. Cadmium

    Energy Technology Data Exchange (ETDEWEB)

    Hammons, A.S.; Huff, J.E.; Braunstein, H.M.; Drury, J.S.; Shriner, C.R.; Lewis, E.B.; Whitfield, B.L.; Towill, L.E.

    1978-06-01

    This report is a comprehensive, multidisciplinary review of the health and environmental effects of cadmium and specific cadmium derivatives. More than 500 references are cited. The cadmium body burden in animals and humans results mainly from the diet. In the United States, the normal intake of cadmium for adult humans is estimated at about 50 ..mu..g per day. Tobacco smoke is a significant additional source of cadmium exposure. The kidneys and liver together contain about 50% of the total cadmium body burden. Acute cadmium poisoning is primarily an occupational problem, generally from inhalation of cadmium fumes or dusts. In the general population, incidents of acute poisoning by inhaled or ingested cadmium or its compounds are relatively rare. The kidney is the primary target organ for toxicity from prolonged low-level exposure to cadmium. No causal relationship has been established between cadmium exposure and human cancer, although a possible link between cadmium and prostate cancer has been indicated. Cadmium has been shown to be teratogenic in rats, hamsters, and mice, but no such effects have been proven in humans. Cadmium has been reported to increase the frequency of chromosomal aberrations in cultured Chinese hamster ovary cells and in human peripheral leukocytes. The major concern about environmental cadmium is the potential effects on the general population. There is no substantial evidence of hazard from current levels of cadmium in air, water, or food. However, because cadmium is a cumulative poison and because present intake provides a relatively small safety margin, there are adequate reasons for concern over possible future increases in background levels.

  17. Reviews of the environmental effects of pollutants: IV. Cadmium

    International Nuclear Information System (INIS)

    This report is a comprehensive, multidisciplinary review of the health and environmental effects of cadmium and specific cadmium derivatives. More than 500 references are cited. The cadmium body burden in animals and humans results mainly from the diet. In the United States, the normal intake of cadmium for adult humans is estimated at about 50 μg per day. Tobacco smoke is a significant additional source of cadmium exposure. The kidneys and liver together contain about 50% of the total cadmium body burden. Acute cadmium poisoning is primarily an occupational problem, generally from inhalation of cadmium fumes or dusts. In the general population, incidents of acute poisoning by inhaled or ingested cadmium or its compounds are relatively rare. The kidney is the primary target organ for toxicity from prolonged low-level exposure to cadmium. No causal relationship has been established between cadmium exposure and human cancer, although a possible link between cadmium and prostate cancer has been indicated. Cadmium has been shown to be teratogenic in rats, hamsters, and mice, but no such effects have been proven in humans. Cadmium has been reported to increase the frequency of chromosomal aberrations in cultured Chinese hamster ovary cells and in human peripheral leukocytes. The major concern about environmental cadmium is the potential effects on the general population. There is no substantial evidence of hazard from current levels of cadmium in air, water, or food. However, because cadmium is a cumulative poison and because present intake provides a relatively small safety margin, there are adequate reasons for concern over possible future increases in background levels

  18. On the mechanism of cadmium toxicity: Suppression of mitochondrial respiration by an organic complex of cadmium

    Energy Technology Data Exchange (ETDEWEB)

    Korotkov, S.M.; Rozengart, E.V.; Suvorov, A.A.; Nesterov, V.P.; Khovanskikh, A.E. [Setchenow Institute of Evolutionary Physiology and Biochemistry, St. Petersburg (Russian Federation)

    1994-09-01

    Mitochondria are the main targets of the deleterious effect of cadmium. It was found that 94% of cadmium in mitochondria exists as a soluble complex with low-molecular-weight proteins, i.e., metallothioneins. The remaining 6% of cadmium is bound to protein structures of the mitochondrial matrix and, thereby cause the dysfunction of subcellular organelles in vivo. The mechanism of direct interaction of cadmium with the target protein is unknown; however, it is evident that the incorporation of cadmium into a complex with an organic ligand can significantly affect this process and eventually affect the interaction of cadmium with matrix proteins. It was of interest to compare the effects of an inorganic cadmium salt (hydrated Cd{sup 2+} cation) and an organic complex of cadmium [Cd(II)-1,3-bis-(chlorobenzylidenamino)guanidine, CBG] on rat liver mitochondrial respiration. This complex was earlier shown to display a wide range of biological activities. Particularly, it appeared to be more potent than Cd{sup 2+} in inhibiting monoamine oxidase.

  19. Effects of bacteria on cadmium bioaccumulation in the cadmium hyperaccumulator plant Beta vulgaris var. cicla L.

    Science.gov (United States)

    Chen, Su; Chao, Lei; Sun, Lina; Sun, Tieheng

    2013-01-01

    To investigate the effects of two cadmium-tolerant bacteria, Staphylococcus pasteuri (S. pasteuri X1) and Agrobacterium tumefaciens (A. tumefaciens X2), on cadmium uptake by the cadmium hyperaccumulator plant Beta vulgaris var. cicla L., a pot experiment with artificially contaminated soil was conducted. The results demonstrated that both cadmium-tolerant bacteria enhanced the dry weight of Beta vulgaris var. cicla L. The total dry weights of plants in the control CK20, S. pasteuri X1 and A. tumefaciens X2 treatments were 0.85, 1.13, and 1.38 g/pot, respectively. Compared with the control CK20 findings, the total dry weight of plants was increased by 32.8 and 61.1% after inoculation with S. pasteuri X1 and A. tumefaciens X2, respectively, indicating that A. tumefaciens X2 more strongly promoted the growth of Beta vulgaris var. cicla L. than S. pasteuri X1. In addition, inoculation with S. pasteuri X1 and A. tumefaciens X2 significantly (p < 0.05) promoted cadmium uptake by plants and improved the bioaccumulation of cadmium by the plants from the soil. Moreover, the inoculation of S. pasteuri X1 and A. tumefaciens X2 effectively facilitated the transfer of cadmium in the soil from the Fe-Mn oxide and residual fractions to the soluble plus exchangeable and weakly specially adsorbed fractions in the rhizosphere soils of plants. The bacterial enhancement of cadmium phytoavailability might provide a potential and promising method to increase the efficiency of phytoextraction. PMID:23488173

  20. Dunaliella salina as marine microalga highly tolerant to but a poor remover of cadmium

    Energy Technology Data Exchange (ETDEWEB)

    Folgar, S. [Departamento de Biologia Celular y Molecular, Laboratorio de Microbiologia, Facultad de Ciencias, Universidade da Coruna, Alejandro de la Sota no 1, 15008 La Coruna (Spain); Torres, E., E-mail: torres@udc.es [Departamento de Biologia Celular y Molecular, Laboratorio de Microbiologia, Facultad de Ciencias, Universidade da Coruna, Alejandro de la Sota no 1, 15008 La Coruna (Spain); Perez-Rama, M.; Cid, A.; Herrero, C.; Abalde, J. [Departamento de Biologia Celular y Molecular, Laboratorio de Microbiologia, Facultad de Ciencias, Universidade da Coruna, Alejandro de la Sota no 1, 15008 La Coruna (Spain)

    2009-06-15

    Cadmium tolerance and removal in the marine microalga Dunaliella salina were studied in cultures exposed to different metal concentrations (5-120 mg Cd l{sup -1}) for 96 h. This microalga can be included in the group of microalgal species most tolerant to cadmium due to the high value of EC50 that it possesses (48.9 mg Cd l{sup -1} at 96 h of culture). The greater percentage of cadmium removed was obtained in cultures exposed to 5 mg Cd l{sup -1} at 96 h, but removing only 11.3% of the added cadmium. In all cultures, the quantity of cadmium removed intracellularly was much lower than the bioadsorbed quantity and it was proportional to the sulfhydryl group levels. Both the Freundlich and Langmuir adsorption models were suitable for describing the short-term biosorption of cadmium by living cells of D. salina.

  1. Dunaliella salina as marine microalga highly tolerant to but a poor remover of cadmium

    International Nuclear Information System (INIS)

    Cadmium tolerance and removal in the marine microalga Dunaliella salina were studied in cultures exposed to different metal concentrations (5-120 mg Cd l-1) for 96 h. This microalga can be included in the group of microalgal species most tolerant to cadmium due to the high value of EC50 that it possesses (48.9 mg Cd l-1 at 96 h of culture). The greater percentage of cadmium removed was obtained in cultures exposed to 5 mg Cd l-1 at 96 h, but removing only 11.3% of the added cadmium. In all cultures, the quantity of cadmium removed intracellularly was much lower than the bioadsorbed quantity and it was proportional to the sulfhydryl group levels. Both the Freundlich and Langmuir adsorption models were suitable for describing the short-term biosorption of cadmium by living cells of D. salina.

  2. 13 CFR 113.310 - Recruitment.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Recruitment. 113.310 Section 113... Discrimination on the Basis of Sex in Admission and Recruitment Prohibited § 113.310 Recruitment. (a) Nondiscriminatory recruitment. A recipient to which §§ 113.300 through 113.310 apply shall not discriminate on...

  3. Spectroscopic study of cadmium (II) complexes with heterocyclic dithiocarbamate ligands

    Energy Technology Data Exchange (ETDEWEB)

    Garcia-Fontan, S. (Departamento de Quimica Pura y Aplicada, Universidad de Vigo (Spain)); Rodriguez-Seoane, P. (Departamento de Quimica Pura y Aplicada, Universidad de Vigo (Spain)); Casas, J.S. (Departamento de Quimica Inorganica, Universidad de Santiago de Compostela (Spain)); Sordo, J. (Departamento de Quimica Inorganica, Universidad de Santiago de Compostela (Spain)); Jones, M.M. (Department of Chemistry and Center in Molecular Toxicology, Vanderbilt University, Nashville, TN (United States))

    1993-09-15

    Cadmium(II) dithiocarbamates Cd(dtc)[sub 2] (dtc=4-carboxamidopiperidine-1-carbodithioate, morpholine-1-carbodithioate or 4-(2-hydroxyethyl)piperazine-1-carbodithioate) and Cd(dtc)[sub 2].H[sub 2]O (dtc=4-hydroxypiperidine-1-carbodithioate)[r brace] have been prepared and characterized by thermal analysis and IR and NMR ([sup 13]C, [sup 113]Cd) spectrometry. Two of these ligands have previously been shown capable of removing cadmium from its aged in vivo storage sites. The use of solid state [sup 13]C NMR measurements to establish the coordination mode of the dithiocarbomate ligands is also examined and the difficulties which arise are discussed. (orig.)

  4. Some Yields in the Thermal- and Epi-Cadmium-Neutron Fission of Pu239

    International Nuclear Information System (INIS)

    The yields of several nuclides in the thermal- and epi-cadmium-neutron fission of Pu239 have been measured and are reported. In epi-cadmium-neutron fission a decrease, relative to thermal fission, in the yields of Ag111 and Ag113, i.e. an increased peak-to-valley ratio, was found. The yield of As77 and As78, which represent, highly unsymmetrical fission, were found to be greater in epi-cadmium-neutron fission than in thermal fission. This result is' shown to be inconsistent with the simple two mode of fission hypothesis. (author)

  5. The vapour pressures over saturated aqueous solutions of cadmium chloride, cadmium bromide, cadmium iodide, cadmium nitrate, and cadmium sulphate

    Energy Technology Data Exchange (ETDEWEB)

    Apelblat, Alexander [Department of Chemical Engineering, Ben Gurion University of the Negev, P.O. Box 653, Beer Sheva 84105 (Israel)]. E-mail: apelblat@bgu.ac.il; Korin, Eli [Department of Chemical Engineering, Ben Gurion University of the Negev, P.O. Box 653, Beer Sheva 84105 (Israel)

    2007-07-15

    Vapour pressures of water over saturated solutions of cadmium salts (chloride, bromide, iodide, nitrate, and sulphate) were determined over the temperature range 280 K to 322 K and compared with the literature data. The vapour pressures determined were used to obtain the water activities, osmotic coefficients and the molar enthalpies of vaporization in the (cadmium salt + water) systems.

  6. The vapour pressures over saturated aqueous solutions of cadmium chloride, cadmium bromide, cadmium iodide, cadmium nitrate, and cadmium sulphate

    International Nuclear Information System (INIS)

    Vapour pressures of water over saturated solutions of cadmium salts (chloride, bromide, iodide, nitrate, and sulphate) were determined over the temperature range 280 K to 322 K and compared with the literature data. The vapour pressures determined were used to obtain the water activities, osmotic coefficients and the molar enthalpies of vaporization in the (cadmium salt + water) systems

  7. 13 CFR 113.405 - Housing.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Housing. 113.405 Section 113.405... Discrimination on the Basis of Sex in Education Programs Or Activities Prohibited § 113.405 Housing. (a... different fees or requirements, or offer different services or benefits related to housing, except...

  8. 49 CFR 380.113 - Employer responsibilities.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Employer responsibilities. 380.113 Section 380.113 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL MOTOR CARRIER SAFETY....113 Employer responsibilities. (a) No motor carrier shall: (1) Allow, require, permit or authorize...

  9. 19 CFR 113.12 - Bond application.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Bond application. 113.12 Section 113.12 Customs... CUSTOMS BONDS Bond Application and Approval of Bond § 113.12 Bond application. (a) Single entry bond application. In order to insure that the revenue is adequately protected the port director may require...

  10. 46 CFR 107.113 - Industrial personnel.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Industrial personnel. 107.113 Section 107.113 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING UNITS INSPECTION AND CERTIFICATION General § 107.113 Industrial personnel. Industrial personnel are all persons, exclusive of...

  11. 49 CFR 572.113 - Neck assembly.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 7 2010-10-01 2010-10-01 false Neck assembly. 572.113 Section 572.113... 50th Percentile Male § 572.113 Neck assembly. The head/neck assembly consists of the parts 78051-61X...) Test procedure. (1) Soak the head and neck assembly in a test environment at any temperature between...

  12. 49 CFR 383.113 - Required skills.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Required skills. 383.113 Section 383.113... STANDARDS; REQUIREMENTS AND PENALTIES Required Knowledge and Skills § 383.113 Required skills. (a) Basic vehicle control skills. All applicants for a CDL must possess and demonstrate basic motor vehicle...

  13. 21 CFR 113.60 - Containers.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Containers. 113.60 Section 113.60 Food and Drugs... CONSUMPTION THERMALLY PROCESSED LOW-ACID FOODS PACKAGED IN HERMETICALLY SEALED CONTAINERS Control of Components, Food Product Containers, Closures, and In-Process Materials § 113.60 Containers. (a)...

  14. 10 CFR 71.113 - Document control.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Document control. 71.113 Section 71.113 Energy NUCLEAR....113 Document control. The licensee, certificate holder, and applicant for a CoC shall establish measures to control the issuance of documents such as instructions, procedures, and drawings,...

  15. 9 CFR 11.3 - Scar rule.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Scar rule. 11.3 Section 11.3 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL WELFARE HORSE PROTECTION REGULATIONS § 11.3 Scar rule. The scar rule applies to all horses born on...

  16. 48 CFR 49.113 - Cost principles.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Cost principles. 49.113 Section 49.113 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACT MANAGEMENT TERMINATION OF CONTRACTS General Principles 49.113 Cost principles. The cost principles and procedures in...

  17. 14 CFR 1240.113 - Financial accounting.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Financial accounting. 1240.113 Section 1240.113 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION INVENTIONS AND CONTRIBUTIONS Awards for Scientific and Technical Contributions § 1240.113 Financial accounting. (a) An Award...

  18. 28 CFR 551.113 - Counseling.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Counseling. 551.113 Section 551.113... Pretrial Inmates § 551.113 Counseling. (a) When consistent with institution security and good order, pretrial inmates may be allowed the opportunity to receive counseling services with convicted inmates....

  19. 32 CFR 552.113 - References.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 3 2010-07-01 2010-07-01 true References. 552.113 Section 552.113 National Defense Department of Defense (Continued) DEPARTMENT OF THE ARMY MILITARY RESERVATIONS AND NATIONAL...-Fort Lewis, Washington § 552.113 References. This regulation is to be used in conjunction with...

  20. 14 CFR 125.113 - Cabin interiors.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Cabin interiors. 125.113 Section 125.113 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIR CARRIERS....113 Cabin interiors. (a) Upon the first major overhaul of an airplane cabin or refurbishing of...

  1. 33 CFR 117.113 - Tensaw River.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Tensaw River. 117.113 Section 117.113 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Alabama § 117.113 Tensaw River. The draw of the...

  2. 9 CFR 113.407 - Pullorum antigen.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Pullorum antigen. 113.407 Section 113... and Reagents § 113.407 Pullorum antigen. Pullorum Antigen shall be produced from a culture of... standard for stained antigen K's and 50 ±10 times McFarland No. 1 standard for tube antigen....

  3. 9 CFR 113.114 - Tetanus Toxoid.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Tetanus Toxoid. 113.114 Section 113... Bacterial Products § 113.114 Tetanus Toxoid. Tetanus Toxoid shall be produced from a culture of Clostridium... purified and concentrated. Each serial of biological product containing tetanus toxoid fraction shall...

  4. 7 CFR 1220.113 - Marketing.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Marketing. 1220.113 Section 1220.113 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS... CONSUMER INFORMATION Soybean Promotion and Research Order Definitions § 1220.113 Marketing. The...

  5. Increased cadmium and lead uptake of a cadmium hyperaccumulator tomato by cadmium-resistant bacteria.

    Science.gov (United States)

    He, Lin-Yan; Chen, Zhao-Jin; Ren, Gai-Di; Zhang, Yan-Feng; Qian, Meng; Sheng, Xia-Fang

    2009-07-01

    Two cadmium (Cd)-resistant strains Pseudomonas sp. RJ10 and Bacillus sp. RJ16 were investigated for their effects on the soil Cd and lead (Pb) solubilization and promotion of plant growth and Cd and Pb uptakes of a Cd-hyperaccumulator tomato. In the heavy metal-contaminated inoculated soil, the CaCl(2)-extractable Cd and Pb were increased by 58-104% and 67-93%, respectively, compared to the uninoculation control. The bacteria produced indole acetic acid, siderophore and 1-aminocyclopropane-1-carboxylate deaminase. Root elongation assay conducted on tomato under gnotobiotic conditions demonstrated increase in root elongation of inoculated tomato seedlings compared to the control plants. An increase in Cd and Pb contents of above-ground tissues varied from 92% to 113% and from 73% to 79% in inoculated plants growing in heavy metal-contaminated soil compared to the uninoculation control, respectively. These results show that the bacteria could be exploited for bacteria enhanced-phytoextraction of Cd- and Pb-polluted soils. PMID:19368973

  6. Cadmium status in Egypt

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    It is inferred from these studies that releases of Cd are still increasing and it is recommended that measures must be taken to reduce emissions of cadmium. Any cadmium discharged into the Egyptian environment may move from one compartment to another at varying rates,resulting in an accumulation in compartments such as soils and biota. Such accumulation can be expected to increase with continued emissions,and attention should be given to all sources of cadmium, natural as well as anthropogenic especially in the industrial cities in Egypt. Cadmium present in sewage, as well as industrial effluent (also, other liquid and solid wastes) and sewage sludge will increase levels in soils and is xpected to contribute to dietary levels and body burdens. The current information indicates that such effects may have to be evaluated over long periods of time, possibly as long as 50 - 100 years.

  7. Quality control of the 113Sn-113mIn generator

    International Nuclear Information System (INIS)

    Methods for quality control of 113Sn-113mIn generators are compared and recommended the most convenient to applicate in hospitals and in more specialized quality control laboratories. The quality of 113Sn-113mIn generator produced by POLATOM (Poland) is also evaluated. The product met the requirements of the International Pharmacopeia

  8. Study on Systemic Separation of Palladium, Silver, Cadmium and Tin

    Institute of Scientific and Technical Information of China (English)

    YU; Zhen-hua; HUANG; Kun

    2013-01-01

    To accurately measure the yields of palladium,silver,cadmium and tin that generated from the fission of plutonium,radiochemical method is needed because there is much interference in using directγ-spectroscopy measurements.Usually,we want to get as much as possible the experiment data from one target,so it is required systemic separation of palladium,silver,cadmium and tin.Considering the

  9. Solution and solid state characterization of a cadmium octaazacryptand complex

    Energy Technology Data Exchange (ETDEWEB)

    Thompson, J.A.; Barr, M.E.; Ford, D.K. [Los Alamos National Laboratory, NM (United States)] [and others

    1996-03-27

    The constant for cadmium binding by octaazacryptand L = N(CH{sub 2}CH{sub 2}NHCH{sub 2}CH{sub 2}NHCH{sub 2}CH{sub 2}){sub 3}N was determined by potentiometry; log {Beta}{sub ML}=18.3(1). Calculation of pM values (pM = -log [M]) show that L has the highest reported binding affinity for cadmium relative to other [2.2.2]polyoxa-polyaza cryptates. Two cadmium cryptate complexes, [CdL](BF{sub 4}){sub 2} (1a) and [CdL](OAc){sub 2}{center_dot}2H{sub 2}O (1b), were synthesized by metalation of the free cryptand. The molecular structures of compounds 1a and 1b were determined by X-ray diffraction. The cadmium ions in both complexes are eight-coordinate and display similar coordination geometries but different ligand conformations, designated as parallel and oblique. The cadmium coordination sphere is best described as a bicapped octahedron. Through 2D NMR experiments the authors have found that the Cd is in a symmetric environment and the conformation of the ligand in solution is consistent with the parallel conformation observed in one of the solid state structures. The {sup 113}Cd NMR shift of this eight-coordinate amine complex is 75 ppm relative to 0.1 M aqueous Cd(ClO{sub 4}){sub 2}, which correlates with shifts observed for other [2.2.2] cadmium polyoxa-polyaza cryptates.

  10. Cadmium inhibits acid secretion in stimulated frog gastric mucosa

    International Nuclear Information System (INIS)

    Cadmium, a toxic environmental pollutant, affects the function of different organs such as lungs, liver and kidney. Less is known about its toxic effects on the gastric mucosa. The aim of this study was to investigate the mechanisms by which cadmium impacts on the physiology of gastric mucosa. To this end, intact amphibian mucosae were mounted in Ussing chambers and the rate of acid secretion, short circuit current (Isc), transepithelial potential (Vt) and resistance (Rt) were recorded in the continuous presence of cadmium. Addition of cadmium (20 μM to 1 mM) on the serosal but not luminal side of the mucosae resulted in inhibition of acid secretion and increase in NPPB-sensitive, chloride-dependent short circuit current. Remarkably, cadmium exerted its effects only on histamine-stimulated tissues. Experiments with TPEN, a cell-permeant chelator for heavy metals, showed that cadmium acts from the intracellular side of the acid secreting cells. Furthermore, cadmium-induced inhibition of acid secretion and increase in Isc cannot be explained by an action on: 1) H2 histamine receptor, 2) Ca2+ signalling 3) adenylyl cyclase or 4) carbonic anhydrase. Conversely, cadmium was ineffective in the presence of the H+/K+-ATPase blocker omeprazole suggesting that the two compounds likely act on the same target. Our findings suggest that cadmium affects the functionality of histamine-stimulated gastric mucosa by inhibiting the H+/K+-ATPase from the intracellular side. These data shed new light on the toxic effect of this dangerous environmental pollutant and may result in new avenues for therapeutic intervention in acute and chronic intoxication.

  11. Dicty_cDB: SSJ113 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSJ113 (Link to dictyBase) - - - Contig-U15711-1 SSJ113Z (Link... to Original site) - - SSJ113Z 502 - - - - Show SSJ113 Library SS (Link to library) Clone ID SSJ113 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSJ1-A/SSJ113Q.Seq.d/ Representative seq. ID SSJ11...3Z (Link to Original site) Representative DNA sequence >SSJ113 (SSJ113Q) /CSM/SS/SSJ1-A/SSJ113Q.Seq.d/ XXXXX...AAAAAAAAAAAAAAAAAAAAAATAACACT sequence update 1997.12.24 Translated Amino Acid sequence ---kvfpyhfxxvxgykqllisss

  12. Nephrotoxicity of cadmium & lead.

    Science.gov (United States)

    Gonick, H C

    2008-10-01

    Cadmium and lead are divalent cations with a propensity to settle in the proximal tubule of the nephron, leading to nephrotoxicity. The pathophysiological results, however, tend to diverge. Cadmium in sufficient cumulative dosage leads to the production of the Fanconi syndrome, a generalized proximal tubular reabsorptive defect thought to be related to inhibition of both ATP production and Na-K-ATPase activity. On the other hand, lead accumulation in the proximal tubule leads to hyperuricaemia and gout, presumably by inhibiting uric acid secretion, and diminished glomerular filteration rate (GFR). Fanconi syndrome is seen unusually only in children and experimental animals. Cadmium nephrotoxicity is heralded by increased excretion of beta2-microglobulin, retinol binding protein and alpha1-microglobulin, indicative of decreased proximal tubule function. Beta2-microglobulinuria is not found in lead nephropathy. In lead nephropathy albuminuria is absent or minimal whereas in cadmium nephropathy albuminuria is variable. From the standpoint of pathology, both entities are characterized by tubulointerstitial disease and fibrosis, but only early lead nephropathy is characterized by the presence of proximal tubule nuclear inclusion bodies, due to the combination of lead with a lead binding-protein. PMID:19106433

  13. 7 CFR 1955.113 - Price (housing).

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 14 2010-01-01 2009-01-01 true Price (housing). 1955.113 Section 1955.113 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE... REGULATIONS (CONTINUED) PROPERTY MANAGEMENT Disposal of Inventory Property Rural Housing (rh) Real...

  14. 36 CFR 1150.113 - Amicable resolution.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false Amicable resolution. 1150.113 Section 1150.113 Parks, Forests, and Public Property ARCHITECTURAL AND TRANSPORTATION BARRIERS COMPLIANCE... resolution. (a) Amicable resolution is encouraged at any stage of proceedings where such resolution...

  15. 18 CFR 401.113 - Segregable materials.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 2 2010-04-01 2010-04-01 false Segregable materials. 401.113 Section 401.113 Conservation of Power and Water Resources DELAWARE RIVER BASIN COMMISSION... Segregable materials. Any reasonably segregable portion of a record shall be provided to any...

  16. 13 CFR 113.510 - Recruitment.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Recruitment. 113.510 Section 113... Recruitment. (a) Nondiscriminatory recruitment and hiring. A recipient shall not discriminate on the basis of sex in the recruitment and hiring of employees. Where a recipient has been found to be...

  17. 7 CFR 15.113 - Testimony.

    Science.gov (United States)

    2010-01-01

    ... officer, in his discretion, may require or permit that the testimony of any witness be prepared in writing and served on all parties in advance of the hearing. Such testimony may be adopted by the witness at... 7 Agriculture 1 2010-01-01 2010-01-01 false Testimony. 15.113 Section 15.113 Agriculture Office...

  18. 27 CFR 21.113 - Isopropyl alcohol.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Isopropyl alcohol. 21.113 Section 21.113 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS FORMULAS FOR DENATURED ALCOHOL AND RUM Specifications for Denaturants §...

  19. 9 CFR 113.7 - Multiple fractions.

    Science.gov (United States)

    2010-01-01

    ... production make provisions and set forth conditions for use of the same animals for testing different... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Multiple fractions. 113.7 Section 113.7 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF...

  20. 9 CFR 113.2 - Testing aids.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Testing aids. 113.2 Section 113.2 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES... Testing aids. To better ensure consistent and reproducible test results when Standard Requirement...

  1. 9 CFR 113.5 - General testing.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false General testing. 113.5 Section 113.5 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES... General testing. (a) No biological product shall be released prior to the completion of tests...

  2. 10 CFR 110.113 - Commission action.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Commission action. 110.113 Section 110.113 Energy NUCLEAR... Commission action. (a) Upon completion of a hearing, the Commission will issue a written opinion including... hearing issues; and (4) Take other action, as appropriate....

  3. 5 CFR 930.113 - Corrective action.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Corrective action. 930.113 Section 930....113 Corrective action. An agency will take adverse, disciplinary, or other appropriate action against... such action against an operator or an incidental operator: (a) The employee is convicted of...

  4. 9 CFR 113.318 - Pseudorabies Vaccine.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Pseudorabies Vaccine. 113.318 Section... Virus Vaccines § 113.318 Pseudorabies Vaccine. Pseudorabies Vaccine shall be prepared from virus-bearing... be used for preparing seeds for vaccine production. All serials of vaccine shall be prepared from...

  5. 13 CFR 113.515 - Compensation.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Compensation. 113.515 Section 113.515 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION IN FINANCIAL... of which requires equal skill, effort, and responsibility, and that are performed under...

  6. 42 CFR 53.113 - Community service.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Community service. 53.113 Section 53.113 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GRANTS GRANTS, LOANS AND LOAN GUARANTEES FOR CONSTRUCTION AND MODERNIZATION OF HOSPITALS AND MEDICAL FACILITIES Services for Persons...

  7. 13 CFR 113.540 - Advertising.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Advertising. 113.540 Section 113.540 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION IN FINANCIAL ASSISTANCE PROGRAMS OF SBA-EFFECTUATION OF POLICIES OF FEDERAL GOVERNMENT AND SBA...

  8. 15 CFR 930.113 - Public hearings.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 3 2010-01-01 2010-01-01 false Public hearings. 930.113 Section 930.113 Commerce and Foreign Trade Regulations Relating to Commerce and Foreign Trade (Continued) NATIONAL... disagreement. (c) Hearings shall be informal and shall be conducted by the hearing officer with the...

  9. Dicty_cDB: VHP113 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP113 (Link to dictyBase) - - - Contig-U16433-1 VHP113P (Link to Original site) VHP1...13F 144 VHP113Z 590 VHP113P 714 - - Show VHP113 Library VH (Link to library) Clone ID VHP1... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP1-A/VHP113Q.Seq.d/ Representative seq. ID VHP1...13P (Link to Original site) Representative DNA sequence >VHP113 (VHP113Q) /CSM/VH/VHP1-A/VHP1...core E Sequences producing significant alignments: (bits) Value VHP113 (VHP113Q) /CSM/VH/VHP1-A/VHP113Q.Seq.

  10. Contacting cadmium deposition from spent industrial solutions

    International Nuclear Information System (INIS)

    Cadmium metal deposition from spent industrial solutions by cadmium (2) reduction with dispersed aluminium is studied. The influence of temperature, reagent concentration and the presence of complexing agents on the yield and purity of isolated cadmium metal is examined

  11. Cadmium in Sweden - environmental risks

    Energy Technology Data Exchange (ETDEWEB)

    Parkman, H.; Iverfeldt, Aa. [Swedish Environmental Research Inst. (Sweden); Borg, H.; Lithner, G. [Stockholm Univ. (Sweden). Inst. for Applied Environmental Research

    1998-03-01

    This report aims at assessing possible effects of cadmium in the Swedish environment. Swedish soils and soft freshwater systems are, due to a generally poor buffering capacity, severely affected by acidification. In addition, the low salinity in the Baltic Sea imply a naturally poor organism structure, with some important organisms living close to their limit of physiological tolerance. Cadmium in soils is mobilized at low pH, and the availability and toxicity of cadmium in marine systems are enhanced at low salinity. The Swedish environment is therefore extra vulnerable to cadmium pollution. The average concentrations of cadmium in the forest mor layers, agricultural soils, and fresh-waters in Sweden are enhanced compared to `back-ground concentrations`, with a general increasing trend from the north to the south-west, indicating strong impact of atmospheric deposition of cadmium originating from the central parts of Europe. In Swedish sea water, total cadmium concentrations, and the fraction of bio-available `free` cadmium, generally increases with decreasing salinity. Decreased emissions of cadmium to the environment have led to decreasing atmospheric deposition during the last decade. The net accumulation of cadmium in the forest mor layer has stopped, and even started to decrease. In northern Sweden, this is due to the decreased deposition, but in southern Sweden the main reason is increased leakage of cadmium from the topsoil as a consequence of acidification. As a result, cadmium in the Swedish environments is undergoing an extended redistribution between different soil compartments, and from the soils to the aquatic systems. 90 refs, 23 figs, 2 tabs. With 3 page summary in Swedish

  12. Cadmium sulfite hexahydrate revisited

    Directory of Open Access Journals (Sweden)

    Sergio Baggio

    2008-07-01

    Full Text Available The present structural revision of the title compound, tetracadmium tetrasulfite hexahydrate, [Cd4(SO34(H2O5]·H2O, is a low-temperature upgrade (T = 100 K and R = 0.017 of the original room-temperature structure reported by Kiers & Vos [Cryst. Struct. Commun. (1978. 7, 399–403; T = 293 K and R = 0.080. The compound is a three-dimensional polymer with four independent cadmium centres, four sulfite anions and six water molecules, five of them coordinated to two cadmium centres and the remaining one an unbound solvent molecule which completes the asymmetric unit. There are two types of cadmium environment: CdO8 (through four chelating sulfite ligands and CdO6 (by way of six monocoordinated ligands. The former groups form planar arrays [parallel to (001 and separated by half a unit cell translation along c], made up of chains running along [110] and [overline{1}10], respectively. These chains are, in turn, interconnected both in an intraplanar as well as in an interplanar fashion by the latter CdO6 polyhedra into a tight three-dimensional framework. There is, in addition, an extensive network of hydrogen bonds, in which all 12 water H atoms act as donors and eight O atoms from all four sulfite groups and two water molecules act as acceptors.

  13. Low serum zinc is associated with elevated risk of cadmium nephrotoxicity

    Energy Technology Data Exchange (ETDEWEB)

    Lin, Yu-Sheng, E-mail: Lin.Yu-Sheng@epa.gov [National Center for Environmental Assessment, Office of Research and Development, U.S. Environmental Protection Agency, Washington, DC (United States); Ho, Wen-Chao [Department of Public Health, College of Public Health, China Medical University, Taichung, Taiwan (China); Caffrey, James L. [Integrative Physiology and Cardiovascular Research Institute, University of North Texas Health Science Center, Fort Worth, TX (United States); Sonawane, Babasaheb [National Center for Environmental Assessment, Office of Research and Development, U.S. Environmental Protection Agency, Washington, DC (United States)

    2014-10-15

    Background: Despite animal evidence suggests that zinc modulates cadmium nephrotoxicity, limited human data are available. Objective: To test the hypothesis that low serum zinc concentrations may increase the risk of cadmium-mediated renal dysfunction in humans. Methods: Data from 1545 subjects aged 20 or older in the National Health and Nutrition Examination Survey (NHANES), 2011–2012 were analyzed. Renal function was defined as impaired when estimated glomerular filtration rate (eGFR) fell below 60 ml/min/1.73 m{sup 2} and/or the urinary albumin-to-creatinine ratio surpassed 2.5 in men and 3.5 mg/mmol in women. Results: Within the study cohort, 117 subjects had reduced eGFR and 214 had elevated urinary albumin. After adjusting for potential confounders, subjects with elevated blood cadmium (>0.53 μg/L) were more likely to have a reduced eGFR (odds ratio [OR]=2.21, 95% confidence interval [CI]: 1.09–4.50) and a higher urinary albumin (OR=2.04, 95% CI: 1.13–3.69) than their low cadmium (<0.18 μg/L) peers. In addition, for any given cadmium exposure, low serum zinc is associated with elevated risk of reduced eGFR (OR=3.38, 95% CI: 1.39–8.28). A similar increase in the odds ratio was observed between declining serum zinc and albuminuria but failed to reach statistical significance. Those with lower serum zinc/blood cadmium ratios were likewise at a greater risk of renal dysfunction (p<0.01). Conclusions: This study results suggest that low serum zinc concentrations are associated with an increased risk of cadmium nephrotoxicity. Elevated cadmium exposure is global public health issue and the assessment of zinc nutritional status may be an important covariate in determining its effective renal toxicity. - Highlights: • Blood cadmium was associated with increased risk of nephrotoxicity. • Low serum zinc may exacerbate risk of cadmium-mediated renal dysfunction. • Both zinc deficiency and elevated cadmium exposure are global public health issues.

  14. Low serum zinc is associated with elevated risk of cadmium nephrotoxicity

    International Nuclear Information System (INIS)

    Background: Despite animal evidence suggests that zinc modulates cadmium nephrotoxicity, limited human data are available. Objective: To test the hypothesis that low serum zinc concentrations may increase the risk of cadmium-mediated renal dysfunction in humans. Methods: Data from 1545 subjects aged 20 or older in the National Health and Nutrition Examination Survey (NHANES), 2011–2012 were analyzed. Renal function was defined as impaired when estimated glomerular filtration rate (eGFR) fell below 60 ml/min/1.73 m2 and/or the urinary albumin-to-creatinine ratio surpassed 2.5 in men and 3.5 mg/mmol in women. Results: Within the study cohort, 117 subjects had reduced eGFR and 214 had elevated urinary albumin. After adjusting for potential confounders, subjects with elevated blood cadmium (>0.53 μg/L) were more likely to have a reduced eGFR (odds ratio [OR]=2.21, 95% confidence interval [CI]: 1.09–4.50) and a higher urinary albumin (OR=2.04, 95% CI: 1.13–3.69) than their low cadmium (<0.18 μg/L) peers. In addition, for any given cadmium exposure, low serum zinc is associated with elevated risk of reduced eGFR (OR=3.38, 95% CI: 1.39–8.28). A similar increase in the odds ratio was observed between declining serum zinc and albuminuria but failed to reach statistical significance. Those with lower serum zinc/blood cadmium ratios were likewise at a greater risk of renal dysfunction (p<0.01). Conclusions: This study results suggest that low serum zinc concentrations are associated with an increased risk of cadmium nephrotoxicity. Elevated cadmium exposure is global public health issue and the assessment of zinc nutritional status may be an important covariate in determining its effective renal toxicity. - Highlights: • Blood cadmium was associated with increased risk of nephrotoxicity. • Low serum zinc may exacerbate risk of cadmium-mediated renal dysfunction. • Both zinc deficiency and elevated cadmium exposure are global public health issues.

  15. Cadmium(II) complex formation with cysteine and penicillamine.

    Science.gov (United States)

    Jalilehvand, Farideh; Leung, Bonnie O; Mah, Vicky

    2009-07-01

    The complex formation between cadmium(II) and the ligands cysteine (H(2)Cys) and penicillamine (H(2)Pen = 3,3'-dimethylcysteine) in aqueous solutions, having C(Cd(II)) approximately 0.1 mol dm(-3) and C(H(2)L) = 0.2-2 mol dm(-3), was studied at pH = 7.5 and 11.0 by means of (113)Cd NMR and Cd K- and L(3)-edge X-ray absorption spectroscopy. For all cadmium(II)-cysteine molar ratios, the mean Cd-S and Cd-(N/O) bond distances were found in the ranges 2.52-2.54 and 2.27-2.35 A, respectively. The corresponding cadmium(II)-penicillamine complexes showed slightly shorter Cd-S bonds, 2.50-2.53 A, but with the Cd-(N/O) bond distances in a similar wide range, 2.28-2.33 A. For the molar ratio C(H(2)L)/C(Cd(II)) = 2, the (113)Cd chemical shifts, in the range 509-527 ppm at both pH values, indicated complexes with distorted tetrahedral CdS(2)N(N/O) coordination geometry. With a large excess of cysteine (molar ratios C(H(2)Cys)/C(Cd(II)) >or= 10), complexes with CdS(4) coordination geometry dominate, consistent with the (113)Cd NMR chemical shifts, delta approximately 680 ppm at pH 7.5 and 636-658 ppm at pH 11.0, and their mean Cd-S distances were 2.53 +/- 0.02 A. At pH 7.5, the complexes are almost exclusively sulfur-coordinated as [Cd(S-cysteinate)(4)](n-), while at higher pH, the deprotonation of the amine groups promotes chelate formation. At pH 11.0, a minor amount of the [Cd(Cys)(3)](4-) complex with CdS(3)N coordination is formed. For the corresponding penicillamine solutions with molar ratios C(H(2)Pen)/C(Cd(II)) >or= 10, the (113)Cd NMR chemical shifts, delta approximately 600 ppm at pH 7.5 and 578 ppm at pH 11.0, together with the average bond distances, Cd-S 2.53 +/- 0.02 A and Cd-(N/O) 2.30-2.33 A, indicate that [Cd(penicillaminate)(3)](n-) complexes with chelating CdS(3)(N/O) coordination dominate already at pH 7.5 and become mixed with CdS(2)N(N/O) complexes at pH 11.0. The present study reveals differences between cysteine and penicillamine as ligands to the

  16. 21 CFR 163.113 - Cocoa.

    Science.gov (United States)

    2010-04-01

    ... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.113 Cocoa. (a... requirements for label declaration of ingredients for breakfast cocoa in § 163.112, except that the cacao...

  17. Exposure to environmental levels of waterborne cadmium impacts corticosteroidogenic and metabolic capacities, and compromises secondary stressor performance in rainbow trout

    International Nuclear Information System (INIS)

    Highlights: •Low level chronic waterborne cadmium exposure did not evoke a plasma cortisol response in rainbow trout. •Chronic cadmium exposure increases liver and gill metabolic capacities. •Chronic cadmium exposure disrupts head kidney steroidogenic capacity. •Chronic cadmium exposure disrupts glucocorticoid and mineralocorticoid receptor protein expressions in target tissues. •Chronic cadmium exposure compromises physiological performances to a secondary stressor in trout. -- Abstract: The physiological responses to waterborne cadmium exposure have been well documented; however, few studies have examined animal performances at low exposure concentrations of this metal. We tested the hypothesis that longer-term exposure to low levels of cadmium will compromise the steroidogenic and metabolic capacities, and reduce the cortisol response to a secondary stressor in fish. To test this, juvenile rainbow trout (Oncorhynchus mykiss) were exposed to 0 (control), 0.75 or 2.0 μg/L waterborne cadmium in a flow-through system and were sampled at 1, 7 and 28 d of exposure. There were only very slight disturbances in basal plasma cortisol, lactate or glucose levels in response to cadmium exposure over the 28 d period. Chronic cadmium exposure significantly affected key genes involved in corticosteroidogenesis, including melanocortin 2 receptor, steroidogenic acute regulatory protein and cytochrome P450 side chain cleavage enzyme. At 28 d, the high cadmium exposure group showed a significant drop in the glucocorticoid receptor and mineralocorticoid receptor protein expressions in the liver and brain, respectively. There were also perturbations in the metabolic capacities in the liver and gill of cadmium-exposed trout. Subjecting these fish to a secondary handling disturbance led to a significant attenuation of the stressor-induced plasma cortisol, glucose and lactate levels in the cadmium groups. Collectively, although trout appears to adjust to subchronic exposure

  18. Exposure to environmental levels of waterborne cadmium impacts corticosteroidogenic and metabolic capacities, and compromises secondary stressor performance in rainbow trout

    Energy Technology Data Exchange (ETDEWEB)

    Sandhu, Navdeep [Department of Biology, University of Waterloo, Waterloo, Ontario N2L 3G1 (Canada); McGeer, James C. [Department of Biology, Wilfrid Laurier University, Waterloo, Ontario N2L 3C5 (Canada); Vijayan, Mathilakath M., E-mail: matt.vijayan@ucalgary.ca [Department of Biology, University of Waterloo, Waterloo, Ontario N2L 3G1 (Canada)

    2014-01-15

    Highlights: •Low level chronic waterborne cadmium exposure did not evoke a plasma cortisol response in rainbow trout. •Chronic cadmium exposure increases liver and gill metabolic capacities. •Chronic cadmium exposure disrupts head kidney steroidogenic capacity. •Chronic cadmium exposure disrupts glucocorticoid and mineralocorticoid receptor protein expressions in target tissues. •Chronic cadmium exposure compromises physiological performances to a secondary stressor in trout. -- Abstract: The physiological responses to waterborne cadmium exposure have been well documented; however, few studies have examined animal performances at low exposure concentrations of this metal. We tested the hypothesis that longer-term exposure to low levels of cadmium will compromise the steroidogenic and metabolic capacities, and reduce the cortisol response to a secondary stressor in fish. To test this, juvenile rainbow trout (Oncorhynchus mykiss) were exposed to 0 (control), 0.75 or 2.0 μg/L waterborne cadmium in a flow-through system and were sampled at 1, 7 and 28 d of exposure. There were only very slight disturbances in basal plasma cortisol, lactate or glucose levels in response to cadmium exposure over the 28 d period. Chronic cadmium exposure significantly affected key genes involved in corticosteroidogenesis, including melanocortin 2 receptor, steroidogenic acute regulatory protein and cytochrome P450 side chain cleavage enzyme. At 28 d, the high cadmium exposure group showed a significant drop in the glucocorticoid receptor and mineralocorticoid receptor protein expressions in the liver and brain, respectively. There were also perturbations in the metabolic capacities in the liver and gill of cadmium-exposed trout. Subjecting these fish to a secondary handling disturbance led to a significant attenuation of the stressor-induced plasma cortisol, glucose and lactate levels in the cadmium groups. Collectively, although trout appears to adjust to subchronic exposure

  19. Susceptibility of early life stages of Xenopus laevis to cadmium

    Energy Technology Data Exchange (ETDEWEB)

    Herkovits, J.; Perez-Coll, C.S. [Inst. de Ciencias Ambientales y Salud, Buenos Aires (Argentina). Programa Seguridad Quimica; Cardellini, P.; Pavanati, C. [Univ. degli Studi di Padova Via Trieste (Italy). Dept. di Biologia

    1997-02-01

    The susceptibility of Xenopus laevis to cadmium during different stages of development was evaluated by exposing embryos to cadmium concentrations ranging from 0.1 to 10 mg Cd{sup 2+}/L for 24, 48, and 72 h and assessing lethality and malformations. Susceptibility increased from the two blastomeres stage (stage 2) to stage 40, in which the 24-h LC100 was 1.13 mg Cd{sup 2+}/L, and resistance increased from this stage onward. Malformations occurred at all developmental stages evaluated, the most common being reduced size, incurvated axis, underdeveloped or abnormally developed fin, microcephaly, and microphtalmy. Scanning electron microscopy revealed changes in the ectodermal surface ranging from slightly vaulted cells to a severe reduction in the number of ciliated cells as the concentration of cadmium increased. The intraspecific variation evaluated in embryos (from four sets of parents) at seven developmental stages, expressed as the coefficient of variation of the LC100, ranged from 10 to 112% and reflects the capacity of Xenopus laevis to adapt to changing environmental conditions at different embryonic stages.

  20. Projectbeschrijving Cadmium-informatiepunt (CIP)

    OpenAIRE

    Meijer PJ

    1989-01-01

    To minimize the use of cadmium the Central Government has decided to perform the purchase of products and materials within the Central Government as much as possible within the Draft Cadmium Decree. The activities to achieve this are as far as could be seen at the start of the project in june 1989, mentioned in this report.

  1. Cadmium(II) complex formation with glutathione.

    Science.gov (United States)

    Mah, Vicky; Jalilehvand, Farideh

    2010-03-01

    Complex formation between heavy metal ions and glutathione (GSH) is considered as the initial step in many detoxification processes in living organisms. In this study the structure and coordination between the cadmium(II) ion and GSH were investigated in aqueous solutions (pH 7.5 and 11.0) and in the solid state, using a combination of spectroscopic techniques. The similarity of the Cd K-edge and L(3)-edge X-ray absorption spectra of the solid compound [Cd(GS)(GSH)]ClO(4).3H(2)O, precipitating at pH 3.0, with the previously studied cysteine compound {Cd(HCys)(2).H(2)O}(2).H(3)O(+).ClO(4) (-) corresponds to Cd(S-GS)(3)O (dominating) and Cd(S-GS)(4) four-coordination within oligomeric complexes with mean bond distances of 2.51 +/- 0.02 A for Cd-S and 2.24 +/- 0.04 A for Cd-O. For cadmium(II) solutions (C (Cd(II)) approximately 0.05 M) at pH 7.5 with moderate excess of GSH (C (GSH)/C (Cd(II)) = 3.0-5.0), a mix of Cd(S-GS)(3)O (dominating) and Cd(S-GS)(4) species is consistent with the broad (113)Cd NMR resonances in the range 632-658 ppm. In alkaline solutions (pH 11.0 and C (GSH)/C (Cd(II)) = 2.0 or 3.0), two distinct peaks at 322 and 674 ppm are obtained. The first peak indicates six-coordinated mononuclear and dinuclear complexes with CdS(2)N(2)(N/O)(2) and CdSN(3)O(2) coordination in fast exchange, whereas the second corresponds to Cd(S-GS)(4) sites. At high ligand excess the tetrathiolate complex, Cd(S-GS)(4), characterized by a sharp delta((113)Cd) NMR signal at 677 ppm, predominates. The average Cd-S distance, obtained from the X-ray absorption spectra, varied within a narrow range, 2.49-2.53 A, for all solutions (pH 7.5 and 11.0) regardless of the coordination geometry. PMID:20035360

  2. 29 CFR 1926.1127 - Cadmium.

    Science.gov (United States)

    2010-07-01

    ... containment of cadmium or materials containing cadmium on the site or location at which construction...) SAFETY AND HEALTH REGULATIONS FOR CONSTRUCTION Toxic and Hazardous Substances § 1926.1127 Cadmium. (a... forms, in all construction work where an employee may potentially be exposed to cadmium....

  3. Cadmium exposure in the Swedish environment

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-03-01

    This report gives a thorough description of cadmium in the Swedish environment. It comprises three parts: Cadmium in Sweden - environmental risks;, Cadmium in goods - contribution to environmental exposure;, and Cadmium in fertilizers, soil, crops and foods - the Swedish situation. Separate abstracts have been prepared for all three parts

  4. Synthesis, structural characterization, and spectroscopy of the cadmium-cadmium bonded molecular species Ar'CdCdAr' (Ar' = C6H3-2,6-(C6H3-2,6-Pri2)2).

    Science.gov (United States)

    Zhu, Zhongliang; Fischer, Roland C; Fettinger, James C; Rivard, Eric; Brynda, Marcin; Power, Philip P

    2006-11-29

    The synthesis and first structural characterization of a cadmium-cadmium bonded molecular compound Ar'CdCdAr' (Ar' = C6H3-2,6-(C6H3-2,6-Pri2)2) are reported. The existence of the Cd-Cd bond was established by 113Cd NMR spectroscopy and X-ray diffraction (Cd-Cd = 2.6257(5) A). Like its group 12 analogue Ar'ZnZnAr', DFT calculations showed that Ar'CdCdAr' had significant p-character in the Cd-Cd sigma-bonding HOMO. PMID:17117840

  5. Cadmium in newborns

    OpenAIRE

    Eklund, Gunilla

    2003-01-01

    Cadmium (Cd) is a well-known nephrotoxic environmental contaminant but there are indications that the developing nervous system might be even more sensitive to Cd than the kidneys in adults. Infants are exposed to Cd from various formulas and infant diets and the gastrointestinal Cd uptake is believed to be higher in newborns than in adults. Cd levels monitored in infant foods ranged between 0.74 and 27.0 µg/kg. Cow's milk formulas had the lowest levels and cereal-based formulas had up to 21 ...

  6. Cadmium sulfite hexahydrate revisited

    OpenAIRE

    Sergio Baggio; Andrés Ibáñez; Ricardo Baggio

    2008-01-01

    The present structural revision of the title compound, tetracadmium tetrasulfite hexahydrate, [Cd4(SO3)4(H2O)5]·H2O, is a low-temperature upgrade (T = 100 K and R = 0.017) of the original room-temperature structure reported by Kiers & Vos [Cryst. Struct. Commun. (1978). 7, 399–403; T = 293 K and R = 0.080). The compound is a three-dimensional polymer with four independent cadmium centres, four sulfite anions and six water molecules, five of them coordinated to two c...

  7. Cadmium and zinc

    International Nuclear Information System (INIS)

    Cadmium and zinc are naturally occurring trace metals that are often considered together because of their close geochemical association and similarities in chemical reactivity. The loss of two electrons from an atom of Cd or Zn imparts to each an electron configuration with completely filled d orbitals; this results in a highly stable 2/sup +/ oxidation state. But Cd and Zn differ greatly in their significance to biological systems. Whereas Zn is an essential nutrient for plants, animals, and humans, Cd is best known for its toxicity to plants and as a causative agent of several disease syndromes in animals and humans

  8. 21 CFR 113.5 - Current good manufacturing practice.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Current good manufacturing practice. 113.5 Section 113.5 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... CONTAINERS General Provisions § 113.5 Current good manufacturing practice. The criteria in §§ 113.10,...

  9. 13 CFR 113.305 - Preference in admission.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Preference in admission. 113.305... Discrimination on the Basis of Sex in Admission and Recruitment Prohibited § 113.305 Preference in admission. A recipient to which §§ 113.300 through 113.310 apply shall not give preference to applicants for...

  10. Detection of cadmium radioactivity in the marine environment

    International Nuclear Information System (INIS)

    Sediment and tissues from different marine organisms recently collected at atolls of the Marshall Islands have been found to contain measurable amounts of 113Cdsup(m) previously deposited to the atolls during the testing of nuclear devices at the Pacific Proving Grounds. Cadmium-113m has been also detected in some internal organs of mullet collected from the east coast of the United States of America in an area contaminated only with global fall-out debris. This is one of the few summaries to show that this long-lived radionuclide (Tsub(1/2) = 14.6 years) exists and persists in the marine environment. It is the dominate anthropogenic radionuclide in the liver of some pelagic fish from Bikini and Enewetak Atolls and is found concentrated in other tissues and organs of all fish analysed. Dose to man from 113Cdsup(m) ingestion is being assessed at the Marshall Islands and should be carried out at any other global site where contamination by this radionuclide is suspected in the aquatic environment. (author)

  11. Biomonitoring of cadmium in pig production

    OpenAIRE

    Lindén, Anna

    2002-01-01

    Cadmium is a nephrotoxic metal with increasing levels in arable soils. The non-smoking population is exposed to cadmium mainly from vegetable food, especially cereal products. The major part of pig feed is cereals, and accumulated cadmium in pig kidney could reflect cadmium in the local agricultural environment. In this thesis, the possibility to use pig kidney as a bioindicator of the availability of cadmium in the agricultural environment was evaluated. There were significant correlations b...

  12. Dicty_cDB: CHC113 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHC113 (Link to dictyBase) - - - Contig-U15579-1 CHC113P (Link... to Original site) CHC113F 198 CHC113Z 396 CHC113P 574 - - Show CHC113 Library CH (Link to library) Clone ID CHC113 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dict...nif*KLENIIKKRNKLIFNYK KK--- ---GFGCLAIPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPRECN PRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICT...KK--- ---GFGCLAIPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPRECN PRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICTPTPS

  13. RNA-Seq identifies key reproductive gene expression alterations in response to cadmium exposure.

    Science.gov (United States)

    Hu, Hanyang; Lu, Xing; Cen, Xiang; Chen, Xiaohua; Li, Feng; Zhong, Shan

    2014-01-01

    Cadmium is a common toxicant that is detrimental to many tissues. Although a number of transcriptional signatures have been revealed in different tissues after cadmium treatment, the genes involved in the cadmium caused male reproductive toxicity, and the underlying molecular mechanism remains unclear. Here we observed that the mice treated with different amount of cadmium in their rodent chow for six months exhibited reduced serum testosterone. We then performed RNA-seq to comprehensively investigate the mice testicular transcriptome to further elucidate the mechanism. Our results showed that hundreds of genes expression altered significantly in response to cadmium treatment. In particular, we found several transcriptional signatures closely related to the biological processes of regulation of hormone, gamete generation, and sexual reproduction, respectively. The expression of several testosterone synthetic key enzyme genes, such as Star, Cyp11a1, and Cyp17a1, were inhibited by the cadmium exposure. For better understanding of the cadmium-mediated transcriptional regulatory mechanism of the genes, we computationally analyzed the transcription factors binding sites and the mircoRNAs targets of the differentially expressed genes. Our findings suggest that the reproductive toxicity by cadmium exposure is implicated in multiple layers of deregulation of several biological processes and transcriptional regulation in mice. PMID:24982889

  14. RNA-Seq Identifies Key Reproductive Gene Expression Alterations in Response to Cadmium Exposure

    Directory of Open Access Journals (Sweden)

    Hanyang Hu

    2014-01-01

    Full Text Available Cadmium is a common toxicant that is detrimental to many tissues. Although a number of transcriptional signatures have been revealed in different tissues after cadmium treatment, the genes involved in the cadmium caused male reproductive toxicity, and the underlying molecular mechanism remains unclear. Here we observed that the mice treated with different amount of cadmium in their rodent chow for six months exhibited reduced serum testosterone. We then performed RNA-seq to comprehensively investigate the mice testicular transcriptome to further elucidate the mechanism. Our results showed that hundreds of genes expression altered significantly in response to cadmium treatment. In particular, we found several transcriptional signatures closely related to the biological processes of regulation of hormone, gamete generation, and sexual reproduction, respectively. The expression of several testosterone synthetic key enzyme genes, such as Star, Cyp11a1, and Cyp17a1, were inhibited by the cadmium exposure. For better understanding of the cadmium-mediated transcriptional regulatory mechanism of the genes, we computationally analyzed the transcription factors binding sites and the mircoRNAs targets of the differentially expressed genes. Our findings suggest that the reproductive toxicity by cadmium exposure is implicated in multiple layers of deregulation of several biological processes and transcriptional regulation in mice.

  15. Potentiometric titration of excess cadmium in cadmium selenide

    International Nuclear Information System (INIS)

    A simple and rapid potentiometric technique for determining excess cadmium in CdSe has been developed. Reaction with AgNO3 is used for sample treatment. Silver, formed in the AgNO3 reaction with excess Cd is determined with the help of KI. When using the given method of analysis the relative standard deviation is equal to 0.08-0.21. The real detection limit of excess cadmium is 9x10-7 g

  16. Synthesis and spectroscopic and structural studies of a new cadmium(II)-citrate aqueous complex. Potential relevance to cadmium(II)-citrate speciation and links to cadmium toxicity.

    Science.gov (United States)

    Dakanali, M; Kefalas, E T; Raptopoulou, C P; Terzis, A; Mavromoustakos, T; Salifoglou, A

    2003-04-21

    The presence of cadmium in the environment undoubtedly contributes to an increased risk of exposure and ultimate toxic influence on humans. In an effort to comprehend the chemical and biological interactions of Cd(II) with physiological ligands, like citric acid, we explored the requisite aqueous chemistry, which afforded the first aqueous Cd(II)-citrate complex [Cd(C(6)H(6)O(7))(H(2)O)](n)() (1). Compound 1 was characterized by elemental analysis, and spectroscopically by FT-IR and (113)Cd MAS NMR. Compound 1 crystallizes in the orthorhombic space group P2(1)2(1)2(1), with a = 6.166(2) A, b = 10.508(3) A, c = 13.599(5) A, V = 881.2(5) A(3), and Z = 4. The X-ray structure of 1 reveals the presence of octahedral Cd(II) ions bound to citrate ligands in a molecular crystal lattice. Citrate acts as a tridentate binder promoting coordination to one Cd(II) through the central alcoholic moiety, one terminal carboxylate group, and the central carboxylate group. In addition, the central carboxylate binds to three Cd(II) ions. Specifically, one of the oxygens of the central carboxylate serves as a bridge to two neighboring Cd(II) ions, while the other oxygen binds to a third Cd(II). A bound water molecule completes the coordination requirements of Cd(II). (113)Cd MAS NMR studies project the spectroscopic signature of the nature of the coordination environment around Cd(II) in 1, thus corroborating the X-ray findings. Collectively, the data at hand are in line with past solution studies. The latter predict that other similar low molecular mass Cd(II)-citrate complexes may exist in the acidic pH region, thus influencing the uptake of cadmium by living (micro)organisms, their ability to metabolize organic substrates, and possibly Cd(II) toxicity. PMID:12691558

  17. Cadmium(2) complexes of cytosine

    International Nuclear Information System (INIS)

    Complexes of cadmium(2) with cytosine obtained from aqueous or physiological solutions at room temperature are reported. The complexes were characterized by spectroscopic, conductometric, 1H-NMR, and 13C-NMR measurements and also by thermogravimetry. (Authors)

  18. Discovery of the Cadmium Isotopes

    OpenAIRE

    Amos, S.; Thoennessen, M

    2009-01-01

    Thirty-seven cadmium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  19. Cadmium telluride nuclear radiation detectors

    International Nuclear Information System (INIS)

    The characteristics and performance of undoped high resistivity cadmium telluride detectors are compared to chlorine lifted counters. It is shown, in particular, that Undodep CdTe is in fact aluminium doped and that compensation occurs, as an silicon or germanium, by pair and triplet formation between the group III donor and the doubly charged cadmium vacancy acceptor. Furthermore, in chlorine doped samples, the polarization effect results from the unpaired level at Esub(c)-0,6eV

  20. Speciation of Dissolved Cadmium

    DEFF Research Database (Denmark)

    Holm, Peter Engelund; Andersen, Sjur; Christensen, Thomas Højlund

    1995-01-01

    Equilibrium dialysis and ion exchange methods, as well as computer calculations (GEOCHEM), were applied for speciation of dissolved cadmium (Cd) in test solutions and leachate samples. The leachate samples originated from soil, compost, landfill waste and industrial waste. The ion exchange (IE......) method separates dissolved Cd into free divalent Cd (Cd 2+) and complexed Cd and furthermore separates the latter into the operationally defined forms: labile, slowly labile and stable complexes. The dialysis (ED) method determines high molecular weight Cd complexes (above 1000mol. wt). For both methods...... the reproducibility was good. By combining the results of the GEOCHEM calculations in terms of the inorganic complexes, and the IE results, the fractions of free and inorganically complexed Cd were estimated. The IE and ED results furthermore provided information about the organic complexes. Selected...

  1. 40 CFR 92.113 - Fuel specifications.

    Science.gov (United States)

    2010-07-01

    ...) CONTROL OF AIR POLLUTION FROM LOCOMOTIVES AND LOCOMOTIVE ENGINES Test Procedures § 92.113 Fuel specifications. (a) Diesel test fuel. (1) The diesel fuels for testing locomotives or locomotive engines designed...-690 ( °C) (321.1-365.6) Gravity, °API D287 32-37 Total sulfur, pct D2622 0.2-0.4...

  2. 49 CFR 229.113 - Warning notice.

    Science.gov (United States)

    2010-10-01

    ....113 Warning notice. Whenever any steam generator has been shut down because of defects, a distinctive warning notice giving reasons for the shut-down shall be conspicuously attached near the steam generator starting controls until the necessary repairs have been made. The locomotive in which the steam...

  3. 13 CFR 113.525 - Fringe benefits.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Fringe benefits. 113.525 Section... benefits. (a) “Fringe benefits” defined. For purposes of these Title IX regulations, fringe benefits means: Any medical, hospital, accident, life insurance, or retirement benefit, service, policy or plan,...

  4. 14 CFR 15.113 - Indemnification agreements.

    Science.gov (United States)

    2010-01-01

    ... 15.113 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION PROCEDURAL... States Department of Justice, the FAA will promptly enter into an indemnification agreement providing for... reasonable attorney fees at a rate not to exceed that permitted under the Equal Access to Justice Act (5...

  5. 9 CFR 113.327 - Bronchitis Vaccine.

    Science.gov (United States)

    2010-01-01

    ... respiratory signs or death shall be counted as failures. Two-stage sequential testing may be conducted if the.... Final container samples of completed product shall be tested for virus titer using the procedure... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Bronchitis Vaccine. 113.327...

  6. 9 CFR 113.332 - Tenosynovitis Vaccine.

    Science.gov (United States)

    2010-01-01

    ... postinoculation, blood samples shall be taken from each chicken and the serum separated using a technique...-bearing cell culture fluids or embryonated chicken eggs. Only Master Seed which has been established as...) Pathogens by the chicken inoculation test prescribed in § 113.36. (2) Lymphoid leukosis virus...

  7. Cadmium accumulation and depuration in Anodonta anatina exposed to cadmium chloride or cadmium-EDTA complex

    Energy Technology Data Exchange (ETDEWEB)

    Holwerda, D.A.; Hemelraad, J.; Veenhof, P.R.; Zandee, D.I.

    1988-03-01

    The authors have previously reported on the uptake and distribution of cadmium in unionids, experimentally exposed to cadmium chloride. The purpose of the present investigation was to study the effect of metal chelation on cadmium kinetics, including metal elimination in the post-exposure phase. Generally, chelation of ionic metal by natural substances like humic acids or by synthetic compounds like EDTA decreases its environmental toxicity through a diminished rate of uptake, as compared with the free ion. The influences of metal chelation on bioconcentration and on toxicity do not always run parallel. To their knowledge, there are no data on the effect of chelation on metal kinetics in freshwater clams. Data on rates of cadmium elimination from aquatic invertebrates are highly divergent, but Cd excretion is invariably found to be smaller than uptake.

  8. Studies of 3He Induced Nuclear Reactions on Cadmium

    International Nuclear Information System (INIS)

    Excitation functions of 3He induced nuclear reactions on natural cadmium were measured using the standard stacked foil technique and high resolution gamma ray spectroscopy. The experimental cross sections for the nuclear reactions natCd(3He,xnp )117m,g,116m115m,114m,113m,111,110m,g,109,108,107 In were measured from their threshold energy up to 27 MeV. The integral yields for some medically important products were determined. Theoretical calculations using the nuclear codes ALICE- IPPE, TAL YS, and EMPIRE-3 were used to describe the formation of these products. Theoretical and experimental results were compared with each other. K

  9. Zinc-induced protection against cadmium

    Energy Technology Data Exchange (ETDEWEB)

    Early, J.L.; Schnell, R.C.

    1978-02-01

    Pretreatment of male rats with cadmium acetate potentiates the duration of hexobarbital hypnosis and inhibits the rate of hepatic microsomal drug metabolism. Pretreatment of rats with zinc acetate protects against these alterations in drug action elicited by cadmium.

  10. Bioavailability of cadmium from linseed and cocoa

    DEFF Research Database (Denmark)

    Hansen, Max; Sloth, Jens Jørgen; Rasmussen, Rie Romme

    In Denmark and EU the exposure of cadmium from food is at a level that is relatively close to the Tolerable Daily Intake (TDI). This report describes an investigation of the bioavailability of cadmium in selected food items known to contain high levels of cadmium. The purpose was to provide data ...... crushed linseed nor the intake of cocoa and chocolate....

  11. Cadmium purification and quantification using immunochromatography.

    Science.gov (United States)

    Sasaki, Kazuhiro; Yongvongsoontorn, Nunnarpas; Tawarada, Kei; Ohnishi, Yoshikazu; Arakane, Tamami; Kayama, Fujio; Abe, Kaoru; Oguma, Shinichi; Ohmura, Naoya

    2009-06-10

    One of the pathways by which cadmium enters human beings is through the consumption of agricultural products. The monitoring of cadmium has a significant role in the management of cadmium intake. Cadmium purification and quantification using immunochromatography were conducted in this study as an alternative means of cadmium analysis. The samples used in this study were rice, tomato, lettuce, garden pea, Arabidopsis thaliana (a widely used model organism for studying plants), soil, and fertilizer. The cadmium immunochromatography has been produced from the monoclonal antibody Nx2C3, which recognize the chelate form of cadmium, Cd.EDTA. The immunochromatography can be used for quantification of cadmium in a range from 0.01 to 0.1 mg/L at 20% mean coefficient of variance. A chelate column employing quaternary ammonium salts was used for the purification of cadmium from HCl extracts of samples. Recoveries of cadmium were near 100%, and the lowest recovery was 76.6% from rice leaves. The estimated cadmium concentrations from the immunochromatography procedure were evaluated by comparison with the results of instrumental analysis (ICP-AES or ICP-MS). By comparison of HCl extracts analyzed by ICP-MS and column eluates analyzed by immunochromatography of the samples, the estimated cadmium concentrations were closely similar, and their recoveries were from 98 to 116%. PMID:19489614

  12. Mechanisms of cadmium carcinogenesis

    International Nuclear Information System (INIS)

    Cadmium (Cd), a heavy metal of considerable occupational and environmental concern, has been classified as a human carcinogen by the International Agency for Research on Cancer (IARC). The carcinogenic potential of Cd as well as the mechanisms underlying carcinogenesis following exposure to Cd has been studied using in vitro cell culture and in vivo animal models. Exposure of cells to Cd results in their transformation. Administration of Cd in animals results in tumors of multiple organs/tissues. Also, a causal relationship has been noticed between exposure to Cd and the incidence of lung cancer in human. It has been demonstrated that Cd induces cancer by multiple mechanisms and the most important among them are aberrant gene expression, inhibition of DNA damage repair, induction of oxidative stress, and inhibition of apoptosis. The available evidence indicates that, perhaps, oxidative stress plays a central role in Cd carcinogenesis because of its involvement in Cd-induced aberrant gene expression, inhibition of DNA damage repair, and apoptosis.

  13. Cadmium uptake by plants

    Energy Technology Data Exchange (ETDEWEB)

    Haghiri, F.

    1973-01-01

    Absorption of /sup 115m/Cd by soybean (Gylcine max l.) plants via foliar and root systems and translocation into the seed was determined. The uptake of /sup 115m/Cd by soybeans via the root system was more efficient than that of the foliar placement. Growth and Cd concentrations of soybean and wheat (Triticum aestivum l.) tops were influenced by soil-applied Cd. In both crops, the Cd concentration of plant tops increased while yield decreased with increasing levels of applied Cd. Cadmium toxicitiy began to occur in both crops at the lowest level of soil applied Cd (2.5 ppM). With soybean plants, Cd toxicity symptoms resembled fe chlorosis. For wheat plants there were no visual symptoms other than the studied growth. The relative concentration of Cd found in several vegetable crops varied depending on the plant species. The relative Cd concentration in descending order for various vegetables was lettuce (Lactuca sativa l.) > radish top (Raphanus sativus l.) > celery stalk (Apium graveolens l.) > celery leaves greater than or equal to green pepper (Capsicum frutescens l.) > radish roots.

  14. 9 CFR 113.45 - Sheep safety test.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Sheep safety test. 113.45 Section 113... Procedures § 113.45 Sheep safety test. The sheep safety test provided in this section shall be conducted when.... (1) Inject each of two sheep of the minimum age for which the product is recommended with...

  15. 9 CFR 113.33 - Mouse safety tests.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Mouse safety tests. 113.33 Section 113... Procedures § 113.33 Mouse safety tests. One of the mouse safety tests provided in this section shall be... or more ingredients makes the biological product lethal or toxic for mice but not lethal or toxic...

  16. 7 CFR 3550.113 - Rates and terms (loans only).

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Rates and terms (loans only). 3550.113 Section 3550.113 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE... 306C Water and Waste Disposal Grants § 3550.113 Rates and terms (loans only). (a) Interest rate....

  17. 5 CFR 185.113 - Location of hearing.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Location of hearing. 185.113 Section 185.113 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PROGRAM FRAUD CIVIL REMEDIES § 185.113 Location of hearing. (a) The hearing may be held: (1) In any judicial...

  18. 9 CFR 113.40 - Dog safety tests.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Dog safety tests. 113.40 Section 113... Procedures § 113.40 Dog safety tests. The safety tests provided in this section shall be conducted when... recommended for use in dogs. Serials which are not found to be satisfactory when tested pursuant to...

  19. 9 CFR 113.122 - Salmonella Choleraesuis Bacterin.

    Science.gov (United States)

    2010-01-01

    ... applicable requirements in 9 CFR 113.100 and shall be tested for purity, safety, and potency as prescribed in... provided in 9 CFR 113.26. (b) Safety test. Bulk or final container samples of completed product from each serial shall be tested for safety as provided in 9 CFR 113.33(b). The subcutaneous route shall be...

  20. 9 CFR 113.41 - Calf safety test.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Calf safety test. 113.41 Section 113... Procedures § 113.41 Calf safety test. The calf safety test provided in this section shall be conducted when.... Each of two calves shall be injected with the equivalent of 10 doses of vaccine administered in...

  1. 9 CFR 113.68 - Pasteurella Haemolytica Vaccine, Bovine.

    Science.gov (United States)

    2010-01-01

    ..., Bovine. 113.68 Section 113.68 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... REQUIREMENTS Live Bacterial Vaccines § 113.68 Pasteurella Haemolytica Vaccine, Bovine. Pasteurella Haemolytica Vaccine, Bovine, shall be prepared as a desiccated live culture bacterial vaccine of an avirulent...

  2. 9 CFR 113.39 - Cat safety tests.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Cat safety tests. 113.39 Section 113... Procedures § 113.39 Cat safety tests. The safety tests provided in this section shall be conducted when... recommended for use in cats. (a) The cat safety test provided in this paragraph shall be used when the...

  3. 9 CFR 113.208 - Avian Encephalomyelitis Vaccine, Killed Virus.

    Science.gov (United States)

    2010-01-01

    ..., Killed Virus. 113.208 Section 113.208 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.208 Avian Encephalomyelitis Vaccine, Killed Virus....

  4. 9 CFR 113.216 - Bovine Rhinotracheitis Vaccine, Killed Virus.

    Science.gov (United States)

    2010-01-01

    ... Virus. 113.216 Section 113.216 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.216 Bovine Rhinotracheitis Vaccine, Killed Virus. Infectious...

  5. 9 CFR 113.211 - Feline Rhinotracheitis Vaccine, Killed Virus.

    Science.gov (United States)

    2010-01-01

    ... Virus. 113.211 Section 113.211 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.211 Feline Rhinotracheitis Vaccine, Killed Virus....

  6. 9 CFR 113.123 - Salmonella Dublin Bacterin.

    Science.gov (United States)

    2010-01-01

    ... biological product containing Salmonella dublin fraction shall meet the applicable requirements in 9 CFR 113... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Salmonella Dublin Bacterin. 113.123... Inactivated Bacterial Products § 113.123 Salmonella Dublin Bacterin. Salmonella Dublin Bacterin shall...

  7. 5 CFR 831.113 - Payments to children.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Payments to children. 831.113 Section 831.113 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) RETIREMENT Administration and General Provisions § 831.113 Payments to children. For purposes...

  8. 29 CFR 780.113 - Seeds, spawn, etc.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Seeds, spawn, etc. 780.113 Section 780.113 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR STATEMENTS OF GENERAL... of Agriculture Agricultural Or Horticultural Commodities § 780.113 Seeds, spawn, etc. Seeds...

  9. 34 CFR 303.113 - Reviewing public comments received.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 2 2010-07-01 2010-07-01 false Reviewing public comments received. 303.113 Section 303.113 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF SPECIAL... TODDLERS WITH DISABILITIES State Application for a Grant Public Participation § 303.113 Reviewing...

  10. 48 CFR 432.113 - Customary contract financing.

    Science.gov (United States)

    2010-10-01

    ... financing. 432.113 Section 432.113 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 432.113 Customary contract financing. The contracting officer may determine the necessity for customary contract financing....

  11. 29 CFR 779.113 - Warehouse and stock room employees.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Warehouse and stock room employees. 779.113 Section 779.113 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR STATEMENTS....113 Warehouse and stock room employees. Warehouse and stock room employees of retail businesses...

  12. 9 CFR 113.32 - Detection of Brucella contamination.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Detection of Brucella contamination. 113.32 Section 113.32 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Standard Procedures § 113.32...

  13. 9 CFR 113.65 - Brucella Abortus Vaccine.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Brucella Abortus Vaccine. 113.65 Section 113.65 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Live Bacterial Vaccines § 113.65 Brucella...

  14. 9 CFR 113.203 - Feline Panleukopenia Vaccine, Killed Virus.

    Science.gov (United States)

    2010-01-01

    ... Virus. 113.203 Section 113.203 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.203 Feline Panleukopenia Vaccine, Killed Virus. Feline...

  15. 9 CFR 113.205 - Newcastle Disease Vaccine, Killed Virus.

    Science.gov (United States)

    2010-01-01

    ... Virus. 113.205 Section 113.205 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.205 Newcastle Disease Vaccine, Killed Virus. Newcastle Disease...

  16. 9 CFR 113.210 - Feline Calicivirus Vaccine, Killed Virus.

    Science.gov (United States)

    2010-01-01

    ... Virus. 113.210 Section 113.210 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.210 Feline Calicivirus Vaccine, Killed Virus. Feline...

  17. 36 CFR 11.3 - Power to revoke.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Power to revoke. 11.3 Section 11.3 Parks, Forests, and Public Property NATIONAL PARK SERVICE, DEPARTMENT OF THE INTERIOR ARROWHEAD AND PARKSCAPE SYMBOLS § 11.3 Power to revoke. Permission granted under this part by the Director...

  18. 29 CFR 825.113 - Serious health condition.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Serious health condition. 825.113 Section 825.113 Labor... AND MEDICAL LEAVE ACT OF 1993 Coverage Under the Family and Medical Leave Act § 825.113 Serious health condition. (a) For purposes of FMLA, “serious health condition” entitling an employee to FMLA leave means...

  19. Discoveries of Elements 113, 115 and 117

    International Nuclear Information System (INIS)

    Discovery of two isotopes of the new element 117 in the 249Bk + 48Ca reaction is described. A new 243Am + 48Ca experiment was carried out to firmly establish the discoveries of new elements 115 and 113. A total of thirty one decay chains of 288115 are now observed in the Am reaction. In addition, four new decay chains are assigned to 289115.

  20. Cadmium, copper and nickel levels in vegetables from industrial and residential areas of Lagos City, Nigeria.

    Science.gov (United States)

    Yusuf, A A; Arowolo, T A; Bamgbose, O

    2003-03-01

    The levels of cadmium, copper and nickel in five different edible vegetables, Talinum triangulare, Celosia trigyna, Corchorus olitorus, Venomia amygydalina and Telfaria accidentalis, and the soils in which they were grown, from three industrial and three residential areas of Lagos City, Nigeria, were determined using atomic absorption spectrophotometry. The results obtained for these three heavy metals from the industrial areas were higher than those of the residential areas as a result of pollution. Industrial area results for vegetables ranged between 1.13 and 1.67 microg/g for cadmium; 25.08 and 56.84 microg/g for copper and 1.33 and 2.06 microg/g for nickel. There were statistically significant differences (P<0.05) between the levels of copper and nickel in all the vegetables studied from industrial and residential areas, while there was no statistically significant difference for cadmium. The results also show that Corchorus olitorus (bush okra) has the ability to accumulate more copper and nickel than the other vegetable studied but has the least ability to accumulate cadmium. PMID:12504169

  1. Zinc and cadmium. 4; Transition metal chemistry review 1984. Pt. C

    Energy Technology Data Exchange (ETDEWEB)

    Dakternieks, D. (Deakin University, Geelong (Australia). Department of Chemical and Analitical Sciences)

    1990-02-01

    This review of the inorganic and coordination chemistry of zinc and cadmium covers material which appeared in volumes 102 and 103 of Chemical Abstracts. Zinc and cadmium are treated together and, as was the case last year, much of the reported chemistry is routine and has not been reported in detail. Rigorous classification of ligands continues to be a difficulty for compounds containing several different potential donor atoms and the reader may need to refer to more than one section. Although the scopeof this review does not encompass bio-inorganic in general, some more interesting aspects of application of {sup 113}Cd probes for biological systems have veen included this year. (author). 164 refs.; 9 schemes.

  2. Nickel cadmium battery expert system

    Science.gov (United States)

    1986-01-01

    The applicability of artificial intelligence methodologies for the automation of energy storage management, in this case, nickel cadmium batteries, is demonstrated. With the Hubble Space Telescope Electrical Power System (HST/EPS) testbed as the application domain, an expert system was developed which incorporates the physical characterization of the EPS, in particular, the nickel cadmium batteries, as well as the human's operational knowledge. The expert system returns not only fault diagnostics but also status and advice along with justifications and explanations in the form of decision support.

  3. Insulin Expression in Rats Exposed to Cadmium

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Objectives To investigate the effects of cadmium exposure on insulin expression in rats. Methods Eighteen adult SD assessed. The levels of cadmium and zinc in pancreas, blood and urine glucose, serum insulin and urine NAG (N-acyetyl-β-glucosaminidase) were determined. The gene expressions of metallothionein (MT) and insulin were also measured,and the oral glucose tolerance tests (OGTT) were carried out. Results The contents of cadmium in pancreas in cadmium-treated rats were higher than that in the control group, which was associated with slight increase of zinc in pancreas.not change significantly after cadmium administration, and the UNAG had no change in Cd-treated group. The gene expression the change of the expression of insulin, MT-Ⅰ and MT-Ⅱ genes. Cadmium can influence the biosynthesis of insulin, but does not induce the release of insulin. The dysfunction of pancreas occurs earlier than that of kidney after administration of cadmium.

  4. Preparation of an sup(113m) indium generator

    International Nuclear Information System (INIS)

    This paper describes the features related to the preparation of sup(113m) In from a generator for nuclear medicine application. 113Sn radioisotope is adsorbed on a hidrated zirconium oxide column and sup(113m) In generated from the decay of 113Sn is eluted with diluted hydrochloric acid. This procedure is simple and appropriate for the separation of the desired radionuclide. Parameters which may affect the adsorption of 113Sn like tin and hydrochloric acid concentration and temperature are studied. The influence of eluent concentration and temperature and flow rate of elution on sup(113m) In separation yields are observed. The purity of eluted sup(113m) In is analysed and variation of elution yield in a generator prepared with enriched tin is studied. (Author)

  5. Ethylenediaminetetramethylene phosphate labelled with Indium-113 m (sup(113m)In-EDTMP) in bone scintigraphy

    International Nuclear Information System (INIS)

    Studies aimed at evaluating the utility of sup(113m)In-EDTMP as a bone imaging agent in regions of the world where supplies of sup(99m)Tc are difficult to ensure are reported. Preliminary studies were concerned with characterization of unlabelled EDTMP, its toxicity in rats, its labelling with sup(113m)In and the radiochemical purity of the labelled product. Dosimetric studies were carried out with the labelled product on 15 normal human volunteers after intravenous administration of the labelled material. Preliminary imaging studies were carried out on 5 normal human volunteers. Finally, clinical studies were carried out on 199 patients with various diseases involving bone. It is concluded that sup(113m)In-EDTMP is a appropriate agent to use for bone imaging where sup(99m)Tc is unavailable

  6. Cadmium in jamaican bush teas.

    Science.gov (United States)

    Hoo Fung, L A; Rattray, V R; Lalor, G C

    2014-01-01

    Samples of Jamaican plants used as bush teas were collected from households in high soil-cadmium (Cd) areas of central Jamaica and analysed by graphite furnace atomic absorption spectrophotometry for total cadmium and for cadmium extractable with a hot water brew as prepared for human consumption to determine their contribution to dietary cadmium exposure. The concentrations ranged from < 0.03 to 6.85 µg/g for total Cd, between 1 and 15% of which was extracted with a hot water brew. One cup (200 ml) of the teas examined was found to contain < 0.04-1.18 µg of Cd and would contribute 0.1-0.3 µg of Cd to a person's dietary intake. This is significantly below the provisional tolerable weekly intake (PTWI) of 7 µg Cd/kg body weight established by the World Health Organization (WHO). While this suggests that bush tea consumption does not contribute significantly to the PTWI, some of the teas examined exceed the WHO recommendation of less than 0.3 mg/kg Cd for medicinal plants. PMID:25303189

  7. Application of small diameter nozzles systems for cyclotron targets cooling

    International Nuclear Information System (INIS)

    In the present work estimating calculations of cadmium targets cooling conditions under proton beam irradiation are cited. Irradiation conditions and targets parameters are as follows: a) proton initial energy - 16 MeV, beam current - 20 μA; b) metallic cadmium layer thickness - 660 μm; target diameter - 9 mm, it squire - 0.64 cm2; c) vanadium substrate thickness, on which the cadmium layer is fixed - 200 μm; d) proton energy losses in the target - 15 MeV, heat release in the cadmium layer - 300 W, heat release on the target surface - 471 W·cm-2; e) proton energy losses in the substrate - 1 MeV, heat release in vanadium - 15 W. For the calculation the system of 7 nozzles was selected. It is noted, that cooling change by single jet of nozzle systems with small diameter provides to heat transfer coefficient increase and sharply reduces (into 3 times) water flow

  8. Deformed intruder band in 113I

    International Nuclear Information System (INIS)

    High-spin states in the neutron-deficient 113I nucleus have been investigated for the first time using the 58Ni(58Ni,3pγ) reaction. Gamma-ray coincidence data were acquired with the Eurogam spectrometer in conjunction with the Daresbury recoil mass separator. A deformed intruder band has been established extending to a spin approaching 40ℎ and excitation energy 30 MeV. A possible structure for the band is discussed. This is the first evidence for such a band in this mass region with Z>51

  9. The newly observed 113th element

    International Nuclear Information System (INIS)

    The convincing candidate event of the isotope of the 113th element, 278113, and its daughter nuclei, 274111 and 271Mt, were observed, for the first time, in the 209Bi + 70Zn reaction. The experiment was performed at RIKEN (The Institute of Physical and Chemical Research) Linear Accelerator Facility using a GAs-filled Recoil Ion Separator GARIS. The experiments to confirm the productions and decays of isotopes 265Hs(Z=108), 271Ds(Z=110), 272Rg(Z=111), and 277112(Z=112) were also done. (author)

  10. Cadmium detoxification processes in the digestive gland of cephalopods in relation to accumulated cadmium concentrations

    OpenAIRE

    Bustamante, Paco; Cosson, Richard; Gallien, Isabelle; Caurant, Florence; Miramand, Pierre

    2002-01-01

    International audience The high concentrations of cadmium recorded in the digestive gland of cephalopods from various temperate and subpolar waters suggest that these molluscs have developed efficient cadmium detoxification mechanisms. The subcellular distribution of cadmium in the digestive gland cells was investigated in seven cephalopod species from the Bay of Biscay (France) and the Faroe Islands. In most species, cadmium was mainly found in the cytosolic fraction of the digestive glan...

  11. Cadmium content of plants as affected by soil cadmium concentration

    Energy Technology Data Exchange (ETDEWEB)

    Lehoczky, E. [Pannon Univ. of Agricultural Sciences, Keszthely (Hungary); Szabados, I.; Marth, P. [Plant Health and Soil Conservation Station, Higany (Hungary)

    1996-12-31

    Pot experiments were conducted in greenhouse conditions to study the effects of increasing cadmium (Cd) levels on biomass production and Cd contents in corn, (Zea mays L.), garlic (Allium sativum L.), and spinach (Spinacia oleracea L.). Plants were grown in two soil types: Eutric cambisol soil and A gleyic luvisol soil. Spinach proved to be the most sensitive to Cd treatments as its biomass considerably decreased with the increasing Cd levels. Cadmium contents of the three crops increased with increasing levels of Cd applications. Statistical differences were observed in the Cd contents of crops depending on soil type. With the same Cd rates, Cd tissue concentration of test plants grown in the strongly acidic Gleyic luvisol soil were many times higher than that of plants grown in a neutral Eutric cambisol soil. 14 refs., 4 tabs.

  12. Cadmium-induced Cancers in Animals and in Humans

    OpenAIRE

    Huff, James; Lunn, Ruth M.; Waalkes, Michael P.; Tomatis, Lorenzo; Infante, Peter F.

    2007-01-01

    Discovered in the early 1800s, the use of cadmium and various cadmium salts started to become industrially important near the close of the 19th century, rapidly thereafter began to flourish, yet has diminished more recently. Most cadmium used in the United States is a byproduct from the smelting of zinc, lead, or copper ores, and is used to manufacture batteries. Carcinogenic activity of cadmium was discovered first in animals and only subsequently in humans. Cadmium and cadmium compounds hav...

  13. Cadmium Exposure and Pancreatic Cancer in South Louisiana

    OpenAIRE

    Luckett, Brian G.; L. Joseph Su; Rood, Jennifer C.; Elizabeth T. H. Fontham

    2012-01-01

    Cadmium has been hypothesized to be a pancreatic carcinogen. We test the hypothesis that cadmium exposure is a risk factor for pancreatic cancer with a population-based case-control study sampled from a population with persistently high rates of pancreatic cancer (south Louisiana). We tested potential dietary and nondietary sources of cadmium for their association with urinary cadmium concentrations which reflect long-term exposure to cadmium due to the accumulation of cadmium in the kidney c...

  14. Aluminium-based Coatings for Cadmium Replacement

    OpenAIRE

    Cardilli , Emanuele

    2008-01-01

    Cadmium electroplating is widely used in the aerospace industry for the corrosion protection of high strength steels. Cadmium is also used as compatible coating to reduce the galvanic corrosion generated in the assembly of components manufactured with different materials. However, environmental and safety concerns over the high toxicity of cadmium has led to the investigation of suitable replacements. Aluminium coatings are promising coatings for the replacement of electropl...

  15. Zone refining of cadmium and related characterization

    Indian Academy of Sciences (India)

    N R Munirathnam; D S Prasad; Ch Sudheer; J V Rao; T L Prakash

    2005-06-01

    We present the zone refining results of cadmium using horizontal resistive zone refiner under constant flow of moisture free hydrogen gas. The boron impurity in cadmium can be avoided using quartz (GE 214 grade) boat in lieu of high pure graphite boat. The analytical results using inductively coupled plasma optical emission spectrometry (ICPOES) show that majority of the impurities are less than the detection limits. Comparatively, zinc is the most difficult impurity element to remove in cadmium matrix by zone refining.

  16. 48 CFR 32.113 - Customary contract financing.

    Science.gov (United States)

    2010-10-01

    ... GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 32.113... contracts for supplies or services awarded under the competitive negotiation method of procurement...

  17. Cadmium induces carcinogenesis in BEAS-2B cells through ROS-dependent activation of PI3K/AKT/GSK-3β/β-catenin signaling

    Energy Technology Data Exchange (ETDEWEB)

    Son, Young-Ok; Wang, Lei; Poyil, Pratheeshkumar; Budhraja, Amit; Hitron, J. Andrew; Zhang, Zhuo [Graduate Center for Toxicology, College of Medicine, University of Kentucky, Lexington, KY (United States); Lee, Jeong-Chae [Graduate Center for Toxicology, College of Medicine, University of Kentucky, Lexington, KY (United States); School of Dentistry and Institute of Oral Biosciences (BK21 program), Research Center of Bioactive Materials, Chonbuk National University, Jeonju 561-756 (Korea, Republic of); Shi, Xianglin, E-mail: xshi5@email.uky.edu [Graduate Center for Toxicology, College of Medicine, University of Kentucky, Lexington, KY (United States)

    2012-10-15

    -dependent signaling as potential therapeutic targets in cadmium carcinogenesis.

  18. Cadmium induces carcinogenesis in BEAS-2B cells through ROS-dependent activation of PI3K/AKT/GSK-3β/β-catenin signaling

    International Nuclear Information System (INIS)

    -dependent signaling as potential therapeutic targets in cadmium carcinogenesis.

  19. Cadmium-mediated disruption of cortisol biosynthesis involves suppression of corticosteroidogenic genes in rainbow trout.

    Science.gov (United States)

    Sandhu, Navdeep; Vijayan, Mathilakath M

    2011-05-01

    Cadmium is widely distributed in the aquatic environment and is toxic to fish even at sublethal concentrations. This metal is an endocrine disruptor, and one well established role in teleosts is the suppression of adrenocorticotrophic hormone (ACTH)-stimulated cortisol biosynthesis by the interrenal tissue. However the mechanism(s) leading to this steroid suppression is poorly understood. We tested the hypothesis that cadmium targets genes encoding proteins critical for corticosteroid biosynthesis, including melanocortin 2 receptor (MC2R), steroidogenic acute regulatory protein (StAR) and cytochrome P450 side chain cleavage enzyme (P450scc), in rainbow trout (Oncorhynchus mykiss). To test this, head kidney slices (containing the interrenal tissues) were incubated in vitro with cadmium chloride (0, 10, 100 and 1000nM) for 4h either in the presence or absence of ACTH (0.5IU/mL). In the unstimulated head kidney slices, cadmium exposure did not affect basal cortisol secretion and the mRNA levels of MC2R and P450scc, while StAR gene expression was significantly reduced. Cadmium exposure significantly suppressed ACTH-stimulated cortisol production in a dose-related fashion. This cadmium-mediated suppression in corticosteroidogenesis corresponded with a significant reduction in MC2R, StAR and P450scc mRNA levels in trout head kidney slices. The inhibition of ACTH-stimulated cortisol production and suppression of genes involved in corticosteroidogenesis by cadmium were completely abolished in the presence of 8-Bromo-cAMP (a cAMP analog). Overall, cadmium disrupts the expression of genes critical for corticosteroid biosynthesis in rainbow trout head kidney slices. However, the rescue of cortisol production as well as StAR and P450scc gene expressions by cAMP analog suggests that cadmium impact occurs upstream of cAMP production. We propose that MC2R signaling, the primary step in ACTH-induced cortocosteroidogenesis, is a key target for cadmium-mediated disruption of

  20. Cadmium-mediated disruption of cortisol biosynthesis involves suppression of corticosteroidogenic genes in rainbow trout

    Energy Technology Data Exchange (ETDEWEB)

    Sandhu, Navdeep [Department of Biology, University of Waterloo, 200 University Avenue West, Waterloo, Ontario N2L 3G1 (Canada); Vijayan, Mathilakath M., E-mail: mvijayan@uwaterloo.ca [Department of Biology, University of Waterloo, 200 University Avenue West, Waterloo, Ontario N2L 3G1 (Canada)

    2011-05-15

    Cadmium is widely distributed in the aquatic environment and is toxic to fish even at sublethal concentrations. This metal is an endocrine disruptor, and one well established role in teleosts is the suppression of adrenocorticotrophic hormone (ACTH)-stimulated cortisol biosynthesis by the interrenal tissue. However the mechanism(s) leading to this steroid suppression is poorly understood. We tested the hypothesis that cadmium targets genes encoding proteins critical for corticosteroid biosynthesis, including melanocortin 2 receptor (MC2R), steroidogenic acute regulatory protein (StAR) and cytochrome P450 side chain cleavage enzyme (P450scc), in rainbow trout (Oncorhynchus mykiss). To test this, head kidney slices (containing the interrenal tissues) were incubated in vitro with cadmium chloride (0, 10, 100 and 1000 nM) for 4 h either in the presence or absence of ACTH (0.5 IU/mL). In the unstimulated head kidney slices, cadmium exposure did not affect basal cortisol secretion and the mRNA levels of MC2R and P450scc, while StAR gene expression was significantly reduced. Cadmium exposure significantly suppressed ACTH-stimulated cortisol production in a dose-related fashion. This cadmium-mediated suppression in corticosteroidogenesis corresponded with a significant reduction in MC2R, StAR and P450scc mRNA levels in trout head kidney slices. The inhibition of ACTH-stimulated cortisol production and suppression of genes involved in corticosteroidogenesis by cadmium were completely abolished in the presence of 8-Bromo-cAMP (a cAMP analog). Overall, cadmium disrupts the expression of genes critical for corticosteroid biosynthesis in rainbow trout head kidney slices. However, the rescue of cortisol production as well as StAR and P450scc gene expressions by cAMP analog suggests that cadmium impact occurs upstream of cAMP production. We propose that MC2R signaling, the primary step in ACTH-induced cortocosteroidogenesis, is a key target for cadmium-mediated disruption of

  1. Cadmium-mediated disruption of cortisol biosynthesis involves suppression of corticosteroidogenic genes in rainbow trout

    International Nuclear Information System (INIS)

    Cadmium is widely distributed in the aquatic environment and is toxic to fish even at sublethal concentrations. This metal is an endocrine disruptor, and one well established role in teleosts is the suppression of adrenocorticotrophic hormone (ACTH)-stimulated cortisol biosynthesis by the interrenal tissue. However the mechanism(s) leading to this steroid suppression is poorly understood. We tested the hypothesis that cadmium targets genes encoding proteins critical for corticosteroid biosynthesis, including melanocortin 2 receptor (MC2R), steroidogenic acute regulatory protein (StAR) and cytochrome P450 side chain cleavage enzyme (P450scc), in rainbow trout (Oncorhynchus mykiss). To test this, head kidney slices (containing the interrenal tissues) were incubated in vitro with cadmium chloride (0, 10, 100 and 1000 nM) for 4 h either in the presence or absence of ACTH (0.5 IU/mL). In the unstimulated head kidney slices, cadmium exposure did not affect basal cortisol secretion and the mRNA levels of MC2R and P450scc, while StAR gene expression was significantly reduced. Cadmium exposure significantly suppressed ACTH-stimulated cortisol production in a dose-related fashion. This cadmium-mediated suppression in corticosteroidogenesis corresponded with a significant reduction in MC2R, StAR and P450scc mRNA levels in trout head kidney slices. The inhibition of ACTH-stimulated cortisol production and suppression of genes involved in corticosteroidogenesis by cadmium were completely abolished in the presence of 8-Bromo-cAMP (a cAMP analog). Overall, cadmium disrupts the expression of genes critical for corticosteroid biosynthesis in rainbow trout head kidney slices. However, the rescue of cortisol production as well as StAR and P450scc gene expressions by cAMP analog suggests that cadmium impact occurs upstream of cAMP production. We propose that MC2R signaling, the primary step in ACTH-induced cortocosteroidogenesis, is a key target for cadmium-mediated disruption of

  2. Bioavailability of cadmium from linseed and cocoa

    OpenAIRE

    Hansen, Max; Rasmussen, Rie Romme; Sloth, Jens Jørgen

    2014-01-01

    The exposure of the European population to cadmium from food is high compared with the tolerable weekly intake of 2.5 μg/kg bodyweight set by EFSA in 2009. Only few studies on the bioavailability of cadmium from different food sources has been performed but this information in very important for the food authorities in order to give correct advises to the population. The aim of this study was to investigate the bioavailability of cadmium from whole linseed, crushed linseed, cocoa and cadmium ...

  3. Lead and cadmium in food

    International Nuclear Information System (INIS)

    The amounts of lead and cadmium produced and processed in these days are considerable. As a result, our environment is increasingly polluted by heavy metals and industrial installations, motor vehicles or incinerating plants appear to be among the main culprits here. Air and water are the media permitting the entry of heavy metals into our natural environment where they accumulate in the soil and then gradually migrate into the plants. Their further transport in the food constitutes the third step in the environmental spread of heavy metals. The consumption of muscle and organ meats, of vegetables, fruits, canned food and drinking water is unavoidably associated with some ingestion of lead and cadmium. The degree to which they are taken up and stored in different tissues is determined by absorption properties and the nutritional state of the organism. Cadmium tends to accumulate in the kidneys, lead is mainly stored in the bones. A continuously increasing uptake finally results in health injuries that range from unspecific complaints to damaged kidneys or bones and disorders of liver function. Children and elderly people are at a particular risk here. The level of food contamination is such that screening for heavy metals must be rigorously carried out once appropriate legal thresholds have been set, which ought to be based on proven detrimental effects of lead and cadmium on our health and also take account of infants and children or any other risk groups, where particular caution must be exercised. It should be pointed out that such thresholds have so far not been determined. (orig./MG)

  4. Historical perspectives on cadmium toxicology

    International Nuclear Information System (INIS)

    The first health effects of cadmium (Cd) were reported already in 1858. Respiratory and gastrointestinal symptoms occurred among persons using Cd-containing polishing agent. The first experimental toxicological studies are from 1919. Bone effects and proteinuria in humans were reported in the 1940's. After World War II, a bone disease with fractures and severe pain, the itai-itai disease, a form of Cd-induced renal osteomalacia, was identified in Japan. Subsequently, the toxicokinetics and toxicodynamics of Cd were described including its binding to the protein metallothionein. International warnings of health risks from Cd-pollution were issued in the 1970's. Reproductive and carcinogenic effects were studied at an early stage, but a quantitative assessment of these effects in humans is still subject to considerable uncertainty. The World Health Organization in its International Program on Chemical Safety, WHO/IPCS (1992) (Cadmium. Environmental Health Criteria Document 134, IPCS. WHO, Geneva, 1-280.) identified renal dysfunction as the critical effect and a crude quantitative evaluation was presented. In the 1990's and 2000 several epidemiological studies have reported adverse health effects, sometimes at low environmental exposures to Cd, in population groups in Japan, China, Europe and USA (reviewed in other contributions to the present volume). The early identification of an important role of metallothionein in cadmium toxicology formed the basis for recent studies using biomarkers of susceptibility to development of Cd-related renal dysfunction such as gene expression of metallothionein in peripheral lymphocytes and autoantibodies against metallothionein in blood plasma. Findings in these studies indicate that very low exposure levels to cadmium may give rise to renal dysfunction among sensitive subgroups of human populations such as persons with diabetes.

  5. Cadmium accumulation by Axonopus compressus (Sw.) P. Beauv and Cyperus rotundas Linn growing in cadmium solution and cadmium-zinc contaminated soil

    OpenAIRE

    Paitip Thiravetyan; Vibol Sao; Woranan Nakbanpote

    2007-01-01

    This research investigated the phyto-remediation potentials of Cyperus rotundas Linn (Nutgrass) and Axonopus compressus (Sw.) P. Beauv (Carpetgrass) for cadmium removal from cadmium solution andcadmium-zinc contaminated soil. Plants growth in the solution showed that cadmium decreased the relative growth rate of both grasses. However, the amount of cadmium accumulated in shoot and root was increasedwith the increase in cadmium concentration and exposure time. Growth in fertile soil mixed with...

  6. Improvement of cadmium phytoremediation after soil inoculation with a cadmium-resistant Micrococcus sp.

    Science.gov (United States)

    Sangthong, Chirawee; Setkit, Kunchaya; Prapagdee, Benjaphorn

    2016-01-01

    Cadmium-resistant Micrococcus sp. TISTR2221, a plant growth-promoting bacterium, has stimulatory effects on the root lengths of Zea mays L. seedlings under toxic cadmium conditions compared to uninoculated seedlings. The performance of Micrococcus sp. TISTR2221 on promoting growth and cadmium accumulation in Z. mays L. was investigated in a pot experiment. The results indicated that Micrococcus sp. TISTR2221significantly promoted the root length, shoot length, and dry biomass of Z. mays L. transplanted in both uncontaminated and cadmium-contaminated soils. Micrococcus sp. TISTR2221 significantly increased cadmium accumulation in the roots and shoots of Z. mays L. compared to uninoculated plants. At the beginning of the planting period, cadmium accumulated mainly in the shoots. With a prolonged duration of cultivation, cadmium content increased in the roots. As expected, little cadmium was found in maize grains. Soil cadmium was significantly reduced with time, and the highest percentage of cadmium removal was found in the bacterial-inoculated Z. mays L. after transplantation for 6 weeks. We conclude that Micrococcus sp. TISTR2221 is a potent bioaugmenting agent, facilitating cadmium phytoextraction in Z. mays L. PMID:26336850

  7. 9 CFR 113.66 - Anthrax Spore Vaccine-Nonencapsulated.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Anthrax Spore Vaccine-Nonencapsulated... REQUIREMENTS Live Bacterial Vaccines § 113.66 Anthrax Spore Vaccine—Nonencapsulated. Anthrax Spore Vaccine... in 9 CFR 113.64 and the requirements in this paragraph. Any serial or subserial found...

  8. 9 CFR 113.331 - Bursal Disease Vaccine.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Bursal Disease Vaccine. 113.331... Virus Vaccines § 113.331 Bursal Disease Vaccine. Bursal Disease Vaccine shall be prepared from virus...-five 1-day-old bursal disease susceptible chickens (vaccinates) shall be injected subcutaneously...

  9. 9 CFR 113.329 - Newcastle Disease Vaccine.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Newcastle Disease Vaccine. 113.329... Virus Vaccines § 113.329 Newcastle Disease Vaccine. Newcastle Disease Vaccine shall be prepared from...) Newcastle Disease susceptible chickens, all of the same age and from the same source, shall be used....

  10. Dicty_cDB: VFB113 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB113 (Link to dictyBase) - - - Contig-U16478-1 VFB113P (Link to Original ... tnsqclrwcryqrehyn*nfsyp**ctngih*tnlqe*tw*iikrss*ir skw *l*eiireth*tkr*itshqpnasfkrc*rslqsw*r*nwyrrkgihqnsh ...

  11. 9 CFR 113.302 - Distemper Vaccine-Mink.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Distemper Vaccine-Mink. 113.302... Virus Vaccines § 113.302 Distemper Vaccine—Mink. Distemper Vaccine—Mink shall be prepared from virus... follows: (1) To detect virulent canine distemper virus, each of two distemper susceptible mink or...

  12. 9 CFR 113.306 - Canine Distemper Vaccine.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Canine Distemper Vaccine. 113.306... Virus Vaccines § 113.306 Canine Distemper Vaccine. Canine Distemper Vaccine shall be prepared from virus... distemper virus, each of five canine distemper susceptible ferrets shall be injected with a sample of...

  13. 23 CFR 650.113 - Only practicable alternative finding.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Only practicable alternative finding. 650.113 Section... § 650.113 Only practicable alternative finding. (a) A proposed action which includes a significant encroachment shall not be approved unless the FHWA finds that the proposed significant encroachment is the...

  14. 9 CFR 113.120 - Salmonella Typhimurium Bacterin.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Salmonella Typhimurium Bacterin. 113... REQUIREMENTS Inactivated Bacterial Products § 113.120 Salmonella Typhimurium Bacterin. Salmonella Typhimurium Bacterin shall be prepared from a culture of Salmonella typhimurium which has been inactivated and...

  15. 9 CFR 113.310 - Bovine Rhinotracheitis Vaccine.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Bovine Rhinotracheitis Vaccine. 113... REQUIREMENTS Live Virus Vaccines § 113.310 Bovine Rhinotracheitis Vaccine. Bovine Rhinotracheitis Vaccine shall...-five infectious bovine rhinotracheitis susceptible calves shall be used as test animals (20...

  16. 9 CFR 113.309 - Bovine Parainfluenza3 Vaccine.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Bovine Parainfluenza3 Vaccine. 113.309... Virus Vaccines § 113.309 Bovine Parainfluenza3 Vaccine. Bovine Parainfluenza3 Vaccine shall be produced... virus dose from the lot of Master Seed Virus shall be established as follows: (1) Twenty-five...

  17. 14 CFR 1221.113 - Use of the NASA Flags.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Use of the NASA Flags. 1221.113 Section... Identifiers, NASA Flags, and the Agency's Unified Visual Communications System § 1221.113 Use of the NASA Flags. (a) The NASA Flag is authorized for use only as follows: (1) On or in front of NASA buildings....

  18. 9 CFR 113.38 - Guinea pig safety test.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Guinea pig safety test. 113.38 Section... Standard Procedures § 113.38 Guinea pig safety test. The guinea pig safety test provided in this section... be injected either intramuscularly or subcutaneously into each of two guinea pigs and the...

  19. 9 CFR 113.105 - Leptospira Hardjo Bacterin.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Hardjo Bacterin. 113.105... Inactivated Bacterial Products § 113.105 Leptospira Hardjo Bacterin. Leptospira Hardjo Bacterin shall be produced from a culture of Leptospira hardjo which has been inactivated and is nontoxic. Each serial...

  20. 9 CFR 113.101 - Leptospira Pomona Bacterin.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Pomona Bacterin. 113.101... Inactivated Bacterial Products § 113.101 Leptospira Pomona Bacterin. Leptospira Pomona Bacterin shall be produced from a culture of Leptospira pomona which has been inactivated and is nontoxic. Each serial...

  1. 9 CFR 113.103 - Leptospira Canicola Bacterin.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Canicola Bacterin. 113.103... Inactivated Bacterial Products § 113.103 Leptospira Canicola Bacterin. Leptospira Canicola Bacterin shall be produced from a culture of Leptospira canicola which has been inactivated and is nontoxic. Each serial...

  2. 9 CFR 113.104 - Leptospira Grippotyphosa Bacterin.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Grippotyphosa Bacterin. 113... REQUIREMENTS Inactivated Bacterial Products § 113.104 Leptospira Grippotyphosa Bacterin. Leptospira Grippotyphosa Bacterin shall be produced from a culture of Leptospira grippotyphosa which has been...

  3. 19 CFR 12.113 - Arrival of shipment.

    Science.gov (United States)

    2010-04-01

    ... excess of 30 additional days, as the port director for good cause may specially authorize. An application... 19 Customs Duties 1 2010-04-01 2010-04-01 false Arrival of shipment. 12.113 Section 12.113 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE...

  4. 9 CFR 113.317 - Parvovirus Vaccine (Canine).

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Parvovirus Vaccine (Canine). 113.317... Virus Vaccines § 113.317 Parvovirus Vaccine (Canine). Parvovirus Vaccine recommended for use in dogs... for immunogenicity. The selected virus dose shall be established as follows: (1) Twenty-five...

  5. 9 CFR 113.408 - Avian mycoplasma antigen.

    Science.gov (United States)

    2010-01-01

    ... with 9 CFR 114.8. If phenol is used, a direct titration with a standardized bromide-bromate solution... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Avian mycoplasma antigen. 113.408... Diagnostics and Reagents § 113.408 Avian mycoplasma antigen. Mycoplasma antigens shall be prepared...

  6. 9 CFR 113.328 - Fowl Laryngotracheitis Vaccine.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Fowl Laryngotracheitis Vaccine. 113... REQUIREMENTS Live Virus Vaccines § 113.328 Fowl Laryngotracheitis Vaccine. Fowl Laryngotracheitis Vaccine shall... dose to be used shall be established as follows: (1) Fowl laryngotracheitis susceptible chickens all...

  7. 9 CFR 113.330 - Marek's Disease Vaccines.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Marek's Disease Vaccines. 113.330... Virus Vaccines § 113.330 Marek's Disease Vaccines. Marek's disease vaccine shall be prepared from virus... immunogenic shall be used for preparing the production seed virus for vaccine production. (a) The Master...

  8. 9 CFR 113.315 - Feline Rhinotracheitis Vaccine.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Feline Rhinotracheitis Vaccine. 113... REQUIREMENTS Live Virus Vaccines § 113.315 Feline Rhinotracheitis Vaccine. Feline Rhinotracheitis Vaccine shall... as pure, safe, and immunogenic shall be used for preparing the production seed virus for...

  9. 9 CFR 113.301 - Ovine Ecthyma Vaccine.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Ovine Ecthyma Vaccine. 113.301 Section... Virus Vaccines § 113.301 Ovine Ecthyma Vaccine. Ovine Ecthyma Vaccine shall be prepared from tissue... inoculation with virulent ovine ecthyma virus. Ovine Ecthyma Vaccine is exempt from the...

  10. 9 CFR 113.314 - Feline Calicivirus Vaccine.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Feline Calicivirus Vaccine. 113.314... Virus Vaccines § 113.314 Feline Calicivirus Vaccine. Feline Calicivirus Vaccine shall be prepared from... immunogenic shall be used for preparing the production seed virus for vaccine production. All serials...

  11. 9 CFR 113.304 - Feline Panleukopenia Vaccine.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Feline Panleukopenia Vaccine. 113.304... Virus Vaccines § 113.304 Feline Panleukopenia Vaccine. Feline Panleukopenia Vaccine shall be prepared..., and immunogenic shall be used for preparing the production seed virus for vaccine production....

  12. 9 CFR 113.325 - Avian Encephalomyelitis Vaccine.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Avian Encephalomyelitis Vaccine. 113... REQUIREMENTS Live Virus Vaccines § 113.325 Avian Encephalomyelitis Vaccine. Avian Encephalomyelitis Vaccine... vaccine production. All serials shall be prepared from the first through the fifth passage from the...

  13. 9 CFR 113.206 - Wart Vaccine, Killed Virus.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Wart Vaccine, Killed Virus. 113.206... AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.206 Wart Vaccine, Killed Virus. Wart Vaccine, Killed Virus, shall be...

  14. 9 CFR 113.312 - Rabies Vaccine, Live Virus.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Rabies Vaccine, Live Virus. 113.312... AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Live Virus Vaccines § 113.312 Rabies Vaccine, Live Virus. Rabies Vaccine shall be prepared from...

  15. 9 CFR 113.311 - Bovine Virus Diarrhea Vaccine.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Bovine Virus Diarrhea Vaccine. 113.311... Virus Vaccines § 113.311 Bovine Virus Diarrhea Vaccine. Bovine Virus Diarrhea Vaccine shall be prepared... virus diarrhea susceptible calves shall be used as test animals (20 vaccinates and five controls)....

  16. 41 CFR 109-40.113 - Insurance against transportation hazards.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Insurance against transportation hazards. 109-40.113 Section 109-40.113 Public Contracts and Property Management Federal Property... property while in the possession of commercial carriers is set forth in 41 CFR 1-19.107....

  17. 20 CFR 703.113 - Marine insurance contracts.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Marine insurance contracts. 703.113 Section... AND HARBOR WORKERS' COMPENSATION ACT AND RELATED STATUTES INSURANCE REGULATIONS Authorization of Insurance Carriers § 703.113 Marine insurance contracts. A longshoremen's policy, or the...

  18. Oral cadmium chloride intoxication in mice

    DEFF Research Database (Denmark)

    Andersen, O; Nielsen, J B; Svendsen, P

    1988-01-01

    Diethyldithiocarbamate (DDC) is known to alleviate acute toxicity due to injection of cadmium salts. However, when cadmium chloride was administered by the oral route, DDC enhanced rather than alleviated the acute toxicity; both oral and intraperitoneal (i.p.) administration of DDC had this effec...

  19. Cadmium Modulates Biofilm Formation by Staphylococcus epidermidis

    NARCIS (Netherlands)

    Wu, Xueqing; Santos, Regiane R.; Fink-Gremmels, Johanna

    2015-01-01

    The aim of the study was to evaluate the effect of cadmium exposure on Staphylococcus epidermidis (ATCC 35984) biofilm formation. Bacteria were cultured in the absence or presence of different concentrations (0-50 mu M) of cadmium. Biofilm formation and bacterial viability were assessed. Quantitativ

  20. Cadmium Toxicity to Ringed Seals (Phoca hispida)

    DEFF Research Database (Denmark)

    Sonne, Christian; Dietz, R.; Riget, F. F.;

    Cadmium concentrations in kidneys from ringed seals (Phoca hispida) from North West Greenland (Qaanaaq) are high. Concentrations range at level known to induce renal toxic effects (mainly tubulopathy) and demineralisation (osteopenia) of the skeletal system (Fanconi's Syndrome) in humans as well...... the absence of toxic effects of cadmium in ringed seal...

  1. Electrodialytic Removal of Cadmium from Straw Ash

    DEFF Research Database (Denmark)

    Hansen, Henrik; Ottosen, Lisbeth M.; Villumsen, Arne;

    1999-01-01

    A problem with flyash from straw and wood combustion is the high level of heavy metals, especially cadmium. Two electrodialytic remediation experiments were carried out on cadmium polluted flyash from straw combustion. The flyash could be cleaned to 1/3 of its initial level after 24 days of...

  2. New result in the production and decay of an isotope, 278113, of the 113th element

    International Nuclear Information System (INIS)

    An isotope of the 113th element, i.e., 278113, was produced in a nuclear reaction with a 70Zn beam on a 209Bi target. We observed six consecutive α-decays following the implantation of a heavy particle in nearly the same position in the semiconductor detector under an extremely low background condition. The fifth and sixth decays are fully consistent with the sequential decays of 262Db and 258Lr in both decay energies and decay times. This indicates that the present decay chain consisted of 278113, 274Rg (Z=111), 270Mt (Z=109), 266Bh (Z=107), 262Db (Z=105), and 258Lr (Z=103) with firm connections. This result, together with previously reported results from 2004 and 2007, conclusively leads to the unambiguous production and identification of the isotope 278113 of the 113th element. (author)

  3. Development of cadmium/silver/palladium separation by ion chromatography with quadrupole inductively coupled plasma mass spectrometry detection for off-line cadmium isotopic measurements

    International Nuclear Information System (INIS)

    A separation method was investigated to perform off-line cadmium isotopic measurements on a 109Ag transmutation target. Ion chromatography (IC) with Q ICPMS detection (quadrupole inductively coupled plasma mass spectrometry detection) was chosen to separate cadmium from the isobarically interfering elements, silver and palladium, present in the sample. The optimization of chromatographic conditions was particularly studied. Several anion and cation columns (Dionex AG11 (R), CS10 (R) and CS12 (R)) were compared with different mobile phases (HNO3, HCl). The separation procedure was achieved with a carboxylate-functionalized cation exchange CS12 column using 0.5 M HNO3 as eluent. The developed technique yielded satisfactory results in terms of separation factors (greater than 5) and provides an efficient solution to obtain rapidly purified cadmium fractions (decontamination factors higher 100,000 for silver and palladium) which can directly be analyzed by multi collection inductively coupled plasma mass spectrometry (MC ICPMS). By applying the proposed procedure, accurate and precise cadmium isotope ratios were determined for the irradiated 109Ag transmutation target. (authors)

  4. Cadmium(II) N-acetylcysteine complex formation in aqueous solution.

    Science.gov (United States)

    Jalilehvand, Farideh; Amini, Zahra; Parmar, Karnjit; Kang, Eun Young

    2011-12-21

    The complex formation between Cd(II) ions and N-acetylcysteine (H(2)NAC) in aqueous solution was investigated using Cd K- and L(3)-edge X-ray absorption and (113)Cd NMR spectroscopic techniques. Two series of 0.1 M Cd(II) solutions with the total N-acetylcysteine concentration c(H2NAC) varied between 0.2-2 M were studied at pH 7.5 and 11.0, respectively. At pH = 11 a novel mononuclear [Cd(NAC)(4)](6-) complex with the average Cd-S distance 2.53(2) Å and the chemical shift δ((113)Cd) = 677 ppm was found to dominate at a concentration of the free deprotonated ligand [NAC(2-)] > 0.1 M, consistent with our previous reports on cadmium tetrathiolate complex formation with cysteine and glutathione. At pH 7.5 much higher ligand excess ([HNAC(-)] > 0.6 M) is required to make this tetrathiolate complex the major species. The (113)Cd NMR spectrum of a solution containing c(Cd(II)) = 0.5 M and c(H2NAC) = 1.0 M measured at 288 K showed three broad signals at 421, 583 and 642 ppm, which can be attributed to CdS(3)O(3), CdS(3)O and CdS(4) coordination sites, respectively, in oligomeric Cd(II)-NAC species with single thiolate bridges between the cadmium ions. PMID:22012146

  5. Molecular and cellular mechanisms of cadmium carcinogenesis

    International Nuclear Information System (INIS)

    Cadmium is a heavy metal, which is widely used in industry, affecting human health through occupational and environmental exposure. In mammals, it exerts multiple toxic effects and has been classified as a human carcinogen by the International Agency for Research on Cancer. Cadmium affects cell proliferation, differentiation, apoptosis and other cellular activities. Cd2+ does not catalyze Fenton-type reactions because it does not accept or donate electrons under physiological conditions, and it is only weakly genotoxic. Hence, indirect mechanisms are implicated in the carcinogenicity of cadmium. In this review multiple mechanisms are discussed, such as modulation of gene expression and signal transduction, interference with enzymes of the cellular antioxidant system and generation of reactive oxygen species (ROS), inhibition of DNA repair and DNA methylation, role in apoptosis and disruption of E-cadherin-mediated cell-cell adhesion. Cadmium affects both gene transcription and translation. The major mechanisms of gene induction by cadmium known so far are modulation of cellular signal transduction pathways by enhancement of protein phosphorylation and activation of transcription and translation factors. Cadmium interferes with antioxidant defense mechanisms and stimulates the production of reactive oxygen species, which may act as signaling molecules in the induction of gene expression and apoptosis. The inhibition of DNA repair processes by cadmium represents a mechanism by which cadmium enhances the genotoxicity of other agents and may contribute to the tumor initiation by this metal. The disruption of E-cadherin-mediated cell-cell adhesion by cadmium probably further stimulates the development of tumors. It becomes clear that there exist multiple mechanisms which contribute to the carcinogenicity of cadmium, although the relative weights of these contributions are difficult to estimate

  6. Cadmium blood concentrations in relation to nutrition.

    Science.gov (United States)

    Krajcovicová-Kudládková, Marica; Ursínyová, Monika; Masánová, Vlasta; Béderová, Alzbeta; Valachovicová, Martina

    2006-09-01

    Cadmium is a toxic element ubiquitous in the environment, which damages biological systems in various ways. The major source of cadmium exposure is food. High cadmium content in the soil leads to high cadmium concentrations in certain plants such as grains (above all surface layers and germs), oil or non-oil seeds, fruit and vegetables. These food commodities are the crucial components of a vegetarian nutrition. Blood cadmium concentrations were measured in two non-smoking population groups: the vegetarian group (n = 80) and the non-vegetarian (control) group of general population on traditional mixed diet (n = 84). The significantly higher blood cadmium content (1.78 +/- 0.22 vs. 0.45 +/- 0.04 microg/l) was measured in vegetarian group. Healthy risk values > 5 microg/l were found in 6 vegetarians vs. no non-vegetarian. The highest cadmium concentration (3.15 +/- 0.77 microg/l) was measured in vegan subgroup (plant food only, n = 10) and that value decreased with increasing animal food consumption (1.75 +/- 0.36 microg/l, lactovegetarian and lactoovovegetarian subgroup/added dairy products and eggs, n = 41/, 1.34 +/- 0.21 microg/I, semivegetarian subgroup /as a previous subgroup and added white meat, n = 291). Risk vegetarians vs. non-risk vegetarians consume significantly higher amounts of whole grain products, grain sprouts and oil seeds. Blood cadmium content is directly influenced by age (r = 0.32, p vegetarianism (r = 0.5, p Vegetarians have significantly higher plasma concentrations of natural antioxidants. The sufficient antioxidative protection against cadmium induced free radical formation in vegetarians may inhibit the harmful effects of greater cadmium intake from plant food. PMID:17152224

  7. Concurrent reduction and distillation: an improved technique for the recovery and chemical refinement of the isotopes of cadmium and zinc

    International Nuclear Information System (INIS)

    The Electromagnetic Isotope Separations Program of the Oak Ridge National Laboratory has been involved in the separation, chemical recovery, and refinement of the stable isotopes of cadmium and zinc since 1946. Traditionally, the chemical refinement procedures for these elements consisted of ion exchange separations using anion exchange resins followed by pH-controlled hydrogen sulfide precipitations. The procedures were quite time-consuming and made it difficult to remove trace quantities of sulfur which interferes in subsequent attempts to prepare rolled metal foils. As demands for 113Cd and 68Zn (a precursor for the production of the radiopharmaceutical 67Ga) increased, it became evident that a quicker, more efficient refinement procedure was needed. Details of an improved method, which employs concurrent hydrogen reduction and distillation in the recovery and refinement of isotopically enriched zinc, are described. Modifications of the procedure suitable for the refinement of cadmium isotopes are also described. 3 figures, 1 table

  8. The role of microRNAs in copper and cadmium homeostasis

    International Nuclear Information System (INIS)

    Essential heavy metals (e.g., copper) and non-essential metals (e.g., cadmium) are both toxic to plants at high concentrations. Recently, microRNAs (miRNAs) have emerged as important modulators of plants adaptive response to heavy metal stress. Plant miRNAs negatively regulate target mRNAs by post-transcriptional cleavage. miR398 regulates copper homeostasis via down-regulating the expression of Cu,Zn-superoxide dismutase (CSD), a scavenger of superoxide radicals. miR393 and miR171 play an important role in cadmium stress mediation. This review focuses on the recent advance in the involvement of miRNAs in copper and cadmium stress regulatory networks in plants.

  9. Response of Saccharomyces cerevisiae to cadmium stress

    Energy Technology Data Exchange (ETDEWEB)

    Moreira, Luciana Mara Costa; Ribeiro, Frederico Haddad; Neves, Maria Jose [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil). Lab. de Radiobiologia], e-mail: luamatu@uol.com.br; Porto, Barbara Abranches Araujo; Amaral, Angela M.; Menezes, Maria Angela B.C. [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil). Lab. de Ativacao Neutronica], e-mail: menezes@cdtn.br; Rosa, Carlos Augusto [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil). Dept. de Microbiologia], e-mail: carlrosa@icb.ufmg

    2009-07-01

    The intensification of industrial activity has been greatly contributing with the increase of heavy metals in the environment. Among these heavy metals, cadmium becomes a serious pervasive environmental pollutant. The cadmium is a heavy metal with no biological function, very toxic and carcinogenic at low concentrations. The toxicity of cadmium and several other metals can be mainly attributed to the multiplicity of coordination complexes and clusters that they can form. Some aspects of the cellular response to cadmium were extensively investigated in the yeast Saccharomyces cerevisiae. The primary site of interaction between many toxic metals and microbial cells is the plasma membrane. Plasma-membrane permeabilisation has been reported in a variety of microorganisms following cadmium exposure, and is considered one mechanism of cadmium toxicity in the yeast. In this work, using the yeast strain S. cerevisiae W303-WT, we have investigated the relationships between Cd uptake and release of cellular metal ions (K{sup +} and Na{sup +}) using neutron activation technique. The neutron activation was an easy, rapid and suitable technique for doing these metal determinations on yeast cells; was observed the change in morphology of the strains during the process of Cd accumulation, these alterations were observed by Transmission Electron Microscopy (TEM) and Scanning Electron Microscopy (SEM) during incorporation of cadmium. (author)

  10. Cadmium - a complex environmental problem. Part II. Cadmium in sludges used as fertilizer

    Energy Technology Data Exchange (ETDEWEB)

    Davis, R.D.

    1984-02-15

    Utilisation of sewage sludge as a fertilizer is the most economic disposal route for inland sewage-treatment works. Much of the cadmium in wastewater is concentrated into sludge. It is impracticable to reduce cadmium concentrations in sludge below certain levels. Cadmium is a principal factor limiting the use of sludge on land. Investigations are described which have attempted to identify and to determine the availability of forms of cadmium in soil. There is considerable research interest in cadmium in soil solution which is likely to be directly available for crop uptake. Another area of interest is the apparent disappearance of cadmium from sludge-treated soil. Soil analysis often cannot fully account for the cadmium added in sludge. Apart from the effect of soil conditions, especially pH value, crop uptake varies according to the particular crop examined. Highest concentrations of cadmium occur in tobacco, lettuce, spinach and other leafy vegetables. Using crop uptake data from field trials it is possible to relate potential human dietary intake of cadmium, on which hazard depends, to soil concentrations of cadmium, which can be controlled by regulating applications of sludge. This provides an objective basis for limits for cadmium concentrations in soils receiving sludge. Transfer of cadmium via farm animals to meat and dairy products for human consumption is thought to be minimal, even allowing for some direct ingestion of sludge-treated soil by the animals. Evidence from these and other investigations suggests that a loading rate limit of 5 kg Cd/ha (equivalent to a soil concentration of about 3.5 mg Cd/kg) affords adequate protection to the foodchain where sludge is used on agricultural land.

  11. Multisite Kinetic Modeling of 13C Metabolic MR Using [1-13C]Pyruvate

    International Nuclear Information System (INIS)

    Hyperpolarized 13C imaging allows real-time in vivo measurements of metabolite levels. Quantification of metabolite conversion between [1-13C]pyruvate and downstream metabolites [1-13C]alanine, [1-13C]lactate, and [13C]bicarbonate can be achieved through kinetic modeling. Since pyruvate interacts dynamically and simultaneously with its downstream metabolites, the purpose of this work is the determination of parameter values through a multisite, dynamic model involving possible biochemical pathways present in MR spectroscopy. Kinetic modeling parameters were determined by fitting the multisite model to time-domain dynamic metabolite data. The results for different pyruvate doses were compared with those of different two-site models to evaluate the hypothesis that for identical data the uncertainty of a model and the signal-to-noise ratio determine the sensitivity in detecting small physiological differences in the target metabolism. In comparison to the two-site exchange models, the multisite model yielded metabolic conversion rates with smaller bias and smaller standard deviation, as demonstrated in simulations with different signal-to-noise ratio. Pyruvate dose effects observed previously were confirmed and quantified through metabolic conversion rate values. Parameter interdependency allowed an accurate quantification and can therefore be useful for monitoring metabolic activity in different tissues

  12. Multisite Kinetic Modeling of 13C Metabolic MR Using [1-13C]Pyruvate

    Directory of Open Access Journals (Sweden)

    Pedro A. Gómez Damián

    2014-01-01

    Full Text Available Hyperpolarized 13C imaging allows real-time in vivo measurements of metabolite levels. Quantification of metabolite conversion between [1-13C]pyruvate and downstream metabolites [1-13C]alanine, [1-13C]lactate, and [13C]bicarbonate can be achieved through kinetic modeling. Since pyruvate interacts dynamically and simultaneously with its downstream metabolites, the purpose of this work is the determination of parameter values through a multisite, dynamic model involving possible biochemical pathways present in MR spectroscopy. Kinetic modeling parameters were determined by fitting the multisite model to time-domain dynamic metabolite data. The results for different pyruvate doses were compared with those of different two-site models to evaluate the hypothesis that for identical data the uncertainty of a model and the signal-to-noise ratio determine the sensitivity in detecting small physiological differences in the target metabolism. In comparison to the two-site exchange models, the multisite model yielded metabolic conversion rates with smaller bias and smaller standard deviation, as demonstrated in simulations with different signal-to-noise ratio. Pyruvate dose effects observed previously were confirmed and quantified through metabolic conversion rate values. Parameter interdependency allowed an accurate quantification and can therefore be useful for monitoring metabolic activity in different tissues.

  13. Effect of iron upon cadmium-manganese and cadmium-iron interaction

    International Nuclear Information System (INIS)

    Increase cadmium production has enhanced the potential danger of this toxic metal including its effect upon the metabolism of some essential elements as, for instance, manganese of some essential elements as, for instance, manganese and iron. Relevant data about the cadmium-manganese interaction are rather scanty. Since there are more data of the effect of iron on the metabolism of either of these ions independently. The authors decided to investigate how the presence of iron affected the interaction between cadmium and manganese and how cadmium alone or in combination with the additional iron affected iron transfer and retention in the intestinal wall

  14. Long-term stability of underground operated CZT detectors based on the analysis of intrinsic 113Cd β--decay

    Science.gov (United States)

    Ebert, J.; Gößling, C.; Gehre, D.; Hagner, C.; Heidrich, N.; Klingenberg, R.; Kröninger, K.; Nitsch, C.; Oldorf, C.; Quante, T.; Rajek, S.; Rebber, H.; Rohatsch, K.; Tebrügge, J.; Temminghoff, R.; Theinert, R.; Timm, J.; Wonsak, B.; Zatschler, S.; Zuber, K.

    2016-06-01

    The COBRA collaboration operates a demonstrator setup at the underground facility Laboratori Nazionali del Gran Sasso (LNGS, located in Italy) to prove the technological capabilities of this concept for the search for neutrinoless double beta-decay. The setup consists of 64 (1×1×1) cm3 Cadmium-Zinc-Telluride (CZT) detectors in Coplanar-Grid (CPG) configuration. One purpose of this demonstrator is to test if reliable long-term operation of CZT-CPG detectors in such a setup is possible. The demonstrator has been operated under ultra low-background conditions for more than three years and collected data corresponding to a total exposure of 218 kg days. The presented study focuses on the long-term stability of CZT detectors by analyzing the intrinsic, fourfold forbidden non-unique 113Cd single beta-decay. It can be shown that CZT detectors can be operated stably for long periods of time and that the 113Cd single beta-decay can be used as an internal monitor of the detector performance during the runtime of the experiment.

  15. 23 CFR 230.113 - Implementation of supportive services.

    Science.gov (United States)

    2010-04-01

    ... 230.113 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION CIVIL RIGHTS EXTERNAL PROGRAMS Equal Employment Opportunity on Federal and Federal-Aid Construction Contracts (Including... construction contractors, subcontractors, and trainees, for recruiting, counseling, remedial...

  16. Tripolyphosphates of potassium-cadmium and ammonium-cadmium

    International Nuclear Information System (INIS)

    Formation of barely soluble compounds during interaction of ammonium and potassium tripolyphosphates with cadmium nitrate in aqueous solutions (0.1-2.0 mol% concentration, the temperature 20 deg C), is investigated. KCd2P3O10x7H2O, NH4Cd2P3O10x7H2O crystallohydrates and Cd5(P3O10)2xhH2O (x=10-13) X-ray amorphous salt, that are dissolved in potassium and ammonium tripolyphosphate solution with formation of Cd2+:P3O105-=1:1 and 1:2 complexes, are separated. In K5P3O10-Cd(NO3)2-H2O system Cd2+:P3O105-=1:1 complex is crystallized in a mixture with varied composition amorphous phase

  17. 40 CFR 86.113-07 - Fuel specifications.

    Science.gov (United States)

    2010-07-01

    ... Heavy-Duty Vehicles; Test Procedures § 86.113-07 Fuel specifications. Section 86.113-07 includes text... ASTM test method No. Type 2-D (i) Cetane Number D613 40-50 (ii) Cetane Index D976 40-50 (iii...) (293.3-332.2) (E) EP °F D86 610-690 ( °C) (321.1-365.6) (iv) Gravity °API D287 32-37 (v) Total...

  18. Genome Sequence of the Biocontrol Strain Pseudomonas fluorescens F113

    OpenAIRE

    Redondo-Nieto, M.; M. Barret; Morrisey, J; Germaine, K.; Martínez-Granero, F.; Barahona, E.; Navazo, A.; Sánchez-Contreras, M.; Moynihan, J.; Giddens, S.; Coppoolse, E.; Muriel, C.; Stiekema, W.; Rainey, P; Dowling, D

    2012-01-01

    Pseudomonas fluorescens F113 is a plant growth-promoting rhizobacterium (PGPR) that has biocontrol activity against fungal plant pathogens and is a model for rhizosphere colonization. Here, we present its complete genome sequence, which shows that besides a core genome very similar to those of other strains sequenced within this species, F113 possesses a wide array of genes encoding specialized functions for thriving in the rhizosphere and interacting with eukaryotic organisms.

  19. Tissue-specific accumulation of cadmium in subcellular compartments of eastern oysters Crassostrea virginica Gmelin (Bivalvia: Ostreidae)

    International Nuclear Information System (INIS)

    Cadmium distribution was studied in different subcellular fractions of gill and hepatopancreas tissues of eastern oysters Crassostrea virginica. Oysters were exposed for up to 21 days to low sublethal Cd concentrations (25 μg L-1). Gill and hepatopancreas tissues were sampled and divided into organelle fractions and cytosol by differential centrifugation. Organelle content of different fractions was verified by activities of marker enzymes, citrate synthase and acid phosphatase for mitochondria and lysosomes, respectively. In both tissue types, there was a significant accumulation of cadmium in cytosol reaching 230-350 ng mg-1 protein. Among organelles, mitochondria were the main target for Cd bioaccumulation in gills (250-300 ng mg-1 protein), whereas in hepatopancreas tissues, the highest cadmium accumulation occurred in lysosomes (90-94 ng mg-1 protein). Although 75-83% of total cadmium burden was associated with the cytosol reflecting high volume fraction of this compartment, Cd concentrations in organelle fractions reached levels that could cause dysfunction of mitochondria and lysosomes. Organ- and organelle-specific patterns of cadmium bioaccumulation support our previous in vivo studies, which showed adverse effects of cadmium exposures on mitochondrial oxidation in gills and on the lysosomal system of hepatopancreas. This may have important implications for the development of biomarkers of effect for heavy metals and for understanding the mechanisms of toxic effects of metals

  20. Market for nickel-cadmium batteries

    Science.gov (United States)

    Putois, F.

    Besides the lead/acid battery market, which has seen a tremendous development linked with the car industry, the alkaline rechargeable battery market has also been expanded for more than twenty years, especially in the field of portable applications with nickel-cadmium batteries. Today, nickel-cadmium batteries have to face newcomers on the market, such as nickel-metal hydride, which is another alkaline couple, and rechargeable lithium batteries; these new battery systems have better performances in some areas. This work illustrates the status of the market for nickel-cadmium batteries and their applications. Also, for two major applications—the cordless tool and the electric vehicles—the competitive situation of nickel-cadmium batteries; facing new systems such as nickel-metal hydride and lithium ion cells are discussed.

  1. External costs of cadmium emissions to soil

    DEFF Research Database (Denmark)

    Pizzol, Massimo; Smart, James C. R.; Thomsen, Marianne

    2014-01-01

    concentration to be calculated for each scenario. Human exposure was determined based on soil-crop bioconcentration factors for cadmium and dietary intake rates of Danish food crops. Updated dose-response functions linking lifetime cadmium intake to the probability of developing cadmium-induced renal disease...... and osteoporosis were applied. These impacts were converted into monetary values by using the EU standard value of a life-year adjusted for quality of life experience. Annualized cost per unit of phosphorus and cadmium are presented, discounted and undiscounted, for comparison. Application of struvite (magnesium...... ammonium phosphate) and mineral fertilizer produced the lowest external health costs, followed by the fertilizer products wastewater sludge and pig manure. The external cost estimates produced in this study could be used to design economic policy instruments to encourage use of cleaner fertilizer products....

  2. Soybean phytoremediation of cadmium polluted agricultural soils

    OpenAIRE

    Mihajlov, Ljupco; Zajkova-Paneva, Vesna; Balabanova, Biljana

    2015-01-01

    Soil pollution with cadmium is a result of the strengthened industrial development, especially in the areas of drilling, exploitation and processing of mineral raw materials. On the territory of the Republic of Macedonia there are several areas with significant higher content of cadmium in the soil, including the vicinity of the mine lead and zinc “Zletovo” near the town of Probištip. Phytoremediation is one of the most convenient techniques for remediation of heavy metals from conta...

  3. Cadmium poisoning. Knowledge of the risk

    International Nuclear Information System (INIS)

    This data sheet provides an up-to-date summary of information on cadmium poisoning. The following points are examined: - the problem of increasing pollution of soil, water and the food chain; - physical and chemical properties, manufacture, industrial applications; - the toxic action of cadmium and its derivatives; - methods and apparatus for taking and analysis samples from the atmosphere and from body fluids; - existing French regulations; - technical control and medical surveillance

  4. Cathodoluminescence of cadmium diphosphide crystals

    International Nuclear Information System (INIS)

    An investigation is made of the cathodoluminescence spectra of CdP2 crystals in the temperature range 6 to 300 K. A pulsing beam of high energy electrons (40 kV) is used in the experiment. The samples investigated are undoped, heat annealed in vacuum or saturated vapours of cadmium, and also doped with As and Bi, elements isoelectronic to phosphorus. The experimental results show that the fine structure present in the higher energywing (2.02 to 2.14 eV) depends on the concentration of the uncontrolled nitrogen impurity in CdP2. Atoms of nitrogen give rise to exciton-impurity complexes, leading to intense narrow peaks in the spectrum of cathodoluminescence. Their location and nature are shown in a table. (author)

  5. Cadmium zinc telluride spectral modeling

    International Nuclear Information System (INIS)

    Cadmium zinc telluride (CZT) detectors are the highest resolution room temperature gamma-ray detectors available for isotopic analysis. As with germanium detectors, accurate isotopic analysis using spectra requires peak deconvolution. The CZT peak shapes are asymmetric, with a long low energy tail. The asymmetry is a result of the physics of the electron/hole transport in the semiconductor. An accurate model of the physics of the electron/hole transport through an electric field will allow the parameterization of the peak shapes as a function of energy. In turn this leads to the ability to perform accurate spectral deconvolution and therefore accurate isotopic analysis. The model and the peak-shape parameterization as a function of energy will be presented

  6. Effect of dietary zinc deficiency on the accumulation of cadmium and metallothionein in selected tissues of the rat

    Energy Technology Data Exchange (ETDEWEB)

    Waalkes, M.P.

    1986-01-01

    The effect of continuous dietary zinc deficiency on the metabolism of the toxic heavy metal cadmium has not been widely studied. This investigation was designed to assess the effects of subadequate dietary zinc intake on the accumulation of dietary cadmium and on metallothionein (MT) and zinc concentrations in target organs of cadmium toxicity. Adult male Wistar rats (180-200 g) were allowed, ad libitum, diets either adequate (60 ppm) or deficient (7 ppm) in zinc for a total of 9 wk. The zinc-deficient diet resulted in an approximately 40% reduction in plasma zinc (assessed at 3, 6, and 9 wk) in the absence of overt signs of zinc deficiency (i.e., reduced weight gain, alopecia, etc.). Separate groups of rats were also maintained on zinc-defined diets for a total of 9 wk, but cadmium was added to the diet (0, 12.5, 25, 50, 100, and 200 ppm) a the end of wk 3 and maintained at that level throughout the remaining 6 wk of the study, when the rats were killed. The feeding of the zinc-deficient diet markedly enhanced the accumulation of cadmium in the liver, kidney, and testes. Hepatic, renal, and testicular zinc concentrations were not affected by suboptimal zinc intake alone. However, marked reductions in renal and testicular zinc concentrations were caused by zinc deficiency in concert with cadmium exposure. MT levels, when related to tissue cadmium concentrations, were elevated to a significantly lesser extent in the kidneys of zinc-deficient animals. These results indicate that marginal zinc deficiency markedly increases cadmium accumulation in various organs and reduces zinc content and MT induction in some organs.

  7. Cadmium leaching from thermal treated and gamma irradiated Mexican aluminosilicates

    International Nuclear Information System (INIS)

    Thermal and radiation effects on the leaching of cadmium from two cadmium exchanged zeolitic tuffs and one clay were determined. The cadmium exchanged aluminosilicates were heated at different temperatures (500, 700, 900 and 1100 oC), and the materials were then treated with NaCl (1 M and 5 M) and HNO3 (0.001 M and 1 M) solutions to determine the leaching behaviour of cadmium from the materials. The stability of cadmium in the materials increased as the heating temperature was increased. Cadmium leaching from gamma irradiated and heated materials at 1100 oC was higher than leaching from non-irradiated samples

  8. Cadmium affects retinogenesis during zebrafish embryonic development

    International Nuclear Information System (INIS)

    Ocular malformations are commonly observed in embryos of aquatic species after exposure to toxicants. Using zebrafish embryos as the model organism, we showed that cadmium exposure from sphere stage (4 hpf) to end of segmentation stage (24 hpf) induced microphthalmia in cadmium-treated embryos. Embryos with eye defects were then assessed for visual abilities. Cadmium-exposed embryos were behaviorally blind, showing hyperpigmentation and loss of camouflage response to light. We investigated the cellular basis of the formation of the small eyes phenotype and the induction of blindness by studying retina development and retinotectal projections. Retinal progenitors were found in cadmium-treated embryos albeit in smaller numbers. The number of retinal ganglion cells (RGC), the first class of retinal cells to differentiate during retinogenesis, was reduced, while photoreceptor cells, the last batch of retinal neurons to differentiate, were absent. Cadmium also affected the propagation of neurons in neurogenic waves. The neurons remained in the ventronasal area and failed to spread across the retina. Drastically reduced RGC axons and disrupted optic stalk showed that the optic nerves did not extend from the retina beyond the chiasm into the tectum. Our data suggested that impairment in neuronal differentiation of the retina, disruption in RGC axon formation and absence of cone photoreceptors were the causes of microphthalmia and visual impairment in cadmium-treated embryos

  9. Application of multiwalled carbon nanotubes treated by potassium permanganate for determination of trace cadmium prior to flame atomic absorption spectrometry

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    In this study we investigated the enrichment ability of oxidized multiwalled carbon nanotubes (MWCNTs) and established a new method for the determination of trace cadmium in environment with flame atomic absorption spectrometry. The MWCNTs were oxidized by potassium permanganate under appropriate conditions before use as preconcentration packing. Parameters influencing the recoveries of target analytes were optimized. Under optimal conditions, the target analyte exhibited a good linearity (R2=0.9992)over the concentration range 0.5-50 ng/ml. The detection limit and precision of the proposed method were 0.15 ng/ml and 2.06%,respectively. The proposed method was applied to the determination of cadmium in real-world environmental samples and the recoveries were in the range of 91.3%-108.0%. All these experimental results indicated that this new procedure could be applied to the determination of trace cadmium in environmental waters.

  10. Cadmium removal by Lemna minor and Spirodela polyrhiza.

    Science.gov (United States)

    Chaudhuri, Devaleena; Majumder, Arunabha; Misra, Amal K; Bandyopadhyay, Kaushik

    2014-01-01

    The present study investigates the ability of two genus of duckweed (Lemna minor and Spirodela polyrhiza) to phytoremediate cadmium from aqueous solution. Duckweed was exposed to six different cadmium concentrations, such as, 0.5,1.0,1.5, 2.0, 2.5, and 3.0 mg/L and the experiment was continued for 22 days. Water samples were collected periodically for estimation of residual cadmium content in aqueous solution. At the end of treatment period plant samples were collected and accumulated cadmium content was measured. Cadmium toxicity was observed through relative growth factor and changes in chlorophyll content Experimental results showed that Lemna minor and Spirodela polyrhiza were capable of removing 42-78% and 52-75% cadmium from media depending upon initial cadmium concentrations. Cadmium was removed following pseudo second order kinetic model Maximum cadmium accumulation in Lemna minor was 4734.56 mg/kg at 2 mg/L initial cadmium concentration and 7711.00 mg/kg in Spirodela polyrhiza at 3 mg/L initial cadmium concentration at the end of treatment period. Conversely in both cases maximum bioconcentration factor obtained at lowest initial cadmium concentrations, i.e., 0.5 mg/L, were 3295.61 and 4752.00 for Lemna minor and Spirodela polyrhiza respectively. The present study revealed that both Lemna minor and Spirodela polyrhiza was potential cadmium accumulator. PMID:24933906

  11. Effects of cadmium on nickel electrodes in nickel-cadmium cells

    International Nuclear Information System (INIS)

    Nickel cadmium battery cells containing nicel electrodes that are not treated with cadmium during the manufacturing process have a history of performance variability and capacity problems in various cell test programs. In this work cadmium additions to the nickel electrode are examined to determine the effects on the fundamental electrochemical processes occurring at this electrode. The results indicate that cadmium treatments improve recharge efficiency by increasing the potential required for oxygen evolution from the nickel electrode, thus decreasing the overcharge rate at a given voltage and allowing the nickel electrode to attain a higher state of charge. The effects of cadmium treatment become particularly important for stable cell operation at temperatures above 10 C, and for capacity maintenance under conditions of long term, low rate trickle charge

  12. Cadmium exposure induces hematuria in Korean adults

    International Nuclear Information System (INIS)

    Introduction: Toxic heavy metals have adverse effects on human health. However, the risk of hematuria caused by heavy metal exposure has not been evaluated. Methods: Data from 4701 Korean adults were obtained in the Korean National Health and Nutritional Examination Survey (2008–2010). Blood levels of the toxic heavy metals cadmium, lead, and mercury were measured. Hematuria was defined as a result of ≥+1 on a urine dipstick test. The odds ratios (ORs) for hematuria were measured according to the blood heavy metal levels after adjusting for multiple variables. Results: Individuals with blood cadmium levels in the 3rd and 4th quartiles had a greater OR for hematuria than those in the 1st quartile group: 3rd quartile, 1.35 (1.019–1.777; P=0.037); 4th quartile, 1.52 (1.140–2.017; P=0.004). When blood cadmium was considered as a log-transformed continuous variable, the correlation between blood cadmium and hematuria was significant: OR, 1.97 (1.224–3.160; Ptrend=0.005). In contrast, no significant correlations between hematuria and blood lead or mercury were found in the multivariate analyses. Discussion: The present study shows that high cadmium exposure is associated with a risk of hematuria. -- Highlights: • A high level of blood cadmium is associated with a high risk of hematuria. • This correlation is independent of several confounding factors. • Blood levels of lead and mercury are not associated with risk of hematuria. • This is the first study on the correlation between cadmium exposure and hematuria risk

  13. Cadmium exposure induces hematuria in Korean adults

    Energy Technology Data Exchange (ETDEWEB)

    Han, Seung Seok [Department of Internal Medicine, Seoul National University College of Medicine, Seoul 110-744 (Korea, Republic of); Kim, Myounghee, E-mail: dkkim73@gmail.com [Department of Dental Hygiene, College of Health Science, Eulji University, Gyeonggi-do 461-713 (Korea, Republic of); Lee, Su Mi [Department of Internal Medicine, Seoul National University College of Medicine, Seoul 110-744 (Korea, Republic of); Lee, Jung Pyo [Department of Internal Medicine, Seoul National University Boramae Medical Center, Seoul 156-707 (Korea, Republic of); Kim, Sejoong [Department of Internal Medicine, Seoul National University Bundang Hospital, Gyeonggi-do 463-707 (Korea, Republic of); Joo, Kwon Wook [Department of Internal Medicine, Seoul National University College of Medicine, Seoul 110-744 (Korea, Republic of); Lim, Chun Soo [Department of Internal Medicine, Seoul National University Boramae Medical Center, Seoul 156-707 (Korea, Republic of); Kim, Yon Su; Kim, Dong Ki [Department of Internal Medicine, Seoul National University College of Medicine, Seoul 110-744 (Korea, Republic of)

    2013-07-15

    Introduction: Toxic heavy metals have adverse effects on human health. However, the risk of hematuria caused by heavy metal exposure has not been evaluated. Methods: Data from 4701 Korean adults were obtained in the Korean National Health and Nutritional Examination Survey (2008–2010). Blood levels of the toxic heavy metals cadmium, lead, and mercury were measured. Hematuria was defined as a result of ≥+1 on a urine dipstick test. The odds ratios (ORs) for hematuria were measured according to the blood heavy metal levels after adjusting for multiple variables. Results: Individuals with blood cadmium levels in the 3rd and 4th quartiles had a greater OR for hematuria than those in the 1st quartile group: 3rd quartile, 1.35 (1.019–1.777; P=0.037); 4th quartile, 1.52 (1.140–2.017; P=0.004). When blood cadmium was considered as a log-transformed continuous variable, the correlation between blood cadmium and hematuria was significant: OR, 1.97 (1.224–3.160; P{sub trend}=0.005). In contrast, no significant correlations between hematuria and blood lead or mercury were found in the multivariate analyses. Discussion: The present study shows that high cadmium exposure is associated with a risk of hematuria. -- Highlights: • A high level of blood cadmium is associated with a high risk of hematuria. • This correlation is independent of several confounding factors. • Blood levels of lead and mercury are not associated with risk of hematuria. • This is the first study on the correlation between cadmium exposure and hematuria risk.

  14. Copper-cadmium interaction in mice: effects of copper status on retention and distribution of cadmium after cadmium exposure

    International Nuclear Information System (INIS)

    The role of increased dietary copper in altering the accumulation of cadmium and other metals in tissues, was investigated. Female Swiss-Webster mice were pretreated with cadmium or copper in drinking water for three weeks prior to cadmium exposure for an additional nine weeks, with sub groups from each dose level receiving Cu additions to the Cd supplemented water. In Cd pretreated animals, a significant decrease was observed in Cd concentrations in liver and kidney when Cu was added to Cd in drinking water. Cadmium levels in soluble protein fractions of liver of animals administered 5 ppm Cd were approximately three fold greater than that for the same Cd dose when Cu was added. The same was the case for the metallothionein-like protein fraction (MTP) of the liver cytosol. In copper pretreated animals similar trends were noted in that brain, spleen, liver (but not kidney) Cd levels were decreased in animals receiving Cu additions to the Cd dose. Increased binding of Cd to the MTP fraction was observed after both in vivo and in vitro exposure of intestinal mucosal cells to cadmium

  15. Observation of the distant blazar PG1553+113 with Fermi and H.E.S.S

    Energy Technology Data Exchange (ETDEWEB)

    Fegan, Stephen; Giebels, Berrie; Naurois, Mathieu de; King, Johannes; Sanchez, David [Laboratoire Leprince-Ringuet, Palaiseau (France)

    2015-07-01

    High-frequency peaked BL Lac objects are primary targets and the bulk of extragalactic sources detected in the TeV range, and the AGN PG1553+113 belongs to this class. In the High Energy (HE) range, PG1553+113 exhibits a hard spectrum (Γ∝1.6). The TeV spectrum, however, is among the softer ones (Γ∝4.5) making this object the source with the sharpest break between the HE and TeV range ever detected. An updated analysis of the Fermi data with a larger data set of 5 years, from 2008 August 4 to 2013 August 4 (MJD54682.0-56508.0) and improved reconstruction software is presented in this talk. The HE spectrum of PG1553+113 is fitted best by a log-parabola model. By correcting an estimated intrinsic power law spectrum for absorption due to the extragalactic background light (EBL), an estimation of the redshift of PG1553+113 can be made using also archival spectra in the Very High Energy (VHE) range. The found redshift can be considered as an upper limit and is in agreement with other measurements.

  16. On the effect of thallium additions on cadmium amalgam potentials

    International Nuclear Information System (INIS)

    A study has been made of the influence of additives of thallium on potentials of cadmium amalgams with thallium contents of 10, 20, 30, and 40 at.% at 20, 40, 60, and 80 deg C. Additives of thallium have been found to shift the potential of cadmium amalgams towards the range of negative values which indicates an increase in the activity of cadmium. A possibility of calculation of the potential shift for heterogeneous cadmium amalgams on introducing thallium has been shown

  17. Crystallographic structure of ubiquitin in complex with cadmium ions

    Directory of Open Access Journals (Sweden)

    Cheung Peter

    2009-12-01

    Full Text Available Abstract Background Ubiquitination plays a critical role in regulating many cellular processes, from DNA repair and gene transcription to cell cycle and apoptosis. It is catalyzed by a specific enzymatic cascade ultimately leading to the conjugation of ubiquitin to lysine residues of the target protein that can be the ubiquitin molecule itself and to the formation of poly-ubiquitin chains. Findings We present the crystal structure at 3.0 Å resolution of bovine ubiquitin crystallized in presence of cadmium ions. Two molecules of ubiquitin are present in the asymmetric unit. Interestingly this non-covalent dimeric arrangement brings Lys-6 and Lys-63 of each crystallographically-independent monomer in close contact with the C-terminal ends of the other monomer. Residues Leu-8, Ile-44 and Val-70 that form a hydrophobic patch at the surface of the Ub monomer are trapped at the dimer interface. Conclusions The structural basis for signalling by poly-Ub chains relies on a visualization of conformations of alternatively linked poly-Ub chains. This arrangement of ubiquitin could illustrate how linkages involving Lys-6 or Lys-63 of ubiquitin are produced in the cell. It also details how ubiquitin molecules can specifically chelate cadmium ions.

  18. Suitability of Cadmium Tantalate and Indium Tantalate as Control Materials for High-Temperature Reactors

    International Nuclear Information System (INIS)

    Control materials for practical use in high-temperature reactors should, independently of the requirements of the individual case, have the following properties: (a ) high absorption cross-section for neutrons in a wide range of energies; (b ) high absorption capacity for neutrons; (c ) small sensitivity for radiation damage; (d) good thermal resistance; (e ) low reactivity with the environment; and ( f ) low costs and good availability. With these points and the avoidance of the disadvantages of n, α -reactions taken into consideration, attention should be paid chiefly to the elements cadmium, tungsten, indium and tantalum. It is important to combine a good thermal absorber with an epithermál absorber so that the resulting material is stable at elevated temperatures (≳ 700°C). For this purpose the double-oxides CdWO4, Cd 2Ta2O7 and CdIn2O2 are suitable. Among these, cadmium tantalate has the highest thermal resistance. Another double-oxide which in combination with cadmium tantalate possesses an advantageous absorption spectrum for neutrons is indium tantalate. It has also good thermal resistance. Because ceramic absorber materials often have to be shaped by plastic deformation, they usually are used as cermets. Therefore, they must be compatible with metals. Cadmium tantalate is compatible with silver and copper and up to 700°C with nickel; indium, tantalate is completely compatible with silver, copper and nickel and up to 700°C with molybdenum also and to some degree with iron. These results are in agreement with thermodynamical calculations. For an estimation of the behaviour of the absorber materials under reactor conditions the daughter products originating from neutron absorption have to be considered. While Cd113 transforms into the stable Cd114, tantalum transmutes into tungsten and indium into tin. Both daughter products can bind more oxygen in their most stable valency states than the parent elements can. Therefore, the reduction of Cd++to metal

  19. Effect of anions on Toxicity of Cadmium Applied to MIcrobial Biomass in Red Soil

    Institute of Scientific and Technical Information of China (English)

    K.S.KHAN; XIEZHENGMIAO; 等

    1997-01-01

    A laboratory incubation experiment was conducted to elucidat the effects of associated anions on toxicity of cadmium applied to microbial biomass in the red soil. Cadmium was applied at six different levels,i.e.,O(background),5,15,30,60 and 100μg g-1 soil in the form of either cadmium acetate or cadmium chloride. Application of cadmium as cadmium acetate markedly reduced the soil microbial biomass carbon compared to cadmium applied as cadmium chlorde at all the tested levels.Similarly,organic carbon to biomass carbon ration in the soil was markedly increased by increasing the level of the cadmium in the soil as cadmium acetate,while the change wa much smaller in the case of cadmium chloride at the same cadmium levels.The results suggested that due consideration should be given to the source of cadmium while deciding the cadmium levles in experiments.

  20. Dicty_cDB: SSC113 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AAAAAAAA ATTAA Length of 3' end seq. 475 Connected seq. ID SSC113P Connected seq. >SSC113P.Seq CATCATTACTACA...AAAAAAAAAATTAA Length of connected seq. 1106 Full length Seq ID - Full length Seq. - Length of full length seq. - ... ...kgrfyqfyltqmlqfviql vislqi*lkrvvflngqnyyqh*i*h*iv--- ---g*sltiiqmvlyvi*ftfvtllplgikcnlismk...nce. 48 0.23 1 AE015942 |AE015942.1 Clostridium tetani E88, section 7 of 10 of the complete genome. 32 0.41 ...lete... 100 1e-19 BC084944_1( BC084944 |pid:none) Xenopus laevis hypothetical LOC

  1. Boiling of Refrigerant R-113. Three-dimensional numerical analysis

    International Nuclear Information System (INIS)

    In this paper a forced convective boiling of Refrigerant R-113 in a vertical annular channel has been simulated by the CFX-5 code. The employed subcooled boiling model uses a special treatment of the wall boiling boundary, which assures the grid invariant solution. The simulation results have been validated against the published experimental data. In general a good agreement with the experimental data has been achieved, which shows that the current model may be applied for the Refrigerant R-113 without significantly changing the model parameters. The influence of non-drag forces, bubble diameter size and interfacial drag model on the numerical results has been investigated as well. (author)

  2. Comparison of radioisotopic studied calcium metabolism in the orally administered and inhaled cadmium rat

    International Nuclear Information System (INIS)

    The radioisotopic study of calcium metabolism in the rat after oral administration of cadmium, 8 mg/kg during 13 weeks, has shown two different effects of this ion: 1) in the intestine, cadmium inhibits the absorption of calcium by active transport; 2) in the deep bone compartment, the decrease of the bone calcium used for the crystallization and slowly exchangeable with the calcium central pool (serum, extracellular and soft tissues calcium) is combined with a reduction of the exchange rates between the two compartments. When administered through a microparticle aerosol inhalation (1 mg/m3 of air, 30 mn a day, during 12 weeks), cadmium's main target organ is the deep bone compartment. For both modes of administration, the slowing down of osteogenesis is confirmed by a drop in serum alkaline phosphatase after a four weeks period which reflects a decrease of the osteoblastic activity. Therefore it appears that the effects on bones observed during the chronic oral cadmium administration, do not result from a malabsorption of intestine calcium but also from the very action the Cd++ ion on the bone crystallization process

  3. Mitochondrial Toxicity of Cadmium Telluride Quantum Dot Nanoparticles in Mammalian Hepatocytes

    OpenAIRE

    Nguyen, Kathy C; Rippstein, Peter; Tayabali, Azam F.; Willmore, William G.

    2015-01-01

    There are an increasing number of studies indicating that mitochondria are relevant targets in nanomaterial-induced toxicity. However, the underlying mechanisms by which nanoparticles (NPs) interact with these organelles and affect their functions are unknown. The aim of this study was to investigate the effects of cadmium telluride quantum dot (CdTe-QD) NPs on mitochondria in human hepatocellular carcinoma HepG2 cells. CdTe-QD treatment resulted in the enlargement of mitochondria as examined...

  4. CONTROL OF CADMIUM CARBONATE PRECIPITATION INTERFERENCES DURING THE DIALYSIS OF CADMIUM IN HIGH BICARBONATE ALKALINITY AQUATIC-LIFE BIOASSAY WATERS

    Science.gov (United States)

    The precipitation of cadmium carbonate during the dialysis of cadmium in a high bicarbonate alkalinity natural water, was linked to a significant source of error when determining dialyzate cadmium concentrations. The relative standard deviation was reduced by approximately four-f...

  5. Cadmium accumulation by Axonopus compressus (Sw. P. Beauv and Cyperus rotundas Linn growing in cadmium solution and cadmium-zinc contaminated soil

    Directory of Open Access Journals (Sweden)

    Paitip Thiravetyan

    2007-05-01

    Full Text Available This research investigated the phyto-remediation potentials of Cyperus rotundas Linn (Nutgrass and Axonopus compressus (Sw. P. Beauv (Carpetgrass for cadmium removal from cadmium solution andcadmium-zinc contaminated soil. Plants growth in the solution showed that cadmium decreased the relative growth rate of both grasses. However, the amount of cadmium accumulated in shoot and root was increasedwith the increase in cadmium concentration and exposure time. Growth in fertile soil mixed with Cd-contaminated zinc silicate residue (65% Si, 19% Ca, 2% Zn, 1% Mg and 0.03% Cd at the ratio of 50:50 (w/wfor 30 days showed that C. rotundas Linn accumulated cadmium in root and shoot to 2,178 and 1,144 mg kg-1 dry weight, respectively. A. compressus (Sw. P. Beauv accumulated cadmium in root and shoot to 1,965and 669 mg kg-1 dry weight, respectively. Scanning electron microscope connected to energy-dispersive X-ray spectroscopy suggested that the mechanism of cadmium accumulation by both grasses involved thecadmium precipitation in the stable form of cadmium silicate, which indicated that C. rotundas Linn and A. compressus (Sw. P. Beauv could be grown to prevent soil erosion and to remediate cadmium-contaminatedsoil.

  6. ELECTROKINETIC REMEDIATION STUDY FOR CADMIUM CONTAMINATED SOIL

    Directory of Open Access Journals (Sweden)

    P. Bala Ramudu

    2007-09-01

    Full Text Available This paper presents the results of an experimental research undertaken to evaluate different purging solutions to enhance the removal of cadmium from spiked contaminated field soil by electrokinetic remediation. Three experiments were conducted when soil was saturated with deionised water and subsequently deionised water, ammonium citrate and sodium citrate were used as purging solutions at anode end. One experiment was conducted when the soil was saturated with ammonium citrate and itself was used as the purging solution. Results showed that 49% reduction of cadmium concentration was achieved in the case of soil saturated (washed with ammonium citrate as well as purging solution also was ammonium citrate. The soil pH and washing solutions were the most important factors in controlling the removal of cadmium in electrokinetic remediation process.

  7. Bireactor Electronuclear Systems with Liquid Cadmium Valve

    CERN Document Server

    Bznuni, S A; Zhamkochyan, V M; ASosnin, A N; Polanski, A; Khudaverdyan, A H

    2002-01-01

    Three main types of bireactor electronuclear systems are discussed. From the point of view of assuring high level of functional characteristics and safety bireactor electronuclear systems with booster using enriched uranium (20 %) and with a liquid cadmium valve appears to be the most effective. It is shown by means of Monte-Carlo modeling that such operation conditions can be achieved which lead to the destruction of the intermediate cadmium layer making the systems supercritical (k_{eff}>1). One can avoid the problem by using a special design of the liquid cadmium valve. In comparison with other nuclear systems (critical reactors, one-reactor electronuclear systems) cascade electronuclear systems have essential advantages allowing the decrease of the proton beam current by one order of magnitude and providing at same time the necessary level of power generation and neutron flux. Availability of both the thermal and fast cones allows one to transmute not only transuranics but also the fission products - cesi...

  8. Cadmium tungstate ceramics for application as scintillator

    International Nuclear Information System (INIS)

    The aim of the present work is the production of cadmium tungstate scintillator ceramics (CdWO4 - CWO). The route of production employed was the solid state synthesis. Before the calcination, the precursors cadmium oxide and tungsten oxide were homogenized in an agate mortar. Bismuth oxide was used in the production of doped ceramics with 1% in mol of bismuth, in order to improve de efficiency of the scintillators. Since there is a possibility of Cd2+ loss at temperatures above 1000 deg C, ceramics with 1% of cadmium oxide excess were also produced. The crystalline phase was obtained after two calcination, according to X-Ray diffraction results. For the characterization, radioluminescence measurements were performed under β and X-radiation. Images of the surface of the sintered ceramic were registered by Atomic Force Microscopy. The density of ceramics bodies was calculated by the Archimedes' method and compared with the theoretical density (7.99 g/cm3). (author)

  9. Treatment of cadmium dust with two-stage leaching process

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    The treatment of cadmium dust with a two-stage leaching process was investigated to replace the existing sulphation roast-leaching processes. The process parameters in the first stage leaching were basically similar to the neutralleaching in zinc hydrometallurgy. The effects of process parameters in the second stage leaching on the extraction of zincand cadmium were mainly studied. The experimental results indicated that zinc and cadmium could be efficiently recoveredfrom the cadmium dust by two-stage leaching process. The extraction percentages of zinc and cadmium in two stage leach-ing reached 95% and 88% respectively under the optimum conditions. The total extraction percentage of Zn and Cdreached 94%.

  10. Thermodynamic properties of cadmium in lead amalgam dilute solution

    International Nuclear Information System (INIS)

    Investigation of thermodynamic properties of cadmium dilute solutions in lead amalgam is carried out by means of electromotive force technique within 453-523 K temperature range. Cadmium thermodynamic functions are calculated: activity, activity ratio, Libbs partial energy and its excess value and integral characteristics, respectively. When changing cadmium content from 0.01 up to 0.1 χcd at T=473 K, logarithm of activity ratio does not depend on alloy composition, that is, Heury's law is fulfilled. Increase of cadmium content in amalgam results in the essential reduction of mercury and cadmium reaction

  11. Urinary excretion of cadmium and zinc among persons from Sweden

    Energy Technology Data Exchange (ETDEWEB)

    Elinder, C.G.; Kjellstrom, T.; Linnman, L.; Pershagen, G.

    1978-06-01

    Cadmium and zinc concentrations in the urine of 132 Swedes, including 50 pairs of identical twins, were measured. Atomic absorption spectrophotometry procedures were developed for the analysis. Cadmium concentration increased with age and was higher among smokers than among nonsmokers. Estimated 24-hr excretion of cadmium among nonsmokers increased from about 0.25 to 0.40 ..mu..g in persons from 20 to 70 years old. The 24-hr cadmium excretions among nonsmokers in different age-groups fitted better to total kidney burden than to daily cadmium intake from food. Zinc excretion, on the other hand, decreased after the age of 20.

  12. Cadmium telluride quantum dots advances and applications

    CERN Document Server

    Donegan, John

    2013-01-01

    Optical Properties of Bulk and Nanocrystalline Cadmium Telluride, Núñez Fernández and M.I. VasilevskiyAqueous Synthesis of Colloidal CdTe Nanocrystals, V. Lesnyak, N. Gaponik, and A. EychmüllerAssemblies of Thiol-Capped CdTe Nanocrystals, N. GaponikFörster Resonant Energy Transfer in CdTe Nanocrystal Quantum Dot Structures, M. Lunz and A.L. BradleyEmission of CdTe Nanocrystals Coupled to Microcavities, Y.P. Rakovich and J.F. DoneganBiological Applications of Cadmium Telluride Semiconductor Quantum Dots, A. Le Cign

  13. 9 CFR 113.452 - Erysipelothrix Rhusiopathiae Antibody.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Erysipelothrix Rhusiopathiae Antibody... REQUIREMENTS Antibody Products § 113.452 Erysipelothrix Rhusiopathiae Antibody. Erysipelothrix Rhusiopathiae Antibody is a specific antibody product containing antibodies directed against one or more somatic...

  14. 9 CFR 113.214 - Parvovirus Vaccine, Killed Virus (Canine).

    Science.gov (United States)

    2010-01-01

    ... Seed. (a) The Master Seed shall meet the applicable general requirements prescribed in § 113.200. (b... antibody against canine parvovirus to determine susceptibility. A constant virus-varying serum... vaccination, a second serum sample shall be drawn from each dog and tested for neutralizing antibody to...

  15. 9 CFR 113.316 - Canine Parainfluenza Vaccine.

    Science.gov (United States)

    2010-01-01

    ... applicable general requirements prescribed in § 113.300 and the requirements in this section. (b) Each lot of... virus. Blood samples shall also be drawn and individual serum samples tested for neutralizing antibody... are negative for canine parainfluenza antibody at a 1:2 final dilution in a constant...

  16. 10 CFR 1304.113 - Privacy Act training.

    Science.gov (United States)

    2010-01-01

    ... NUCLEAR WASTE TECHNICAL REVIEW BOARD PRIVACY ACT OF 1974 § 1304.113 Privacy Act training. (a) The Board... Board systems are informed of all requirements necessary to protect the privacy of individuals. The Board shall ensure that all employees having access to records receive adequate training in...

  17. 9 CFR 113.30 - Detection of Salmonella contamination.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Detection of Salmonella contamination... REQUIREMENTS Standard Procedures § 113.30 Detection of Salmonella contamination. The test for detection of Salmonella contamination provided in this section shall be conducted when such a test is prescribed in...

  18. 9 CFR 113.69 - Pasteurella Multocida Vaccine, Bovine.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Pasteurella Multocida Vaccine, Bovine... REQUIREMENTS Live Bacterial Vaccines § 113.69 Pasteurella Multocida Vaccine, Bovine. Pasteurella Multocida Vaccine, Bovine, shall be prepared as a desiccated live culture bacterial vaccine of an avirulent...

  19. 9 CFR 113.115 - Staphylococcus Aureus Bacterin-Toxoid.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Staphylococcus Aureus Bacterin-Toxoid... REQUIREMENTS Inactivated Bacterial Products § 113.115 Staphylococcus Aureus Bacterin-Toxoid. Staphylococcus... Staphylococcus aureus which has been inactivated and is nontoxic. Each serial of biological product...

  20. 13 CFR 113.130 - Effect of employment opportunities.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Effect of employment opportunities... Financial Assistance Introduction § 113.130 Effect of employment opportunities. The obligation to comply with these Title IX regulations is not obviated or alleviated because employment opportunities in...

  1. 9 CFR 113.102 - Leptospira Icterohaemorrhagiae Bacterin.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Icterohaemorrhagiae... REQUIREMENTS Inactivated Bacterial Products § 113.102 Leptospira Icterohaemorrhagiae Bacterin. Leptospira Icterohaemorrhagiae Bacterin shall be produced from a culture of Leptospira icterohaemorrhagiae which has...

  2. Dicty_cDB: CHI113 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI113 (Link to dictyBase) - - - Contig-U14338-1 - (Link to Original site) ... 37591_59( DQ437591 |pid:none) Variola virus strain Sumatra ... 1970... 33 3.0 AL844504_205( AL844504 |pid:none) P ...

  3. 9 CFR 113.326 - Avian Pox Vaccine.

    Science.gov (United States)

    2010-01-01

    ... Vaccines § 113.326 Avian Pox Vaccine. Fowl Pox Vaccine and Pigeon Pox Vaccine shall be prepared from virus... established as follows: (1) Fowl pox susceptible birds all of the same age and from the same source, shall be... controls do not develop fowl pox during the observation period, the test is inconclusive and may...

  4. 9 CFR 113.28 - Detection of mycoplasma contamination.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Detection of mycoplasma contamination... REQUIREMENTS Standard Procedures § 113.28 Detection of mycoplasma contamination. The heart infusion test, using... for mycoplasma contamination is prescribed in an applicable Standard Requirement or in the...

  5. 9 CFR 113.31 - Detection of avian lymphoid leukosis.

    Science.gov (United States)

    2010-01-01

    ... REQUIREMENTS Standard Procedures § 113.31 Detection of avian lymphoid leukosis. The complement-fixation test... the same week from material harvested from each source flock (or other sampling procedure acceptable... cultures shall be prepared from the same cell suspension as the cultures for testing the vaccine....

  6. 13 CFR 113.400 - Education programs or activities.

    Science.gov (United States)

    2010-01-01

    ... ADMINISTRATOR Nondiscrimination on the Basis of Sex in Education Programs or Activities Receiving Federal Financial Assistance Discrimination on the Basis of Sex in Education Programs Or Activities Prohibited § 113... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Education programs or...

  7. 9 CFR 113.204 - Mink Enteritis Vaccine, Killed Virus.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Mink Enteritis Vaccine, Killed Virus..., DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.204 Mink Enteritis Vaccine, Killed Virus. Mink Enteritis...

  8. 9 CFR 113.213 - Pseudorabies Vaccine, Killed Virus.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Pseudorabies Vaccine, Killed Virus..., DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.213 Pseudorabies Vaccine, Killed Virus. Pseudorabies Vaccine,...

  9. 9 CFR 113.212 - Bursal Disease Vaccine, Killed Virus.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Bursal Disease Vaccine, Killed Virus..., DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.212 Bursal Disease Vaccine, Killed Virus. Bursal Disease...

  10. 9 CFR 113.201 - Canine Distemper Vaccine, Killed Virus.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Canine Distemper Vaccine, Killed Virus..., DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.201 Canine Distemper Vaccine, Killed Virus. Canine Distemper...

  11. 9 CFR 113.209 - Rabies Vaccine, Killed Virus.

    Science.gov (United States)

    2010-01-01

    ... 5 U.S.C. 552(a) and 1 CFR part 51. Copies may be obtained from the World Health Organization... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Rabies Vaccine, Killed Virus. 113.209... AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD...

  12. 14 CFR 129.113 - Fuel tank system maintenance program.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Fuel tank system maintenance program. 129... Continued Airworthiness and Safety Improvements § 129.113 Fuel tank system maintenance program. (a) Except... limitations for fuel tank systems. (d) The proposed fuel tank system maintenance program revisions must...

  13. Metallothionein protection of cadmium toxicity

    International Nuclear Information System (INIS)

    The discovery of the cadmium (Cd)-binding protein from horse kidney in 1957 marked the birth of research on this low-molecular weight, cysteine-rich protein called metallothionein (MT) in Cd toxicology. MT plays minimal roles in the gastrointestinal absorption of Cd, but MT plays important roles in Cd retention in tissues and dramatically decreases biliary excretion of Cd. Cd-bound to MT is responsible for Cd accumulation in tissues and the long biological half-life of Cd in the body. Induction of MT protects against acute Cd-induced lethality, as well as acute toxicity to the liver and lung. Intracellular MT also plays important roles in ameliorating Cd toxicity following prolonged exposures, particularly chronic Cd-induced nephrotoxicity, osteotoxicity, and toxicity to the lung, liver, and immune system. There is an association between human and rodent Cd exposure and prostate cancers, especially in the portions where MT is poorly expressed. MT expression in Cd-induced tumors varies depending on the type and the stage of tumor development. For instance, high levels of MT are detected in Cd-induced sarcomas at the injection site, whereas the sarcoma metastases are devoid of MT. The use of MT-transgenic and MT-null mice has greatly helped define the role of MT in Cd toxicology, with the MT-null mice being hypersensitive and MT-transgenic mice resistant to Cd toxicity. Thus, MT is critical for protecting human health from Cd toxicity. There are large individual variations in MT expression, which might in turn predispose some people to Cd toxicity.

  14. Cadmium exposure and pancreatic cancer in south Louisiana.

    Science.gov (United States)

    Luckett, Brian G; Su, L Joseph; Rood, Jennifer C; Fontham, Elizabeth T H

    2012-01-01

    Cadmium has been hypothesized to be a pancreatic carcinogen. We test the hypothesis that cadmium exposure is a risk factor for pancreatic cancer with a population-based case-control study sampled from a population with persistently high rates of pancreatic cancer (south Louisiana). We tested potential dietary and nondietary sources of cadmium for their association with urinary cadmium concentrations which reflect long-term exposure to cadmium due to the accumulation of cadmium in the kidney cortex. Increasing urinary cadmium concentrations were significantly associated with an increasing risk of pancreatic cancer (2nd quartile OR = 3.34, 3rd = 5.58, 4th = 7.70; test for trend P ≤ 0.0001). Potential sources of cadmium exposure, as documented in the scientific literature, found to be statistically significantly associated with increased risk of pancreatic cancer included working as a plumber, pipefitter or welder (OR = 5.88) and high consumption levels of red meat (4th quartile OR = 6.18) and grains (4th quartile OR = 3.38). Current cigarette smoking, at least 80 pack years of smoking, occupational exposure to cadmium and paints, working in a shipyard, and high consumption of grains were found to be statistically significantly associated with increased concentrations of urinary cadmium. This study provides epidemiologic evidence that cadmium is a potential human pancreatic carcinogen. PMID:23319964

  15. Cadmium Exposure and Pancreatic Cancer in South Louisiana

    Directory of Open Access Journals (Sweden)

    Brian G. Luckett

    2012-01-01

    Full Text Available Cadmium has been hypothesized to be a pancreatic carcinogen. We test the hypothesis that cadmium exposure is a risk factor for pancreatic cancer with a population-based case-control study sampled from a population with persistently high rates of pancreatic cancer (south Louisiana. We tested potential dietary and nondietary sources of cadmium for their association with urinary cadmium concentrations which reflect long-term exposure to cadmium due to the accumulation of cadmium in the kidney cortex. Increasing urinary cadmium concentrations were significantly associated with an increasing risk of pancreatic cancer (2nd quartile OR = 3.34, 3rd = 5.58, 4th = 7.70; test for trend P≤0.0001. Potential sources of cadmium exposure, as documented in the scientific literature, found to be statistically significantly associated with increased risk of pancreatic cancer included working as a plumber, pipefitter or welder (OR = 5.88 and high consumption levels of red meat (4th quartile OR = 6.18 and grains (4th quartile OR = 3.38. Current cigarette smoking, at least 80 pack years of smoking, occupational exposure to cadmium and paints, working in a shipyard, and high consumption of grains were found to be statistically significantly associated with increased concentrations of urinary cadmium. This study provides epidemiologic evidence that cadmium is a potential human pancreatic carcinogen.

  16. European Union Summary Risk Assessment Report - Cadmium Metal and Cadmium Oxide

    OpenAIRE

    2008-01-01

    This report provides a summary, with conclusions, of the risk assessment report of the substances cadmium metal and cadmium oxide that has been prepared by Belgium in the context of Council Regulation (EEC) No. 793/93 on the evaluation and control of existing substances. For detailed information on the risk assessment principles and procedures followed, the underlying data and the literature references, the reader is referred to the comprehensive Final Risk Assessment Report (Final RAR) t...

  17. Impact of iron status on cadmium uptake in suckling piglets

    International Nuclear Information System (INIS)

    Low iron status is known to increase the uptake of dietary cadmium in both adolescents and adults and there are indications that cadmium is absorbed from the intestine by the two major iron transporters divalent metal transporter 1 (DMT1) and ferroportin 1 (FPN1). In addition, it has been suggested that duodenal metallothionein (MT) may limit the transport of cadmium across the intestinal epithelium. The present investigation was undertaken to examine whether iron status influences cadmium absorption in newborns by applying a model of suckling piglets and the possible roles of duodenal DMT1, FPN1 and MT. An oral cadmium dose (20 μg/kg body weight) was given daily for 6 consecutive days on postnatal days (PNDs) 10-15 to iron-deficient or iron-supplemented piglets. The cadmium dose was chosen to keep the cadmium level at a realistically low but still detectable level, and without inducing any adverse health effects in the piglets. As indicators of cadmium uptake, cadmium levels in blood and kidneys were measured on PND 16 by inductively coupled plasma-mass spectrometry (ICP-MS). Cadmium levels in blood were statistically significantly correlated with cadmium levels in kidneys. The cadmium uptake was not higher in iron-deficient suckling piglets; rather, we detected a higher cadmium uptake in the iron-supplemented ones. The expression and localisation of DMT1, FPN1 and MT were not affected by iron status and could therefore not explain the findings. Our results suggest that there are developmental differences in the handling of both iron and cadmium in newborns as compared to adults

  18. CADMIUM EXPOSURE VIA FOOD CROPS: A CASE STUDY OF INTENSIVE FARMING AREA

    Directory of Open Access Journals (Sweden)

    Raagheni Munisamy

    2013-01-01

    Full Text Available Cadmium (Cd is ubiquitous in environment and may enter food chain through intense application of phosphate fertilizers to agricultural crops. A cross-sectional study was conducted at Kuala Terla and Blue Valley farming villages, Cameron Highlands to determine cadmium concentration in vegetables and soil and to determine the health risks among respondents. A total of 87 respondents were selected based on inclusive and exclusive criteria. A set of pre-tested questionnaires utilized to obtain socio-demographic information and to predict health risks faced by the respondents based on their vegetable ingestion rate. The Average Daily Dose (ADD and Target Hazard Quotient (THQ were determined in this study. Convenient sampling method was employed to obtain 15 paired soil and vegetable samples. Cadmium concentration in the samples was acid digested prior analysis using Flame Atomic Absorption Spectrophotometer (FAAS. The mean ± standard deviation concentrations of Cd in vegetable samples were 0.13±0.082 mg kg-1, within the acceptable range specified by Malaysia Food Regulation 1985 (1 mg kg-1. For sol samples, the mean ± standard deviation concentration of Cd was 2.78±2.83 mg kg-1. Eight out of 11 soil samples exceed the permissible limit of Cd outlined by The Dutch Standard (1 mg kg-1. The findings on THQ demonstrated that all respondents are within the acceptable non-carcinogenic health risk (THQ<1. The results also exhibit that there is no correlation between cadmium in soils and vegetables. There are unlikely potential adverse health impacts arising from Cd through vegetables consumption in this study. Respondents are advised to have a medical check-up in order to determine Cd body burden thus eliminating the risks of acquiring cadmium related diseases.

  19. Accumulation of cadmium by transgenic tobacco

    Czech Academy of Sciences Publication Activity Database

    Macek, Tomáš; Macková, M.; Pavlíková, D.; Száková, J.; Truks, M.; Singh Cundy, A.; Kotrba, P.; Yancey, N.; Scouten, W. H.

    2002-01-01

    Roč. 22, 1/2 (2002), s. 101-106. ISSN 0138-4988 R&D Projects: GA ČR GA526/02/0293 Institutional research plan: CEZ:AV0Z4055905 Keywords : phytoremediation * cadmium Subject RIV: CE - Biochemistry Impact factor: 0.542, year: 2002

  20. Cadmium isotope variations in the Southern Ocean

    NARCIS (Netherlands)

    Xue, Z.; Rehkämper, M.; Horner, T.J.; Abouchami, W.; Middag, R.; van de Flierd, T.; de Baar, H.J.W.

    2013-01-01

    Cadmium concentrations and isotope compositions were determined for 47 seawater samples from the high nutrient low chlorophyll (HNLC) zone of the Atlantic sector of the Southern Ocean. The samples include 13 surface waters from a transect of the Weddell Gyre and 3 depth profiles from the Weddell Sea

  1. Physicochemical properties of a cadmium telluride surface

    International Nuclear Information System (INIS)

    Change of chemical state of cadmium telluride surface is investigated after different treatments (exposure in air, vacuum, gaseous media, γ- and IR-irradiation). The results of these investigations are of great interest for clarifying the nature of active surface of diamond-like semiconductors, the mechanism of its interaction with different media and the possibilities of surface properties regulation

  2. The effect of cadmium on plant metabolism

    Czech Academy of Sciences Publication Activity Database

    Pavlíková, D.; Pavlík, Milan; Vokáč, Karel; Balík, J.; Szaková, J.; Tlustoš, P.

    Budapest : Institute of Materials and Environmental Chemistry, 2006. s. 71. [International Symposium on Trace Element in the Food Chain . 25.05.2006-27.05.2006, Budapest] Institutional research plan: CEZ:AV0Z40550506 Keywords : cadmium * plant metabolism * glutamate kinase Subject RIV: DK - Soil Contamination ; De-contamination incl. Pesticides

  3. The effect of cadmium on plant metabolism

    Czech Academy of Sciences Publication Activity Database

    Pavlíková, D.; Pavlík, Milan; Vokáč, Karel; Staszková, L.; Balík, J.; Szaková, J.; Tlustoš, P.

    Budapest : Institute of Materials and Environmental Chemistry, 2006 - (Szilágyi, M.; Szentmihályi, K.), 256-260 [Trace Elements in the food chain . Budapest (HU), 25.05.2006-27.05.2006] Institutional research plan: CEZ:AV0Z40550506 Keywords : cadmium * plant metabolism * glutamate kinase Subject RIV: DK - Soil Contamination ; De-contamination incl. Pesticides

  4. Cadmium phytoextraction potential of different Alyssum species

    International Nuclear Information System (INIS)

    Highlights: ► The possibility of using serpentine plants for phytoextraction of Cd was investigated. ► Variation in Cd tolerance, accumulation and translocation in three Alyssum plants with different phenotypes were found. ► Alyssum montanum showed higher Cd tolerance and accumulation than the Ni hyperaccumulator Alyssum bertolonii. ► As for the kinetic parameters of the Cd uptake system, A. montanum presented a low apparent Km value. ► The Vmax values were not significantly different among the plants. - Abstract: This work was planned for providing useful information about the possibility of using serpentine adapted plants for phytoextraction of cadmium, element scarcely represented in such metalliferous environment. To this aim, we investigated variation in cadmium tolerance, accumulation and translocation in three Alyssum plants with different phenotypes: Alyssum bertolonii, that is a serpentine endemic nickel hyperaccumulator, and two populations of Alyssum montanum, one adapted and one not adapted to serpentine soils. Plants were hydroponically cultivated in presence of increasing concentrations of CdSO4 for two weeks. For the metal concentration used in the experiments, the three different Alyssum populations showed variation in cadmium tolerance, accumulation and content. The serpentine adapted population of A. montanum showed statistically higher cadmium tolerance and accumulation than A. bertolonii and the population of A. montanum not adapted to serpentine soil thus deserving to be investigated for phytoextraction purposes. Furthermore, as for the kinetic parameters of the cadmium uptake system, A. montanum serpentine population presented a low apparent Km value, suggesting a high affinity for this metal of its uptake system, whereas the Vmax values were not significantly different among the plants. Present data revealed metallicolous plants are also suitable for the phytoremediation of metals underrepresented in the environment of their initial

  5. Cadmium and Chrome Concentrations in Human Milk

    Directory of Open Access Journals (Sweden)

    Sima Nazarpour

    2014-04-01

    Full Text Available Introduction: Nutrition of children has the highest priority in any program aimed at children's health care. Milk contaminated with various toxic elements can have adverse effects on children's health. This study aimed to determine the concentration of heavy metals including cadmium(Cd and chromium (Cr of breast feeding women’s milk in Varamin. Methods: This is a cross sectional study. In the present study, chromium and cadmium levels in milk of 100 mothers attending clinics in the city of Varamin were measured in four to eight weeks after delivery, using atomic absorption spectrometry. Results: The mean values (±SD of Cd and Cr in human milk were 5±6.9 μg/ml and 3±2.7 μg/ml respectively. Result of Linear regression showed that cadmium levels were higher in breast milk of people living close to the factory or industrial center. Also, the chromium levels were higher in the breast milk of women in cases of: Smoking by spouses, consumption of imported rice, consumption of mineral water, and living close to the factory or an industrial center. Conclusion: This study showed that the relationship of some factors such as living near a factory or an industrial center, smoking by spouse, the type of consumed rice and water, with the level of cadmium and chromium. Cadmium and chromium levels of breast milk in this study were higher than the levels of these elements mentioned in the reviewed articles and international standard. Because some variables, such as living near a factory or an industrial center, smoking by spouse, the type of consumed rice and water can affect the amount of entering elements in breast milk. Actions can be taken to reduce or eliminate these variables in order to decrease the mentioned elements in human milk.

  6. Cadmium phytoextraction potential of different Alyssum species

    Energy Technology Data Exchange (ETDEWEB)

    Barzanti, R., E-mail: rbarzanti@supereva.it [Department of Evolutionary Biology, Universita di Firenze, via Micheli 1, 50121 Firenze (Italy); Colzi, I., E-mail: ilariacolzi@hotmail.it [Department of Evolutionary Biology, Universita di Firenze, via Micheli 1, 50121 Firenze (Italy); Arnetoli, M., E-mail: miluscia@gmail.com [Department of Evolutionary Biology, Universita di Firenze, via Micheli 1, 50121 Firenze (Italy); Gallo, A., E-mail: galloalessia@hotmail.com [Department of Evolutionary Biology, Universita di Firenze, via Micheli 1, 50121 Firenze (Italy); Pignattelli, S., E-mail: sara.pignattelli@gmail.com [Department of Evolutionary Biology, Universita di Firenze, via Micheli 1, 50121 Firenze (Italy); Gabbrielli, R., E-mail: gabbrielli@unifi.it [Department of Evolutionary Biology, Universita di Firenze, via Micheli 1, 50121 Firenze (Italy); Gonnelli, C., E-mail: cristina.gonnelli@unifi.it [Department of Evolutionary Biology, Universita di Firenze, via Micheli 1, 50121 Firenze (Italy)

    2011-11-30

    Highlights: Black-Right-Pointing-Pointer The possibility of using serpentine plants for phytoextraction of Cd was investigated. Black-Right-Pointing-Pointer Variation in Cd tolerance, accumulation and translocation in three Alyssum plants with different phenotypes were found. Black-Right-Pointing-Pointer Alyssum montanum showed higher Cd tolerance and accumulation than the Ni hyperaccumulator Alyssum bertolonii. Black-Right-Pointing-Pointer As for the kinetic parameters of the Cd uptake system, A. montanum presented a low apparent K{sub m} value. Black-Right-Pointing-Pointer The V{sub max} values were not significantly different among the plants. - Abstract: This work was planned for providing useful information about the possibility of using serpentine adapted plants for phytoextraction of cadmium, element scarcely represented in such metalliferous environment. To this aim, we investigated variation in cadmium tolerance, accumulation and translocation in three Alyssum plants with different phenotypes: Alyssum bertolonii, that is a serpentine endemic nickel hyperaccumulator, and two populations of Alyssum montanum, one adapted and one not adapted to serpentine soils. Plants were hydroponically cultivated in presence of increasing concentrations of CdSO{sub 4} for two weeks. For the metal concentration used in the experiments, the three different Alyssum populations showed variation in cadmium tolerance, accumulation and content. The serpentine adapted population of A. montanum showed statistically higher cadmium tolerance and accumulation than A. bertolonii and the population of A. montanum not adapted to serpentine soil thus deserving to be investigated for phytoextraction purposes. Furthermore, as for the kinetic parameters of the cadmium uptake system, A. montanum serpentine population presented a low apparent K{sub m} value, suggesting a high affinity for this metal of its uptake system, whereas the V{sub max} values were not significantly different among the

  7. Cadmium-induced fetal toxicity in the rat

    International Nuclear Information System (INIS)

    Cadmium, a heavy metal environment contaminant, induces fetal death and placental necrosis in the Wistar rat. This study investigated fetal, maternal, and placental responses to cadmium intoxication. Subcutaneous injection of CdCl2 to dams on day 18 of pregnancy produced a high incidence of fetal death (75%) and placental necrosis. Death in the fetus was produced despite limited fetal accumulations of cadmium. Distribution studies using 109Cd-labeled CdCl2 demonstrated that less than 0.1% of the injected dose was associated with the fetus. To determine if fetuses were sensitive to these low levels of cadmium, direct injections of CdCl2 into fetuses were performed in utero. Direct injections produced fetal accumulations 8-fold greater than those following maternal injections. The 8-fold greater fetal accumulations following direct injection were associated with only a 12% fetal mortality compared to the 75% mortality following maternal injections. The data indicated that the fetal toxicity of cadmium following maternal injections was not the result of direct effects of cadmium on the fetus. In conclusion, cadmium-induced fetal death was not the result of direct effects of cadmium on the fetus but may have been induced by placental cellular injury resulting from high accumulations of cadmium in the placenta. A vascular response to placental injury, leading to decreased utero-placental bood flow and cadmium-induced alterations in trophoblastic function, resulted in fetal death

  8. Cadmium and lead elimination through milk in the ewe

    Energy Technology Data Exchange (ETDEWEB)

    Houpert, P.; Mehennaoui, S.; Federspiel, B.; Milhaud, G. [Equipe associee INRA-ENV Alfort, 94 - Maisons-Alfort (France)

    1997-12-31

    Cadmium and lead are heavy metals widely distributed in industrialized countries, and known for their cumulative properties in continental ecological cycling. The purpose of the experiments was to study lead and cadmium transfer from ewe feed to their milk and meat, in view of protecting human consumers. Ewes were given daily oral administrations of lead, cadmium or associations of lead-cadmium, lead-cadmium-zinc for 52 days. Lead and cadmium were measured in blood, milk and tissues. About 0.1 pc of the total lead and 0.002-0.004 pc of the total cadmium dose was excreted via milk during the lactation, with milk concentrations of about 120 microgram per liter for lead and about 3.5 micro-g./l for cadmium. Sixty days after the last administration, 0.16 pc of the total cadmium dose was retained in liver and 0.09 pc in kidneys. Cadmium and lead concentrations in the muscle remained low

  9. Modelling of Cadmium Transport in Soil-Crop System

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    A model for simulating cadmium transport in a soil-plant system was built using a commercial simu lating program named Powersim on the basis of input-output processes happening in the soil-plant system.Convective and dispersive transport processes of cadmium in soil profile are embedded. Simulations on a daily base have been done up to a total simulating time of 250 years. Results show that applications of sewage sludge and fertilizer at the simulated rates would only cause slight cadmium accumulations in each layer of the soil, and cadmium accumulation would be levelling off, reaching an equilibrium concentrations layer by layer downward after certain time. The time scale to reach an equilibrium concentration varies from 10 years for the top three layers to over 250 years for the bottom layers. Plant cadmium uptake would increase from 52 ug m-2 under initial soil cadmium concentrations to 65 μg m-2 under equilibrium soil cadmium concentrations, which would not exceed the maximum allowable cadmium concentration in wheat grains. Main parameters which influence cadmium accumulation and transport in soil are total cadmium input, rainfall, evaporation, plant uptake and soil properties.

  10. Accumulation of cadmium in livers and kidneys in Greenlanders

    International Nuclear Information System (INIS)

    In the Arctic, the traditional diet exposes its people to a very high intake of cadmium because it is highly concentrated in the liver and kidneys of commonly eaten marine mammals. In one study in Greenland, the cadmium intake was estimated to 182 μg/day/person in the fall and 346 in the spring. To determine whether the cadmium is accumulated in humans, we analyzed autopsy samples of liver and kidneys from 95 ethnic Greenlanders (aged 19-89) who died from a wide range of causes. The cadmium concentration in liver (overall mean 1.97 μg/g wet wt) appeared to be unrelated to any particular age group, whereas the concentrations in the kidneys peaked in Greenlanders between 40 and 50 years of age (peak concentration 22.3 μg/g wet wt). Despite the high cadmium levels in the typical Greenlander diet, we found that the cadmium concentrations in livers and kidneys were comparable to those reported from Denmark, Sweden, Australia and Great Britain. Furthermore, even though the mean cadmium intake from the diet was estimated to be 13-25 times higher in Greenlanders than in Danes, we found similar cadmium levels in the kidneys of both. Seal livers and kidneys are the main source of cadmium in the diet of Greenlanders, but these tissues are not eaten in Denmark. Thus, our results suggest that the accumulation of cadmium from Greenlander's marine diet is very low

  11. Associations of neonatal lead, cadmium, chromium and nickel co-exposure with DNA oxidative damage in an electronic waste recycling town

    International Nuclear Information System (INIS)

    Objective: This study aimed to evaluate the effects of toxic heavy metal co-exposure on DNA oxidative damage in neonates from a primitive e-waste recycling region, Guiyu town, China. Methods: Our participants included 201 pregnant women: 126 from Guiyu town and 75 from Jinping district of Shantou city, where no e-waste recycling and dismantling activities existed. Structured interview questionnaires were administered to the pregnant women and umbilical cord blood (UCB) samples were collected after delivery. The UCB concentrations of lead, cadmium, chromium, and nickel were analyzed by graphite furnace atomic absorption spectrometry (GFAAS). Levels of UCB plasma 8-hydroxydeoxyguanosine (8-OHdG, a DNA oxidative damage biomarker) were determined by enzyme-linked immunosorbent assay. Results: Our results suggested that UCB lead and cadmium concentrations in neonates of Guiyu were significantly higher than those of Jinping (lead: median 110.45 ng/mL vs. 57.31 ng/mL; cadmium: median 2.50 ng/mL vs. 0.33 ng/mL, both P < 0.001). Parents' residence in Guiyu, and parents' work related to e-waste recycling were the risk factors associated with neonate's UCB lead and cadmium levels. No significant difference of UCB plasma 8-OHdG levels was found between Guiyu and the control area. After adjusting for potential confounders, cord plasma 8-OHdG concentrations (ng/mL) were positively associated with blood cadmium (β = 0.126 ng/mL, 95% CI: 0.055 to 0.198 ng/mL), chromium (β = 0.086 ng/mL, 95% CI: 0.014 to 0.158 ng/mL) and nickel (β = 0.215 ng/mL, 95% CI: 0.113 to 0.317 ng/mL) concentrations. Conclusions: The primitive e-waste recycling and dismantling activities may contribute to the elevated umbilical cord blood toxic heavy metal levels in neonates born in Guiyu. Exposures to cadmium, chromium and nickel were associated with increased oxidative DNA damage in neonates. - Highlights: • DNA oxidative damage levels (8-OHdG) in neonates from Guiyu were assessed. • Neonatal lead

  12. Associations of neonatal lead, cadmium, chromium and nickel co-exposure with DNA oxidative damage in an electronic waste recycling town

    Energy Technology Data Exchange (ETDEWEB)

    Ni, Wenqing; Huang, Yue; Wang, Xiaoling; Zhang, Jingwen; Wu, Kusheng, E-mail: kswu@stu.edu.cn

    2014-02-01

    Objective: This study aimed to evaluate the effects of toxic heavy metal co-exposure on DNA oxidative damage in neonates from a primitive e-waste recycling region, Guiyu town, China. Methods: Our participants included 201 pregnant women: 126 from Guiyu town and 75 from Jinping district of Shantou city, where no e-waste recycling and dismantling activities existed. Structured interview questionnaires were administered to the pregnant women and umbilical cord blood (UCB) samples were collected after delivery. The UCB concentrations of lead, cadmium, chromium, and nickel were analyzed by graphite furnace atomic absorption spectrometry (GFAAS). Levels of UCB plasma 8-hydroxydeoxyguanosine (8-OHdG, a DNA oxidative damage biomarker) were determined by enzyme-linked immunosorbent assay. Results: Our results suggested that UCB lead and cadmium concentrations in neonates of Guiyu were significantly higher than those of Jinping (lead: median 110.45 ng/mL vs. 57.31 ng/mL; cadmium: median 2.50 ng/mL vs. 0.33 ng/mL, both P < 0.001). Parents' residence in Guiyu, and parents' work related to e-waste recycling were the risk factors associated with neonate's UCB lead and cadmium levels. No significant difference of UCB plasma 8-OHdG levels was found between Guiyu and the control area. After adjusting for potential confounders, cord plasma 8-OHdG concentrations (ng/mL) were positively associated with blood cadmium (β = 0.126 ng/mL, 95% CI: 0.055 to 0.198 ng/mL), chromium (β = 0.086 ng/mL, 95% CI: 0.014 to 0.158 ng/mL) and nickel (β = 0.215 ng/mL, 95% CI: 0.113 to 0.317 ng/mL) concentrations. Conclusions: The primitive e-waste recycling and dismantling activities may contribute to the elevated umbilical cord blood toxic heavy metal levels in neonates born in Guiyu. Exposures to cadmium, chromium and nickel were associated with increased oxidative DNA damage in neonates. - Highlights: • DNA oxidative damage levels (8-OHdG) in neonates from Guiyu were assessed.

  13. 9 CFR 3.113 - Primary enclosures used to transport marine mammals.

    Science.gov (United States)

    2010-01-01

    ... marine mammals. 3.113 Section 3.113 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION..., Treatment, and Transportation of Marine Mammals Transportation Standards § 3.113 Primary enclosures used to transport marine mammals. No dealer, research facility, exhibitor, or operator of an auction sale...

  14. 9 CFR 113.25 - Culture media for detection of bacteria and fungi.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Culture media for detection of bacteria and fungi. 113.25 Section 113.25 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION... STANDARD REQUIREMENTS Standard Procedures § 113.25 Culture media for detection of bacteria and fungi....

  15. 9 CFR 113.55 - Detection of extraneous agents in Master Seed Virus.

    Science.gov (United States)

    2010-01-01

    ... Master Seed Virus. 113.55 Section 113.55 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION... STANDARD REQUIREMENTS Ingredient Requirements § 113.55 Detection of extraneous agents in Master Seed Virus... Seed Virus (MSV) shall be tested as prescribed in this section. A MSV found unsatisfactory by...

  16. 48 CFR 18.113 - Interagency acquisitions under the Economy Act.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Interagency acquisitions under the Economy Act. 18.113 Section 18.113 Federal Acquisition Regulations System FEDERAL ACQUISITION... 18.113 Interagency acquisitions under the Economy Act. Interagency acquisitions are authorized...

  17. 46 CFR 45.113 - Access openings in bulkheads at ends of enclosed superstructures.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Access openings in bulkheads at ends of enclosed superstructures. 45.113 Section 45.113 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) LOAD LINES GREAT LAKES LOAD LINES Conditions of Assignment § 45.113 Access openings in bulkheads at ends of enclosed superstructures. (a)...

  18. 27 CFR 40.113 - Change in location to another region.

    Science.gov (United States)

    2010-04-01

    ... another region. 40.113 Section 40.113 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND... Products Changes in Location of Factory § 40.113 Change in location to another region. Whenever a manufacturer of tobacco products intends to remove his factory to another region, the manufacturer...

  19. 17 CFR 10.113 - Right to challenge distribution of funds to customers.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Right to challenge distribution of funds to customers. 10.113 Section 10.113 Commodity and Securities Exchanges COMMODITY FUTURES TRADING COMMISSION RULES OF PRACTICE Restitution Orders § 10.113 Right to challenge distribution of...

  20. 13 CFR 113.3-3 - Structural accommodations for handicapped clients.

    Science.gov (United States)

    2010-01-01

    ... sections 3-8 of the Uniform Federal Accessibility Standards (UFAS) (appendix A to 41 CFR subpart 101-19.6... handicapped clients. 113.3-3 Section 113.3-3 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION... ADMINISTRATOR General Provisions § 113.3-3 Structural accommodations for handicapped clients. (a)...

  1. 13 CFR 113.425 - Counseling and use of appraisal and counseling materials.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Counseling and use of appraisal and counseling materials. 113.425 Section 113.425 Business Credit and Assistance SMALL BUSINESS... Activities Prohibited § 113.425 Counseling and use of appraisal and counseling materials. (a) Counseling....

  2. 9 CFR 113.6 - Animal and Plant Health Inspection Service testing.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Animal and Plant Health Inspection Service testing. 113.6 Section 113.6 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION... STANDARD REQUIREMENTS Applicability § 113.6 Animal and Plant Health Inspection Service testing....

  3. 9 CFR 113.10 - Testing of bulk material for export or for further manufacture.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Testing of bulk material for export or for further manufacture. 113.10 Section 113.10 Animals and Animal Products ANIMAL AND PLANT HEALTH... VECTORS STANDARD REQUIREMENTS Applicability § 113.10 Testing of bulk material for export or for...

  4. 9 CFR 113.8 - In vitro tests for serial release.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false In vitro tests for serial release. 113.8 Section 113.8 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT... REQUIREMENTS Applicability § 113.8 In vitro tests for serial release. (a) Master Seed which has...

  5. 9 CFR 113.200 - General requirements for killed virus vaccines.

    Science.gov (United States)

    2010-01-01

    ... vaccines. 113.200 Section 113.200 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... REQUIREMENTS Killed Virus Vaccines § 113.200 General requirements for killed virus vaccines. When prescribed in an applicable Standard Requirement or in the filed Outline of Production, a killed virus...

  6. 9 CFR 113.64 - General requirements for live bacterial vaccines.

    Science.gov (United States)

    2010-01-01

    ... bacterial vaccines. 113.64 Section 113.64 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION... STANDARD REQUIREMENTS Live Bacterial Vaccines § 113.64 General requirements for live bacterial vaccines... bacterial vaccine shall meet the requirements in this section. (a) Purity test. Final container samples...

  7. 9 CFR 113.300 - General requirements for live virus vaccines.

    Science.gov (United States)

    2010-01-01

    ... vaccines. 113.300 Section 113.300 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... REQUIREMENTS Live Virus Vaccines § 113.300 General requirements for live virus vaccines. When prescribed in an applicable Standard Requirement or in the filed Outline of Production, a live virus vaccine shall meet...

  8. 46 CFR 113.35-9 - Mechanical engine order telegraph systems.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Mechanical engine order telegraph systems. 113.35-9 Section 113.35-9 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) ELECTRICAL ENGINEERING COMMUNICATION AND ALARM SYSTEMS AND EQUIPMENT Engine Order Telegraph Systems § 113.35-9 Mechanical engine...

  9. 19 CFR Appendix A to Part 113 - Airport Customs Security Area Bond

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Airport Customs Security Area Bond A Appendix A to Part 113 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS BONDS Pt. 113, App. A Appendix A to Part 113—Airport Customs Security...

  10. 48 CFR 1371.113 - Department of Labor occupational safety and health standards for ship repair.

    Science.gov (United States)

    2010-10-01

    ... occupational safety and health standards for ship repair. 1371.113 Section 1371.113 Federal Acquisition... CONSTRUCTION AND SHIP REPAIR Provisions and Clauses 1371.113 Department of Labor occupational safety and health standards for ship repair. Insert clause 1352.271-82, Department of Labor Occupational Safety and...

  11. 30 CFR 260.113 - When does an eligible lease qualify for a royalty suspension volume?

    Science.gov (United States)

    2010-07-01

    ... royalty suspension volume? 260.113 Section 260.113 Mineral Resources MINERALS MANAGEMENT SERVICE... Leases § 260.113 When does an eligible lease qualify for a royalty suspension volume? (a) Your eligible lease will receive a royalty suspension volume as specified in the Act. The bidding system in §...

  12. Rotary mode core sampling approved checklist: 241-TX-113

    Energy Technology Data Exchange (ETDEWEB)

    Fowler, K.D.

    1998-08-03

    The safety assessment for rotary mode core sampling was developed using certain bounding assumptions, however, those assumptions were not verified for each of the existing or potential flammable gas tanks. Therefore, a Flammable Gas/Rotary Mode Core Sampling Approved Checklist has been completed for tank 241-TX-113 prior to sampling operations. This transmittal documents the dispositions of the checklist items from the safety assessment.

  13. Identification of collective bands in neutron-rich 113Ru

    International Nuclear Information System (INIS)

    New levels in the neutron-rich 113Ru nucleus have been identified by analyzing γ-γ-γ coincidence events following the spontaneous fission of 252Cf with the Gammasphere detector array. A rotational band going up to 3.6 MeV is identified and is proposed to be built on the intruder νh11/2 orbital going up to (31/2)(ℎ/2π). A few states of a possible signature partner are also observed

  14. Temperature dependence of the quadrupole interaction of tin in cadmium

    International Nuclear Information System (INIS)

    Isomeric states in Sn isotopes offer the possibility to study the temperature dependence of the e.f.g. at a Sn impurity in Cd by DPAD methods. The isomeric states in 113Sn, 11/2-, tau=128 and 116Sn, 5-, tau=534 ns populated via the reactions Cd(α,n) and Cd(α,2n) on isotopically enriched polycrystalline targets were used. The temperature dependence behaviour can be well reproduced by the proposed Tsup(3/2) dependence and is the same for CdCd and SnCd. So far measured data indicate that for InCd the temperature dependence is also quite similar to that of CdCd, possibly somewhat steeper. One can conclude that the temperature dependence of the e.f.g. for these systems is determined by the host lattice alone, in contrast to the similar system GeZn relative to ZnZn. (Auth.)

  15. HESS Observations and VLT Spectroscopy of PG 1553+113

    CERN Document Server

    Aharonian, F; Barresde Almeida, U; Bazer-Bachi, A R; Behera, B; Beilicke, M; Benbow, W; Bernlöhr, K; Boisson, C; Bolz, O; Borrel, V; Braun, I; Brion, E; Brown, A M; Buhler, R; Bulik, T; Büsching, I; Boutelier, T; Carrigan, S; Chadwick, P M; Chounet, L M; Clapson, A C; Coignet, G; Cornils, R; Costamante, L; Dalton, M; Degrange, B; Dickinson, H J; Djannati-Ata, A; Domainko, W; O'Connor-Drury, L; Dubois, F; Dubus, G; Dyks, J; Egberts, K; Emmanoulopoulos, D; Espigat, P; Farnier, C; Feinstein, F; Fiasson, A; Frster, A; Fontaine, G; Funk, Seb; Fuling, M; Gallant, Y A; Giebels, B; Glicenstein, J F; Glück, B; Goret, P; Hadjichristidis, C; Hauser, D; Hauser, M; Heinzelmann, G; Henri, G; Hermann, G; Hinton, J A; Hoffmann, A; Hofmann, W; Holleran, M; Hoppe, S; Horns, D; Jacholkowska, A; De Jager, O C; Jung, I; Katarzynski, K; Kendziorra, E; Kerschhaggl, M; Khlifi, B; Keogh, D; Komin, Nu; Kosack, K; Lamanna, G; Latham, I J; Lemiere, A; Lemoine-Goumard, M; Lenain, J P; Lohse, T; Martin, J M; Martineau-Huynh, O; Marcowith, A; Masterson, C; Maurin, D; Maurin, G; McComb, T J L; Moderski, R; Moulin, E; De Naurois, Mathieu; Nedbal, D; Nolan, S J; Ohm, S; Olive, J P; de Ona Wilhelmi, E; Orford, K J; Osborne, J L; Ostrowski, M; Panter, M; Pedaletti, G; Pelletier, G; Petrucci, P O; Pita, S; Pühlhofer, G; Punch, M; Ranchon, S; Raubenheimer, B C; Raue, M; Rayner, S M; Renaud, M; Ripken, J; Rob, L; Rolland, L; Rosier-Lees, S; Rowell, G; Rudak, B; Ruppel, J; Sahakian, V V; Santangelo, A; Schlickeiser, R; Schock, F; Schroder, R; Schwanke, U; Schwarzburg, S; Schwemmer, S; Sol, H; Spangler, D; Stawarz, L; Steenkamp, R; Stegmann, C; Superina, G; Tam, A Shalchi P H; Tavernet, J P; Terrier, R; Van Eldik, C; Vasileiadis, G; Venter, C; Vialle, J P; Vincent, P; Vivier, M; Vlk, H J; Volpe, F; Wagner, S J; Ward, M; Zdziarski, A A; Zech, A; Ablikim, M

    2007-01-01

    AIMS: The properties of the very high energy (VHE; E>100 GeV) gamma-ray emission from the high-frequency peaked BL Lac PG 1553+113 are investigated. An attempt is made to measure the currently unknown redshift of this object. METHODS: VHE Observations of PG 1553+113 were made with the High Energy Stereoscopic System (HESS) in 2005 and 2006. H+K (1.45-2.45 micron) spectroscopy of PG 1553+113 was performed in March 2006 with SINFONI, an integral field spectrometer of the ESO Very Large Telescope (VLT) in Chile. RESULTS: A VHE signal, ~10 standard deviations, is detected by HESS during the 2 years of observations (24.8 hours live time). The integral flux above 300 GeV is (4.6 +- 0.6{stat} +- 0.9{syst}) x 10^{-12} cm^{-2} s^{-1}, corresponding to ~3.4% of the flux from the Crab Nebula above the same threshold. The time-averaged energy spectrum is measured from 225 GeV to ~1.3 TeV, and is characterized by a very soft power law (photon index of Gamma = 4.5 +- 0.3{stat} +- 0.1{syst}). No evidence for any flux or spe...

  16. Investigation of the influence of cadmium processing on zinc gallium oxide:manganese thin films for photoluminescent and thin film electroluminescent applications

    Science.gov (United States)

    Flynn, Michael John

    Cadmium processing of ZnGa2O4 films provides a new fabrication route for phosphor powders and thin films. It relies on the enhanced diffusion due to the large vacancy concentration left by the sublimation of cadmium. Photoluminescent powders can be made with a single high temperature firing. Thin film devices can be processed at a significantly lower temperature, expanding the range of available substrates. Powders and thin films of ZnGa2O4:Mn were fabricated using starting materials in which between 0% and 50% of the ZnO was substituted by CdO. It was found that the emission spectra of the various compositions was unaffected by the change in composition, peaking at 504 nm, with the colour coordinates x = 0.08 and y = 0.69. The invariance of the emission spectrum is due to the spinel crystal structure exhibited by the compound. However, the maximum PL brightness was obtained from powders in which 10% of the ZnO had been substituted by CdO in the starting materials. The improved brightness is the result of better manganese incorporation which resulted from CdO sublimation during processing. This left a large vacancy concentration which enhanced the diffusion, and hence the manganese incorporation. In the case of thin films sputtered from cadmium processed targets, the composition of the films as deposited closely mirrored that of the target starting materials. The as deposited films were not luminescent and had to be annealed in vacuum in order to activate the manganese. EDX of these films showed that all of the cadmium had sublimed during the anneal. Very long anneal times also resulted in the loss of zinc. The decomposition products were amorphous or nanocrystalline. These films had an identical PL emission to the powders. The loss of cadmium correlated with the onset of bright 254 nm photoluminescence in the films, indicating that cadmium loss aided in the activation of the manganese. This was the result of the enhanced diffusion due to the large vacancy

  17. Cadmium uptake in oyster isognomon alatus under laboratory condition

    International Nuclear Information System (INIS)

    The uptake of cadmium in Flat tree oyster Isognomon alatus was investigated under controlled laboratory conditions for two weeks. Oysters were exposed to 100 μg 1'-1 cadmium and the accumulation of cadmium in the tissues was measured for every two days. Soft tissues of oyster were digested in concentrated acid and cadmium concentrations were determined by using Atomic Absorption Spectrophotometer. The accumulation of cadmium in the soft tissues of oysters was increased during the first six days from 0.73 μg g- 1 to 10.77 μg g'-1, and remaining constant for four days at average level of 10.96 μg g'-1. The Cl concentrations was increased to 32.70 μg g'-1 until the end of experiment. There was no sign of cadmium accumulation approaching saturation for the period of exposure. (author)

  18. Study on electrokinetic remediation of cadmium contaminated soils

    Institute of Scientific and Technical Information of China (English)

    SHI Wen-xin; CUI Chong-wei; YU Shui-li; FENG Wei-ming

    2007-01-01

    Kaolinite from a lead-zinc mining district, which was spiked with cadmium, has been treated by electrokinetics to investigate effects of treatment time and applied voltage gradient. The results showed that the increased test duration had induced a higher removal rate of cadmium. Being treated for 7 days, cadmium was removed from kaolinite dramatically. It was also found that higher removal rate happened when a higher voltage gradient was applied and cadmium accumulated near the cathode because pH increased. Increase of pH near the cathode caused accumulation of cadmium. Moreover, it was observed that cation exchange membrane which was placed between kaolinite and cathode could make pH lower than the initial value and avoid the higher pH near the cathode. As a result, the high concentration accumulation of cadmium near the cathode was avoided.

  19. Assessment and management of risk to wildlife from cadmium

    International Nuclear Information System (INIS)

    Cadmium, a nonessential heavy metal that comes from natural and anthropogenic sources, is a teratogen, carcinogen, and a possible mutagen. Assessment of potential risk from cadmium requires understanding environmental exposure, mainly from ingestion, although there is some local exposure through inhalation. Chronic exposure is more problematic than acute exposure for wildlife. There is evidence for bioaccumulation, particularly in freshwater organisms, but evidence for biomagnification up the food chain is inconsistent; in some bird studies, cadmium levels were higher in species that are higher on the food chain than those that are lower. Some freshwater and marine invertebrates are more adversely affected by cadmium exposure than are birds and mammals. There is very little experimental laboratory research on the effects of cadmium in amphibians, birds and reptiles, and almost no data from studies of wildlife in nature. Managing the risk from cadmium to wildlife involves assessment (including ecological risk assessment), biomonitoring, setting benchmarks of effects, regulations and enforcement, and source reduction

  20. Research and Development of Cadmium Sulphoselenide Red Pigment

    Institute of Scientific and Technical Information of China (English)

    WU Jianfeng; LI Kun; XU Xiaohong; ZHANG Yaxiang; XU Xiaoyang; LAO Xinbin

    2015-01-01

    Cadmium sulphoselenide was synthesized continuous substitution solid solution and the only known pigment to yield bright red color on ceramic decoration. Encapsulated cadmium sulphoselenide pigments could yield abundant hues from yellow to red with high opacity at high temperature. The color generation has a linear function relation with the substitution rate. The encapsulation formation process of zirconium silicate encapsulated cadmium sulphoselenide was shown. Insufifcient encapsulation efifciency and potential hazard to human and environment had limited the industrial application of cadmium sulphoselenide red pigment. Ink-jet printing decoration required ifne size cadmium sulphoselenide red pigment on ceramic decoration. The review mainly focused on the synthesis techniques and industrial application of cadmium sulphoselenide red pigment.

  1. Cadmium filtered neutron flux determination. Comparison of activation methods

    International Nuclear Information System (INIS)

    Neutron fluxes under cadmium filters are determined by the cadmium ratio and sandwich activation methods. The thermal neutron flux levels obtained with 7 detectors of different kinds: In, Au, Ag, W, Co, Mn, Zn are compared. The cadmium ratio method was used in locations for which the epithermal and thermal neutron flux ratio are quite different. By irradiating materials under different thicknesses of cadmium it was possible to establish experimental curves from which the flux depression factors for intermediate neutrons may be determined whatever the thickness of the filter used. Whereas the cadmium ratio method can only measure the mean flux above the cadmium cut-off energy the sandwich method enables the flux value to be determined in a narrow band around the resonance energy of each detector used

  2. In search of biomonitors for cadmium: cadmium content of wild Swedish fauna during 1973-1976.

    Science.gov (United States)

    Frank, A

    1986-12-01

    Forty-five species of birds and 22 species of mammals of the terrestrial and aquatic fauna, herbivores as well as carnivores, were investigated during the period 1973-1976 for cadmium-accumulating properties in order to find biomonitors for cadmium in the Swedish environment. The herbivores of the terrestrial fauna, birds as well as mammals, are preferred to carnivores, since they demonstrate generally higher renal Cd levels. The moose (Alces alces), roe deer (Capreolus capreolus) and hare (Lepus europeus and Lepus timidus) were found to be suitable as biomonitors because of their common occurrence and uniform geographical distribution. The eider duck (Somateria mollissima), although a short-distance migrating bird whose diet is composed mainly of mussels and crustaceans, and which lives along a great part of the Swedish coastline, is suggested as a biomonitor of cadmium for the aquatic environment. The accumulation rate of cadmium in the kidneys is rapid. Renal levels of cadmium in the parts per million range are reached 10 weeks after hatching. Juvenile birds should be collected for monitoring purposes before leaving their feeding domains at the end of the summer. PMID:3810147

  3. Growth of cadmium oxide whiskers on cadmium sulphide single crystals with copper as growth activator

    International Nuclear Information System (INIS)

    Some results on the growth and morphology of cadmium oxide whiskers, obtained on cadmium sulphide single crystals with copper as a growth activator, are presented in this work. Cadmium oxide whiskers have been obtained on brace 112-bar0 brace faces of cadmium sulphide plates with a copper layer deposited in advance. The whiskers grew during the annealing of the plates in a weak stream of technically pure argon at temperatures 670 to 730 deg C for 15 min to 3.5 h. Details about the procedure have been given elsewhere. The composition and morphology of the whiskers have been studied by an X-ray microanalyser JEOL 35 DDS and a scanning electron microscope JEOL, JSM 35. The optical microscopic observations have shown that after annealing, a gray-black granular layer is formed on the cadmium sulphide single crystals and this layer can easily be separated from the crystal substrate. Under the granular layer the crystal is heavily damaged. The whiskers grow on the granular layer and they are coloured yellow-brown or red-brown. The maximum whisker length attains several hundreds of micrometres and in some cases up to 1 mm or more. (author)

  4. Growth of cadmium oxide whiskers on cadmium sulphide single crystals with copper as growth activator

    Energy Technology Data Exchange (ETDEWEB)

    Koparanova, N.; Simov, S. (Bylgarska Akademiya na Naukite, Sofia. Inst. po Fizika na Tvyrdoto Tyalo); Genchev, D. (Bylgarska Akademiya na Naukite, Sofia. Inst. za Yadrena Izsledvaniya i Yadrena Energetika); Metchenov, G. (Research Inst. of Criminalistics and Criminology, Sofia (Bulgaria))

    1985-02-01

    Some results on the growth and morphology of cadmium oxide whiskers, obtained on cadmium sulphide single crystals with copper as a growth activator, are presented in this work. Cadmium oxide whiskers have been obtained on brace 112-bar0 brace faces of cadmium sulphide plates with a copper layer deposited in advance. The whiskers grew during the annealing of the plates in a weak stream of technically pure argon at temperatures 670 to 730 deg C for 15 min to 3.5 h. Details about the procedure have been given elsewhere. The composition and morphology of the whiskers have been studied by an X-ray microanalyser JEOL 35 DDS and a scanning electron microscope JEOL, JSM 35. The optical microscopic observations have shown that after annealing, a gray-black granular layer is formed on the cadmium sulphide single crystals and this layer can easily be separated from the crystal substrate. Under the granular layer the crystal is heavily damaged. The whiskers grow on the granular layer and they are coloured yellow-brown or red-brown. The maximum whisker length attains several hundreds of micrometres and in some cases up to 1 mm or more.

  5. Oral cadmium exposure of adults in Germany. 1: Cadmium content of foodstuffs and beverages.

    Science.gov (United States)

    Müller, M; Anke, M; Hartmann, E; Illing-Günther, H

    1996-04-01

    The cadmium contents of 94 and 105 foodstuffs bought in six-fold repetition in 1988 and in nine-fold repetition in 1991, respectively were analysed within the framework of a market-basket study. These foodstuffs were typical of German eating habits. Additionally, 170 samples of drinking water were investigated. The cadmium concentrations of the foodstuffs were comparable with results of recent studies carried out in Europe and North America. Fruit, milk and dairy products, sugar and sugar-rich foodstuffs as well as beverages showed mean cadmium contents cakes and pastries as well as farinaceous products were within the range of 20-40 ng/g. The most important bread, cakes and pastries (wheat and rye bread, toasted bread, rolls) contained 25-35 ng/g. A median cadmium concentration of 0.2 micrograms/l was found in the drinking water. As expected, liver and kidneys showed the highest cadmium levels of 73 and 204 ng/g, respectively on average. PMID:8718751

  6. Urinary cadmium and mammographic density in premenopausal women.

    Science.gov (United States)

    Adams, Scott V; Newcomb, Polly A; Shafer, Martin M; Atkinson, Charlotte; Bowles, Erin J Aiello; Newton, Katherine M; Lampe, Johanna W

    2011-08-01

    Mammographic density (MD), a strong marker of breast cancer risk, is influenced by genetic, environmental, and hormonal factors. Cadmium, a persistent and widespread environmental pollutant, has been associated with risk of breast cancer, and laboratory evidence suggests cadmium is a carcinogen in the breast. We investigated the hypothesis that cadmium exposure is associated with higher MD. In a cross-sectional study of MD and urinary cadmium concentration, percentage MD (MD%) and Breast Imaging-Reporting and Data Systems (BI-RADS®) density category were determined from screening mammograms of 190 premenopausal women ages 40-45 years. Women completed a health questionnaire, and the cadmium content of spot urine samples was measured with inductively coupled plasma mass spectrometry and corrected for urine creatinine. Urinary cadmium concentrations are thought to reflect exposure to cadmium during a period of 20-30 years. Multivariable linear regression and logistic regression were used to estimate the strength of association between urinary cadmium and mammographic breast density. Adjusted mean MD% among women in the upper tertile of creatinine-corrected urinary cadmium was 4.6% higher (95% CI: -2.3 to 11.6%) than in women in the lowest cadmium tertile. Each twofold increase in urinary cadmium was associated with higher odds of MD% in the upper tertile (OR: 1.29, 95% CI: 0.82-2.02) or a BI-RADS category rating of "extremely dense" (OR: 1.75, 95% CI: 1.14-2.70). Stronger associations were observed among nulliparous women, and current or former smokers. Exposure to cadmium may be associated with increased breast density in premenopausal women. PMID:21327468

  7. The effects of low environmental cadmium exposure on bone density

    International Nuclear Information System (INIS)

    Recent epidemiological data indicate that low environmental exposure to cadmium, as shown by cadmium body burden (Cd-U), is associated with renal dysfunction as well as an increased risk of cadmium-induced bone disorders. The present study was designed to assess the effects of low environmental cadmium exposure, at the level sufficient to induce kidney damage, on bone metabolism and mineral density (BMD). The project was conducted in the area contaminated with cadmium, nearby a zinc smelter located in the region of Poland where heavy industry prevails. The study population comprised 170 women (mean age=39.7; 18-70 years) and 100 men (mean age=31.9; 18-76 years). Urinary and blood cadmium and the markers of renal tubular dysfunction (β2M-U RBP, NAG), glomerular dysfunction (Alb-U and β2M-S) and bone metabolism markers (BAP-S, CTX-S) as well as forearm BMD, were measured. The results of this study based on simple dose-effect analysis showed the relationship between increasing cadmium concentrations and an increased excretion of renal dysfunction markers and decreasing bone density. However, the results of the multivariate analysis did not indicate the association between exposure to cadmium and decrease in bone density. They showed that the most important factors that have impact on bone density are body weight and age in the female subjects and body weight and calcium excretion in males. Our investigation revealed that the excretion of low molecular weight proteins occurred at a lower level of cadmium exposure than the possible loss of bone mass. It seems that renal tubular markers are the most sensitive and significant indicators of early health effects of cadmium intoxication in the general population. The correlation of urinary cadmium concentration with markers of kidney dysfunction was observed in the absence of significant correlations with bone effects. Our findings did not indicate any effects of environmental cadmium exposure on bone density.

  8. Evaluation of aluminium–based coatings for cadmium replacement

    OpenAIRE

    Chalaftris, George

    2003-01-01

    Cadmium electroplating is widely used in the aerospace industry for the corrosion protection of aircraft components like fasteners manufactured from non corrosion resisting high strength steels. However, environmental and safety concerns over the high toxicity of cadmium and its compounds have led to the investigation of suitable replacements. Alternatives to cadmium should offer effective corrosion protection and have no detrimental effects on the steel substrate. Hydrogen is known to be abs...

  9. Hepatotoxicity of Cadmium and Roles of Mitigating Agents

    Directory of Open Access Journals (Sweden)

    Elias Adikwu

    2013-12-01

    Full Text Available There are increasing reports on cadmium associated hepatotoxicity, due to these reports this study reviewed relevant literature on cadmium associated hepatotoxicity with emphasis on doses, route of administration, salt forms (cadmium compounds and the roles of mitigating agents. Reports have shown that continuous exposure of the liver to cadmium has led to hepatotoxicity. Humans are generally exposed to cadmium by two main routes, inhalation and ingestion. In this study, evaluation of relevant literature showed that irrespective of route of administration and salt forms cadmium hepatotoxicity is dose and time dependent. Cadmium associated hepatotoxicity manifested through impaired functions of hepatic biomarkers (transaminases, enzymatic and non enzymatic antioxidants. Histopathological damage to liver architecture manifested as swelling of hepatocytes, focal necrosis, hepatocytes degeneration, dilatation of ribosomes, damage of membrane-bounded lysosomes, nuclear pyknosis and cytoplasm vacuolization. Deterioration of mitochondrial cristae, deposition of collagen fibrils, hypertrophy of kuffer cells, congestion in central veins and sinusoids, infiltration of mixed inflammatory cells and peripheral hemorrhage also occurred. Hepatotoxic effect of cadmium was mitigated by Vitamin C, Vitamin E, Manganese (11 Chloride, N-acetylcysteine and Selenium. Extracts of plant origin including Solanum tuberosum, Calycopteris floribunda Hibiscus sabdariffa mitigated cadmium induced hepatotoxicity. Chemical substances of animal origin including honey and camel milk were reported to have ameliorated cadmium induced hepatotoxicity. One of the mechanisms of cadmium induced hepatotoxicity is reported to be associated with the up regulation of reactive oxygen species (oxidative stress which caused oxidative damage to lipid contents of membranes and direct liver injury. Conclusion cadmium is dose and time dependently hepatotoxic irrespective of route of administration

  10. Cadmium burden and the risk and phenotype of prostate cancer

    OpenAIRE

    Wu Tony T; Wu Hsi-Chin; Pu Yeong S; Chen Yi-Chun; Lai Ming; Yang Chun Y; Sung Fung-Chang

    2009-01-01

    Abstract Background Studies on the association between prostate cancer and cadmium exposure have yielded conflicting results. This study explored cadmium burden on the risk and phenotype of prostate cancer in men with no evident environmental exposure. Methods Hospital-based 261 prostate cancer cases and 267 controls with benign diseases were recruited from four hospitals in Taiwan. Demographic, dietary and lifestyle data were collected by standardized questionnaires. Blood cadmium (BCd) and ...

  11. Association of Environmental Cadmium Exposure with Pediatric Dental Caries

    OpenAIRE

    Arora, Manish; Weuve, Jennifer Lynn; Schwartz, Joel David; Wright, Robert O.

    2008-01-01

    Background: Although animal experiments have shown that cadmium exposure results in severe dental caries, limited epidemiologic data are available on this issue. Objectives: We aimed to examine the relationship between environmental cadmium exposure and dental caries in children 6–12 years of age. Methods: We analyzed cross-sectional data, including urine cadmium concentrations and counts of decayed or filled tooth surfaces, from the Third National Health and Nutrition Examination Survey. We ...

  12. Assessment of soil contamination. Measuring devices for arsenic, berryllium, lead, cadmium, mercury and selenium. Wirkung von Bodenkontaminationen. Messlatten fuer Arsen, Beryllium, Blei, Cadmium, Quecksilber und Selen

    Energy Technology Data Exchange (ETDEWEB)

    Blumenbach, D.; Kloke, A.; Luehr, H.P.

    1991-12-01

    To assess soil contamination with respect to the suitability of the site concerned, it is essential to obtain knowledge of the relationship between soil contamination levels and the effect of the contaminants on a targets meriting protection (e.g. human beings, plants, soil organisms). In this final report, data obtained from literature on the inorganic pollutants arsenic, lead, cadmium, mercury, selenium and beryllium are compiled, and for selected targets an overview is given of the damage occurring at the various concentration levels studies. The present data, together with information on the envisaged use of the site and on soil properties influencing the pollutant's transport to the protected target, can be used to assess soil quality. Threshold values for use in decision-making cannot be derived directly from the presented data, as such data can only convey a picture of the range of the harmful concentrations given in the literature. (orig.).

  13. studies on the use of organic and inorganic ion exchangers for separation of indium(III) from cadmium(II) using analytical methods

    International Nuclear Information System (INIS)

    Organic and inorganic ion exchangers have many applications not only in the industrial, environmental and the nuclear fields but also in the separation of metal ions. This may be returned to its high measured capacity, high selectivity for some metal ions, low solubility, high chemical radiation stability and easy to use.Indium and cadmium are produced from cyclotron target where the solvent extraction represents an ordinary method for separation of indium and cadmium from its target. In the present work, More than chromatographic columns were successfully used for the separation and recovery of indium(III) and cadmium(II) ions from di-component system in aqueous solution using organic and inorganic ion exchangers. The work was carried out in three main parts;1- In the first part, the commercial resin (Dowex50w-x8) was used for the separation of indium from cadmium. The effect of pH, the weight of resin, and equilibrium time on the sorption process of both metal ions were determined. It was found that the adsorption percentage was more than 99% at pH 4 (as optimum pH value) using batch experiment. The results show that indium was first extracted while cadmium is slightly extracted at this pH value. The recovery of indium and cadmium is about 98% using hydrochloric acid as best eluent. The ion exchange/complexing properties of Dowex50w-x8 resin containing various substituted groups towards indium and cadmium cations were investigated.2- In the second part, Zn(II)polymethacrylates, and poly (acrylamide-acrylic acid), as synthetic organic ion exchangers were prepared by gamma irradiation polymerization technique of the corresponding monomer at 30 kGy. The obtained organic resins were mixed with indium ions to determine its capacity in aqueous solutions using batch experiment.

  14. Extraction-photometric determination of cadmium in meat products

    Energy Technology Data Exchange (ETDEWEB)

    Krylova, A.N.; Malyarova, M.A.; Zhulenko, V.N.

    1986-06-01

    As a result of industrial discharges, burning of solid and liquid fuels, and recycling of metal scrap, cadmium compounds enter the atmosphere and drop into the water and soil causing contamination. In this paper, a method was developed for determining cadmium in meat products. It involves wet ashing the sample, extractive separation of the cadmium as the diethyldithiocarbamate, reextraction, and determination as cadmium dithizonate or as a complex with 2,2'-dipyridyl. The detection limit with dithizone is 0.005 mg/kg and with 2,2'-dipyridyl 0.05 mg/kg. An analysis is shown to take less than 60 minutes.

  15. Effects of Cadmium on BMP Induced Bone Formation

    Institute of Scientific and Technical Information of China (English)

    陈秋生; 徐顺清

    2003-01-01

    To demonstrate the direct effects of cadmium on activities of bone morphogenetic protein (BMP), a complex containing BMP and cadmium chloride (CdCl2) was implanted beneath the abdominal skin of young male Wistar rats. The activity of BMP was studied by observing the histological changes, and measuring the activity of alkaline phosphatase (ALP) and acid phosphatase (ACP) and calcium content of the implants at different time points. Our results showed that during bone formation induced by BMP, cadmium inhibited the activities of osteoblasts and osteoclasts, and slowed the deposition of calcium. It is concluded that cadmium can directly affect biological activities of BMP directly.

  16. Bioremoval of cadmium by lemna minor in different aquatic conditions

    Energy Technology Data Exchange (ETDEWEB)

    Uysal, Yagmur [Dept. of Environmental Engineering, Kahramanmaras Sutcu Imam University, Kahramanmaras (Turkey); Taner, Fadime [Dept. of Environmental Engineering, Mersin University, Mersin (Turkey)

    2010-04-15

    This study was undertaken to determine the cadmium removal efficiency of Lemna minor when it was used for treatment of wastewater having different characteristics, i. e., pH, temperature and cadmium concentration. Plants were cultivated in different pH solutions (4.5-8.0) and temperatures (15-35 C) in the presence of cadmium (0.1-10.0 mg/L) for 168 h. The amount of biomass obtained in the study period, the concentrations of cadmium in the tissues and in the media and net uptake of cadmium by Lemna have been determined for each condition. The percentages of cadmium uptake (PMU) and bioconcentration factors (BCF) were also calculated. The highest accumulation was obtained for the highest cadmium concentration of 10.0 mg Cd/L as 11.668 mg Cd/g at pH 6.0, and as 38.650 mg Cd/g at 35 C and pH 5.0. The cadmium accumulation gradually increased with initial concentration of the medium, but the opposite trend was observed for the PMU. However, the maximum PMU was obtained as 52.2% in the solution with the lowest concentration of 0.1 mg Cd/L. A mathematical model was used to describe the cadmium uptake and the equation obtained was seen to fit the experimental data very well. (Abstract Copyright [2010], Wiley Periodicals, Inc.)

  17. Kinetic studies of cadmium sulfide precipitation from aqueous thiourea solutions

    International Nuclear Information System (INIS)

    Kinetics of cadmium sulfide precipitation by thiourea from aqueous solutions containing ammonia complexes of cadmium(II) under conditions of spontaneous initiation of solid phase within solution volume at temperatures of 298-318 K was studied. It was ascertained that the process activation energy is 77843 J/mol, while the reaction order by initial cadmium complex equals unity. Kinetic equation, which permits control over cadmium sulfide precipitation and preparation of CdS films of desired morphology was derived on the basis of the experimental data

  18. Cadmium elemination from phosphoric acid by ionic flotation

    International Nuclear Information System (INIS)

    The ion flotation process for the recovery of cadmium from wet phosphoric acid (30%P2O5) has been studied. This technique combines a chemical recation between the collector and the cadmium to form a precipitate (sublate) which is carried to the surface of the solution by air bubbles. the resulting foam containing the cadmium may then separated from solution. The influence of parameters such as collector and cadmium concentration as well as iron content have been investigated for the case a synthetic acid (30% P2O5). The result have been applied to the industrial phosphoric acid produced from Djebel Onk's phosphates (Algeria)

  19. Cadmium in milk and mammary gland in rats and mice

    International Nuclear Information System (INIS)

    The purpose of the present investigation was to study the uptake of cadmium in mammary tissue, effects on milk secretion and composition, and lactational transport of cadmium to the sucklings. Cadmium exposure during lactation resulted in retention of cadmium in the mammary tissue in mice and rats. The uptake of cadmium in the mammary tissue was rapid, as shown in lactating mice by whole-body autoradiography 4 h after an intravenous injection of a tracer dose of 109CdCl2. Retention of cadmium in kidneys of suckling pups was observed in the autoradiograms at 7 days after exposure of the dams. Lactating rats were intravenously infused with 109CdCl2 in 0.9% saline via osmotic minipumps from day 3 to day 16 after parturition. The cadmium dose given was 0, 8.8, 62 and 300 μg Cd/kg body wt. per day. Plasma and milk were collected at day 10 and 16 after parturition. Plasma cadmium levels in dams increased from day 10 to day 16. Cadmium levels were higher in milk than in plasma, with milk/plasma ratios varying from 2 to 6. Zinc levels in milk were positively correlated to cadmium levels in milk (r2=0.26; P=0.03). In milk, 109Cd was distributed in fat (46-52%), casein fraction (40-46%), and whey fraction (6-8%). There was a high correlation between cadmium concentrations in pups' kidney and cadmium concentrations in dam's milk (r2=0.98; P 109Cd was bound to metallothionein in mammary tissue. The fraction of radiolabelled cadmium bound to metallothionein increased in a dose-dependent manner in both the liver (88-98%) and mammary tissue (57-80%). The present results indicate a low transfer of cadmium to the suckling pup, which might be due to binding of cadmium to metallothionein in the mammary tissue. However, during the susceptible developmental period even a low cadmium exposure may be of concern. (orig.)

  20. Phytoremediation of cadmium contaminated soils by tuberose

    International Nuclear Information System (INIS)

    The potential of three varieties of tuberose (Prajwal, Shringar and Mexican single) for phytoremediation of soil contaminated with cadmium was evaluated by subjecting the plants to five levels of Cd (0, 25, 50, 75 and 100 mg kg-1 soil). Applied Cd did not produce any toxic symptoms in all the three varieties of tuberose except marginal reduction in the photosynthesis rate and total dry weight beyond 50 mg Cd kg-1 soil. The study showed that tuberose possessed the typical ability of Cd hyper accumulator characterized by (1) accumulation of Cd in the shoots of the plant exceeding the critical judging standard i.e., 100 μg g-1 DW and (2) ratio of Cd in the shoots to bulbs >1. It was concluded that tuberose may be an effective accumulator plant for phytoremediation of cadmium polluted soils. (author)

  1. An assessment of alternatives for replacing Freon 113 in bench type electrical circuit board cleaning at Fermi National Accelerator Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Isakson, K.; Vessell, A.L.

    1994-07-01

    Fermilab is presently phasing out all solvents containing Freon-113 (CFC-113) as part of the continuing Waste Minimization Program. These solvents are used primarily in cleaning the flux off of electronic circuit boards after soldering, specifically in bench type work. Title VI of the Clean Air Act mandates a production phase-out for ozone depleting substances, like CFC-113, by the year 2000. Our study addresses this issue by evaluating and choosing alternative non-CFC solvents to replace the CFC-1 13 solvents at Fermilab. Several potential non-CFC cleaning solvents were tested. The evaluation took place in three parts: controlled experimental evaluation, chemical composition evaluation, and employee performed evaluation. First, we performed a controlled nine-step procedure with the potential solvents where each was evaluated in categories such as cleaning effectiveness, odor, residue, type of output and drying time. Next, we listed the chemical composition of each solvent. We noted which solvents contained hydrochlorofluorocarbons because they are targeted for phase-out in the future and will be recognized as interim solutions only. Finally, after preliminary testing, five solvents were chosen as the best options. These solvents were sent to be tested by Fermilab employees who use such materials. Their opinions are valuable not only because they are knowledgeable in this field, but also because they will be using the solvents chosen to replace the CFC-113 solvents. The results favored two ``best alternatives``: Safezone Solvent Flux Remover by Miller-Stephenson and E-Series CFC Free Flux-Off 2000 by Chemtech. Another possible solution also pursued is the no-clean solder option. In our study, we were not able to thoroughly investigate the many types of no-clean solders because of time and financial constraints. The testing that was done, however, showed that no-clean solder was a viable alternative in many cases.

  2. An assessment of alternatives for replacing Freon 113 in bench type electrical circuit board cleaning at Fermi National Accelerator Laboratory

    International Nuclear Information System (INIS)

    Fermilab is presently phasing out all solvents containing Freon-113 (CFC-113) as part of the continuing Waste Minimization Program. These solvents are used primarily in cleaning the flux off of electronic circuit boards after soldering, specifically in bench type work. Title VI of the Clean Air Act mandates a production phase-out for ozone depleting substances, like CFC-113, by the year 2000. Our study addresses this issue by evaluating and choosing alternative non-CFC solvents to replace the CFC-1 13 solvents at Fermilab. Several potential non-CFC cleaning solvents were tested. The evaluation took place in three parts: controlled experimental evaluation, chemical composition evaluation, and employee performed evaluation. First, we performed a controlled nine-step procedure with the potential solvents where each was evaluated in categories such as cleaning effectiveness, odor, residue, type of output and drying time. Next, we listed the chemical composition of each solvent. We noted which solvents contained hydrochlorofluorocarbons because they are targeted for phase-out in the future and will be recognized as interim solutions only. Finally, after preliminary testing, five solvents were chosen as the best options. These solvents were sent to be tested by Fermilab employees who use such materials. Their opinions are valuable not only because they are knowledgeable in this field, but also because they will be using the solvents chosen to replace the CFC-113 solvents. The results favored two ''best alternatives'': Safezone Solvent Flux Remover by Miller-Stephenson and E-Series CFC Free Flux-Off 2000 by Chemtech. Another possible solution also pursued is the no-clean solder option. In our study, we were not able to thoroughly investigate the many types of no-clean solders because of time and financial constraints. The testing that was done, however, showed that no-clean solder was a viable alternative in many cases

  3. Prevention of cadmium bioaccumulation by herbal adaptogens

    OpenAIRE

    K Bharavi; A. Gopala Reddy; G S Rao; Ravi Kumar, P.; D Srinivas Kumar; P Prabhu Prasadini

    2011-01-01

    Objectives : To evaluate the effect of various herbal adaptogens such as shade-dried powders of Withania somnifera, Ocimum sanctum, Asperagus recemosus, Andrographis paniculata, Asphaltum panjabinum (Shilajith), Gymnema sylvestre, Spirulina platensis, and Panex ginseng on cadmium (Cd)-induced oxidative stress and its accumulation in broiler chicken. Materials and Methods : A total of 80 male broiler chicks of day old age were randomly assigned to 10 equal groups. Group 1 birds were fed wi...

  4. ELECTROKINETIC REMEDIATION STUDY FOR CADMIUM CONTAMINATED SOIL

    OpenAIRE

    P. Bala Ramudu; R. P. Tiwari; Srivastava, R. K.

    2007-01-01

    This paper presents the results of an experimental research undertaken to evaluate different purging solutions to enhance the removal of cadmium from spiked contaminated field soil by electrokinetic remediation. Three experiments were conducted when soil was saturated with deionised water and subsequently deionised water, ammonium citrate and sodium citrate were used as purging solutions at anode end. One experiment was conducted when the soil was saturated with ammonium citrate and itself wa...

  5. Electron mobility in mercury cadmium telluride

    Science.gov (United States)

    Patterson, James D.

    1988-01-01

    A previously developed program, which includes all electronic interactions thought to be important, does not correctly predict the value of electron mobility in mercury cadmium telluride particularly near room temperature. Part of the reason for this discrepancy is thought to be the way screening is handled. It seems likely that there are a number of contributors to errors in the calculation. The objective is to survey the calculation, locate reasons for differences between experiment and calculation, and suggest improvements.

  6. Bioaugmentation with cadmium-resistant plant growth-promoting rhizobacteria to assist cadmium phytoextraction by Helianthus annuus.

    Science.gov (United States)

    Prapagdee, Benjaphorn; Chanprasert, Maesinee; Mongkolsuk, Skorn

    2013-07-01

    Micrococcus sp. MU1 and Klebsiella sp. BAM1, the cadmium-resistant plant growth-promoting rhizobacteria (PGPR), produce high levels of indole-3-acetic acid (IAA) during the late stationary phase of their growth. The ability of PGPR to promote root elongation, plant growth and cadmium uptake in sunflowers (Helianthus annuus) was evaluated. Both species of bacteria were able to remove cadmium ions from an aqueous solution and enhanced cadmium mobilization in contaminated soil. Micrococcus sp. and Klebsiella sp. use aminocyclopropane carboxylic acid as a nitrogen source to support their growth, and the minimum inhibitory concentrations of cadmium for Micrococcus sp. and Klebsiella sp. were 1000 and 800mM, respectively. These bacteria promoted root elongation in H. annuus seedlings in both the absence and presence of cadmium compared to uninoculated seedlings. Inoculation with these bacteria was found to increase the root lengths of H. annuus that had been planted in cadmium-contaminated soil. An increase in dry weight was observed for H. annuus inoculated with Micrococcus sp. Moreover, Micrococcus sp. enhanced the accumulation of cadmium in the root and leaf of H. annuus compared to untreated plants. The highest cadmium accumulation in the whole plant was observed when the plants were treated with EDTA following the treatment with Micrococcus sp. In addition, the highest translocation of cadmium from root to the above-ground tissues of H. annuus was found after treatment with Klebsiella sp. in the fourth week after planting. Our results show that plant growth and cadmium accumulation in H. annuus was significantly enhanced by cadmium-resistant PGPRs, and these bacterial inoculants are excellent promoters of phytoextraction for the rehabilitation of heavy metal-polluted environments. PMID:23478127

  7. Bioavailability of cadmium from linseed and cocoa

    DEFF Research Database (Denmark)

    Hansen, Max; Rasmussen, Rie Romme; Sloth, Jens Jørgen

    2014-01-01

    the food authorities in order to give correct advises to the population. The aim of this study was to investigate the bioavailability of cadmium from whole linseed, crushed linseed, cocoa and cadmium chloride in rats. An experiment where 40 rats were divided into 4 groups and a control group and dosed...... with whole linseed, crushed linseed, cocoa and CdCl2 for 3 weeks was performed. Linseed or cocoa made up 10% of the feed (by weight) and was added as a replacement for carbohydrate source. The rats were dosed for 3 weeks and the cadmium content in the rats' kidneys was measured by ICPMS as a biomarker...... which could be measured in the kidney compared to the calculated total intake was as follows: Control 2.0 %, Crushed linseed 0.9 %, whole linseed, 1.5 %, cocoa 0.7 % and CdCl2 4.6 %. Based on this study it could not be concluded that the bioavailability in rats form whole linseed is lower that for...

  8. Soil ecotoxicity assessment using cadmium sensitive plants

    International Nuclear Information System (INIS)

    The crop plants, sorghum and cucumber, can be used as indicator species to assess ecotoxicity of soils contaminated by cadmium. - Four crop plant species (sweet corn, Zea may; wheat, Triticum aestivum; cucumber, Cucumis sativus; and sorghum, Sorghum bicolor) were tested to assess an ecotoxicity in cadmium-amended soils. The measurement endpoints used were seed germination and seedling growth (shoot and root). The presence of cadmium decreased the seedling growth. The medium effective concentration values (EC50) for shoot or root growth were calculated by the Trimmed Spearman-Karber method. Due to the greater accumulation of Cd to the roots, root growth was a more sensitive endpoint than shoot growth. Bioavailability and transport of Cd within plant were related to concentration and species. The ratio of bioaccumulation factor (BAF) in the shoots to the roots indicated high immobilization of Cd in the roots. Seed germination was insensitive to Cd toxicity, and is not recommended for a suitable assay. Among the test plants and test endpoints, root growth of sorghum and cucumber appears to be a good protocol to assess ecotoxicity of soils contaminated by Cd

  9. Soil ecotoxicity assessment using cadmium sensitive plants

    Energy Technology Data Exchange (ETDEWEB)

    An, Youn-Joo

    2004-01-01

    The crop plants, sorghum and cucumber, can be used as indicator species to assess ecotoxicity of soils contaminated by cadmium. - Four crop plant species (sweet corn, Zea may; wheat, Triticum aestivum; cucumber, Cucumis sativus; and sorghum, Sorghum bicolor) were tested to assess an ecotoxicity in cadmium-amended soils. The measurement endpoints used were seed germination and seedling growth (shoot and root). The presence of cadmium decreased the seedling growth. The medium effective concentration values (EC50) for shoot or root growth were calculated by the Trimmed Spearman-Karber method. Due to the greater accumulation of Cd to the roots, root growth was a more sensitive endpoint than shoot growth. Bioavailability and transport of Cd within plant were related to concentration and species. The ratio of bioaccumulation factor (BAF) in the shoots to the roots indicated high immobilization of Cd in the roots. Seed germination was insensitive to Cd toxicity, and is not recommended for a suitable assay. Among the test plants and test endpoints, root growth of sorghum and cucumber appears to be a good protocol to assess ecotoxicity of soils contaminated by Cd.

  10. Use of cadmium in solution in the EL 4 reactor moderator irreversible fixing of cadmium on the metallic surfaces

    International Nuclear Information System (INIS)

    In the framework of research into the poisoning of the EL-4 reactor by cadmium sulphate, measurements have been made by two different methods of the residual amounts of cadmium liable to be fixed irreversibly on the surfaces in contact with the heavy water. A marked influence of the pH has been noticed. The mechanism of the irreversible fixing is compatible with the hypothesis of an ion-exchange in the surface oxide layer. In a sufficiently wide range of pH the cadmium thus fixed causes very little residual poisoning. The stability of the cadmium sulphate solutions is however rather low in the conditions of poisoning. (authors)

  11. Reduction of Cadmium Uptake of Rice Plants Using Soil Amendments in High Cadmium Contaminated Soil: A Pot Experiment

    OpenAIRE

    Dian Siswanto; Parinda Suksabye; Paitip Thiravetyan

    2013-01-01

    The aims of this study were to investigate the effect of agricultural residues on reducing cadmium uptake in rice plants. The rice plants growing on no cadmium/free cadmium soils (N), Cd soils (Cds), and Cd soils each amended with 1% w/w of coir pith (CP), coir pith modified with sodium hydroxide (CPm) and corncob (CC) under high cadmium contaminated soil with an average 145 mg Cd kg-1 soil were investigated. The results showed that the cumulative transpiration of rice grown in various treatm...

  12. Measuring changes in substrate utilization in the myocardium in response to fasting using hyperpolarized [1-(13)C]butyrate and [1-(13)C]pyruvate.

    Science.gov (United States)

    Bastiaansen, Jessica A M; Merritt, Matthew E; Comment, Arnaud

    2016-01-01

    Cardiac dysfunction is often associated with a shift in substrate preference for ATP production. Hyperpolarized (HP) (13)C magnetic resonance spectroscopy (MRS) has the unique ability to detect real-time metabolic changes in vivo due to its high sensitivity and specificity. Here a protocol using HP [1-(13)C]pyruvate and [1-(13)C]butyrate is used to measure carbohydrate versus fatty acid metabolism in vivo. Metabolic changes in fed and fasted Sprague Dawley rats (n = 36) were studied at 9.4 T after tail vein injections. Pyruvate and butyrate competed for acetyl-CoA production, as evidenced by significant changes in [(13)C]bicarbonate (-48%), [1-(13)C]acetylcarnitine (+113%), and [5-(13)C]glutamate (-63%), following fasting. Butyrate uptake was unaffected by fasting, as indicated by [1-(13)C]butyrylcarnitine. Mitochondrial pseudoketogenesis facilitated the labeling of the ketone bodies [1-(13)C]acetoacetate and [1-(13)C]β-hydroxybutyryate, without evidence of true ketogenesis. HP [1-(13)C]acetoacetate was increased in fasting (250%) but decreased during pyruvate co-injection (-82%). Combining HP (13)C technology and co-administration of separate imaging agents enables noninvasive and simultaneous monitoring of both fatty acid and carbohydrate oxidation. This protocol illustrates a novel method for assessing metabolic flux through different enzymatic pathways simultaneously and enables mechanistic studies of the changing myocardial energetics often associated with disease. PMID:27150735

  13. Cadmium sulfate complexing with thiourea during preparation of cadmium sulfide films

    International Nuclear Information System (INIS)

    Composition of complexes deposited from cadmium sulfate and thiourea(TU) aqueous solution is studied. Its influence on cadmium sulfide film deposition during solution spraying is ascertained. It is shown that with increase of TU concentration in aqueous solution gradual substitution of TU molecules for the first sphere SO42- ions takes place. As a result CdS deposition from these solutions is initiated when the ratio of CdSO4:TU concentrations is 1:2 and for prepartation of uniform films a five-fold TU excess as a minimum is necessary

  14. High rate deposition of thin film cadmium sulphide by pulsed direct current magnetron sputtering

    International Nuclear Information System (INIS)

    Cadmium Sulphide (CdS) is an important n-type semiconductor widely used as a window layer in thin film photovoltaics Copper Indium Selenide, Copper Indium Gallium (di)Selenide, Copper Zinc Tin Sulphide and Cadmium Telluride (CdTe). Cadmium Sulphide has been deposited using a number of techniques but these techniques can be slow (chemical bath deposition and Radio Frequency sputtering) or the uniformity and the control of thickness can be relatively difficult (close space sublimation). In this paper we report on the development of a process using pulsed Direct Current magnetron sputtering which allows nanometre control of thin film thickness using time only. The CdS thin films deposited in this process are highly uniform and smooth. They exhibit the preferred hexagonal structure at room temperature deposition and they have excellent optical properties. Importantly, the process is highly stable despite the use of a semi-insulating magnetron target. Moreover, the process is very fast. The deposition rate using 1.5 kW of power to a 6-inch circular magnetron was measured to be greater than 8 nm/s. This makes the process suitable for industrial deployment. - Highlights: • Pulsed DC magnetron sputtering of CdS • High deposition rate deposition • Uniform, pinhole free films

  15. Correlative characteristic of cadmium in soils of steppe Dnieper region

    Directory of Open Access Journals (Sweden)

    N. M. Tsvetkova

    2015-09-01

    Full Text Available Much attention is paid to searching for methods of establishing environmental standards for objective assessment of admissibility of anthropogenic load on the biosphere. The main pollutants of the environment are xenobiotics; heavy metals such as cadmium occupy hold a special place among them. Cadmium is one of the most dangerous environmental toxic agents, belonging to the 1stclass of hazard. Due to insufficient and fragmented information available on the distribution of cadmium in the city edaphotopes, it’s necessary to conduct additional research, taking into account the properties of soils and the biological characteristics of every element. The paper shows the ratio of cadmium in soils and soil-forming rocks of steppe Dnieper region. Environmental assessment of cadmium content in Dniprodzerzhinsk city soilsis made, and the problem of topsoil contamination of the city as a territory of high anthropogenic load is considered. It is found that the content of cadmium down the profile in natural soil increases. Enrichment of the topsoil with cadmium occurs due to contamination. The value of movable forms content, expressed as a percentage of the total content, varies from 12% to 70%, providing the evidence of the technogenic origin of cadmium in Dniprodzerzhinsk city topsoil. General and proximate correlation analyses of interrelation of soil cadmium and specifically selected characteristics of soil (pH, humus, sulfate ions, dry solid, chloride ions, total alkalinity, hygroscopic moisture were made. It is established that cadmium concentration in the movable forms of natural soils of the steppe Dnieper region depends primarily on pH value. With the increase in pH value, concentration of movable cadmium in soil increases.

  16. Critical review of animal carcinogenesis by cadmium and its inorganic compounds

    International Nuclear Information System (INIS)

    Animal carcinogenic biassays relative to 6 inorganic cadmium substances (cadmium metal, cadmium oxide, cadmium sulfide, cadmium sulfate, cadmium chloride and cadmium acetate) are reviewed (speciation). Critical evaluation of literature data on carcinogenicity has been performed by making reference to E.C. guidelines of good laboratory practice. There are few data on routes relevant for human risk assessment: experiments on inhalation demonstrate lung carcinogenicity of cadmium oxide, cadmium sulfide, cadmium sulfate and cadmium chloride in rats but not in mice nor in hamsters; no carcinogenic effects of cadmium compounds are observed following oral administration. For routes of less or no relevance for human risk assessment, some results are clearly positive: subcutaneous injection induces cancers in situ (various cadmium compounds), testicular tumours (cadmium sulfate and cadmium chloride) and prostatic tumours (cadmium chloride) but such effects are not observed using relevant malignancies in rats. With respect to other no relevant routes (intraperitoneal, intrarenal...) tumours are incidentally produced in situ, but not in remote organs. Numerous studies fail to demonstrate cadmium carcinogenicity, but methodologically acceptable negative ones are very limited in number. Accordingly strain dependent effects and dose effect relationship could not be thoroughly assessed

  17. STS-108 backup crew member Padalka in an M-113

    Science.gov (United States)

    2001-01-01

    KENNEDY SPACE CENTER, Fla. -- Joining the STS-108 crew and Expedition 4 crew, cosmonaut Gennadi Padalka is ready to practice driving an M-113 armored personnel carrier. Padalka completed training in 2000 for a space flight on Soyuz-TM transport vehicle as a commander of an ISS contingency crew and is part of a backup crew for the Expedition 4. STS-108 is a Utilization Flight that will carry the replacement Expedition 4 crew to the International Space Station, as well as the Multi-Purpose Logistics Module Raffaello, filled with supplies and equipment. The l1-day mission is scheduled for launch Nov. 29 on Space Shuttle Endeavour.

  18. STS-113 P1 Truss payload in the SSPF

    Science.gov (United States)

    2002-01-01

    KENNEDY SPACE CENTER, FLA. -- Inside the Space Station Processing Facility, the P1 Truss Segment is lowered into the payload canister. The P1 truss is the primary payload for Mission STS-113. It is the first port truss segment which will be attached to the Station'''s central truss segment, S0. Once delivered, the P1 truss will remain stowed until flight 12A.1. The mission will also deliver the Expedition 6 crew to the Station and return Expedition 5 to Earth. Space Shuttle Endeavour is scheduled to launch no earlier than Nov. 10 on the 11-day mission.

  19. STS-113 P1 Truss paylad in Payload Changeout Room

    Science.gov (United States)

    2002-01-01

    KENNEDY SPACE CENTER, FLA. - From the Payload Changeout Room on Launch Pad 39A, the P1 truss payload, plus the Crew and Equipment Translation Aid (CETA) cart B, are moved into the payload bay of Space Shuttle Endeavour. Scheduled to launch Nov. 10 on mission STS-113, Endeavour will make the 16th assembly flight to the International Space Station. Once delivered, the P1 truss will remain stowed until flight 12A.1 in 2003 when it will be attached to the central truss segment, S0, on the Space Station. The mission will also deliver the Expedition 6 crew to the Station and return Expedition 5 to Earth.

  20. Identification of proteins that interact with murine cytomegalovirus early protein M112-113 in brain

    Institute of Scientific and Technical Information of China (English)

    WANG Hui; LIU Xing-lou; SHU Sai-nan; HUANG Yong-jian; FANG Feng

    2011-01-01

    Background Murine cytomegalovirus (MCMV) early protein M112-113 is involved in viral DNA replication and believed to play a crucial role in the viral pathogenesis.To investigate the biological function of M112-113 protein in the pathogenesis of the brain disorders caused by cytomegalovirus (CMV),a screening for proteins interacting with M112-113 was performed by a yeast two-hybrid system.Methods Bait plasmid pGBKT7-M112-113 was constructed and transformed into AH109 yeast.After confirmation of the expression of MCMV M112-113 in yeast,the bait yeast was mated with a prey yeast containing mouse brain cDNA library plasmid to screen the proteins interacting with M112-113.Interactions between M112-113 and the obtained proteins were verified by yeast two-hybrid assay and chemiluminescent co-immunoprecipitaion.Results Two proteins interacting with M112-113 were identified,including metastasis-associated 1 (MTA1) and zinc finger,CCHC domain containing 18 (ZCCHC18).M112-113 protein could interact with MTA1 or ZCCHC18 in yeast and mammalian cells.Conclusion The interactions of M112-113 with MTA1 or ZCCHC18 may be related to the pathogenesis of MCMV-associated disease in central nervous system.

  1. Naringenin protects against cadmium-induced oxidative renal dysfunction in rats.

    Science.gov (United States)

    Renugadevi, J; Prabu, S Milton

    2009-02-01

    Cadmium (Cd) is an environmental and industrial pollutant that affects various organs in human and experimental animals. Naringenin is a naturally occurring plant bioflavonoid found in citrus fruits, which has been reported to have a wide range of pharmacological properties. A body of evidence has accumulated implicating the free radical generation with subsequent oxidative stress in the biochemical and molecular mechanisms of cadmium toxicity. Since kidney is the critical target organ of chronic Cd toxicity, we carried out this study to investigate the effects of naringenin on Cd-induced toxicity in the kidney of rats. In experimental rats, oral administration of cadmium chloride (5mg/(kgday)) for 4 weeks significantly induced the renal damage which was evident from the increased levels of serum urea, uric acid, creatinine with a significant (pCadmium also significantly decreased the levels of urea, uric acid and creatinine in urine. A markedly increased levels of lipid peroxidation markers (thiobarbituric acid reactive substances and lipid hydroperoxides) and protein carbonyl contents with significant (pcadmium-treated rats. Co-administration of naringenin (25 and 50mg/(kgday)) along with Cd resulted in a reversal of Cd-induced biochemical changes in kidney accompanied by a significant decrease in lipid peroxidation and an increase in the level of renal antioxidant defense system. The histopathological studies in the kidney of rats also showed that naringenin (50mg/(kgday)) markedly reduced the toxicity of Cd and preserved the normal histological architecture of the renal tissue. The present study suggest that the nephroprotective potential of naringenin in Cd toxicity might be due to its antioxidant and metal chelating properties, which could be useful for achieving optimum effects in Cd-induced renal damage. PMID:19063931

  2. Gene expression profiling in rat kidney after intratracheal exposure to cadmium-doped nanoparticles

    International Nuclear Information System (INIS)

    While nephrotoxicity of cadmium is well documented, very limited information exists on renal effects of exposure to cadmium-containing nanomaterials. In this work, “omics” methodologies have been used to assess the action of cadmium-containing silica nanoparticles (Cd-SiNPs) in the kidney of Sprague-Dawley rats exposed intratracheally. Groups of animals received a single dose of Cd-SiNPs (1 mg/rat), CdCl2 (400 μg/rat) or 0.1 ml saline (control). Renal gene expression was evaluated 7 and 30 days post exposure by DNA microarray technology using the Agilent Whole Rat Genome Microarray 4x44K. Gene modulating effects were observed in kidney at both time periods after treatment with Cd-SiNPs. The number of differentially expressed genes being 139 and 153 at the post exposure days 7 and 30, respectively. Renal gene expression changes were also observed in the kidney of CdCl2-treated rats with a total of 253 and 70 probes modulated at 7 and 30 days, respectively. Analysis of renal gene expression profiles at day 7 indicated in both Cd-SiNP and CdCl2 groups downregulation of several cluster genes linked to immune function, oxidative stress, and inflammation processes. Differing from day 7, the majority of cluster gene categories modified by nanoparticles in kidney 30 days after dosing were genes implicated in cell regulation and apoptosis. Modest renal gene expression changes were observed at day 30 in rats treated with CdCl2. These results indicate that kidney may be a susceptible target for subtle long-lasting molecular alterations produced by cadmium nanoparticles locally instilled in the lung.

  3. Comparative genomic analyses identify common molecular pathways modulated upon exposure to low doses of arsenic and cadmium

    Directory of Open Access Journals (Sweden)

    Fry Rebecca C

    2011-04-01

    Full Text Available Abstract Background Exposure to the toxic metals arsenic and cadmium is associated with detrimental health effects including cancers of various organs. While arsenic and cadmium are well known to cause adverse health effects at high doses, the molecular impact resulting from exposure to environmentally relevant doses of these metals remains largely unexplored. Results In this study, we examined the effects of in vitro exposure to either arsenic or cadmium in human TK6 lymphoblastoid cells using genomics and systems level pathway mapping approaches. A total of 167 genes with differential expression were identified following exposure to either metal with surprisingly no overlap between the two. Real-time PCR was used to confirm target gene expression changes. The gene sets were overlaid onto protein-protein interaction maps to identify metal-induced transcriptional networks. Interestingly, both metal-induced networks were significantly enriched for proteins involved in common biological processes such as tumorigenesis, inflammation, and cell signaling. These findings were further supported by gene set enrichment analysis. Conclusions This study is the first to compare the transcriptional responses induced by low dose exposure to cadmium and arsenic in human lymphoblastoid cells. These results highlight that even at low levels of exposure both metals can dramatically influence the expression of important cellular pathways.

  4. Long non-coding RNAs as novel expression signatures modulate DNA damage and repair in cadmium toxicology

    Science.gov (United States)

    Zhou, Zhiheng; Liu, Haibai; Wang, Caixia; Lu, Qian; Huang, Qinhai; Zheng, Chanjiao; Lei, Yixiong

    2015-10-01

    Increasing evidence suggests that long non-coding RNAs (lncRNAs) are involved in a variety of physiological and pathophysiological processes. Our study was to investigate whether lncRNAs as novel expression signatures are able to modulate DNA damage and repair in cadmium(Cd) toxicity. There were aberrant expression profiles of lncRNAs in 35th Cd-induced cells as compared to untreated 16HBE cells. siRNA-mediated knockdown of ENST00000414355 inhibited the growth of DNA-damaged cells and decreased the expressions of DNA-damage related genes (ATM, ATR and ATRIP), while increased the expressions of DNA-repair related genes (DDB1, DDB2, OGG1, ERCC1, MSH2, RAD50, XRCC1 and BARD1). Cadmium increased ENST00000414355 expression in the lung of Cd-exposed rats in a dose-dependent manner. A significant positive correlation was observed between blood ENST00000414355 expression and urinary/blood Cd concentrations, and there were significant correlations of lncRNA-ENST00000414355 expression with the expressions of target genes in the lung of Cd-exposed rats and the blood of Cd exposed workers. These results indicate that some lncRNAs are aberrantly expressed in Cd-treated 16HBE cells. lncRNA-ENST00000414355 may serve as a signature for DNA damage and repair related to the epigenetic mechanisms underlying the cadmium toxicity and become a novel biomarker of cadmium toxicity.

  5. Levels of arsenic, cadmium, lead and mercury in the branchial plate and muscle tissue of mobulid rays

    International Nuclear Information System (INIS)

    Highlights: • Branchial plate and muscle tissue from mobulid rays were analysed for certain metals. • Mean concentrations of cadmium in Mobula japanica were above the EC ML. • Mean inorganic arsenic concentration in Mobula japanica muscle equalled the FSANZ ML. • Mean concentration of lead in Manta alfredi muscle tissue exceeded EC and Codex MLs. • There were significant correlations between the types of tissues for some metals. - Abstract: Mobulid rays are targeted in fisheries for their branchial plates, for use in Chinese medicine. Branchial plate and muscle tissue from Mobula japanica were collected from fish markets in Sri Lanka, and muscle tissue biopsies from Manta alfredi in Australia. These were analysed for arsenic, cadmium, lead and mercury and compared to maximum levels (MLs) set by Food Standards Australia and New Zealand (FSANZ), European Commission (EC) and Codex Alimentarius Commission. The estimated intake for a vulnerable human age group was compared to minimal risk levels set by the Agency for Toxic Substances and Disease Registry. The mean inorganic arsenic concentration in M. japanica muscle was equivalent to the FSANZ ML while cadmium exceeded the EC ML. The mean concentration of lead in M. alfredi muscle tissue exceeded EC and Codex MLs. There were significant positive linear correlations between branchial plate and muscle tissue concentrations for arsenic, cadmium and lead

  6. Cadmium interferes with the degradation of ATF5 via a post-ubiquitination step of the proteasome degradation pathway

    International Nuclear Information System (INIS)

    ATF5 is a member of the CREB/ATF family of transcription factors. In the current study, using a transient transfection system to express FLAG epitope fusion proteins of ATF5, we have shown that CdCl2 or NaAsO3 increases the protein levels of ATF5 in cells, and that cadmium stabilizes the ATF5 protein. Proteasome inhibitors had a similar effect to cadmium on the cellular accumulation of ATF5. Proteasome inhibition led to an increase in ubiquitinated ATF5, while cadmium did not appear to reduce the extent of ATF5 ubiquitination. ATF5 contains a putative nuclear export signal within its N-terminus. We demonstrated that whereas deletion of N-terminal region resulted in a increase of ATF5 levels, this region does not appear to be involved in the ubiquitination of ATF5. These results indicate that ATF5 is targeted for degradation by the ubiquitin-proteasome pathway, and that cadmium slows the rate of ATF5 degradation via a post-ubiquitination mechanism.

  7. Effects of Aluminium Sulfate on Cadmium Accumulation in Rice

    International Nuclear Information System (INIS)

    Full text: Cadmium accumulation in Pathum Thani 1 and Suphan Buri 60 rice cultivars was investigated upon treatment with aluminium sulfate as a precipitant. Rice was grown hydroponically in a medium containing 4 ppm cadmium nitrate with or without 4 ppm aluminium sulfate. Root, stem with leaves and grain samples were collected and analyzed for cadmium content using atomic absorption spectroscopy and inductively coupled plasma atomic emission spectroscopy. Without the addition of aluminium sulfate, Pathum Thani 1 and Suphan Buri 60 accumulated 24.71∫ 3.14 ppm and 34.43 ∫ 4.51 ppm (dry weight of whole plant) of cadmium, respectively. With aluminium sulfate, cadmium accumulation increased to 40.66 ∫ 2.47 ppm and 62.94 ∫ 10.69 ppm, respectively. The addition of aluminium sulfate to the planting medium did not reduce cadmium accumulation but caused the rice to accumulate more cadmium especially in the shoots and grains. This observation might serve as the basis for future research on the management of agricultural areas that are contaminated with cadmium and aluminium

  8. Phytoremediation of cadmium and nickel by Spirodela polyrhiza

    International Nuclear Information System (INIS)

    Heavy metal pollution in surface and groundwater has considerably increased in the last few years. It is essential to have an effective removal mechanism of these toxic metals. Current research includes the need to develop environment friendly and cost effective technologies for removing heavy metals from water. In several studies cadmium and nickel have been considerably removed using phytoremediation. The removal efficiency of cadmium and nickel by Spirodela polyrhiza, common duckweed has been examined in the present study for 3 different concentrations of cadmium (1, 2 and 3 mg/L) and nickel (4, 5 and 6 mg/L). Two sets of experiments for cadmium and nickel were conducted separately. Effect of metal toxicity on Spirodela polyrhiza was evaluated in terms of relative growth factor and cadmium was found to be more toxic than nickel. Under experimental condition BCF value for cadmium removal was more than >1000 in all the 3 concentrations of cadmium. But the BCF value was found to be more than > 1000 only when input nickel concentration was 4 mg/L during phytoremediation process. Experimental results suggest that Spirodela polyrhiza has the potential of accumulating cadmium and nickel from aqueous solution at lower metal concentration. (author)

  9. Cadmium inhibits neurogenesis in zebrafish embryonic brain development

    Energy Technology Data Exchange (ETDEWEB)

    Chow, Elly Suk Hen [Division of Biology, California Institute of Technology, 1200 California Boulevard, Pasadena, CA 91125 (United States); Hui, Michelle Nga Yu; Lin Chunchi [Department of Biology and Chemistry, City University of Hong Kong, 83 Tat Chee Avenue, Kowloon, Hong Kong (China); Cheng Shukhan [Department of Biology and Chemistry, City University of Hong Kong, 83 Tat Chee Avenue, Kowloon, Hong Kong (China)], E-mail: bhcheng@cityu.edu.hk

    2008-05-01

    Cadmium is a non-essential heavy metal found abundantly in the environment. Children of women exposed to cadmium during pregnancy display lower motor and perceptual abilities. High cadmium body burden in children is also related to impaired intelligence and lowered school achievement. However, little is known about the molecular and cellular basis of developmental neurotoxicity in the sensitive early life stages of animals. In this study, we explore neurological deficits caused by cadmium during early embryonic stages in zebrafish by examining regionalization of the neural tube, pattern formation and cell fate determination, commitment of proneural genes and induction of neurogenesis. We show that cadmium-treated embryos developed a smaller head with unclear boundaries between the brain subdivisions, particularly in the mid-hindbrain region. Embryos display normal anterior to posterior regionalization; however, the commitment of neural progenitor cells was affected by cadmium. We observe prominent reductions in the expression of several proneuronal genes including ngn1 in cell clusters, zash1a in the developing optic tectum, and zash1b in the telencephalon and tectum. Cadmium-treated embryos also have fewer differentiated neurons and glia in the facial sensory ganglia as indicated by decreased zn-12 expression. Also, a lower transcription level of neurogenic genes, ngn1 and neuroD, is observed in neurons. Our data suggest that cadmium-induced neurotoxicity can be caused by impaired neurogenesis, resulting in markedly reduced neuronal differentiation and axonogenesis.

  10. Epigenetic Effects of Cadmium [Abstract and Poster 2014

    Science.gov (United States)

    We have reviewed the literature on in vitro and in vivo experiments as well as human studies on cadmium to understand the epigenetic mechanisms involved in cadmium- induced toxicity and carcinogenicity. This presentation will identify gaps in our current understanding and suggest...

  11. Removing cadmium from electroplating wastewater by waste saccharomyces cerevisiae

    Institute of Scientific and Technical Information of China (English)

    DAI Shu-juan; WEI De-zhou; ZHOU Dong-qin; JIA Chun-yun; WANG Yu-juan; LIU Wen-gang

    2008-01-01

    The appropriate condition and scheme of removing cadmium from electroplating wastewater were investigated by adsorption-precipitation method using waste saccharomyces cerevisiae(WSC) as sorbent. Effect factors on biosorption of cadmium in cadmium-containing electroplating wastewater by waste saccharomyces cerevisiae and precipitation process of waste saccharomyces cerevisiae after adsorbing cadmium were studied. The results show that removal rate of cadmium is over 88% after 30 min adsorbing under the condition of cadmium concentration 26 mg/L, the dosage of waste saccharomyces cerevisiae 16.25 g/L, temperature 18 ℃, pH 6.0 and precipitation time 4 h. Biosorption-precipitation method is effective to remove cadmium in cadmium-containing electroplating wastewater by waste saccharomyces cerevisiae. The SEM, infrared spectroscopy and Zeta-potential of the cells show that chemical chelating is the main adsorption form; electrostatic attraction, hydrogen bonding and van der Waals force all function in adsorption process; and ―NH2―,―C=O―,―C=O―NH―,―CH3, ―OH are the main adsorption groups.

  12. Method of making a thin film cadmium telluride solar cell

    International Nuclear Information System (INIS)

    A method for making a photovoltaic cell is described comprising the steps of: (a) depositing a transparent or semi-transparent conductive window layer onto a substrate; (b) depositing a layer of cadmium telluride including phosphorus onto the window layer; (c) depositing a layer of lead telluride onto the layer of cadmium telluride; and (d) depositing a metallic electrode onto the lead telluride layer

  13. Effect of environmental exposure to Cadmium on pregnancy outcome

    Directory of Open Access Journals (Sweden)

    F. Ramezanzadeh

    2010-04-01

    Full Text Available "n "n "nBackgrounds andObjectives:The objective of the present study was to evaluate the potential effect of environmental exposure to toxic metal (cadmium on pregnancy outcome and fetal growth."nMaterials and Methods: 330 normal pregnant women were randomly selected from vali-e-asr hospital, from July 2003 through Feb. 2005. Cadmium was measured in umbilical cord blood and mother whole blood of postpartum women without occupational exposure to metals in Tehran, Iran, using inductively coupled plasma mass spectrometry"nResult: Whole blood cadmium and cord blood cadmium ranged from 0/00 to 6/30 μg/L ,respectivly. in the group higher level of maternal blood cadmium (> 0.40 μg/L 1cm decrease was seen in neonatal birth height. (p = 0.007 There was a significant association between cadmium exposure and birth weight.Mann-whitney test showed that, maternal blood cadmium level, was significantly negatively associated with neonatal birth weight (z = -1.83, P < 0.06."nConclusion: It was concluded that environmental exposure to cadmium significantly reduces neonatal birth height.

  14. Risk of overestimation of urinary cadmium concentrations: interference from molybdenum

    Directory of Open Access Journals (Sweden)

    Cañas A.I.

    2013-04-01

    Full Text Available We show here that the selection of analytical method is critical when measuring low levels of cadmium in human urine. Cadmium is today usually analyzed by Inductively Coupled Plasma Mass Spectrometry (ICP-MS, which has a higher sensitivity than Atomic Absorption Spectroscopy (AAS. ICP-MS cadmium measurements show interference from tin (114Sn and molybdenum oxides, which can result in an overestimation of cadmium levels. The 114Sn interference is stable and can be mathematically corrected. Molybdenum concentrations in urine are variable and different from individual to individual. We have estimated the degree of error which molybdenum interference introduces in the measurement of cadmium in urine by conventional ICP-MS. 268 urine samples from mothers and their children were measured. Removal of the molybdenum oxide interference (DRC-ICP-MS method reduced urinary cadmium concentrations significantly (47.8%. The urinary molybdenum concentration in children was higher than in their mothers, resulting in greater overestimation. Our results clearly show that the DRC method is essential for reliable measurements of urinary cadmium concentrations, particularly in children. Furthermore, care should be taken when comparing Human Biomonitoring data for cadmium in urine and attention should be paid to which analytical method has been used (e.g. AAS and ICP-Ms, and especially if the measurements have been corrected for molybdenum interference.

  15. Electrolytic indium refining from cadmium in glycerine electrolyte

    International Nuclear Information System (INIS)

    The results of investigations directed on development of electrochemical indium cleaning from cadmium in glycerine base electrolyte are presented. Optimal operational conditions, specific consumption of reactants and electric power are determined. Relationship between variation of concentration of cadmium impurity in refined metal and duration of electrolysis is revealed. The method for determination of cleaning time is proposed. Developed process was put into commercial operation

  16. Cadmium and zinc reversibly arrest development of Artemia larvae

    Energy Technology Data Exchange (ETDEWEB)

    Bagshaw, J.C.; Rafiee, P.; Matthews, C.O.; MacRae, T.H.

    1986-08-01

    Despite the widespread distribution of heavy metals such as cadmium and zinc in the environment and their well-known cytotoxicity and embryotoxicity in mammals, comparatively little is known about their effect on aquatic organisms, particularly invertebrates. Post-gastrula and early larval development of the brine shrimp, Artemia, present some useful advantages for studies of developmental aspects of environmental toxicology. Dormant encysted gastrulae, erroneously called brine shrimp eggs, can be obtained commercially and raised in the laboratory under completely defined conditions. Following a period of post-gastrula development within the cyst, pre-nauplius larvae emerge through a crack in the cyst shell. A few hours later, free-swimming nauplius larvae hatch. Cadmium is acutely toxic to both adults and nauplius larvae of Artemia, but the reported LC50s are as high as 10 mM, depending on larval age. In this paper the authors show that pre-nauplius larvae prior to hatching are much more sensitive to cadmium than are hatched nauplius larvae. At 0.1 ..mu..m, cadmium retards development and hatching of larvae; higher concentrations block hatching almost completely and thus are lethal. However, the larvae arrested at the emergence stage survive for 24 hours or more before succumbing to the effects of cadmium, and during this period the potentially lethal effect is reversible if the larvae are placed in cadmium-free medium. The effects of zinc parallel those of cadmium, although zinc is somewhat less toxic than cadmium at equal concentrations.

  17. Cadmium inhibits neurogenesis in zebrafish embryonic brain development

    International Nuclear Information System (INIS)

    Cadmium is a non-essential heavy metal found abundantly in the environment. Children of women exposed to cadmium during pregnancy display lower motor and perceptual abilities. High cadmium body burden in children is also related to impaired intelligence and lowered school achievement. However, little is known about the molecular and cellular basis of developmental neurotoxicity in the sensitive early life stages of animals. In this study, we explore neurological deficits caused by cadmium during early embryonic stages in zebrafish by examining regionalization of the neural tube, pattern formation and cell fate determination, commitment of proneural genes and induction of neurogenesis. We show that cadmium-treated embryos developed a smaller head with unclear boundaries between the brain subdivisions, particularly in the mid-hindbrain region. Embryos display normal anterior to posterior regionalization; however, the commitment of neural progenitor cells was affected by cadmium. We observe prominent reductions in the expression of several proneuronal genes including ngn1 in cell clusters, zash1a in the developing optic tectum, and zash1b in the telencephalon and tectum. Cadmium-treated embryos also have fewer differentiated neurons and glia in the facial sensory ganglia as indicated by decreased zn-12 expression. Also, a lower transcription level of neurogenic genes, ngn1 and neuroD, is observed in neurons. Our data suggest that cadmium-induced neurotoxicity can be caused by impaired neurogenesis, resulting in markedly reduced neuronal differentiation and axonogenesis

  18. Cadmium Removal from Aqueous Solutions by Ground Pine Cone

    Directory of Open Access Journals (Sweden)

    H Izanloo, S Nasseri

    2005-01-01

    Full Text Available A study on the removal of cadmium ions from aqueous solutions by pine cone was conducted in batch conditions. Kinetic data and equilibrium removal isotherms were obtained. The influence of different experimental parameters such as contact time, initial concentration of cadmium, pine cone mass and particle size, and temperature on the kinetics of cadmium removal was studied. Results showed that the main parameters that played an important role in removal phenomenon were initial cadmium concentration, particle size and pine cone mass. The necessary time to reach equilibrium was between 4 and 7 hours based on the initial concentration of cadmium. The capacity of cadmium adsorption at equilibrium increased with the decrease of pine cone particle size. The capacity of cadmium adsorption at equilibrium by pine cone increased with the quantity of pine cone introduced (1–4 g/L. Temperature in the range of 20-30°C showed a restricted effect on the removal kinetics (13.56 mg/g at 20°C and a low capacity of adsorption about 11.48 mg/g at 30°C. The process followed pseudo second-order kinetics. The cadmium uptake of pine cone was quantitatively evaluated using adsorption isotherms. Results indicated that the Langmuir model gave a better fit to the experimental data in comparison with the Freundlich equation.

  19. Rare decays of cadmium and tellurium

    International Nuclear Information System (INIS)

    We report on the pulse height spectrum observed with a CdTe detector in a low-background shield. The spectrum is dominated by the T/sub 1/2/∼10/sup 16/ yr β- decay of /sup 113/Cd. Limits are set on the double beta decay of the isotopes /sup 106,114,116/Cd and /sup 128,130/Te, and the prospects for a more sensitive search for this mode of decay are discussed

  20. PG 1553+113: Five Years of Observations with MAGIC

    Science.gov (United States)

    Aleksić, J.; Alvarez, E. A.; Antonelli, L. A.; Antoranz, P.; Asensio, M.; Backes, M.; Barrio, J. A.; Bastieri, D.; Becerra González, J.; Bednarek, W.; Berdyugin, A.; Berger, K.; Bernardini, E.; Biland, A.; Blanch, O.; Bock, R. K.; Boller, A.; Bonnoli, G.; Borla Tridon, D.; Braun, I.; Bretz, T.; Cañellas, A.; Carmona, E.; Carosi, A.; Colin, P.; Colombo, E.; Contreras, J. L.; Cortina, J.; Cossio, L.; Covino, S.; Dazzi, F.; De Angelis, A.; De Caneva, G.; De Cea del Pozo, E.; De Lotto, B.; Delgado Mendez, C.; Diago Ortega, A.; Doert, M.; Domínguez, A.; Dominis Prester, D.; Dorner, D.; Doro, M.; Elsaesser, D.; Ferenc, D.; Fonseca, M. V.; Font, L.; Fruck, C.; García López, R. J.; Garczarczyk, M.; Garrido, D.; Giavitto, G.; Godinović, N.; Hadasch, D.; Häfner, D.; Herrero, A.; Hildebrand, D.; Höhne-Mönch, D.; Hose, J.; Hrupec, D.; Huber, B.; Jogler, T.; Kellermann, H.; Klepser, S.; Krähenbühl, T.; Krause, J.; La Barbera, A.; Lelas, D.; Leonardo, E.; Lindfors, E.; Lombardi, S.; López, M.; López-Oramas, A.; Lorenz, E.; Makariev, M.; Maneva, G.; Mankuzhiyil, N.; Mannheim, K.; Maraschi, L.; Mariotti, M.; Martínez, M.; Mazin, D.; Meucci, M.; Miranda, J. M.; Mirzoyan, R.; Miyamoto, H.; Moldón, J.; Moralejo, A.; Munar-Adrover, P.; Nieto, D.; Nilsson, K.; Orito, R.; Oya, I.; Paneque, D.; Paoletti, R.; Pardo, S.; Paredes, J. M.; Partini, S.; Pasanen, M.; Pauss, F.; Perez-Torres, M. A.; Persic, M.; Peruzzo, L.; Pilia, M.; Pochon, J.; Prada, F.; Prada Moroni, P. G.; Prandini, E.; Puljak, I.; Reichardt, I.; Reinthal, R.; Rhode, W.; Ribó, M.; Rico, J.; Rügamer, S.; Saggion, A.; Saito, K.; Saito, T. Y.; Salvati, M.; Satalecka, K.; Scalzotto, V.; Scapin, V.; Schultz, C.; Schweizer, T.; Shayduk, M.; Shore, S. N.; Sillanpää, A.; Sitarek, J.; Sobczynska, D.; Spanier, F.; Spiro, S.; Stamatescu, V.; Stamerra, A.; Steinke, B.; Storz, J.; Strah, N.; Surić, T.; Takalo, L.; Takami, H.; Tavecchio, F.; Temnikov, P.; Terzić, T.; Tescaro, D.; Teshima, M.; Tibolla, O.; Torres, D. F.; Treves, A.; Uellenbeck, M.; Vankov, H.; Vogler, P.; Wagner, R. M.; Weitzel, Q.; Zabalza, V.; Zandanel, F.; Zanin, R.; Buson, S.; Horan, D.; Larsson, S.; D'Ammando, F.

    2012-03-01

    We present the results of five years (2005-2009) of MAGIC observations of the BL Lac object PG 1553+113 at very high energies (VHEs; E > 100 GeV). Power-law fits of the individual years are compatible with a steady mean photon index Γ = 4.27 ± 0.14. In the last three years of data, the flux level above 150 GeV shows a clear variability (probability of constant flux < 0.001%). The flux variations are modest, lying in the range from 4% to 11% of the Crab Nebula flux. Simultaneous optical data also show only modest variability that seems to be correlated with VHE gamma-ray variability. We also performed a temporal analysis of (all available) simultaneous Fermi/Large Area Telescope data of PG 1553+113 above 1 GeV, which reveals hints of variability in the 2008-2009 sample. Finally, we present a combination of the mean spectrum measured at VHEs with archival data available for other wavelengths. The mean spectral energy distribution can be modeled with a one-zone synchrotron self-Compton model, which gives the main physical parameters governing the VHE emission in the blazar jet.

  1. Two Instances of Mundus Inversus in Psalm 113

    Directory of Open Access Journals (Sweden)

    A. Basson

    2009-07-01

    Full Text Available The psalms often praise Yahweh for his transformative and restorative interventions both in the past and in all times. They portray the deity as the one who offers protection to the weak and defenceless members of society. He uplifts the downtrodden and affords them a place in structure where they gain a new status. In Psalm 113:7-9, Yahweh changes the circumstances of the poor and needy and the childless woman. Social outcasts have their dignity and honour restored. This article explicates these divine acts in terms of the topos of mundus inversus (world-upside down. This cultural phenomenon, which finds expression in artistic, socio-political and religious spheres, accentuates the possibility of another reality by inverting the status quo. Psalm 113 praises Yahweh as the incomparable God who inverts the situation of those condemned to a life of suffering. His incomparability is linked with his power to create a mundus inversus in which the poor and needy have a banquet with nobles and a barren woman takes pleasure in motherhood.

  2. PG 1553+113: FIVE YEARS OF OBSERVATIONS WITH MAGIC

    Energy Technology Data Exchange (ETDEWEB)

    Aleksic, J.; Blanch, O. [IFAE, Edifici Cn., Campus UAB, E-08193 Bellaterra (Spain); Alvarez, E. A.; Asensio, M.; Barrio, J. A. [Groupo de Fisica Atlas Energias, Universidad Complutense, E-28040 Madrid (Spain); Antonelli, L. A.; Bonnoli, G. [INAF National Institute for Astrophysics, I-00136 Rome (Italy); Antoranz, P. [Dipartimento di Fisica, Universita di Siena and INFN Pisa, I-53100 Siena (Italy); Backes, M. [Fakultat fuer Physik, Technische Universitaet Dortmund, D-44221 Dortmund (Germany); Bastieri, D. [Dipartimento di Fisica, Universita di Padova and INFN, I-35131 Padova (Italy); Gonzalez, J. Becerra; Berger, K. [Inst. de Astrofisica de Canarias, E-38200 La Laguna, Tenerife (Spain); Bednarek, W. [Department of Astrophysics, University of Lodz, PL-90236 Lodz (Poland); Berdyugin, A. [Tuorla Observatory, University of Turku, FI-21500 Piikkioe (Finland); Bernardini, E. [Deutsches Elektronen-Synchrotron (DESY), D-15738 Zeuthen (Germany); Biland, A.; Boller, A.; Braun, I. [ETH Zurich, CH-8093, Wolfgang-Pauli-Str. 15, CH-8093 Zuerich-Hoenggberg (Switzerland); Bock, R. K.; Tridon, D. Borla, E-mail: fabrizio.tavecchio@brera.inaf.it, E-mail: elisa.prandini@pd.infn.it [Max-Planck-Institut fuer Physik, D-80805 Muenchen (Germany); and others

    2012-03-20

    We present the results of five years (2005-2009) of MAGIC observations of the BL Lac object PG 1553+113 at very high energies (VHEs; E > 100 GeV). Power-law fits of the individual years are compatible with a steady mean photon index {Gamma} = 4.27 {+-} 0.14. In the last three years of data, the flux level above 150 GeV shows a clear variability (probability of constant flux < 0.001%). The flux variations are modest, lying in the range from 4% to 11% of the Crab Nebula flux. Simultaneous optical data also show only modest variability that seems to be correlated with VHE gamma-ray variability. We also performed a temporal analysis of (all available) simultaneous Fermi/Large Area Telescope data of PG 1553+113 above 1 GeV, which reveals hints of variability in the 2008-2009 sample. Finally, we present a combination of the mean spectrum measured at VHEs with archival data available for other wavelengths. The mean spectral energy distribution can be modeled with a one-zone synchrotron self-Compton model, which gives the main physical parameters governing the VHE emission in the blazar jet.

  3. Cadmium chronic administration to lactating ewes. Reproductive performance, cadmium tissue accumulation and placental transfer

    Energy Technology Data Exchange (ETDEWEB)

    Floris, B.; Bomboi, G.; Sechi, P.; Marongiu, M. L. [Sassari Univ., Sassari (Italy). Dipt. di Biologia Animale; Pirino, S. [Sassari Univ., Sassari (Italy). Ist. di Patologia Generale, Anatomia Patologica e Clinica Ostetrico-chirurgica Veterinaria

    2000-12-01

    20 lactating ewes were allotted to two groups: 10 subjects received orally 100 mg/day of CdCl{sub 2} for 108 consecutive days, and the remaining 10 acted as control. Reproductive performance in ewes and cadmium tissue accumulation, both in ewes and their lambs, were investigated. The results showed that in ewes: 1) the regular cadmium intestinal intake negatively influences all reproductive parameters; 2) cadmium is particularly accumulated in kidney and liver, bur also in mammary gland, although at distinctly lower level; 3) chronic administration does not increase cadmium placental transfer in lactating pregnant subjects. [Italian] 20 pecore in lattazione sono state suddivise in 2 gruppi: 10 soggetti ricevettero per os 100 mg/giorno di CdCl{sub 2} per 108 giorni consecutivi, e i restanti 10 funsero da controllo. Sono stati studiati i parametri riproduttivi delle pecore e l'accumulo di cadmio nei tessuti, sia delle pecore che dei loro agnelli. I risultati hanno mostrato che negli ovini: 1) il regolare assorbimento intestinale di cadmio influenza negativamente tutti i parametri riproduttivi; 2) il cadmio viene accumulato principalmente nei reni e nel fegato, ma anche dalla ghiandola mammaria, sebbene in misura nettamente inferiore; 3) la somministrazione cronica di cadmio nei soggetti gravidi non incrementa il suo passaggio transplacentare.

  4. Concentration of Cadmium in Cacao Beans and its Relationship with Soil Cadmium in Southern Ecuador

    Science.gov (United States)

    The concentration of cadmium (Cd) in cacao (Theobroma cacao, L.) beans above a critical level (0.6 mg kg-1 established by the European Union) has raised concerns of safety in the consumption of cacao-based chocolate (dark chocolate). Currently, little is available regarding Cd concentration in soil,...

  5. Impact of cadmium, cobalt and nickel on sequence-specific DNA binding of p63 and p73 in vitro and in cells

    Energy Technology Data Exchange (ETDEWEB)

    Adámik, Matej [Institute of Biophysics, Academy of Science of the Czech Republic, v.v.i., Královopolská 135, 612 65 Brno (Czech Republic); Bažantová, Pavla [Institute of Biophysics, Academy of Science of the Czech Republic, v.v.i., Královopolská 135, 612 65 Brno (Czech Republic); Department of Biology and Ecology, Faculty of Science, University of Ostrava, Chittussiho 10, 701 03 Ostrava (Czech Republic); Navrátilová, Lucie; Polášková, Alena [Institute of Biophysics, Academy of Science of the Czech Republic, v.v.i., Královopolská 135, 612 65 Brno (Czech Republic); Pečinka, Petr [Institute of Biophysics, Academy of Science of the Czech Republic, v.v.i., Královopolská 135, 612 65 Brno (Czech Republic); Department of Biology and Ecology, Faculty of Science, University of Ostrava, Chittussiho 10, 701 03 Ostrava (Czech Republic); Holaňová, Lucie [Department of Chemical Drugs, Faculty of Pharmacy, University of Veterinary and Pharmaceutical Sciences, Palackého 1/3, 61242 Brno (Czech Republic); Tichý, Vlastimil [Institute of Biophysics, Academy of Science of the Czech Republic, v.v.i., Královopolská 135, 612 65 Brno (Czech Republic); Brázdová, Marie, E-mail: maruska@ibp.cz [Institute of Biophysics, Academy of Science of the Czech Republic, v.v.i., Královopolská 135, 612 65 Brno (Czech Republic); Department of Chemical Drugs, Faculty of Pharmacy, University of Veterinary and Pharmaceutical Sciences, Palackého 1/3, 61242 Brno (Czech Republic)

    2015-01-02

    Highlights: • DNA binding of p53 family core domains is inhibited by cadmium, cobalt and nickel. • Binding to DNA protects p53 family core domains from metal induced inhibition. • Cadmium, cobalt and nickel induced inhibition was reverted by EDTA in vitro. - Abstract: Site-specific DNA recognition and binding activity belong to common attributes of all three members of tumor suppressor p53 family proteins: p53, p63 and p73. It was previously shown that heavy metals can affect p53 conformation, sequence-specific binding and suppress p53 response to DNA damage. Here we report for the first time that cadmium, nickel and cobalt, which have already been shown to disturb various DNA repair mechanisms, can also influence p63 and p73 sequence-specific DNA binding activity and transactivation of p53 family target genes. Based on results of electrophoretic mobility shift assay and luciferase reporter assay, we conclude that cadmium inhibits sequence-specific binding of all three core domains to p53 consensus sequences and abolishes transactivation of several promoters (e.g. BAX and MDM2) by 50 μM concentrations. In the presence of specific DNA, all p53 family core domains were partially protected against loss of DNA binding activity due to cadmium treatment. Effective cadmium concentration to abolish DNA–protein interactions was about two times higher for p63 and p73 proteins than for p53. Furthermore, we detected partial reversibility of cadmium inhibition for all p53 family members by EDTA. DTT was able to reverse cadmium inhibition only for p53 and p73. Nickel and cobalt abolished DNA–p53 interaction at sub-millimolar concentrations while inhibition of p63 and p73 DNA binding was observed at millimolar concentrations. In summary, cadmium strongly inhibits p53, p63 and p73 DNA binding in vitro and in cells in comparison to nickel and cobalt. The role of cadmium inhibition of p53 tumor suppressor family in carcinogenesis is discussed.

  6. Impact of cadmium, cobalt and nickel on sequence-specific DNA binding of p63 and p73 in vitro and in cells

    International Nuclear Information System (INIS)

    Highlights: • DNA binding of p53 family core domains is inhibited by cadmium, cobalt and nickel. • Binding to DNA protects p53 family core domains from metal induced inhibition. • Cadmium, cobalt and nickel induced inhibition was reverted by EDTA in vitro. - Abstract: Site-specific DNA recognition and binding activity belong to common attributes of all three members of tumor suppressor p53 family proteins: p53, p63 and p73. It was previously shown that heavy metals can affect p53 conformation, sequence-specific binding and suppress p53 response to DNA damage. Here we report for the first time that cadmium, nickel and cobalt, which have already been shown to disturb various DNA repair mechanisms, can also influence p63 and p73 sequence-specific DNA binding activity and transactivation of p53 family target genes. Based on results of electrophoretic mobility shift assay and luciferase reporter assay, we conclude that cadmium inhibits sequence-specific binding of all three core domains to p53 consensus sequences and abolishes transactivation of several promoters (e.g. BAX and MDM2) by 50 μM concentrations. In the presence of specific DNA, all p53 family core domains were partially protected against loss of DNA binding activity due to cadmium treatment. Effective cadmium concentration to abolish DNA–protein interactions was about two times higher for p63 and p73 proteins than for p53. Furthermore, we detected partial reversibility of cadmium inhibition for all p53 family members by EDTA. DTT was able to reverse cadmium inhibition only for p53 and p73. Nickel and cobalt abolished DNA–p53 interaction at sub-millimolar concentrations while inhibition of p63 and p73 DNA binding was observed at millimolar concentrations. In summary, cadmium strongly inhibits p53, p63 and p73 DNA binding in vitro and in cells in comparison to nickel and cobalt. The role of cadmium inhibition of p53 tumor suppressor family in carcinogenesis is discussed

  7. Cadmium adsorption in montmorillonite as affected by glyphosate

    Institute of Scientific and Technical Information of China (English)

    WANG Yu-jun; ZHOU Dong-mei; LUO Xiao-san; SUN Rui-juan; CHEN Huai-man

    2004-01-01

    Behaviors of soil heavy metals are often affected by coexisting herbicides due to their physical and chemical interaction. Effect of glyphosate, an herbicide containing -PO32- and -COOH groups, on cadmium adsorption in montmorillonite was studied in detail. The results showed that cadmium adsorption quantity in montmorillonite increased with increasing soil solution pH and cadmium concentration as usual, but decreased with glyphosate, which is due to the formation of a low affinity complex of Cd and glyphosate and decreasing solution pH induced by glyphosate addition. When the equilibrium solution pH was below 6.7, glyphosate has little effect on cadmium adsorption, but when the equilibrium solution pH was above 6.7, glyphosate significantly decreased cadmium adsorption quantity in montmorillonite. In addition, the adding order of Cd and glyphosate also influenced Cd adsorption quantity in montmorillonite.

  8. Cadmium sorption and mobility in sludge-amended soil

    International Nuclear Information System (INIS)

    Cadmium sorption was examined in three soils that were unamended, freshly amended, or preconditioned with gamma-irradiated sewage sludge. Metal sorption in the same soils treated with a CaCl2-extract of the sludge was also studied. Cadmium sorption was greatest in the unamended soils, less in soils preconditioned with sludge, and least in the freshly amended soils and sludge-extract-treated soils. The authors attempted to explain the treatment effects on the basis of reduced free metal ion activity, but the explanations were not adequate. Despite the reduction in metal retention effected by various treatments, cadmium mobility was very limited. Short- or long-term leaching studies showed cadmium movement to be limited to 1 or 2 m below the zone of sludge (109Cd) incorporation. Cadmium mobility is expected to be very limited in calcareous soils, regardless of sludge treatments. 24 references, 1 figure, 5 tables

  9. Amorphous tin-cadmium oxide films and the production thereof

    Science.gov (United States)

    Li, Xiaonan; Gessert, Timothy A

    2013-10-29

    A tin-cadmium oxide film having an amorphous structure and a ratio of tin atoms to cadmium atoms of between 1:1 and 3:1. The tin-cadmium oxide film may have an optical band gap of between 2.7 eV and 3.35 eV. The film may also have a charge carrier concentration of between 1.times.10.sup.20 cm.sup.-3 and 2.times.10.sup.20 cm.sup.-3. The tin cadmium oxide film may also exhibit a Hall mobility of between 40 cm.sup.2V.sup.-1 s.sup.-1 and 60 cm.sup.2V.sup.-1 s.sup.-1. Also disclosed is a method of producing an amorphous tin-cadmium oxide film as described and devices using same.

  10. Transient behavior of cadmium in a grassland arthropod food chain

    International Nuclear Information System (INIS)

    Biological assimilation and transport of cadmium were determined for an arthropod food chain in an east Tennessee grassland community. Laboratory experiments demonstrated that there were no significant differences (P greater than 0.05) in assimilation rates (17 percent assimilation per day) or biological half-lives (7 days) of 109Cd either as soluble nitrate or insoluble oxide in crickets under identical conditions. Field experiments demonstrated that primary consumers (crickets) accumulated 109Cd much more rapidly (uptake rate = 0.55 day-1) than did the spider predators (uptake rate = 0.08 day-1). Equilibrium concentrations in crickets were obtained in 9 days (0.04 ppM cadmium), while equilibrium was not reached in spiders during the 30-day study. Food-chain concentration of cadmium did not occur as crickets accumulated levels of cadmium 60 percent of that in their vegetation food sources and spiders accumulated only 70 percent of the cadmium present in the cricket tissues

  11. Synthesis of cadmium chalcogenide nanotubes at room temperature

    KAUST Repository

    Pan, Jun

    2012-10-01

    Cadmium chalcogenide (CdE, E=S, Se, Te) polycrystalline nanotubes have been synthesized from precursor of CdS/cadmium thiolate complex at room temperature. The precursor was hydrothermally synthesized at 180 °C using thioglycolic acid (TGA) and cadmium acetate as starting materials. The transformation from the rod-like precursor of CdS/cadmium thiolate complex to CdS, CdSe and CdTe nanotubes were performed under constant stirring at room temperature in aqueous solution containing S 2-, Se 2- and Te 2-, respectively. The nanotube diameter can be controlled from 150 to 400 nm related to the dimension of templates. The XRD patterns show the cadmium chalcogenide nanotubes all corresponding to face-centered cubic structure. © 2012 Elsevier B.V. All rights reserved.

  12. Effect of pregnancy on cadmium-treated rats

    Energy Technology Data Exchange (ETDEWEB)

    Takizama, Y. (Akita Univ. School of Medicine, Japan); Nakamura, I.; Kurayama, R.; Hirasawa, F.; Kawai, K.

    1982-01-01

    It is well known that itai-itai disease with the osteopathy is broken out among multiparas, 40 years of age and up Japanese residents. In this paper we described an experimental study of effect of pregnancy on cadmium treated rats. Female mature rats were administered drinking water containing 50 and 200 ppm cadmium as CdCl/sub 2/. During 180 days of the experiment, three times of pregnancy were succesful, though slight depression of body weight gain was noticed in the 200 ppm group. The cadmium was accumulated in the kidneys, liver and bone proportionally to the amount of cadmium administered. No significant change was recognized in serum calcium, phosphorus and alkaline phosphatase levels after 180 days. Though cadmium 200 ppm treated rats showed slight histological lesions in the proximal convoluted tubules of the kidney, there appeared to be no osteomalacia including excess formation of osteoid tissue.

  13. Cadmium in the Amazonian Guajara Estuary: Distribution and remobilization

    Energy Technology Data Exchange (ETDEWEB)

    Nascimento, S.F. [Instituto de Quimica, Departamento de Geoquimica, Universidade Federal Fluminense (Brazil)]. E-mail: nascimento@lisa.univ-paris12.fr; Kurzweil, H. [Institut fuer Petrologie, Universitaet Wien (Austria); Wruss, W. [Institut fuer Chemische Technologie anorganischer Stoffe, Technische Univesitaet Wien (Austria); Fenzl, N. [Nucleo de Altos Estudos Amazonicos, Universidade Federal do Para (Brazil)

    2006-03-15

    Extremely high total cadmium concentrations (average about 500 mg/kg) together with very small (average of 1.1 {mu}g/l) dissolved available cadmium have been found in the more acidic deeper layers of the bottom sediments of the Brazilian Amazonian Guajara Estuary. The paper shows that climatic changes and the periodic input of the Atlantic waters into the Estuary appear to have no direct influence on annual average total cadmium concentration, but they affect accumulation, distribution and remobilization of cadmium in different ways during the rainy season (February/March) and the dry season (November/December). Even if only a very small part of the total Cd is available, the concentrations of dissolved Cd in the Estuary are still high enough to cause environmental concern, if compared with concentrations in natural freshwater ecosystems. - Distribution and remobilization of cadmium is affected differently by season.

  14. Effects of diethyldithiocarbamate on the toxicokinetics of cadmium chloride in mice

    DEFF Research Database (Denmark)

    Andersen, O; Nielsen, J B

    1989-01-01

    investigates effects of DDC on the toxicokinetics of cadmium at lower doses of cadmium than those used in previous studies. During single exposure to subtoxic oral doses of cadmium chloride DDC enhanced intestinal cadmium absorption, both after intraperitoneal and oral administration of DDC. In such acute...

  15. New compositions of cadmium selenium nanoparticles and dye molecules with cyclodextrin inclusion complexes

    International Nuclear Information System (INIS)

    Spectroscopic properties of new heterogeneous multicolor compositions based on cadmium selenium (CdSe/ZnS) nano crystal and inclusion complexes of dye molecule with cyclodextrin are presented. Spectral fluorescence of proposed compositions investigated in thin films. Signals from multicolor fluorescence of proposing compositions may be combined to definite spectral codes that could be used for tracking or verification of different objects. Calibration bar of signal within spectral codes guarantee high reliability in practical application of proposed multicolor compositions. Express analysis the size of nanoparticles during their synthesis and purification by spectroscopic methods is suggested. Application of Cyclodextrin molecules as target delivery systems is considered. (authors)

  16. Tank 241-TX-113 rotary mode core sampling and analysis plan

    International Nuclear Information System (INIS)

    This sampling and analysis plan (SAP) identities characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for push mode core samples from tank 241-TX-113 (TX-113). The Tank Characterization Technical Sampling Basis document identities Retrieval, Pretreatment and Immobilization as an issue that applies to tank TX-113. As a result, a 150 gram composite of solids shall be made and archived for that program. This tank is not on a Watch List

  17. Fast-neutron scattering from elemental cadmium

    International Nuclear Information System (INIS)

    Neutron differential-elastic-scattering cross sections of elemental cadmium are measured from approx. = 1.5 to 4.0 MeV at incident-neutron energy intervals of 50 to 200 keV and at 10 to 20 scattering angles distributed between approx. = 20 and 160 degrees. Concurrently, lumped-level neutron inelastic-excitation cross sections are measured. The experimental results are used to deduce parameters of an optical-statistical model that is descriptive of the observables and are compared with corresponding quantities given in ENDF/B-V

  18. Sorption of Cadmium on Na-Bentonite

    International Nuclear Information System (INIS)

    The sorption of Cd radionuclide into Na-bentonite as candidate for buffer material in the radioactive waste disposal system has been performed. Cadmium was used for this study as a model for bivalence elements. Batch experiment was adopted to study sorption isotherm, influence of carbonate and influence of EDTA. In a simple media, pure water, Cd was retained with a high affinity. Two stages Freundlich sorption isotherm was shown, with high coefficient distribution and sorption capacities. It is shown that the presence of carbonate in solution was not affect significantly to the sorption. While the presence of EDTA, decrease the distribution coefficient value. (author)

  19. Sources of cadmium exposure among healthy premenopausal women

    International Nuclear Information System (INIS)

    Background: Cadmium, a persistent and widespread environmental pollutant, has been associated with kidney function impairment and several diseases. Cigarettes are the dominant source of cadmium exposure among smokers; the primary source of cadmium in non-smokers is food. We investigated sources of cadmium exposure in a sample of healthy women. Methods: In a cross-sectional study, 191 premenopausal women completed a health questionnaire and a food frequency questionnaire. The cadmium content of spot urine samples was measured with inductively-coupled plasma mass spectrometry and normalized to urine creatinine content. Multivariable linear regression was used to estimate the strength of association between smoking habits and, among non-smokers, usual foods consumed and urinary cadmium, adjusted for age, race, multivitamin and supplement use, education, estimated total energy intake, and parity. Results: Geometric mean urine creatinine-normalized cadmium concentration (uCd) of women with any history of cigarette smoking was 0.43 μg/g (95% confidence interval (CI): 0.38-0.48 μg/g) and 0.30 μg/g (0.27-0.33 μg/g) among never-smokers, and increased with pack-years of smoking. Analysis of dietary data among women with no reported history of smoking suggested that regular consumption of eggs, hot cereals, organ meats, tofu, vegetable soups, leafy greens, green salad, and yams was associated with uCd. Consumption of tofu products showed the most robust association with uCd; each weekly serving of tofu was associated with a 22% (95% CI: 11-33%) increase in uCd. Thus, uCd was estimated to be 0.11 μg/g (95% CI: 0.06-0.15 μg/g) higher among women who consumed any tofu than among those who consumed none. Conclusions: Cigarette smoking is likely the most important source of cadmium exposure among smokers. Among non-smokers, consumption of specific foods, notably tofu, is associated with increased urine cadmium concentration. - Research highlights: →Urine cadmium, usual

  20. Sources of cadmium exposure among healthy premenopausal women

    Energy Technology Data Exchange (ETDEWEB)

    Adams, Scott V., E-mail: sadams@fhcrc.org [Fred Hutchinson Cancer Research Center, PO Box 19024, M4-B402, Seattle, WA 98109 (United States); Department of Epidemiology, University of Washington, Box 357236, Seattle, WA 98195 (United States); Newcomb, Polly A. [Fred Hutchinson Cancer Research Center, PO Box 19024, M4-B402, Seattle, WA 98109 (United States); Department of Epidemiology, University of Washington, Box 357236, Seattle, WA 98195 (United States); Shafer, Martin M. [Environmental Chemistry and Technology Program, University of Wisconsin and Wisconsin State Laboratory of Hygiene, Madison, WI (United States); Atkinson, Charlotte [Department of Oral and Dental Science, Bristol Dental School, Bristol (United Kingdom); Bowles, Erin J. Aiello [Group Health Research Institute, Seattle, WA (United States); Newton, Katherine M. [Department of Epidemiology, University of Washington, Box 357236, Seattle, WA 98195 (United States); Group Health Research Institute, Seattle, WA (United States); Lampe, Johanna W. [Fred Hutchinson Cancer Research Center, PO Box 19024, M4-B402, Seattle, WA 98109 (United States); Department of Epidemiology, University of Washington, Box 357236, Seattle, WA 98195 (United States)

    2011-04-01

    Background: Cadmium, a persistent and widespread environmental pollutant, has been associated with kidney function impairment and several diseases. Cigarettes are the dominant source of cadmium exposure among smokers; the primary source of cadmium in non-smokers is food. We investigated sources of cadmium exposure in a sample of healthy women. Methods: In a cross-sectional study, 191 premenopausal women completed a health questionnaire and a food frequency questionnaire. The cadmium content of spot urine samples was measured with inductively-coupled plasma mass spectrometry and normalized to urine creatinine content. Multivariable linear regression was used to estimate the strength of association between smoking habits and, among non-smokers, usual foods consumed and urinary cadmium, adjusted for age, race, multivitamin and supplement use, education, estimated total energy intake, and parity. Results: Geometric mean urine creatinine-normalized cadmium concentration (uCd) of women with any history of cigarette smoking was 0.43 {mu}g/g (95% confidence interval (CI): 0.38-0.48 {mu}g/g) and 0.30 {mu}g/g (0.27-0.33 {mu}g/g) among never-smokers, and increased with pack-years of smoking. Analysis of dietary data among women with no reported history of smoking suggested that regular consumption of eggs, hot cereals, organ meats, tofu, vegetable soups, leafy greens, green salad, and yams was associated with uCd. Consumption of tofu products showed the most robust association with uCd; each weekly serving of tofu was associated with a 22% (95% CI: 11-33%) increase in uCd. Thus, uCd was estimated to be 0.11 {mu}g/g (95% CI: 0.06-0.15 {mu}g/g) higher among women who consumed any tofu than among those who consumed none. Conclusions: Cigarette smoking is likely the most important source of cadmium exposure among smokers. Among non-smokers, consumption of specific foods, notably tofu, is associated with increased urine cadmium concentration. - Research highlights: {yields

  1. Modeling cadmium in the feed chain and cattle organs

    Directory of Open Access Journals (Sweden)

    van der Fels-Klerx, I.

    2011-01-01

    Full Text Available The objectives of this study were to estimate cadmium contamination levels in different scenarios related to soil characteristics and assumptions regarding cadmium accumulation in the animal tissues, using quantitative supply chain modeling. The model takes into account soil cadmium levels, soil pH, soil-to-plant transfer, animal consumption patterns, and transfer into animal organs (liver and kidneys. The model was applied to cattle up to the age of six years which were fed roughage (maize and grass and compound feed. Cadmium content in roughage and cadmium intake by cattle were calculated for six different (soil scenarios varying in soil cadmium levels and soil pH. For each of the six scenarios, the carry-over of cadmium from intake into the cattle organs was estimated applying two model assumptions, i.e., linear accumulation and a steady state situation. The results showed that only in the most extreme soil scenario (cadmium level 2.5 mg.kg-1, pH 4.5, cadmium exceeded the EC maximum tolerated level in roughage. Assuming linear accumulation, cadmium levels in organs of cattle up to six years of age, ranged from 0.37-4.03 mg.kg-1 of fresh weight for kidneys and from 0.07 to 0.77 mg.kg-1 of fresh weight for livers. The maximum tolerated levels in one or both organs were exceeded in several scenarios. When considering organ excretion of cadmium, internal cadmium levels in organs were approximately one order of magnitude lower as compared to the results of the linear accumulation model. In this case only in the most extreme soil scenario, the maximum tolerated level in the kidney was exceeded. It was concluded that the difference between the two assumptions (linear model versus a steady state situation to estimate cadmium carry-over in cattle is negligible in the animal's first five years of life, but will become relevant at higher ages. For the current case, the linear approach is a good descriptor for worst case situations. Furthermore, this

  2. Dietary cadmium intake and risk of prostate cancer: a Danish prospective cohort study

    OpenAIRE

    Eriksen, Kirsten T.; Halkjær, Jytte; Jaymie R. Meliker; McElroy, Jane A.; Sørensen, Mette; Tjønneland, Anne; Raaschou-Nielsen, Ole

    2015-01-01

    Background Cadmium is classified as a human lung carcinogen based on evidence from high-exposure occupational settings. Though cadmium has no physiological role, increasing evidence suggests cadmium may mimic steroid hormones. This dual ability of being carcinogenic and hormone-like makes cadmium a concern for hormone-related cancers. Causes of prostate cancer are not clear, but steroid hormones, particularly androgens and probably estrogens, may be involved. Cadmium has been positively assoc...

  3. 同位镀汞膜电极同时测定水中的铅和镉%On Plating Mercury Film Electrode while Determining Lead and Cadmium in Water

    Institute of Scientific and Technical Information of China (English)

    王静; 贺鹏; 孙海林; 孙凯; 左航; 张坤; 褚衍龙

    2015-01-01

    基于汞修饰玻碳电极,采用阳极溶出伏安法对水中铅和镉同时进行测定。实验结果表明:采用同位镀汞的阳极溶出伏安法同时检测铅和镉可得到灵敏的溶出峰,溶出峰衰减慢,电极维护周期间隔长,当沉积时间为150s时,测量相对标准偏差分别为1.13%和1.40%,检出限分别为0.38μg/L和0.31μg/L,测定地表水及污染源废水铅和镉的回收率均接近100%,可用于地表水及污染源废水中铅和镉同时在线检测。%The paper indicates; By adopting anode to dissolve out voltammetry, lead and cadmium are determined and the sensitive dissolving peak can be received. The dissolution peak attenuates slowly and the long interval maintenance period of electrode is kept. When sediment time is at 150s, the precision degree of lead and cadmium is 1.13%and 1.40%separately, the determining limit is 0.38μg/L and 0.31μg/L separately. The recovery rates of lead and cadmium from surface water and waste water of pol uted sources are at 103.2%~109.6%and 98.3%~101.3%, lead and cadmium from surface water and waste water of poluted sources are determined on line.

  4. Impairment induced by chronic occupational cadmium exposure during brazing process

    International Nuclear Information System (INIS)

    Cadmium (CD) is considered a metal of the 20th century to which all inhabitants of develop societies are exposed. Long-term occupational and environmental exposure to CD often results in renal dysfunction as the kidney is considered the critical target organ. The aim of this work was to evalutate both resporatory and renal manifestations induced by occupational exposure to CD compounds during brazing process, and suggesting a protocol for prevention and control for CD- induced health effects. This study was conducted on 20 males occupationally exposed workers. They are divided into two groups: Group-1 included (10) exposed smokers and group-2 included (10) exposed non-smokers. Results of both groups were compared with those of 10 healthy age and sex matched non-smokers. All subjects were subjected to detailed history taking and laboratory investigations including blood and urinary CD, liver profile (SGOT, SGPT and alkline phosphates), kindey function tests (blood urea, creatinine and urinary beta2- microglobulin). The level of Cd in the atmosphere of the work plase air was also assessed to detect the degree of exposure as it was about 6 times greater than thesave level (1 mu /m3).(1) This study demonstrated elevation levels of blood CD, urea, creatinine and urinary CD and beta2 -microglobulin for both exposed worker groups than the controls. In additions no appreciable were noted for liver function tests, although the levels fell within normal range

  5. Cellular mechanisms of cadmium-induced toxicity: a review.

    Science.gov (United States)

    Rani, Anju; Kumar, Anuj; Lal, Ankita; Pant, Manu

    2014-08-01

    Cadmium is a widespread toxic pollutant of occupational and environmental concern because of its diverse toxic effects: extremely protracted biological half-life (approximately 20-30 years in humans), low rate of excretion from the body and storage predominantly in soft tissues (primarily, liver and kidneys). It is an extremely toxic element of continuing concern because environmental levels have risen steadily due to continued worldwide anthropogenic mobilization. Cadmium is absorbed in significant quantities from cigarette smoke, food, water and air contamination and is known to have numerous undesirable effects in both humans and animals. Cadmium has a diversity of toxic effects including nephrotoxicity, carcinogenicity, teratogenicity and endocrine and reproductive toxicities. At the cellular level, cadmium affects cell proliferation, differentiation, apoptosis and other cellular activities. Current evidence suggests that exposure to cadmium induces genomic instability through complex and multifactorial mechanisms. Most important seems to be cadmium interaction with DNA repair mechanism, generation of reactive oxygen species and induction of apoptosis. In this article, we have reviewed recent developments and findings on cadmium toxicology. PMID:24117228

  6. Cadmium (II) removal mechanisms in microbial electrolysis cells.

    Science.gov (United States)

    Colantonio, Natalie; Kim, Younggy

    2016-07-01

    Cadmium is a toxic heavy metal, causing serious environmental and human health problems. Conventional methods for removing cadmium from wastewater are expensive and inefficient for low concentrations. Microbial electrolysis cells (MECs) can simultaneously treat wastewater, produce hydrogen gas, and remove heavy metals with low energy requirements. Lab-scale MECs were operated to remove cadmium under various electric conditions: applied voltages of 0.4, 0.6, 0.8, and 1.0V; and a fixed cathode potential of -1.0V vs. Ag/AgCl. Regardless of the electric condition, rapid removal of cadmium was demonstrated (50-67% in 24h); however, cadmium concentration in solution increased after the electric current dropped with depleted organic substrate under applied voltage conditions. For the fixed cathode potential, the electric current was maintained even after substrate depletion and thus cadmium concentration did not increase. These results can be explained by three different removal mechanisms: cathodic reduction; Cd(OH)2 precipitation; and CdCO3 precipitation. When the current decreased with depleted substrates, local pH at the cathode was no longer high due to slowed hydrogen evolution reaction (2H(+)+2e(-)→H2); thus, the precipitated Cd(OH)2 and CdCO3 started dissolving. To prevent their dissolution, sufficient organic substrates should be provided when MECs are used for cadmium removal. PMID:26970043

  7. Mobility, bioavailability, and toxic effects of cadmium in soil samples

    International Nuclear Information System (INIS)

    Total concentration is not a reliable indicator of metal mobility or bioavailability in soils. The physicochemical form determines the behavior of metals in soils and hence the toxicity toward terrestrial biota. The main objectives of this study were the application and comparison of three approaches for the evaluation of cadmium behavior in soil samples. The mobility and bioavailability of cadmium in five selected soil samples were evaluated using equilibrium speciation (Windermere humic aqueous mode (WHAM)), extraction procedures (Milli-Q water, DMSO, and DTPA), and a number of bioassays (Microtox, growth inhibition test, contact toxicity test, and respiration). The mobility, represented by the water-extractable fraction corresponded well with the amount of cadmium in the soil solution, calculate using the WHAM (r2=0.96, P<0.001). The results of the ecotoxicologica evaluation, which represent the bioavailable fraction of cadmium, correlated well with DTPA extractability and also with the concentration of free cadmium ion, which is recognized as the most bioavailable metal form. The results of the WHAM as well as the results of extraction experiments showed a strong binding of cadmium to organic matter and a weak sorption of cadmium to clay minerals

  8. Cadmium cutoff energy for MCNP modeling of dosimetry reactions

    International Nuclear Information System (INIS)

    Reactor pressure vessel neutron fluence calculations are verified by comparing calculated reaction rates of dosimetry foils assumed to be placed in the cavity surrounding the pressure vessel with corresponding experimentally determined dosimetry reaction rates at the same location. The irradiated foils used are bare and cadmium covered. The cadmium-covered foils see a different neutron flux than the uncovered foils. Computer models computing reaction rates for the foils must approximate the effect of the cadmium foil cover. The MCNP code modeling of reactor cavity dosimetry reactions to validate the computed neutron flux hitting the pressure vessel of a pressurized water reactor (PWR) requires the choice of an appropriate cadmium cutoff energy. Since the neutron spectrum is harder in the cavity than in the core, the same cadmium cutoff energy may not be universally applied. The correct cutoff energy for the cavity of a PWR was computed by using MCNP4a and a representative cavity spectrum. Four cadmium-covered foil reactions were analyzed, and the appropriate energy cutoff was determined to be ∼ 0.6 eV for ∼0.5-mm-thick cadmium covers

  9. Bacterial bioremediation of aquatic cadmium 11 of area of Pakistan

    International Nuclear Information System (INIS)

    Cadmium Cd/sup +2/ pollution arises mainly from contamination of minerals used in agriculture and from industrial process. The usual situation is of large volume of soil and H/sub 2/O that are contaminated with low but significant concentration of Cd/sup +2/. Cadmium is one of the most dangerous heavy metal both to human health and aquatic ecosystem. Microorganisms have developed different strategies to regulate uptake and to detoxify heavy metals viz; by different mechanisms i.e. by adsorption to cell surface, by intercellular accumulation, precipitation, biosynthesis of metallothioneins to volatile compounds. Microcosm experiments in chemostat incubated at 20 deg. C showed that Cadmium Contamination does not greatly affect bacterial communities in cultures contaminated with up to 1mg CdI/sup -1/. acterial productivity remains unchanged and Cadmium- resistant strains arise quickly and in great number. The cadmium accumulation by bacteria depend on the bacterial productivity. The free bacteria can accumulate up to 1200 ppm Cadmium Where as the adhering bacteria concentrate up to 6100 ppm. At a steady state, 11-29% Cadmium is removed from the water phase of cultures. This paper includes Cd (II) removal by Bacteria from waste water of Wah Cantonment Pakistan. (author)

  10. Accumulation and distribution of arsenic and cadmium by tea plants

    Institute of Scientific and Technical Information of China (English)

    Yuan-zhi SHI; Jian-yun RUAN; Lifeng MA; Wen-yan HAN; Fang WANG

    2008-01-01

    It is important to research the rules about accumulation and distribution of arsenic and cadmium by tea plants, which will give us some scientific ideas about how to control the contents of arsenic and cadmium in tea. In this study, by field inves- tigation and pot trial, we found that mobility of arsenic and cadmium in tea plants was low. Most arsenic and cadmium absorbed were fixed in feeding roots and only small amount was transported to the above-ground parts. Distribution of arsenic and cadmium, based on their concentrations of unit dry matter, in tea plants grown on un-contaminated soil was in the order: feeding roots>stems≈main roots>old leaves>young leaves. When tea plants were grown on polluted soils simulated by adding salts of these two metals, feeding roots possibly acted as a buffer and defense, and arsenic and cadmium were transported less to the above- ground parts. The concentration of cadmium in soil significantly and negatively correlated with chlorophyll content, photosyn- thetic rate, transpiration rate and biomass production of tea plants.

  11. Cadmium Uptake in Synechococcus aquatilis (Reynaud Strain SY01

    Directory of Open Access Journals (Sweden)

    Ruperto Vallarta Jr.

    1998-12-01

    Full Text Available Cadmium uptake in Synechococcus aquatilis (Reynaud Strain SY01 showed a biphasic behavior, with an initial rapid passive cell wall interaction phase and a later slow intracellular cation uptake process. The cell wall uptake process followed Michaelis-Menten kinetics. The apparent Km of the uptake system was 38.89 µM, a relatively high affinity Km value compared to other metal uptake systems. Fitting of experimental data to the Langmuir and Freundlich adsorption isotherms showed that binding of cadmium to the cell surface was monolayer and/or multilayer, although the monolayer adsorption was more probable, as exemplified by a high correlation coefficient. This could be explained by the presence of a strong primary binding site which was responsible for a monolayer adsorption and a weak secondary binding site which could be responsible for a multilayer adsorption. The uptake process was found to be relatively specific for cadmium. Equimolar amounts (200 µM of cobalt, nickel, magnesium, and copper did not significantly affect cadmium uptake. Synechococcus aquatilis Strain SY01 cells also showed an efflux mechanism for cadmium, although the amount of excluded cadmium was insignificant compared with the amount of adsorbed cadmium in the cell wall.

  12. Blood cadmium concentration and lipid profile in Korean adults

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Kisok, E-mail: kimkisok@kmu.ac.kr [Department of Public Health, Keimyung University, 1000 Shindang-dong, Daegu 704-701 (Korea, Republic of)

    2012-01-15

    Although animal experiments have shown that cadmium exposure induces alterations in lipid profiles, no epidemiological study of this relationship has been performed. The objective of this study was to evaluate the association between blood cadmium concentration and blood lipid levels in Korean adults. A cross-sectional study comprising participants (n=3903) aged 20 years or older from the 2005, 2008, and 2009 Korea National Health and Nutrition Examination Surveys was conducted. Demographic characteristics and dietary intake were obtained from the participants by questionnaire, and cadmium and lipid levels were determined by analysis of blood samples. After adjusting for demographic and dietary factors, blood concentration of cadmium was positively associated with the risk of low high-density lipoprotein cholesterol (HDL-C) in a dose-dependent manner (p for trend <0.001). In addition, the odds ratios (ORs) of a high triglyceride to HDL-C ratio was significantly increased in the high blood cadmium groups [OR=1.36; 95% confidence interval (CI), 1.03-1.79 for fourth quintile and OR=1.41; 95% CI, 1.07-1.86 for fifth quintile] compared with the lowest quintile group. However, high blood cadmium was not associated with a risk of high total cholesterol, high low-density lipoprotein cholesterol, or high triglycerides. These data suggest that an increased cadmium body burden increases the risk of dyslipidemia, mainly due to the increased risk of low HDL-C and the high ratio of triglycerides to HDL-C.

  13. Screening of Amaranth Cultivars (Amaranthus mangostanus L.) for Cadmium Hyperaccumulation

    Institute of Scientific and Technical Information of China (English)

    FAN Hong-li; ZHOU Wei

    2009-01-01

    The potential harm of soil cadmium pollution to ecological environment and human health has been increasingly widely concerned. Phytoremediation, as a kind of new and effective technology, has become an important method for cleaning up cadmium in contaminated sites. The amaranth (Amaranthus mangostanus L.) is widely distributed and has abundant varieties in China, its rapid growth and large biomass can be served as candidate for cadmium hyperaccumulators for phytoremediation. To obtain cadmium hyper-accumulator, Cd uptake in 23 amaranth euitivars from different ecological region was investigated under hydroponic culture condition. Meanwhile, pot experiment was established to probe phytoremediation potentiality of Cd contaminated soil by amaranth. Three treatment (Cd 5, 10, and 25 mg kg-1) were imposed to red soil, yellow brown soil, and vegetable soil. The results showed that under hydroponic culture with Cd 3 mg L-1, the cadmium concentration in the shoots of the cultivar Tianxingmi reached 260 mg kg-1, and its total cadmium uptake was the highest among various cultivars. In the treatment Cd 25 mg kg-1, the cadmium concentration in the shoots of the cultivar Tianxingmi reached 212 mg kg-1, while bioaccumulation factor and shoot purification rate reached 8.50 and 3.8%, respectively. Further, the total biomass and shoot biomass were not decreased significantly under Cd exposure.These results suggested that eultivar Tianxingmi is a typical Cd hyperaccumulator, and can be expected to be used in phytoremediation of Cd contaminated soil.

  14. Selenium protection from cadmium and chromium poisoning

    International Nuclear Information System (INIS)

    The interaction of selenium with cadmium and chromium was studied in 168 chicken-broilers (DWCxWR) divided into four equal groups. Eight-week old control animals received an intravenous dose of /sup 115m/Cd Chloride 370 KBq/Kg (Group I), or 51Cr Chloride 370 KBq/Kg (Group II). The kinetics of these isotopes were studied by scintillation spectrometry (NaI/TI) carried out for whole blood, plasma, plasma proteins, urine, feces and homogenates of all organs at various time intervals. Animals in Groups III and IV received eight subcutaneous doses of sodium selenate (5ug) at 8-week intervals prior to /sup 115m/Cd or 51Cr. The kinetics of these elements were studied as in the previous two groups. It was found that selenium affected those kinetics in two ways: (a) by increasing the excretion of Cd by 11 +/- 3% (P < 0.001) and that of Cr by 7 +/- 1% (P < 0.001); and (b) by favoring redistribution of those elements, with significant (P < 0.001) reductions in liver, endocrine glands and kidney and increases (P < 0.01) in bone. The study suggests that selenium protects the animals' vital organs from environmental pollutants, such as cadmium and chromium

  15. Cadmium determination in Lentinus edodes mushroom species

    Directory of Open Access Journals (Sweden)

    Vera Akiko Maihara

    2012-09-01

    Full Text Available Many studies have drawn attention to the occurrence and concentration of toxic elements found in the fruiting body of mushrooms. Some edible mushroom species are known to accumulate high levels of inorganic contaminants, mainly cadmium, mercury, and lead. There are about 2,000 known edible mushroom species, but only 25 of them are cultivated and used as food. In Brazil, the most marketed and consumed mushroom species are Agaricus bisporus, known as Paris champignon, Lentinus edodes, or Shitake and Pleurotus sp, also called Shimeji or Hiratake. In this study, the concentration of cadmium was determined in Lentinus edodes mushrooms from different cities in São Paulo state and some samples imported from Japan and China. The analyses were performed by graphite furnace atomic absorption spectrometry after HNO3-H2O2 digestion. The results showed a lower concentration of Cd in the mushrooms cultivated in São Paulo (0.0079 to 0.023 mg.kg-1 in natura than that of the mushrooms cultivated abroad (0.125 to 0.212 mg.kg-1 in natura. Although there is no tolerance limit for Cd in mushrooms in Brazil, the results show that Lentinus edodes mushrooms can be safely consumed.

  16. Cadmium minimization in wheat: A critical review.

    Science.gov (United States)

    Rizwan, Muhammad; Ali, Shafaqat; Abbas, Tahir; Zia-Ur-Rehman, Muhammad; Hannan, Fakhir; Keller, Catherine; Al-Wabel, Mohammad I; Ok, Yong Sik

    2016-08-01

    Cadmium (Cd) accumulation in wheat (Triticum aestivum L.) and its subsequent transfer to food chain is a major environmental issue worldwide. Understanding wheat response to Cd stress and its management for aiming to reduce Cd uptake and accumulation in wheat may help to improve wheat growth and grain quality. This paper reviewed the toxic effects, tolerance mechanisms, and management of Cd stress in wheat. It was concluded that Cd decreased germination, growth, mineral nutrients, photosynthesis and grain yield of wheat and plant response to Cd toxicity varies with cultivars, growth conditions and duration of stress applied. Cadmium caused oxidative stress and genotoxicity in wheat plants. Stimulation of antioxidant defense system, osmoregulation, ion homeostasis and over production of signalling molecules are important adaptive strategies of wheat under Cd stress. Exogenous application of plant growth regulators, inorganic amendments, proper fertilization, silicon, and organic, manures and biochar, amendments are commonly used for the reduction of Cd uptake in wheat. Selection of low Cd-accumulating wheat cultivars, crop rotation, soil type, and exogenous application of microbes are among the other agronomic practices successfully employed in reducing Cd uptake by wheat. These management practices could enhance wheat tolerance to Cd stress and reduce the transfer of Cd to the food chain. However, their long-term sustainability in reducing Cd uptake by wheat needs further assessment. PMID:27062345

  17. Alternative materials to cadmium for neutron absorbers in safeguards applications

    International Nuclear Information System (INIS)

    Cadmium is increasingly difficult to use in safeguards applications because of rising cost and increased safety regulations. This work examines the properties of two materials produced by Ceradyne, inc. that present alternatives to cadmium for neutron shielding. The first is an aluminum metal doped with boron and the second is a boron carbide powder, compressed into a ceramic. Both are enriched in the 10B isotope. Two sheets of boron doped aluminum (1.1 mm and 5.2mm thick) and one sheet of boron carbide (8.5mm thick) were provided by Ceradyne for testing. An experiment was designed to test the neutron absorption capabilities of these three sheets against two different thicknesses of cadmium (0.6mm and 1.6mm thick). The thinner piece of aluminum boron alloy (1.1mm) performed as well as the cadmium pieces at absorbing neutrons. The thicker aluminum-boron plate provided more shielding than the cadmium sheets and the boron carbide performed best by a relatively large margin. Monte Carlo N-Particle eXtended (MCNPX) transport code modeling of the experiment was performed to provide validaLed computational tools for predicting the behavior of systems in which these materials may be incorporated as alternatives to cadmium. MCNPX calculations predict that approximately 0.17mm of the boron carbide is equivalent to 0.6mm of cadmium. There are drawbacks to these materials that need to be noted when considering using them as replacements for cadmium. Notably, they may need to be thicker than cadmium, and are not malleable, requiring machining to fit any curved forms.

  18. Cadmium-induced inhibition of photosynthesis and long-term acclimation to cadmium stress in the hyperaccumulator Thlaspi caerulescens.

    Science.gov (United States)

    Küpper, Hendrik; Parameswaran, Aravind; Leitenmaier, Barbara; Trtílek, Martin; Setlík, Ivan

    2007-01-01

    Acclimation of hyperaccumulators to heavy metal-induced stress is crucial for phytoremediation and was investigated using the hyperaccumulator Thlaspi caerulescens and the nonaccumulators T. fendleri and T. ochroleucum. Spatially and spectrally resolved kinetics of in vivo absorbance and fluorescence were measured with a novel fluorescence kinetic microscope. At the beginning of growth on cadmium (Cd), all species suffered from toxicity, but T. caerulescens subsequently recovered completely. During stress, a few mesophyll cells in T. caerulescens became more inhibited and accumulated more Cd than the majority; this heterogeneity disappeared during acclimation. Chlorophyll fluorescence parameters related to photochemistry were more strongly affected by Cd stress than nonphotochemical parameters, and only photochemistry showed acclimation. Cd acclimation in T. caerulescens shows that part of its Cd tolerance is inducible and involves transient physiological heterogeneity as an emergency defence mechanism. Differential effects of Cd stress on photochemical vs nonphotochemical parameters indicate that Cd inhibits the photosynthetic light reactions more than the Calvin-Benson cycle. Differential spectral distribution of Cd effects on photochemical vs nonphotochemical quenching shows that Cd inhibits at least two different targets in/around photosystem II (PSII). Spectrally homogeneous maximal PSII efficiency (F(v)/F(m)) suggests that in healthy T. caerulescens all chlorophylls fluorescing at room temperature are PSII-associated. PMID:17688582

  19. Exposure dose response relationships of the freshwater bivalve Hyridella australis to cadmium spiked sediments

    Energy Technology Data Exchange (ETDEWEB)

    Marasinghe Wadige, Chamani P.M., E-mail: chamani.marasinghe.wadige@canberra.edu.au; Maher, William A.; Taylor, Anne M.; Krikowa, Frank

    2014-07-01

    Highlights: • The exposure–dose–response approach was used to assess cadmium exposure and toxicity. • Accumulated cadmium in H. australis reflected the sediment cadmium exposure. • Spill over of cadmium into the biologically active pool was observed. • Increased cadmium resulted in measurable biological effects. • H. australis has the potential to be a cadmium biomonitor in freshwater environments. - Abstract: To understand how benthic biota may respond to the additive or antagonistic effects of metal mixtures in the environment it is first necessary to examine their responses to the individual metals. In this context, laboratory controlled single metal-spiked sediment toxicity tests are useful to assess this. The exposure–dose–response relationships of Hyridella australis to cadmium-spiked sediments were, therefore, investigated in laboratory microcosms. H. australis was exposed to individual cadmium spiked sediments (<0.05 (control), 4 ± 0.3 (low) and 15 ± 1 (high) μg/g dry mass) for 28 days. Dose was measured as cadmium accumulation in whole soft body and individual tissues at weekly intervals over the exposure period. Dose was further examined as sub-cellular localisation of cadmium in hepatopancreas tissues. The biological responses in terms of enzymatic and cellular biomarkers were measured in hepatopancreas tissues at day 28. H. australis accumulated cadmium from spiked sediments with an 8-fold (low exposure organisms) and 16-fold (high exposure organisms) increase at day 28 compared to control organisms. The accumulated tissue cadmium concentrations reflected the sediment cadmium exposure at day 28. Cadmium accumulation in high exposure organisms was inversely related to the tissue calcium concentrations. Gills of H. australis showed significantly higher cadmium accumulation than the other tissues. Accumulated cadmium in biologically active and biologically detoxified metal pools was not significantly different in cadmium exposed

  20. Cadmium biosorption by baker’s yeast in aqueous suspension

    OpenAIRE

    Tálos Katalin; Pernyeszi Tímea; Majdik Cornelia; Hegedűsova Alzbeta; Páger Csilla

    2012-01-01

    The biosorption of cadmium from artificial aqueous solutions using native baker’s yeast was investigated. The highest metal uptake value was 110 mg g-1 in a suspension of 0.3 g L-1. The effect of pH, initial cadmium concentration, adsorption time and biosorbent dosage on biosorption by baker’s yeast was studied. The maximum biosorption capacity of cadmium by yeast was observed at pH 6.0. The adsorption equilibrium was reached within sixty minutes and the sorption process followed pseudo...

  1. Experience of reprocessing of cadmium sulfide-containing waste materials

    International Nuclear Information System (INIS)

    Technique of cadmium extraction from sulfide-containing wastes using the method of oxidizing leaching was developed and subjected to industrial testing. Reagents containing manganese dioxide - manganese ore or manganese slime of electrolytic shop usually used in zinc production - are advisable to be used as oxidizers. Factors of cadmium extraction into solution appeared to be close to ones, obtained during laboratory investigation. If the yield of leaching residual equals ∼38% and the content of cadmium, being in insoluble form, equals ∼0.40%, metal losses with this residual are equal to 0.37%

  2. Hepatoprotective activity of Moringa oleifera against cadmium toxicity in rats

    OpenAIRE

    Reetu Toppo; Birendra Kumar Roy; Ravuri Halley Gora; Sushma Lalita Baxla; Prabhat Kumar

    2015-01-01

    Aim: The present investigation has been conducted to evaluate the hepatoprotective activity of Moringa oleifera against cadmium-induced toxicity in rats. Materials and Methods: For this study, 18 Wistar albino rats were taken. Control group, Group I rats were given cadmium chloride @ 200 ppm per kg and Group II rats were treated with M. oleifera extract @ 500 mg/kg along with cadmium chloride @ 200 ppm per kg (daily oral for 28 days). On 29th day, animals were slaughtered and various paramete...

  3. Cadmium and hypertension in exposed workers: A meta-analysis

    Directory of Open Access Journals (Sweden)

    Tiziana Caciari

    2013-06-01

    Full Text Available Objectives: In the general population, cadmium seems to be responsible for hypertension, atherosclerosis and an increase in acute coronary events. Therefore, the purpose of this meta-analysis was to analyze controlled studies conducted on cadmium and arterial pressure in occupationally-exposed workers. Materials and Methods: After analyzing all the relevant articles found in the literature, 6 publications were selected. Results: A higher prevalence of hypertension and higher values of systolic and diastolic blood pressure were recorded in the exposed subjects. Conclusions: Cadmium in occupationallyexposed individuals appears to induce an increase in systolic and diastolic blood pressure and an increase in the prevalence of hypertension.

  4. Zinc and cadmium oxidation by cyclopentadienylmolybdenum(tungsten) tricarbonyl chlorides

    International Nuclear Information System (INIS)

    Influence of the nature of organic solvent on reaction rate and yield of zinc and cadmium interaction products with Cp(CO)3 MCl complexes (Cp - cyclopentadiene; M = Mo, W) at temperatures of 283-303 K was studied. Kinetic parameters of zinc and cadmium oxidation by molybdenum complex in the presence of N,N-dimethylformamide were ascertained. Thermodynamic parameters of the oxidant and ligand adsorption on metal surface were determined. It is shown that the use of the complexes studied as metal oxidants permits preparing compounds featuring molybdenum and tunsten bond with zinc and cadmium

  5. Determination of cadmium in aluminium by atomic absorption spectrometry

    International Nuclear Information System (INIS)

    A direct method for the determination of cadmium in elemental aluminium is described. Metal samples are dissolved in diluted hydrochloric acid and cadmium is determined by atomic absorption spectrometry in an air-acetylene flame. Interference by non-specific absorption observed at the analytical wavelength incorrected for by means of a non-absorbing line emitted by the hollow-cathode lamp. Relatively large amounts of arsenic do not interfere. The minimun determinable concentration of cadmium for this procedure is 2-3 ppm, expressed on aluminium basis. (author)

  6. Cadmium pollution enhanced ozone damage to winter wheat: biochemical and physiological evidences

    Institute of Scientific and Technical Information of China (English)

    Yong Li; Caihong Li; Yanhai Zheng; Guanglei Wu; Tana Wuyun; Hong Xu; Xinhua He; Gaoming Jiang

    2011-01-01

    Combined effects of ozone (O3) and cadmium (Cd) on growth and physiology of winter wheat (Triticum aestivum L. cv. JM22)were determined. Wheat plants were grown without or with Cd and exposed to charcoal-filtered air (< 10 ppb O3) or elevated O3 (80 ± 5 ppb, 7 hr/day) for 20 days. Results showed that O3 considerably depressed light saturated net photosynthetic rate (-20%),stomatal conductance (-33%), chlorophyll content (-33%), and total biomass (-29%) without Cd. The corresponding decreases were further enhanced by 45%, 56%, 60% and 59%, respectively with Cd, indicating a synergistic effect of O3 and Cd on wheat. Ozone significantly increased the activity of superoxide dismutase (46%), catalase (48%) and peroxidase (56%). However, great increases in malondialdehyde (MDA) content (2.55 folds) and intercellular CO2 concentration (1.13 folds) were noted in O3+Cd treatment compared to control. Our findings demonstrated that the increased anti-oxidative activities in wheat plants exposed to O3+Cd might not be enough to overcome the adverse effects of the combination of both pollutants as evidenced by further increase in MDA content,which is an important indicator of lipid peroxidation. Precise prediction model on O3 damages to crop should be conducted to ensure agricultural production security by considering environmental constraints in an agricultural system in peri-urban regions.

  7. Chromosomal Locus for Cadmium Resistance in Pseudomonas putida Consisting of a Cadmium-Transporting ATPase and a MerR Family Response Regulator

    OpenAIRE

    Lee, Seon-Woo; Glickmann, Eric; Cooksey, Donald A.

    2001-01-01

    Pseudomonads from environmental sources vary widely in their sensitivity to cadmium, but the basis for this resistance is largely uncharactarized. A chromosomal fragment encoding cadmium resistance was cloned from Pseudomonas putida 06909, a rhizosphere bacterium, and sequence analysis revealed two divergently transcribed genes, cadA and cadR. CadA was similar to cadmium-transporting ATPases known mostly from gram-positive bacteria, and to ZntA, a lead-, zinc-, and cadmium-transporting ATPase...

  8. Inclusion free cadmium zinc tellurium and cadmium tellurium crystals and associated growth method

    Science.gov (United States)

    Bolotnikov, Aleskey E.; James, Ralph B.

    2010-07-20

    The present disclosure provides systems and methods for crystal growth of cadmium zinc tellurium (CZT) and cadmium tellurium (CdTe) crystals with an inverted growth reactor chamber. The inverted growth reactor chamber enables growth of single, large, high purity CZT and CdTe crystals that can be used, for example, in X-ray and gamma detection, substrates for infrared detectors, or the like. The inverted growth reactor chamber enables reductions in the presence of Te inclusions, which are recognized as an important limiting factor in using CZT or CdTe as radiation detectors. The inverted growth reactor chamber can be utilized with existing crystal growth techniques such as the Bridgman crystal growth mechanism and the like. In an exemplary embodiment, the inverted growth reactor chamber is a U-shaped ampoule.

  9. 9 CFR 113.499 - Products for treatment of failure of passive transfer.

    Science.gov (United States)

    2010-01-01

    ... STANDARD REQUIREMENTS Antibody Products § 113.499 Products for treatment of failure of passive transfer. A... antibody origin. A product for oral administration shall not be recommended for use in animals more than 24... animals. Each serial shall meet the applicable general requirements provided in § 113.450 and be...

  10. 21 CFR 113.87 - Operations in the thermal processing room.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Operations in the thermal processing room. 113.87... CONTAINERS Production and Process Controls § 113.87 Operations in the thermal processing room. (a) Operating... Food and Drug Administration. (b) A system for product traffic control in the retort room shall...

  11. 46 CFR 113.35-7 - Electric engine order telegraph systems; operations.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Electric engine order telegraph systems; operations. 113... ENGINEERING COMMUNICATION AND ALARM SYSTEMS AND EQUIPMENT Engine Order Telegraph Systems § 113.35-7 Electric engine order telegraph systems; operations. (a) Where two or more transmitters, located on or on top...

  12. 46 CFR 113.35-5 - Electric engine order telegraph systems.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Electric engine order telegraph systems. 113.35-5... COMMUNICATION AND ALARM SYSTEMS AND EQUIPMENT Engine Order Telegraph Systems § 113.35-5 Electric engine order telegraph systems. (a) Each electric engine order telegraph system must have transmitters and...

  13. 9 CFR 113.47 - Detection of extraneous viruses by the fluorescent antibody technique.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Detection of extraneous viruses by the fluorescent antibody technique. 113.47 Section 113.47 Animals and Animal Products ANIMAL AND PLANT HEALTH... fluorescent antibody technique. The test for detection of extraneous viruses by the fluorescent...

  14. High-field dissolution dynamic nuclear polarization of [1-13C]pyruvic acid

    DEFF Research Database (Denmark)

    Yoshihara, Hikari A. I.; Can, Emine; Karlsson, Magnus;

    2016-01-01

    [1-13C]pyruvate is the most widely used hyperpolarized metabolic magnetic resonance imaging agent. Using a custom-built 7.0 T polarizer operating at 1.0 K and trityl radical-doped [1-13C]pyruvic acid, unextrapolated solution-state 13C polarization greater than 60% was measured after dissolution a...

  15. 9 CFR 113.46 - Detection of cytopathogenic and/or hemadsorbing agents.

    Science.gov (United States)

    2010-01-01

    ... hemadsorbing agents. 113.46 Section 113.46 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION... abnormalities attributable to an extraneous agent. (b) Test for hemadsorbing agents. One or more monolayers that... specific cytopathology or hemadsorption attributable to an extraneous agent is found, the material...

  16. 27 CFR 22.113 - Receipt of tax-free alcohol.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Receipt of tax-free alcohol. 22.113 Section 22.113 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS DISTRIBUTION AND USE OF TAX-FREE ALCOHOL Withdrawal...

  17. 9 CFR 113.36 - Detection of pathogens by the chicken inoculation test.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Detection of pathogens by the chicken inoculation test. 113.36 Section 113.36 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... vaccine being tested by each of the following routes: Subcutaneous, intratracheal, eye-drop, and...

  18. Yeast Interacting Proteins Database: YGR113W, YIL144W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YGR113W DAM1 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...113W Bait gene name DAM1 Bait description Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force

  19. 24 CFR 17.113 - Procedures for administrative offset: interagency cooperation.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Procedures for administrative offset: interagency cooperation. 17.113 Section 17.113 Housing and Urban Development Office of the... offset: interagency cooperation. The Department will make use of all possible methods of cooperating...

  20. 19 CFR Appendix D to Part 113 - Importer Security Filing Bond

    Science.gov (United States)

    2010-04-01

    ...) agrees to comply with all Importer Security Filing requirements set forth in 19 CFR part 149, including... THE TREASURY CUSTOMS BONDS Pt. 113, App. D Appendix D to Part 113—Importer Security Filing Bond This... 19 Customs Duties 1 2010-04-01 2010-04-01 false Importer Security Filing Bond D Appendix D to...

  1. 14 CFR 61.113 - Private pilot privileges and limitations: Pilot in command.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Private pilot privileges and limitations: Pilot in command. 61.113 Section 61.113 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION... least 200 hours of logged flight time may demonstrate an aircraft in flight to a prospective buyer....

  2. 9 CFR 113.27 - Detection of extraneous viable bacteria and fungi in live vaccines.

    Science.gov (United States)

    2010-01-01

    ... bacteria and fungi in live vaccines. 113.27 Section 113.27 Animals and Animal Products ANIMAL AND PLANT... bacteria and fungi in live vaccines. Unless otherwise specified by the Administrator or elsewhere exempted in this part, each serial and subserial of live vaccine and each lot of Master Seed Virus and...

  3. 40 CFR 35.113 - Reimbursement for pre-award costs.

    Science.gov (United States)

    2010-07-01

    ... Reimbursement for pre-award costs. (a) Notwithstanding the requirements of 40 CFR 31.23(a) and OMB cost... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Reimbursement for pre-award costs. 35.113 Section 35.113 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GRANTS AND OTHER...

  4. 19 CFR 141.113 - Recall of merchandise released from Customs and Border Protection custody.

    Science.gov (United States)

    2010-04-01

    ... Federal Register citations affecting § 141.113, see the List of CFR Sections Affected, which appears in... 19 Customs Duties 2 2010-04-01 2010-04-01 false Recall of merchandise released from Customs and... Merchandise § 141.113 Recall of merchandise released from Customs and Border Protection custody....

  5. 19 CFR 113.73 - Foreign trade zone operator bond conditions.

    Science.gov (United States)

    2010-04-01

    ... trade zone or subzone; (2) Pay the compensation and expenses of any Customs officer, as required by law... 19 Customs Duties 1 2010-04-01 2010-04-01 false Foreign trade zone operator bond conditions. 113...; DEPARTMENT OF THE TREASURY CUSTOMS BONDS Customs Bond Conditions § 113.73 Foreign trade zone operator...

  6. Cadmium transport and tolerance in rice: perspectives for reducing grain cadmium accumulation

    OpenAIRE

    Uraguchi, Shimpei; Fujiwara, Toru

    2012-01-01

    Cadmium (Cd) is a toxic heavy metal which harms human health. In Japan, a major source of human Cd-intake is rice grains and contamination of paddy soils by Cd and accumulation of Cd in rice grains are the serious agricultural issues. There also exist Cd contamination of rice and its toxicity in several populations in countries including China and Thailand. Understanding the Cd transport mechanisms in rice can be a basis for regulating rice Cd transport and accumulation by molecular engineeri...

  7. Fractionation of Stable Cadmium Isotopes in the Cadmium Tolerant Ricinus communis and Hyperaccumulator Solanum nigrum

    OpenAIRE

    Rongfei Wei; Qingjun Guo; Hanjie Wen; Congqiang Liu; Junxing Yang; Marc Peters; Jian Hu; Guangxu Zhu; Hanzhi Zhang; Liyan Tian; Xiaokun Han; Jie Ma; Chuanwei Zhu; Yingxin Wan

    2016-01-01

    Cadmium (Cd) isotopes provide new insights into Cd uptake, transport and storage mechanisms in plants. Therefore, the present study adopted the Cd-tolerant Ricinus communis and Cd-hyperaccumulator Solanum nigrum, which were cultured under controlled conditions in a nutrient solution with variable Cd supply, to test the isotopic fractionation of Cd during plant uptake. The Cd isotope compositions of nutrient solutions and organs of the plants were measured by multiple collector inductively cou...

  8. Electrochemical removal of cadmium from bio-ash; Elektrokemisk fjernelse af cadmium fra bioasker

    Energy Technology Data Exchange (ETDEWEB)

    Juul Pedersen, Anne; Ottosen, Lisbeth M.; Simonsen, Peter; Christensen, Terkel C.

    2004-07-01

    The potential of using the method electrodialytic remediation for removal of cadmium from bioashes has been investigated. Five different types of fly ash from biomass combustion were included in the study: 1) A straw combustion fly ash from grate-firing at Avedoere power plant. 2) A fly ash from co-firing of wood and fuel oil at Avedoere power plant. 3) A suspended, grain size fractionated straw fly ash, obtained from PSO project FU 2201, fine and coarse size fraction. The ash was originally produced at Avedoere power plant. 4) A straw pellet fly ash from dust-firing at Amager power plant. Thr five ashes were characterised, and a series of preliminary elekctrodialytic remediation experiments were conducted on each ash. In spite a significant differences between the five ashes with respect to parameters such as pH and content of cadmium, all ashes showed promising remediation potential. For all ashes cadmium concentrations below the regulatory limits for recycling were reached in one or more of the preliminary remediation experiements. The best results were obtained with the suspended straw ash from PSO FU 2201, whereas the results with the wood chips ash, due to a high initial pH value, were less sucessful, meaning that the remediation process was progressing more slowly. (BA)

  9. Comparative effects of three dithiocarbamates on tissue distribution and excretion of cadmium in mice

    International Nuclear Information System (INIS)

    The effects of sodium N-benzyl-D-glucamine dithiocarbamate (BGD), sodium N-p-hydroxymethylbenzyl-D-glucamine dithiocarbamate (HBGD), and sodium N-p-carboxybenzyl-D-glucamine dithiocarbamate (CBGD), which were newly synthesized, on the distribution and excretion of cadmium were compared in mice exposed to cadmium. Mice were injected with 109CdCl2 (1 mg Cd/kg and 74 KBq of 109Cd/one animal) and 30 min or 24 h later, they were injected with the dithiocarbamates (400 mumols/kg). At 30 min after treatment with cadmium, these chelating agents significantly enhanced the biliary excretion of cadmium, and HBGD and CBGD significantly increased the urinary excretion of the metal. At 24 h after cadmium injection, BGD and HBGD significantly increased the biliary excretion of cadmium and HBGD was the most effective on the biliary excretion of the metal. These chelating agents were effective in mobilizing cadmium from the liver and kidney at 30 min after cadmium treatment. HBGD showed the largest effectiveness on the depression of cadmium contents in the liver and kidney. At 24 h after cadmium treatment, only HBGD among these chelating agents significantly reduced the cadmium contents in the liver and kidney. These results show that the injection of HBGD at both 30 min and 24 h after cadmium treatment can much more effectively mobilize cadmium from the body mainly through the bile without redistribution of cadmium to other tissues, such as brain, testes, and heart, than injection of BGD and CBGD

  10. A Study of Growth of Cadmium Oxide Nano structure

    International Nuclear Information System (INIS)

    Cadmium oxide nano structure were synthesized by solid-vapor deposition without catalyst. Cadmium Oxide powder was heated to 1320 K in a tube furnace, and the resultant vapor was carried to the silicon substrate zone by an argon flow. Field electron scanning electron microscopy revealed that the product was dendrite-like petals of Cadmium Oxide nano structure. The grown nano structure had random orientations and a grain size of 30 nm. Photoluminescence spectroscopy was conducted to investigate the optical properties of the nano structures. The red-shift direct band gap energy of Cadmium Oxide nano structure was at 548 nm (2.26 eV), whereas that of CdO bulk was at 491 nm (2.5 eV). (author)

  11. Electrodialytic removal of cadmium from straw combustion fly ash

    DEFF Research Database (Denmark)

    Hansen, Henrik K.; Ottosen, Lisbeth M.; Villumsen, Arne

    2004-01-01

    Fly ash from straw combustion contains valuable nutrients when returned to agricultural soils. In many instances, however, this fly ash may contain heavy metals, such as cadmium, at levels which often exceed the limits given by the Danish legislation. Thus before utilizing the nutrients, cadmium...... must be removed from these ashes. The use of an electrodialytic remediation method to remove cadmium from fly ash arising from straw combustion and containing 11.2 mg Cd kg$+-1$/ DM (dry matter) was accessed. After 36 days of remediation at a constant current density of 5.6 mA cm$+-2$/ more than 97% of...... the cadmium had been removed from around 150 g ash on a dry basis. $CPY 2004 Society of Chemical Industry....

  12. Effect of gamma radiation on cadmium telluride surface properties

    International Nuclear Information System (INIS)

    The effect of γ-irradiation on the surface properties of cadmium telluride is studied. The possibility of oriented modification of surface properties for increasing the adsorption activity and obtaining the materials, suited for the sensor transducer production, is shown

  13. Studies on cadmium accumulation by some selected floating macrophytes.

    Science.gov (United States)

    Shuvaeva, Olga V; Belchenko, Ludmila A; Romanova, Tamara E

    2013-01-01

    The results of investigation of the process of cadmium accumulation by floating plants of Eichhornia crassipes and Pistia stratiotes are discussed. The main specialty of this study is that it puts more emphasis on the mechanism of penetration of pollutant within the plant and its fate during accumulation act. As a result it was shown that at the first stage of cadmium uptake the sorption of the metal on the surface of the roots due to the presence of carboxylic groups takes place. At the root of the plant cadmium mainly localized in the cortex and rhizodermis, then the pollutant penetrates into the tissues of the stem according to its translocation factor. It has been also assumed that flavonoids perform an intermediate role in the accumulation of cadmium by the plant, taking part in the transport and combat an oxidative stress. PMID:23819290

  14. Soil biogeochemistry, plant physiology and phytoremediation of cadmium contaminated soils

    Science.gov (United States)

    Cadmium (Cd) loading in soil and the environment has been accelerated worldwide due to enhanced industrialization and intensified agricultural production, particularly in the developing countries. Soil Cd pollution, resulting from both anthropogenic and geogenic sources, has posed an increasing chal...

  15. Ion exchange of Cobalt and Cadmium in Zeolite X

    International Nuclear Information System (INIS)

    The growing development in the industry has an important contribution to the environmental damage, where the natural effluents are each day more contaminated by toxic elements, such as: mercury, chromium, lead and cadmium. So as to separate such elements it has sorbent must have enough stability, and have a sharp capacity of sorption. In this work it was studied the sorption behavior of cobalt and on the other hand, cadmium in aqueous solutions, which along with sodic form of the Zeolite X, undergoes a phenomenon of ionic interchange. Such interchange was verify to different concentration of cadmium, cobalt and hydronium ion. The content of cobalt and sodium in the interchanged samples was detected through the neutronic activation analysis. The results disclose a higher selectivity for cadmium than cobalt. (Author)

  16. EFFECTS OF CADMIUM ON THE REPRODUCTIVE AXIS OF JAPANESE MEDAKA

    Science.gov (United States)

    Cadmium (Cd) is a ubquitous element and a significant inorganic pollutant that has previously been found to bioaccumulate in reproductive organs of fish and disrupt important endocrine processes, especially those involved in synthesis, release and metabolism of hormones. Clearly,...

  17. Surfactant Mediated Cadmium Determination with Dithizone in Aqueous Solution

    OpenAIRE

    Ismael, Fouad Jawad

    2014-01-01

    ABSTRACT: Cadmium is a toxic and hazardous trace metal that has become a serious environmental pollutant since industrialization and intensive farming began in late 19th century. Although there are many established wet-chemical and instrumental methods for qualitative and quantitative determination of cadmium, most involve the formation of the Cd-dithizone complex in the presence of the highly toxic potassium cyanide which is then extracted into carcinogenic chlorinated organic solvents such ...

  18. Ecotoxicity and genotoxicity of cadmium in different marine trophic levels.

    Science.gov (United States)

    Pavlaki, Maria D; Araújo, Mário J; Cardoso, Diogo N; Silva, Ana Rita R; Cruz, Andreia; Mendo, Sónia; Soares, Amadeu M V M; Calado, Ricardo; Loureiro, Susana

    2016-08-01

    Cadmium ecotoxicity and genotoxicity was assessed in three representative species of different trophic levels of marine ecosystems - the calanoid copepod Acartia tonsa, the decapod shrimp, Palaemon varians and the pleuronectiform fish Solea senegalensis. Ecotoxicity endpoints assessed in this study were adult survival, hatching success and larval development ratio (LDR) for A. tonsa, survival of the first larval stage (zoea I) and post-larvae of P. varians, egg and larvae survival, as well as the presence of malformations in the larval stage of S. senegalensis. In vivo genotoxicity was assessed on adult A. tonsa, the larval and postlarval stage of P. varians and newly hatched larvae of S. senegalensis using the comet assay. Results showed that the highest sensitivity to cadmium is displayed by A. tonsa, with the most sensitive endpoint being the LDR of nauplii to copepodites. Sole eggs displayed the highest tolerance to cadmium compared to the other endpoints evaluated for all tested species. Recorded cadmium toxicity was (by increasing order): S. senegalensis eggs < P. varians post-larvae < P. varians zoea I < S. senegalensis larvae < A. tonsa eggs < A. tonsa LDR. DNA damage to all species exposed to cadmium increased with increasing concentrations. Overall, understanding cadmium chemical speciation is paramount to reliably evaluate the effects of this metal in marine ecosystems. Cadmium is genotoxic to all three species tested and therefore may differentially impact individuals and populations of marine taxa. As A. tonsa was the most sensitive species and occupies a lower trophic level, it is likely that cadmium contamination may trigger bottom-up cascading effects in marine trophic interactions. PMID:27203468

  19. Cadmium and hypertension in exposed workers: A meta-analysis

    OpenAIRE

    Tiziana Caciari; Angela Sancini; Mario Fioravanti; Teodorico Casale; Lucio Montuori; Maria Fiaschetti; Maria Pia Schifano; Giorgia Andreozzi; Nadia Nardone; Gianfranco Tomei; Manuela Ciarrocca; Maria Valeria Rosati; Francesco Tomei

    2013-01-01

    Objectives: In the general population, cadmium seems to be responsible for hypertension, atherosclerosis and an increase in acute coronary events. Therefore, the purpose of this meta-analysis was to analyze controlled studies conducted on cadmium and arterial pressure in occupationally-exposed workers. Materials and Methods: After analyzing all the relevant articles found in the literature, 6 publications were selected. Results: A higher prevalence of hypertension and higher values of systoli...

  20. Association between blood cadmium levels and malnutrition in peritoneal dialysis

    OpenAIRE

    Hsu, Ching-Wei; Lin, Ja-Liang; Lin-Tan, Dan-Tzu; Huang, Wen-Hung; Chen, Kuan-Hsing; Yen, Tzung-Hai

    2014-01-01

    Background Malnutrition is associated with an increased risk of cardiovascular death and may cause protein-energy wasting in individuals with chronic kidney disease. A previous study demonstrated that blood cadmium levels (BCLs) were associated with malnutrition in maintenance hemodialysis (MHD) patients. However, the correlation between cadmium exposure and malnutrition remains unclear in chronic peritoneal dialysis (CPD) patients. This study examined the possible adverse effects of environm...

  1. Avalanche multiplication of electrons and holes in cadmium telluride

    CERN Document Server

    Demich, N V

    2001-01-01

    Determination of the ratio of the coefficients of the electrons and holes of the diode structures impact ionization is carried out with the purpose of optimizing the parameters of the avalanche diodes from the cadmium telluride. It is shown experimentally, that the process of the impact ionization in the cadmium telluride is stimulated by holes. The ratio of the coefficients of the holes and electrons impact ionization constitutes approx = 30-40

  2. Elektrokemisk fjernelse af cadmium fra bioasker

    DEFF Research Database (Denmark)

    Pedersen, Anne Juul; Ottosen, Lisbeth M.; Simonsen, Peter;

    Hosliggende rapport formidler resultaterne fra PSO-projektet: ”Elektrokemisk fjernelse af cadmium fra bioasker” (PSO-F&U 3206), finansieret af Elkraft System og Energi E2 A/S. Projektet blev gennemført i perioden 01.05.2003 – 30.06.2004, og partnerne var Energi E2 A/S, BYG-DTU og Krüger A/S, med ...... igangværende PSO FU 2201 ”Opgradering af restprodukter” (”Askepot”), og det skulle derfor også undersøges, om den elektrodialytiske rensningsproces evt. kunne kombineres med den vaskeproces, der benyttes til rensning af aske i FU 2201....

  3. Cadmium substituted high permeability lithium ferrite

    Indian Academy of Sciences (India)

    S S Bellad; S C Watawe; A M Shaikh; B K Chougule

    2000-04-01

    Polycrystalline Li0.5–/2 Cd Fe2.5–/2O4 ferrites where = 0, 0.1, 0.2, 0.3, 0.4, 0.5 and 0.6 were prepared by a double sintering ceramic technique and characterized by X-ray diffraction and scanning electron microscopy (SEM). The lattice parameter is found to increase monotonically with the cadmium content. It is explained in terms of the sizes of component ions. The grain size of the samples increases up to = 0.3 and then it decreases for higher values of . A similar trend is observed in the variation of Ms with Cd2+ content. The initial permeability () is however found to increase continuously with . The increase in is attributed to decrease of anisotropy constant K1 and higher grain size of the samples.

  4. Flotation of cadmium-loaded biomass.

    Science.gov (United States)

    Matis, K A; Zouboulis, A I

    1994-07-01

    Biosorption of heavy metal ions such as Cd(2+) by dead biomass has been recognized as a potential alternative to existing removal technologies applied to wastewater treatment. Two bacterial strains were studied in the laboratory, streptomyces griseus and S. clavuligerus, an industrial by-product. Both washed and unwashed samples were examined. Foam flotation proposed in this work as the separation state following biosorption. Effective biomass separation was conducted in the presence of a frother, ethanol. The pH of the solution was a crucial parameter for flotation and also for metal binding. Other basic parameters of flotation examined were the initial cadmium concentration in the dilute aqueous solution and the quantity of biomass used. A study of zeta-potential measurements of the actinomycetes was carried out under the conditions used in the separation; surface tension was also measured. These provided useful information on the process. PMID:18618752

  5. Synthesis and Electroluminescence Characterization of Cadmium Complex

    Directory of Open Access Journals (Sweden)

    Rahulkumar

    2011-01-01

    Full Text Available We have synthesized and characterized a new electroluminescence material,Cadmium [(2-(2-hydroxyphenylbenzoxazole(8-hydoxyquinoline] Cd(HPBq. The absorption spectra of this material show maxima at 378 nm. It may be attributed due to π° – π* transition. The photoluminescence showed peak at 520 nm. TGA data of the material shows stability up to 370 °C .Organic light emitting diode have been fabricated with this material and the fundamental structures of the device is ITO/α-NPD/ Cd(HPBq/BCP/Alq3/LiF/Al exhibited a luminescence peak at 550 nm. The maximum luminescence of the device was 295 cd/m2 with current density of 6687 A/m2 at 20 V. The maximum current efficiency of OLED was 1.01 cd/A at 17 V and power efficiency was 1.01 lm/w at 17 V.

  6. Soil Cadmium Regulates Antioxidases in Sorghum

    Institute of Scientific and Technical Information of China (English)

    LIU Da-lin; ZHANG Shu-pan; CHEN Zheng; QIU Wei-wei

    2010-01-01

    The regulatory mechanism of soil cadmium(Cd)on antioxidases in sorghum was studied using 3 sorghum species viz.,sweet sorghum[Sorghum bicolor(L.)]Moench.cv.Hunnigreen,sorghum hybrid sudangrass(Sorghum bicolor × S.sudanense,cv.Everlush)and sudangrass[Sorghum sudanense(Piper)Stapf cv.Xinjiang].The results showed that low concentrations of Cd2+(≤10 mg kg-1)induced the activities of 4 antioxidases in leaves of the 3 species of sorghum,but high Cd2+concentrations(≥50 mg kg-1)significantly reduced the activities of all the four antioxidases.The glutathione(GSH)contents in leaves of the 3 species of sorghum correlated positively with the Cd2+concentrations.The maximum antioxidase activities were observed at the elongation stage of sorghum during the whole growth period.

  7. Cadmium in goods - contribution to environmental exposure

    Energy Technology Data Exchange (ETDEWEB)

    Bergbaeck, B.; Jonsson, Arne [Kalmar Univ. (Sweden). Dept. of Natural Science

    1998-03-01

    The total amount of Cd used in Sweden since 1940 is approximately 5000 tonnes, including alloys, fertilizers and impurities in zinc. The stock of Cd in goods in the Swedish anthroposphere is dominated by NiCd-batteries. However, when one considers the degree of exposure to corrosion, Cd stabilizers are dominant. Emissions of Cd from industrial plants and other point sources have been historically important. However, these point source emissions must be seen in relation to the increasingly significant fugitive `consumption emissions`, from the use and/or end-use of various goods. In this study, methods of reconstructing the flows of cadmium (Cd) and estimating the emissions over time are discussed. This is done through studies of the development of production, technology, trade and the longevity of metals in Swedish society. This last part in the chain will form the `consumption emissions` calculated from emission factors giving the proportion of the cadmium content in goods that eventually will reach the environment. The main accumulation of metals in the anthroposphere occurs in urban areas where the influx of metals is greatest. Urban areas probably represent `hot spots` as far as this type of environmental impact is concerned. Extreme Cd concentrations in surface sediments in central Stockholm indicate an ongoing release of Cd from the anthroposphere. The sources are so far unknown, i.e. this Cd flow to the biosphere cannot be explained in terms of deposition or emissions from point sources. Approximately 40 tonnes of Cd in goods are exposed to corrosion in varying degrees. This stock is dominated by Cd in stabilizers and pigments, and as impurities in Zn 15 refs, 2 figs, 8 tabs

  8. Adsorption mechanism of copper and cadmium onto defatted waste biomass.

    Science.gov (United States)

    Ogata, Fumihiko; Tominaga, Hisato; Yabutani, Hitoshi; Kawasaki, Naohito

    2011-01-01

    In this study, the amount of copper or cadmium adsorbed using waste biomass (i.e., coffee grounds (CG) and rice bran (RB)) was investigated. The amount of crude protein in defatted CG (D-CG) or RB (D-RB) was greater than that in CG or RB, respectively. The amount of copper or cadmium adsorbed using CG was greater than that using RB. Additionally, the amount of copper or cadmium adsorbed was not affected by the presence of fat in CG. Adsorption data was fitted to the Freundlich equation, and the correlation coefficients were in the range of 0.794-0.991. The main adsorption mechanism was thought to be monolayer adsorption onto the surface of the waste biomass. The adsorption rate data was fitted to the pseudo-second-order model, and the correlation coefficient average was in the range of 0.891-0.945. This result showed that the rate-limiting step may be chemisorption. Moreover, the amount of copper or cadmium desorbed from CG or RB using 0.01 mol/L or 1.00 mol/L HNO(3) was investigated. Desorption with 0.01 mol/L HNO(3) resulted in the recovery of 86-97% of the copper and cadmium, indicating that copper or cadmium that was adsorbed using waste biomass was recoverable. PMID:21701100

  9. Tantalum-cadmium film coatings: Preparation, phase composition, and structure

    Science.gov (United States)

    Tuleushev, Yu. Zh.; Volodin, V. N.; Zhakanbaev, E. A.

    2015-01-01

    Ion-plasma sputtering and codeposition of ultrafine Ta and Cd particles were used for the first time to prepare solid solutions, namely, alloys with up to 66.2 at % Cd in the form of coatings; the fact of such a production confirms the thermal-fluctuation melting and coalescence of small particles. When the coatings are formed by tantalum and cadmium nanolayers, the mutual dissolution of the components takes place, which is accompanied by the formation of solid solutions of one metal in the other. When the cadmium concentration is above 44 at %, the β-Ta tetragonal lattice transforms into the α-Ta body-centered cubic lattice. Beginning from 74.4 at % Cd, a hexagonal structure typical of cadmium is formed, and tantalum is present in the coatings in the form of amorphous phase. The formation of β-Ta- and Cd-based interstitial and α-Ta-based substitute solid solutions is stated. At 700°C, cadmium evaporates from Ta-based solid solutions, and porous tantalum is formed. The evaporation of cadmium from coatings, which consist of the mixture of tantalum solid solution in cadmium and amorphous tantalum, leads to the formation of tantalum characterized by a highly developed surface. The prepared Ta-based materials assume the technological application of the results of the investigation.

  10. Effects of Cadmium on Some Physiological Characteristics of Eucalyptus occidentalis

    Directory of Open Access Journals (Sweden)

    A. Shariat

    2010-10-01

    Full Text Available Heavy metals including cadmium produced as a result of urban, industrial and agricultural activities lead to the water pollution. Also, considering the growing need for silviculture in Iran, it is necessary to conduct a comprehensive research on fast growing and evergreen species of Eucalyptus and their role in heavy metals' absorption. To achieve this goal, Eucalyptus occidentalis seedlings were grown in pots containing silica and irrigated with a mixture of nutrient solution and cadmium chloride in 5, 10 and 15 m M for 10 months. Root and leaf samples were harvested and the amount of cadmium in stem, root and leaf organs was measured. Also, some morphological and physiological characteristics were determined including soluble sugar and praline. The analysis indicated that the cadmium concentrations of 15 mM treatment in the root, leaf and stem were 585, 142 and 87 mg/kg D.W., respectively. Proline content increased with the increase of Cadmium concentration while the content of pigments decreased. The result of this research shows that eucalypt has the potential of cadmium accumulation without any serious damage to its growth. Therefore, the plant can be used to decrease the environmental pollutions.

  11. Trichosporon jirovecii-mediated synthesis of cadmium sulfide nanoparticles.

    Science.gov (United States)

    El-Baz, Ashraf Farag; Sorour, Noha Mohamed; Shetaia, Youssria Mohamed

    2016-05-01

    Cadmium sulphide is one of the most promising materials for solar cells and of great interest due to its useful applications in photonics and electronics, thus the development of bio-mediated synthesis of cadmium sulphide nanoparticles (CdS NPs) is one of the essential areas in nanoparticles. The present study demonstrates for the first time the eco-friendly biosynthesis of CdS NPs using the yeast Trichosporon jirovecii. The biosynthesis of CdS NPs were confirmed by UV-Vis spectrum and characterized by X-ray diffraction assay and electron microscopy. Scanning and transmission electron microscope analyses shows the formation of spherical CdS NPs with a size range of about 6-15 nm with a mean Cd:S molar ratio of 1.0:0.98. T. jirovecii produced hydrogen sulfide on cysteine containing medium confirmed by positive cysteine-desulfhydrase activity and the colony color turned yellow on 0.1 mM cadmium containing medium. T. jirovecii tolerance to cadmium was increased by the UV treatment and three 0.6 mM cadmium tolerant mutants were generated upon the UV radiation treatment. The overall results indicated that T. jirovecii could tolerate cadmium toxicity by its conversion into CdS NPs on cysteine containing medium using cysteine-desulfhydrase as a defense response mechanism. PMID:26467054

  12. CERN: Fixed target targets

    International Nuclear Information System (INIS)

    Full text: While the immediate priority of CERN's research programme is to exploit to the full the world's largest accelerator, the LEP electron-positron collider and its concomitant LEP200 energy upgrade (January, page 1), CERN is also mindful of its long tradition of diversified research. Away from LEP and preparations for the LHC proton-proton collider to be built above LEP in the same 27-kilometre tunnel, CERN is also preparing for a new generation of heavy ion experiments using a new source, providing heavier ions (April 1992, page 8), with first physics expected next year. CERN's smallest accelerator, the LEAR Low Energy Antiproton Ring continues to cover a wide range of research topics, and saw a record number of hours of operation in 1992. The new ISOLDE on-line isotope separator was inaugurated last year (July, page 5) and physics is already underway. The remaining effort concentrates around fixed target experiments at the SPS synchrotron, which formed the main thrust of CERN's research during the late 1970s. With the SPS and LEAR now approaching middle age, their research future was extensively studied last year. Broadly, a vigorous SPS programme looks assured until at least the end of 1995. Decisions for the longer term future of the West Experimental Area of the SPS will have to take into account the heavy demand for test beams from work towards experiments at big colliders, both at CERN and elsewhere. The North Experimental Area is the scene of larger experiments with longer lead times. Several more years of LEAR exploitation are already in the pipeline, but for the longer term, the ambitious Superlear project for a superconducting ring (January 1992, page 7) did not catch on. Neutrino physics has a long tradition at CERN, and this continues with the preparations for two major projects, the Chorus and Nomad experiments (November 1991, page 7), to start next year in the West Area. Delicate neutrino oscillation effects could become

  13. Bryan Mound SPR cavern 113 remedial leach stage 1 analysis.

    Energy Technology Data Exchange (ETDEWEB)

    Rudeen, David Keith [GRAM, Inc., Albuquerque, NM; Weber, Paula D.; Lord, David L.

    2013-08-01

    The U.S. Strategic Petroleum Reserve implemented the first stage of a leach plan in 2011-2012 to expand storage volume in the existing Bryan Mound 113 cavern from a starting volume of 7.4 million barrels (MMB) to its design volume of 11.2 MMB. The first stage was terminated several months earlier than expected in August, 2012, as the upper section of the leach zone expanded outward more quickly than design. The oil-brine interface was then re-positioned with the intent to resume leaching in the second stage configuration. This report evaluates the as-built configuration of the cavern at the end of the first stage, and recommends changes to the second stage plan in order to accommodate for the variance between the first stage plan and the as-built cavern. SANSMIC leach code simulations are presented and compared with sonar surveys in order to aid in the analysis and offer projections of likely outcomes from the revised plan for the second stage leach.

  14. Stellar multiplicity of the open cluster ASCC 113

    Energy Technology Data Exchange (ETDEWEB)

    Guerrero, C. A.; Orlov, V. G.; Monroy-Rodríguez, M. A.; Voitsekhovich, V. V., E-mail: cguerrero@astro.unam.mx, E-mail: orlov@astro.unam.mx, E-mail: mmonroy@astro.unam.mx, E-mail: voisteko@astro.unam.mx [Instituto de Astronomía, Universidad Nacional Autónoma de México, México, D. F. 04510 (Mexico)

    2014-02-01

    We present a high angular resolution survey for binary and multiple stars in the Galactic open cluster ASCC 113. Our observations were conducted on the 2.1 m telescope of the Observatorio Astronómico Nacional, Sierra San Pedro Mártir, México. Combining our results with data taken from the literature, we found a ratio of the number of single to binary stars to be 27:7 for the most probable members, so the multiplicity fraction for this cluster is 20.6% ± 3%. We also observed field stars in the vicinity of the cluster and estimated a ratio of multiplicities to be 125:27:4:1:0:0:0:1 (between one and eight companions), equivalent to a multiplicity fraction of 20.9% ± 1%. We estimated the number of undetected companions in our sample to be very small. Comparing the multiplicity frequency of the cluster with the frequency of the field, we concluded that they are statistically indistinguishable from each other. We provide a brief review on the topic of stellar multiplicity in open clusters.

  15. Morning Frost in Trench Dug by Phoenix, Sol 113

    Science.gov (United States)

    2008-01-01

    This image from the Surface Stereo Imager on NASA's Phoenix Mars Lander shows morning frost inside the 'Snow White' trench dug by the lander, in addition to subsurface ice exposed by use of a rasp on the floor of the trench. The camera took this image at about 9 a.m. local solar time during the 113th Martian day of the mission (Sept. 18, 2008). Bright material near and below the four-by-four set of rasp holes in the upper half of the image is water-ice exposed by rasping and scraping in the trench earlier the same morning. Other bright material especially around the edges of the trench, is frost. Earlier in the mission, when the sun stayed above the horizon all night, morning frost was not evident in the trench. This image is presented in approximately true color. The trench is 4 to 5 centimeters (about 2 inches) deep, about 23 centimeters (9 inches) wide. Phoenix landed on a Martian arctic plain on May 25, 2008. The mission is led by the University of Arizona, Tucson, on behalf of NASA. Project management of the mission is led by NASA's Jet Propulsion Laboratory, Pasadena, Calif. Spacecraft development was by Lockheed Martin Space Systems, Denver.

  16. Cadmium toxicity to ringed seals (Phoca hispida): an epidemiological study of possible cadmium-induced nephropathy and osteodystrophy in ringed seals (Phoca hispida) from Qaanaaq in Northwest Greenland

    DEFF Research Database (Denmark)

    Sonne-Hansen, C; Dietz, R; Leifsson, P S;

    2002-01-01

    the skeleton nor to the cadmium concentrations. Furthermore, the degree of mineralisation of the skeleton was not correlated with the cadmium concentration, age or sex. It can therefore be concluded that despite high levels of cadmium, none of the ringed seals showed any signs of cadmium......-induced nephropathy or osteodystrophy. This might be explained by the composition of the ringed seals diet, which contains high levels of vitamin D, calcium, phosphorus, zinc, selenium and protein. These elements are all likely to counteract cadmium-induced damage. It is speculated that ringed seal are not...

  17. The Role of Exopolymers in Protection of Ralstonia sp., a Cadmium-resistant Bacterium, from Cadmium Toxicity

    OpenAIRE

    Anchulee Watcharamusik; Benjaphorn Prapagdee

    2008-01-01

    Production of exopolymers is one of heavy metal resistance mechanisms in bacteria. Ralstonia sp. TAK1, a cadmium-resistant bacterium, was isolated from a high cadmium (Cd) contaminated soil at the zinc mine, Tak province, Thailand. The bacterium was cultivated in LB broth and its growth was monitored. The yields of exopolymers were measured by the phenol-sulfuric method at different growth phases. The levels of Cd resistance were quantitatively determined by survival cell assay. The highest a...

  18. Influence of pressure on the synthesis of cadmium sulfide by combustion of complex compound of cadmium nitrate with thiosemicarbazide

    International Nuclear Information System (INIS)

    A method of cadmium sulfide synthesis based on combustion of high-energy content complex of cadmium nitrate and thiosemicarbazide has been suggested. The combustion has been carried out in nitrogen under gas pressure varying from 0.1 to 2.0 MPa. It is shown that the complex may serve as a precursor for obtaining sulfide materials with regulated morphology and dispersivity under combustion conditions

  19. Study on complex formation of cadmium (II) ions, 9. Formation constants on cadmium (II) complexes with dicarboxylic acids

    Energy Technology Data Exchange (ETDEWEB)

    Matsui, Haruo (Government Industrial Research Inst., Nagoya (Japan))

    1984-03-01

    Formation constants of cadmium (11) complexes with dicarboxylic acids such as oxalic, malonic, methylmalonic, succinic, and glutaric acids were determined in aqueous solutions containing 3 mol.dm/sup -3/ LiClO/sub 4/ as a constant ionic medium at 25/sup 0/C by potentiometric titrations. It was reported in the previous works that cadmium (11)- aspartic acid complexes contained two chelate rings. However, a problem remained whether the second chelate ring could be formed by six membered-ring containing -O-Cd-N- bond or by seven membered-ring containing -O-Cd-O- bond. The results of the present work suggested that it would be formed by a six membered ring. Cadmium (11) ions were coordinated with a carboxylic group of the dicarboxylic acids studied, and formed no chelate ring within the complexes. The white precipitate appeared in the solution containing cadmium (11) ion and oxalic acid, in the pH range below 3.0, therefore, the chelate formation was not ascertained in this case. The formation constants, log ..beta..sub(pr)= log((Cdsub(p)Lsub(r)sup((2p-2r)+))/((Cd/sup 2 +/)sup(p)(L/sup 2 -/)sup(r))), of the complexes were: log ..beta../sub 11/ = 1.98, log ..beta../sub 12/ = 3.05 for cadmium (11)-malonic acid; log ..beta../sub 11/ = 2.28, log ..beta../sub 12/ = 3.06 for cadmium (11)-methylmalonic acid; log ..beta../sub 11/ = 1.78, log ..beta../sub 12/ = 3.08 for cadmium (11)-succinic acid; log ..beta../sub 11/ = 1.85, log ..beta../sub 12/ = 3.28 for cadmium (11)-glutaric acid complexes.

  20. Sputter target

    Science.gov (United States)

    Gates, Willard G.; Hale, Gerald J.

    1980-01-01

    The disclosure relates to an improved sputter target for use in the deposition of hard coatings. An exemplary target is given wherein titanium diboride is brazed to a tantalum backing plate using a gold-palladium-nickel braze alloy.