WorldWideScience

Sample records for caco3sbr latex composites

  1. Preparation of composites of national rubber latex (NRL) - portland cement mould. Vol. 3

    International Nuclear Information System (INIS)

    Dessouki, A.M.; Taher, N.H.; El-Nahas, H.H.

    1996-01-01

    The aim of this study is to prepare some polymeric mould using national rubber latex (NRL) - portland cement composites based on a delayed- action mechanism. Factors affecting the preparation process such as concentration, mixing percentage, additives and their effect on what is regarded as a delayed action coacervant combination was studied. Composites of national latex (NRL) - portland cement would were prepared as two separate parts. The stabilized natural rubber latex (NRL) 100 parts with hydroxy ethyl cellulose (HEC) 2 parts as stabilizer and a delayed - action coacervant (sodium meta silicate as a delaying agent) 5 parts on one hand and the dry blend of cement 65 parts soluble in 65 parts of water as a paste on the other hand were mixed thoroughly on site. (HEC) was added to the rubber latex to prevent the coagulation of the rubber latex with the electrolyte (sodium meta silicate) present in the rubber mixture. Two kinds of stabilization occurred in the rubber part, namely steric stabilization and the stabilization against electrolyte. The effect of delayed - action coacervant (sodium meta silicate) on the initial setting time of rubber - cement mould showed that the molding process did not occur at sodium meta silicate concentration less than 2.66 parts per 100 parts of rubber latex (phr), and the optimum concentration used was 5% parts of rubber latex. It was observed that addition of a delaying agent (Sodium meta silicate) to the rubber part enhanced the delaying mechanism in the time needed for the molding process, while the addition of the delaying agent to the cement part did not have any effect on retardation of the molding process. Chemical coacervants function mainly by reducing the ζ potential which is associated with the electrical double layer surrounding the latex particle. This reduction may brought about in at least three distinct ways which take place in the system studied. 5 figs., 3 tabs

  2. Preparation of composites of national rubber latex (NRL) - portland cement mould. Vol. 3

    Energy Technology Data Exchange (ETDEWEB)

    Dessouki, A M; Taher, N H; El-Nahas, H H [National Center for Radiation Research and Technology, Atomic Energy Athority, Cairo (Egypt)

    1996-03-01

    The aim of this study is to prepare some polymeric mould using national rubber latex (NRL) - portland cement composites based on a delayed- action mechanism. Factors affecting the preparation process such as concentration, mixing percentage, additives and their effect on what is regarded as a delayed action coacervant combination was studied. Composites of national latex (NRL) - portland cement would were prepared as two separate parts. The stabilized natural rubber latex (NRL) 100 parts with hydroxy ethyl cellulose (HEC) 2 parts as stabilizer and a delayed - action coacervant (sodium meta silicate as a delaying agent) 5 parts on one hand and the dry blend of cement 65 parts soluble in 65 parts of water as a paste on the other hand were mixed thoroughly on site. (HEC) was added to the rubber latex to prevent the coagulation of the rubber latex with the electrolyte (sodium meta silicate) present in the rubber mixture. Two kinds of stabilization occurred in the rubber part, namely steric stabilization and the stabilization against electrolyte. The effect of delayed - action coacervant (sodium meta silicate) on the initial setting time of rubber - cement mould showed that the molding process did not occur at sodium meta silicate concentration less than 2.66 parts per 100 parts of rubber latex (phr), and the optimum concentration used was 5% parts of rubber latex. It was observed that addition of a delaying agent (Sodium meta silicate) to the rubber part enhanced the delaying mechanism in the time needed for the molding process, while the addition of the delaying agent to the cement part did not have any effect on retardation of the molding process. Chemical coacervants function mainly by reducing the {zeta} potential which is associated with the electrical double layer surrounding the latex particle. This reduction may brought about in at least three distinct ways which take place in the system studied. 5 figs., 3 tabs.

  3. Properties of natural rubber/attapulgite composites prepared by latex compounding method: Effect of filler loading

    International Nuclear Information System (INIS)

    Muttalib, Siti Nadzirah Abdul; Othman, Nadras; Ismail, Hanafi

    2015-01-01

    This paper reports on the effect of filler loading on properties of natural rubber (NR)/attapulgite (ATP) composites. The NR/ATP composites were prepared by latex compounding method. It is called as masterbatch. The masterbatch was subsequently added to the NR through melt mixing process. The vulcanized NR/ATP composites were subjected to mechanical, swelling and morphological tests. All the results were compared with NR/ATP composites prepared by conventional system. The composites from masterbatch method showed better results compared to composites prepared by conventional method. They have higher tensile properties, elongation at break and tear strength. The images captured through scanning electron microscopy test revealed the improvement of tensile strength in masterbatch NR/ATP composites. It can be seen clearly that masterbatch NR/ATP have better filler dispersion compared to conventional method NR/ATP composites

  4. Properties of natural rubber/attapulgite composites prepared by latex compounding method: Effect of filler loading

    Energy Technology Data Exchange (ETDEWEB)

    Muttalib, Siti Nadzirah Abdul, E-mail: sitinadzirah.amn@gmail.com; Othman, Nadras, E-mail: srnadras@usm.my; Ismail, Hanafi, E-mail: ihanafi@usm.my [School of Materials and Mineral Resources Engineering, Engineering Campus, Universiti Sains Malaysia, Seri Ampangan, 14300 Nibong Tebal, Pulau Pinang (Malaysia)

    2015-07-22

    This paper reports on the effect of filler loading on properties of natural rubber (NR)/attapulgite (ATP) composites. The NR/ATP composites were prepared by latex compounding method. It is called as masterbatch. The masterbatch was subsequently added to the NR through melt mixing process. The vulcanized NR/ATP composites were subjected to mechanical, swelling and morphological tests. All the results were compared with NR/ATP composites prepared by conventional system. The composites from masterbatch method showed better results compared to composites prepared by conventional method. They have higher tensile properties, elongation at break and tear strength. The images captured through scanning electron microscopy test revealed the improvement of tensile strength in masterbatch NR/ATP composites. It can be seen clearly that masterbatch NR/ATP have better filler dispersion compared to conventional method NR/ATP composites.

  5. Composite Films Formed by Cellulose nanocrystals and Latex Nanoparticles: Optical, Structural, and Mechanical Properties

    Science.gov (United States)

    Vollick, Brandon McRae

    This thesis describes the preparation of iridescent, birefringent, composite films composed of cellulose nanocrystals (CNCs), latex nanoparticles (NPs) and a NP crosslinker; hexanediamine (HDA). First, aqueous suspensions were prepared with varying quantities of CNCs, NPs and HDA before equilibrating for one week. The cholesteric (Ch) phase was then cast and dried into a film. The optical, structural and mechanical properties of the film was analyzed. Second, films with identical compositions of CNCs, NPs, and HDA were fabricated in three different ways to yield films of different morphology, (i) fast drying of an isotropic suspension, yielding an isotropic film, (ii) slow drying of an isotropic suspension, yielding a partially Ch films, (iii) slow drying of an equilibrated suspension, yielding a highly Ch film. The optical and mechanical properties of the films was analyzed.

  6. EFFECT OF THE PHASE STRUCTURE EVOLUTION ON THE PROPERTIES OF FILMS FORMED FROM PBA/P(ST-CO-MMA)COMPOSITE LATEX

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    A group of heterogeneous latexes poly(butyl acrylate)/poly(styrene-co-methyl methacrylate)(PBA/P(St-co-MMA))were prepared by a semi-continuous seeded emulsion polymerization process under monomer starved conditions.The glass transition temperature(Tg)and the mechanical properties of the film formed from the composite latex changed with the evolution of the particle morphology.A photon transmission method was used to monitor the phase structure evolution of films which were prepared from core-shell PBA/P(St-co-MMA)latex at room temperature and annealed at 383 K above Tg of the polymers.In addition,the changes of the surface of the film formed from the composite latex with time at 383 K were observed by AFM.The evidence illustrated that the film formed from the core-shell latex particles was metastable.The rearrangement of the phases could occur under proper conditions.

  7. Bond Characteristics of Macro Polypropylene Fiber in Cementitious Composites Containing Nanosilica and Styrene Butadiene Latex Polymer

    Directory of Open Access Journals (Sweden)

    Jae-Woong Han

    2015-01-01

    Full Text Available This study evaluated the bond properties of polypropylene (PP fiber in plain cementitious composites (PCCs and styrene butadiene latex polymer cementitious composites (LCCs at different nanosilica contents. The bond tests were evaluated according to JCI SF-8, in which the contents of nanosilica in the cement were 0, 2, 4, 6, 8, and 10 wt%, based on cement weight. The addition of nanosilica significantly affected the bond properties between macro PP fiber and cementitious composites. For PCCs, the addition of 0–2 wt% nanosilica enhanced bond strength and interface toughness, whereas the addition of 4 wt% or more reduced bond strength and interface toughness. The bond strength and interfacial toughness of LCCs also increased with the addition of up to 6% nanosilica. The analysis of the relative bond strength showed that the addition of nanosilica affects the bond properties of both PCC and LCC. This result was confirmed via microstructural analysis of the macro PP fiber surface after the bond tests, which revealed an increase in scratches due to frictional forces and fiber tearing.

  8. Isotactic polypropylene/carbon nanotube composites prepared by latex technology: Electrical conductivity study

    NARCIS (Netherlands)

    Grossiord, N.; Wouters, M.E.L.; Miltner, H.E.; Lu, K.; Loos, J.; Van Mele, B.; Koning, C.E.

    2010-01-01

    Several series of nanocomposites were prepared using a latex-based process, the main step of which consisted of mixing an aqueous suspension of exfoliated carbon nanotubes (CNTs) and a polymer latex. In the present work, a systematic study on the electrical properties of fully amorphous (polystyrene

  9. Practical Latex

    CERN Document Server

    Grätzer, George

    2014-01-01

    Accessible at 200+ pages to all who want to learn the practical usages of LaTeX Avoids technical subjects like font usage Friendly and easy to read, with many examples included Extra source materials include sample LaTeX files and suggestions for further reading

  10. Gloves against mineral oils and mechanical hazards: composites of carboxylated acrylonitrile-butadiene rubber latex.

    Science.gov (United States)

    Krzemińska, Sylwia; Rzymski, Władysław M; Malesa, Monika; Borkowska, Urszula; Oleksy, Mariusz

    2016-09-01

    Resistance to permeation of noxious chemical substances should be accompanied by resistance to mechanical factors because the glove material may be torn, cut or punctured in the workplace. This study reports on glove materials, protecting against mineral oils and mechanical hazards, made of carboxylated acrylonitrile-butadiene rubber (XNBR) latex. The obtained materials were characterized by a very high resistance of the produced materials to oil permeation (breakthrough time > 480 min). The mechanical properties, and especially tear resistance, of the studied materials were improved after the addition of modified bentonite (nanofiller) to the XNBR latex mixture. The nanocomposite meets the requirements in terms of parameters characterizing tear, abrasion, cut and puncture resistance. Therefore, the developed material may be used for the production of multifunctional protective gloves.

  11. Gloves against mineral oils and mechanical hazards: composites of carboxylated acrylonitrile–butadiene rubber latex

    Science.gov (United States)

    Krzemińska, Sylwia; Rzymski, Władysław M.; Malesa, Monika; Borkowska, Urszula; Oleksy, Mariusz

    2016-01-01

    Resistance to permeation of noxious chemical substances should be accompanied by resistance to mechanical factors because the glove material may be torn, cut or punctured in the workplace. This study reports on glove materials, protecting against mineral oils and mechanical hazards, made of carboxylated acrylonitrile–butadiene rubber (XNBR) latex. The obtained materials were characterized by a very high resistance of the produced materials to oil permeation (breakthrough time > 480 min). The mechanical properties, and especially tear resistance, of the studied materials were improved after the addition of modified bentonite (nanofiller) to the XNBR latex mixture. The nanocomposite meets the requirements in terms of parameters characterizing tear, abrasion, cut and puncture resistance. Therefore, the developed material may be used for the production of multifunctional protective gloves. PMID:26757889

  12. Effect of irradiation on the prevulcanized latex/low nitrosamines latex blends

    Energy Technology Data Exchange (ETDEWEB)

    Ibrahim, Pairu; Zin, Wan Manshol Wan [Malaysian Nuclear Agency, 43000 kajang, Selangor (Malaysia); Daik, Rusli [Faculty of Science and Technology, Universiti Kebangsaan Malaysia,43600 bangi, Selangor (Malaysia)

    2015-09-25

    Radiation Prevulcanized Natural Rubber Latex (RVNRL) was blended with Low Nitrosamines Latex (LNL) at different composition ratio. Methyl Metachrylate (MMA) was added for grafting onto the blended latex. Blended latex was subjected to gamma irradiation at various doses up to 8kGy. The mechanical properties and FTIR analysis were investigated as a function of the blended composition and irradiation dose. It was found that blending at specific ratio and gamma irradiation at specific dose led to significant improvement on the properties of the latex. The optimum mechanical properties was attained at a total blending ratio of 70% RVNRL and 30% of LNL.

  13. Isolation rubber latex binary composites consisting of cotton and poly-N, N-dimethyl-N, N-diallilammony chloride

    Directory of Open Access Journals (Sweden)

    J. Cornejo Tueros

    2012-01-01

    Full Text Available The paper discusses the application of rubber from latex binary coagulating agent consisting of cotton - textile waste and polymeric quaternary ammonium salts. The influence on the process of extracting rubber from latex flow coagulating agent temsperatury and concentration of the dispersed phase.

  14. Composite poly(methyl methacrylate-methacrylic acid-2-hydroxyethyl methacrylate) latex for immunoassay. The case of plasminogen.

    Science.gov (United States)

    Miksa, B; Wilczynska, M; Cierniewski, C; Basinska, T; Slomkowski, S

    1995-01-01

    Poly(methyl methacrylate-methacrylic acid-2-hydroxyethyl methacrylate) latex (ACRYLAT) was synthesized by radical precipitation polymerization. The mass median diameter (MMD) and the geometrical standard deviation (GSD) of the ACRYLAT particles were 138 nm and 1.2, respectively. The concentration of the titrable carboxylic groups in the surface layer of latex particles was equal to 8.41 x 10(-6) mol m-2. Latex was able to bind up to 2.82 x 10(-7) mol of 1-aminopyrene per 1 m2 of the surface of the latex particles due to the ionic interactions between carboxylate anions and ammonium cations of protonated 1-aminopyrene. ACRYLAT was able to immobilize covalently human serum albumin in amounts up to 0.23 mg m-2. Aggregation of ACRYLAT with immobilized HSA, induced with specific antibodies (anti-HSA), was investigated turbidimetrically. The results indicated that in the model turbidimetric immunoassay, ACRYLAT coated with HSA can be used for the detection of anti-HSA in the goat anti-HSA serum diluted from 50 to 7000-fold. Immobilization of rabbit antibodies to plasminogen (anti-Plg) to ACRYLAT via the epsilon-aminocaproic acid linkers provided particles which were used for the development of the turbidimetric immunoassay for plasminogen. In this assay plasminogen could be detected in concentration ranging from 0.75 to 75 micrograms ml-1 in the blood plasma.

  15. Bonding Characteristics of Macrosynthetic Fiber in Latex-Modified Fiber-Reinforced Cement Composites as a Function of Carbon Nanotube Content

    Directory of Open Access Journals (Sweden)

    Ji-Hong Jean

    2016-01-01

    Full Text Available The effect of carbon nanotube content (0, 0.5, 1.0, 1.5, and 2.0% of the cement weight on the bonding properties of macrosynthetic fiber in latex-modified hybrid fiber cement-based composites (LMHFRCCs was evaluated. The slump value, compressive strength, and bonding strength were measured for each LMHFRCC. As the carbon nanotube content increased to 1.5%, the bonding properties of the macrosynthetic fiber improved. However, the bonding performance deteriorated at a carbon nanotube content of 2.0%. A decrease in the fluidity of the mix negatively affected the dispersion of the nanotubes in the LMHFRCCs. The addition of carbon nanotubes also affected the relative bonding strength independently of the improvement in compressive strength. Microscopic analysis of the macrosynthetic fiber surfaces was used to understand changes in the bonding behavior.

  16. Cryo-SEM studies of latex/ceramic nanoparticle coating microstructure development.

    Science.gov (United States)

    Luo, Hui; Scriven, L E; Francis, Lorraine F

    2007-12-15

    Cryogenic scanning electron microscopy (cryo-SEM) was used to investigate microstructure development of composite coatings prepared from dispersions of antimony-doped tin oxide (ATO) nanoparticles (approximately 30 nm) or indium tin oxide (ITO) nanoparticles (approximately 40 nm) and latex particles (polydisperse, D(v): approximately 300 nm). Cryo-SEM images of ATO/latex dispersions as-frozen show small clusters of ATO and individual latex particles homogeneously distribute in a frozen water matrix. In contrast, cryo-SEM images of ITO/latex dispersions as-frozen show ITO particles adsorb onto latex particle surfaces. Electrostatic repulsion between negatively charged ATO and negatively charged latex particles stabilizes the ATO/latex dispersion, whereas in ITO/latex dispersion, positively charged ITO particles are attracted onto surfaces of negatively charged latex particles. These results are consistent with calculations of interaction potentials from past research. Cryo-SEM images of frozen and fractured coatings reveal that both ceramic nanoparticles and latex become more concentrated as drying proceeds; larger latex particles consolidate with ceramic nanoparticles in the interstitial spaces. With more drying, compaction flattens the latex-latex particle contacts and shrinks the voids between them. Thus, ceramic nanoparticles are forced to pack closely in the interstitial spaces, forming an interconnected network. Finally, latex particles partially coalesce at their flattened contacts, thereby yielding a coherent coating. The research reveals how nanoparticles segregate and interconnect among latex particles during drying.

  17. Latex in the Hospital Environment

    Science.gov (United States)

    LATEX in the Hospital Environment Updated Fall 2015 This list provides a guide to some of the most common objects containing latex and offers some ... remover–Sepha Pharm) 1 LATEX in the Hospital Environment (continued) Frequently contains LATEX OR/Infection Control masks, ...

  18. Isotactic polypropylene/carbon nanotube composites prepared by latex technology. Thermal analysis of carbon nanotube-induced nucleation

    NARCIS (Netherlands)

    Miltner, H.E.; Grossiord, N.; Lu, K.; Loos, J.; Koning, C.E.; Van Mele, B.

    2008-01-01

    During nonisothermal crystallization of highly dispersed polypropylene/carbon nanotube (CNT) composites, considerable heterogeneous nucleation is observed to an extent scaling with the CNT surface area. Saturation occurs at higher loadings, reaching a plateau value for the crystallization onset

  19. Latex and friends

    CERN Document Server

    Dongen, M R C van

    2012-01-01

    LaTeX is a free, automated state-of-the-art typesetting system. This book teaches all the ins and outs of LaTeX which are needed to write an article, report, thesis, or book. The book teaches by example, giving many worked out examples showing input and output side by side. The book presents the most recent techniques for presenting data plots, complex graphics, and computer presentations, but does not require previous knowledge. However, it is also a reference for the more seasoned user, with pointers to modern techniques and packages. Recurring themes in the book are consistent and effective

  20. More math into Latex

    CERN Document Server

    Grätzer, George

    2007-01-01

    For close to two decades, Math into Latex has been the standard introduction and complete reference for writing articles and books containing mathematical formulas. In this fourth edition, the reader is provided with important updates on articles and books. An important new topic is discussed: transparencies (computer projections). Key features of More Math into Latex, 4th edition: Installation instructions for PC and Mac users; An example-based, visual approach and a gentle introduction with the Short Course; A detailed exposition of multiline math formulas with a Visual Guide; A unified appr

  1. Experimental investigation of the effect of latex solid/water ratio on latex modified co-matrix mechanical properties

    Directory of Open Access Journals (Sweden)

    Ahmed M. Diab

    2013-03-01

    Full Text Available Numerous researches were performed on latex modified concretes and associated properties, however; some vital factors were not given attention in previous works. This study focus on new factor which significantly affects the properties of latex modified cement paste, mortar or concrete. This factor is termed as ‘latex solid/water ratio’ which is defined herein as the ratio of weight of solid latex to weight of total water content of cement composite including the water in latex itself. The effect of this factor on some properties of cement paste, mortar and concrete were experimentally evaluated. Properties of cement paste include the produced calcium hydroxide and ettringite content during hydration process, while those of cement mortar take account of absorption and effect of temperature on compressive strength. Furthermore, the effect of this factor on the compressive and flexural strengths, modulus of elasticity, water penetration depth and drying shrinkage of concrete were explored. Based on experimental evidences, and spite of using different cement contents, sources of latex, water–cement ratios and slump values, it can be generally concluded that the latex solid/water ratio is a dominant factor affecting different properties of latex modified mortars and concrete.

  2. Latex allergy in health care

    Directory of Open Access Journals (Sweden)

    Tina Virtič

    2012-11-01

    Full Text Available The increasing use of natural rubber latex medical gloves in the last three decades has caused an increase in latex allergy. The majority of risk groups for allergy development include health care workers, workers in the rubber industry, atopic individuals and children with congenital malformations. Three types of pathological reactions can occur in people using latex medical gloves: irritant contact dermatitis, allergic contact dermatitis and immediate hypersensitivity. The latex allergy is caused by constituent components of latex gloves and added powders; there are also numerous latex allergens involved in cross-reactivity between latex and fruits and vegetables, the so-called latex-fruit syndrome. The diagnosis is based on an accurate history of exposure, clinical presentation and confirmatory in vivo and in vitro tests. Prevention is the easiest, most effective and least expensive way to avoid latex allergy. Powder-free latex gloves with reduced levels of proteins and chemicals, and synthetic gloves for allergic workers must be provided in the work environment. There are already many health care institutions around the world where all latex products have been replaced by synthetic material products.

  3. PS-HEMA latex fractionation by sedimentation and colloidal crystallization

    Directory of Open Access Journals (Sweden)

    Cardoso André H.

    1999-01-01

    Full Text Available A poly(styrene-co-hydroxyethylmethacrylate latex underwent sedimentation under gravity followed by an spontaneous and extensive colloidal crystallization. It was then fractionated in three visually distinguishable layers. Latex aliquots layers were sampled at different heigths and the particles were characterized by PCS, microelectrophoresis, infrared spectra and analytical electron microscopy. The major fraction was opalescent and contained the colloidal crystals settled in the bottom of the liquid. Two other latex fractions were obtained, which differed in their chemical compositions, particle sizes and topochemical features from the self-arraying particles. Macrocrystallization of the fractionated latex yielded high quality crystals with a low frequency of defects, which confirms that particle chemical homogeneity is an important factor for particle self-arraying.

  4. Latex medical gloves

    DEFF Research Database (Denmark)

    Palosuo, Timo; Antoniadou, Irini; Gottrup, Finn

    2011-01-01

    Many hospitals have implemented policies to restrict or ban the use of devices made of natural rubber latex (NRL) in healthcare as precautionary measures against the perceived risk of NRL allergy. Changes in glove technology, progress in measuring the specific allergenic potential of gloves...... properties of NRL and synthetic gloves and the role of glove powder. The review shows that NRL medical gloves, when compared with synthetic gloves, tend to be stronger, more flexible and better accepted by clinicians. The introduction of powder-free gloves has been associated with reductions in protein...

  5. Latex allergy in the workplace.

    Science.gov (United States)

    Toraason, M; Sussman, G; Biagini, R; Meade, J; Beezhold, D; Germolec, D

    2000-11-01

    While less than 1% of the general population is sensitized to latex, the U.S. Occupational Safety and Health Administration estimates that 8-12% of health-care workers are sensitized. The major source of workplace exposure is powdered natural rubber latex (NRL) gloves. NRL is harvested from HEVEA: brasiliensis trees and ammoniated to prevent coagulation resulting in the hydrolysis of the latex proteins. Prior to use in manufacturing, the latex is formulated by the addition of multiple chemicals. Thus, human exposure is to a mixture of residual chemicals and hydrolyzed latex peptides. Clinical manifestations include irritant contact dermatitis, allergic contact dermatitis (type IV), and type I immediate hypersensitivity response. Type I (IgE-mediated) NRL allergy includes contact urticaria, systemic urticaria, angioedema, rhinitis, conjunctivitis, bronchospasm, and anaphylaxis. Taking an accurate history, including questions on atopic status, food allergy, and possible reactions to latex devices makes diagnosis of type-I latex allergy possible. To confirm a diagnosis, either in vivo skin prick testing (SPT) or in vitro assays for latex-specific IgE are performed. While the SPT is regarded as a primary confirmatory test for IgE-mediated disease, the absence of a U.S. Food and Drug Administration-licensed HEVEA: brasiliensis latex extract has restricted its use in diagnosis. Serological tests have, therefore, become critically important as alternative diagnostic tests. Three manufacturers currently have FDA clearance for in vitro tests, to detect NRL-specific IgE. The commercially available assays may disagree on the antibody status of an individual serum, which may be due to the assay's detecting anti-NRL IgEs to different allergenic NRL proteins. Sensitized individuals produce specific IgE antibody to at least 10 potent HEVEA: allergens, Hev b 1-Hev b 10, each of which differs in its structure, size, and net charge. The relative content and ratios of Hevs in the

  6. Latex allergy and filaggrin null mutations

    DEFF Research Database (Denmark)

    Carlsen, Berit C; Meldgaard, Michael; Hamann, Dathan

    2011-01-01

    to aeroallergens and it is possible that filaggrin null mutations also increase the risk of latex allergy. The aim of this paper was to examine the association between filaggrin null mutations and type I latex allergy. Methods Twenty latex allergic and 24 non-latex allergic dentists and dental assistants...... in the cases in this study may not have occurred through direct skin contact but through the respiratory organs via latex proteins that are absorbed in glove powder and aerosolized...

  7. Latex allergies - for hospital patients

    Science.gov (United States)

    ... ency/patientinstructions/000499.htm Latex allergies - for hospital patients To use the sharing features on this page, ... ADAM Health Solutions. About MedlinePlus Site Map FAQs Customer Support Get email updates Subscribe to RSS Follow ...

  8. Cream concentrated latex for foam rubber products

    Science.gov (United States)

    Suksup, R.; Imkaew, C.; Smitthipong, W.

    2017-12-01

    Fresh natural latex (around 40% rubber and 60% water) can be transformed to concentrated natural latex (around 60% rubber and 40% water) in order to realise economical transportation and easier latex product’s preparation. The concentrated natural latex is an extremely valuable material. It can be applied for many types of products, for example, foam rubber as pillow and mattress, elastic band, etc. Industrially, the concentrated natural latex can be prepared by centrifugation which requires an enormous expensive machine. From the eco-friendly products point of view, most of rubber entrepreneurs in the world try to develop a green rubber product. So, the main objective of this study is to prepare the cream concentrated latex without any sophisticated machine. Thus, we work on a simple, cheap and green method that does not use any expensive machine but uses water-based chemical as sodium alginate to prepare the cream concentrated latex. The optimal amount of sodium alginate in the latex was studied. The main characteristics of the cream concentrated latex were tested by various technics, such as alkalinity, total solid content (TSC), dry rubber content (DRC), etc. We found that there are no significant differences of results between fresh natural latex and cream concentrated latex, except for the TSC and DRC. The TSC and DRC of cream latex are higher than those of fresh natural latex. Finally, we propose a model of natural rubber particle and sodium alginate to form the cream concentrated latex.

  9. Encapsulation of Clay Platelets inside Latex Particles

    NARCIS (Netherlands)

    Voorn, D.J.; Ming, W.; Herk, van A.M.; Fernando, R.H.; Sung, Li-Piin

    2009-01-01

    We present our recent attempts in encapsulating clay platelets inside latex particles by emulsion polymerization. Face modification of clay platelets by cationic exchange has been shown to be insufficient for clay encapsulation, leading to armored latex particles. Successful encapsulation of

  10. Synthesis and Characterization of Core-Shell Acrylate Based Latex and Study of Its Reactive Blends

    Directory of Open Access Journals (Sweden)

    Ying Nie

    2008-03-01

    Full Text Available Techniques in resin blending are simple and efficient method for improving the properties of polymers, and have been used widely in polymer modification field. However, polymer latex blends such as the combination of latexes, especially the latexes with water-soluble polymers, were rarely reported. Here, we report a core-shell composite latex synthesized using methyl methacrylate (MMA, butyl acrylate (BA, 2-ethylhexyl acrylate (EHA and glycidyl methacrylate (GMA as monomers and ammonium persulfate and sodium bisulfite redox system as the initiator. Two stages seeded semi-continuous emulsion polymerization were employed for constructing a core-shell structure with P(MMA-co-BA component as the core and P(EHA-co-GMA component as the shell. Results of Transmission Electron Microscopy (TEM and Dynamics Light Scattering (DLS tests confirmed that the particles obtained are indeed possessing a desired core-shell structural character. Stable reactive latex blends were prepared by adding the latex with waterborne melamine-formaldehyde resin (MF or urea-formaldehyde resin (UF. It was found that the glass transition temperature, the mechanical strength and the hygroscopic property of films cast from the latex blends present marked enhancements under higher thermal treatment temperature. It was revealed that the physical properties of chemically reactive latexes with core-shell structure could be altered via the change of crosslinking density both from the addition of crosslinkers and the thermal treatment.

  11. Managing latex allergies at home

    Science.gov (United States)

    ... Associate Clinical Professor of Medicine, Division of Allergy, Immunology, and Rheumatology, Georgetown University Medical School, Washington, DC. Also reviewed by David Zieve, MD, MHA, Isla Ogilvie, PhD, and the A.D.A.M. Related MedlinePlus Health Topics Latex Allergy Browse the Encyclopedia A.D.A. ...

  12. Latex Allergy - A Case Report

    Directory of Open Access Journals (Sweden)

    Dr. Athma Prasanna

    2005-10-01

    Full Text Available The usage of rubber and its products are not uncommon in various walks of life. A continuous exposure or contact may sensitize the human body, causing reactions from mild to fatal. Despite the availability of the literature, medical personnel are still unaware of the implications of the use of latex materials.

  13. Solid state NMR and LVSEM studies on the hardening of latex modified tile mortar systems

    International Nuclear Information System (INIS)

    Rottstegge, J.; Arnold, M.; Herschke, L.; Glasser, G.; Wilhelm, M.; Spiess, H.W.; Hergeth, W.D.

    2005-01-01

    Construction mortars contain a broad variety of both inorganic and organic additives beside the cement powder. Here we present a study of tile mortar systems based on portland cement, quartz, methyl cellulose and different latex additives. As known, the methyl cellulose stabilizes the freshly prepared cement paste, the latex additive enhances final hydrophobicity, flexibility and adhesion. Measurements were performed by solid state nuclear magnetic resonance (NMR) and low voltage scanning electron microscopy (LVSEM) to probe the influence of the latex additives on the hydration, hardening and the final tile mortar properties. While solid state NMR enables monitoring of the bulk composition, scanning electron microscopy affords visualization of particles and textures with respect to their shape and the distribution of the different phases. Within the alkaline cement paste, the poly(vinyl acetate) (VAc)-based latex dispersions stabilized by poly(vinyl alcohol) (PVA) were found to be relatively stable against hydrolysis. The influence of the combined organic additives methyl cellulose, poly(vinyl alcohol) and latexes stabilized by poly(vinyl alcohol) on the final silicate structure of the cement hydration products is small. But even small amounts of additives result in an increased ratio of ettringite to monosulfate within the final hydrated tile mortar as monitored by 27 Al NMR. The latex was found to be adsorbed to the inorganic surfaces, acting as glue to the inorganic components. For similar latex water interfaces built up by poly(vinyl alcohol), a variation in the latex polymer composition results in modified organic textures. In addition to the networks of the inorganic cement and of the latex, there is a weak network build up by thin polymer fibers, most probably originating from poly(vinyl alcohol). Besides the weak network, polymer fibers form well-ordered textures covering inorganic crystals such as portlandite

  14. Molluscicidal effect of Euphorbia umbellata (Pax Bruyns latex on Biomphalaria glabrata, Schistosoma mansoni host snail

    Directory of Open Access Journals (Sweden)

    Luciana Patrícia Lima Alves Pereira

    2017-12-01

    Full Text Available ABSTRACT Euphorbia umbellata (Pax Bruyns is an easily cultivated shrub, with occurrence in the tropical regions of the American and African continents. Chemical studies have revealed that the latex of this plant is rich in terpene compounds, which are highly toxic to snails Biomphalaria glabrata (Basommatophora: Planorbidae. The aim of this study was to evaluate the chemical composition and molluscicidal activity of the latex produced by E. umbellata, as well as the safety of its application in aquatic environments. The concentration of latex that killed 90% of the exposed snails after 24 h exposure (LC90 was 3.69 mg/L. Toxicity bioassays using Danio rerio (zebrafish revealed that these animals were less susceptible to latex than planorbids. However, it is important to perform other toxicity tests to ensure the feasibility of using latex to control populations of mollusks that contribute to schistosomiasis transmission. A phytochemical screening performed with the E. umbellata latex identified the triterpenoid and coumarin class. Further studies are warranted to isolate, identify, and test the active compounds of E. umbellata latex in B. glabrata.

  15. The polymerization of aniline in polystyrene latex particles

    Czech Academy of Sciences Publication Activity Database

    Blinova, Natalia V.; Reynaud, S.; Roby, F.; Trchová, Miroslava; Stejskal, Jaroslav

    2010-01-01

    Roč. 160, 15/16 (2010), s. 1598-1602 ISSN 0379-6779 R&D Projects: GA AV ČR IAA400500905; GA ČR GA203/08/0686; GA ČR GA202/09/1626 Institutional research plan: CEZ:AV0Z40500505 Keywords : polyaniline * polystyrene latex * polyaniline-polystyrene composite Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.871, year: 2010

  16. Latex sensitisation in healthcare workers in Singapore.

    Science.gov (United States)

    Tang, M B Y; Leow, Y H; Ng, V; Koh, D; Goh, C L

    2005-06-01

    Epidemiological data on latex sensitisation among Asian healthcare workers is lacking. The aim of the study is to determine the rate of latex sensitisation in our healthcare workers. We recruited 313 healthcare workers, of which 46.6% were operating theatre staff and 53.4% were non-operating theatre staff. Seventy-one administrative staff served as controls. All participants answered a self-administered questionnaire relating to latex exposure and glove-related symptoms. Latex sensitisation was determined by skin prick testing to latex and latex-specific IgE detection. The prevalence of latex sensitisation among healthcare workers was 9.6%, with no difference between operating theatre and nonoperating theatre staff. Glove-related symptoms were reported in 13.7% of all healthcare workers, of which 22.9% were sensitised to latex. Only 26.7% of latex-sensitised healthcare workers had glove-related symptoms while the rest were asymptomatic. The most common symptoms were itch and hand eczema but the most important discriminating symptom was contact urticaria. Personal history of atopy was more common in sensitised healthcare workers (40.0%) compared to non-sensitised workers (31.8%). Only 1 out of 9 (11.2%) symptomatic latex-sensitised subjects had sought previous medical attention for the problem. Latex sensitisation among healthcare workers in Singapore should be considered a significant occupational health risk, as it is in the West. Increased screening and awareness of this problem is essential to identify those at risk.

  17. Latex Allergy In Health Care Workers

    Directory of Open Access Journals (Sweden)

    Hayriye Sarıcaoğlu

    2013-05-01

    Full Text Available Background and Design: We aimed to determine the frequency of latex allergy in our hospital and to to evaluate the clinical and demographical features of the cases.Materials and Methods: A detailed questionnaire was administered to healthcare workers by a physician. Skin prick test with latex and patch test with rubber chemicals and a piece of latex glove were performed for all healthcare workers. Latex-specific IgE was measured in serum.Results: The study sample consisted of 36 nurses, 14 doctors, and 50 healthcare workers. While 46 subjects had symptoms, 54 subjects had no symptoms. The relationship of clinical disease with working duration, exposure duration (hour/day, history of atopy, and drug/food allergies was statistically significant. Five nurses and 1 healthcare worker had positive skin prick test. Two of them had positive latex-specific IgE. Positive skin prick test statistically significantly correlated with occupation, working duration, exposure duration (hour/day and positive latex-specific IgE. Two nurses and 2 healthcare workers had positive latex-specific IgE. Two of them had positive skin prick test. Positive latexspecific IgE statistically significantly correlated with working duration, exposure duration, and positive skin prick test. Patch test with a piece of latex glove was negative in all subjects. Three healthcare workers had positive patch test with thiuram-mix, one of them had also positive patch test with mercaptobenzothiazole.Discussion: One of the risk factors for latex allergy is occupations involving frequent exposure to latex products. Latex allergy should be taken into consideration if type I hypersensitivity reactions occur in occupational groups at risk for anaphylactic reaction.

  18. Decontamination of latex gloves; Decontamination de gants en latex

    Energy Technology Data Exchange (ETDEWEB)

    Boutot, P; Schipfer, P; Blachere, A [Commissariat a l' Energie Atomique, Chusclan (France). Centre de Production de Plutonium de Marcoule

    1969-07-01

    Initially the latex gloves used in controlled zones were processed after use as radioactive waste. In view of the continually increasing number used, however, the persons in charge of the SPRAR have considered the possibility of decontaminating the gloves and using them again after control. The recovery installations which have been developed were initially designed rather crudely and operated irregularly; they have been progressively improved as a result of the experience acquired; today they are more really an industrial concern, equipped with automatic machinery. In 1967 it has been possible with this set-up to recover 247000 pairs of gloves, representing nearly 70 per cent of the number treated. (author) [French] Initialement, les gants de latex utilises dans les zones controlees etaient conditionnes apres emploi comme dechets radioactifs. Mais, devant l'augmentation sans cesse croissante des quantites employees, les responsables du SPRAR ont envisage leur decontamination et leur recyclage apres controles. Les installations de recuperation mises au point, de conception artisanale et fonctionnant de maniere episodique au depart, se sont progressivement ameliorees au fur et a mesure de l'experience acquise; elles revetent aujourd'hui le caractere d'une exploitation industrielle equipee de machines automatiques. En 1967, ces nouvelles installations ont permis de recuperer 247000 paires de gants, ce qui represente pres de 70 pour cent des quantites traitees. (auteur)

  19. EDITORIALS Latex allergy: 'Plight, rights and fights'

    African Journals Online (AJOL)

    anaphylaxis and life-threatening food allergies to cross-reacting fruit allergens such as kiwi, banana, tomato and chestnuts). Latex allergy is also encountered more frequently in children with spina bifida than in other hospitalised children.[7] Sensitisation is usually confirmed by commercial latex allergy skinprick testing or by ...

  20. Jackfruit anaphylaxis in a latex allergic patient.

    Science.gov (United States)

    Wongrakpanich, Supakanya; Klaewsongkram, Jettanong; Chantaphakul, Hiroshi; Ruxrungtham, Kiat

    2015-03-01

    Several fruits have been reported to crossreact with latex antigen in latex allergy patients but little is known regarding tropical fruits in particular. Here we report the case of a 34-year old nurse who developed anaphylaxis following the ingestion of dried jackfruit (Artocarpus heterophyllus). The patient had a history of chronic eczema on both hands resulting from a regular wear of latex gloves. She and her family also had a history of atopy (allergic rhinitis and/or atopic dermatitis). The results of skin prick tests were positive for jackfruit, latex glove, kiwi and papaya, but the test was negative for banana. While we are reporting the first case of jackfruit anaphylaxis, further research needs to be conducted to identify the mechanisms underlying it. In particular, in-vitro studies need to be designed to understand if the anaphylaxis we describe is due to a cross reactivity between latex and jackfruit or a coincidence of allergy to these 2 antigens.

  1. Latex improvement of recycled asphalt pavement

    Science.gov (United States)

    Drennon, C.

    1982-08-01

    The performance of a single unmodified milled recycled asphalt concrete was compared to milled asphalt concrete modified by addition of three types of rubber latex. Latex was added at 2, 3, 5, and 8 percent latex by weight of asphalt in the asphalt concrete. Lattices used were a styrene butadiene (SBR), a natural rubber (NR), an acrylonitrile butadiene (NBR), and four varieties of out of specification SBR lattices. Marshall tests, while indecisive, showed a modest improvement in properties of SBR and NR added material at 3 and 5 percent latex. Addition of NBR latex caused deterioration in Marshall stability and flow over that of control. Repeated load tests were run using the indirect tensile test, analyzed by the VESYS program, which computes life of pavements. Repeated load tests showed improvement in asphalt concrete life when 3 and 5 percent SBR was added. Improvement was also shown by the out of specification SBR.

  2. Nitrile versus Latex for Glove Juice Sampling.

    Science.gov (United States)

    Landers, Timothy F; Dent, Anthony

    2014-01-01

    The objective of this study was to explore the utility of nitrile gloves as a replacement for latex surgical gloves in recovering bacteria from the hands. Two types of nitrile gloves were compared to latex gloves using the parallel streak method. Streaks of Klebsiella pneumoniae and Staphylococcus aureus were made on tryptic soy agar plates, and the zones of inhibition were measured around pieces of glove material placed on the plates. Latex gloves produced a mean zone of inhibition of 0.28 mm, compared to 0.002 mm for nitrile gloves (pnitrile may be a viable alternative to latex in glove juice sampling methods, since nitrile avoids the risk of latex exposure.

  3. Nitrile versus Latex for Glove Juice Sampling.

    Directory of Open Access Journals (Sweden)

    Timothy F Landers

    Full Text Available The objective of this study was to explore the utility of nitrile gloves as a replacement for latex surgical gloves in recovering bacteria from the hands. Two types of nitrile gloves were compared to latex gloves using the parallel streak method. Streaks of Klebsiella pneumoniae and Staphylococcus aureus were made on tryptic soy agar plates, and the zones of inhibition were measured around pieces of glove material placed on the plates. Latex gloves produced a mean zone of inhibition of 0.28 mm, compared to 0.002 mm for nitrile gloves (p<.001. While the parallel streak method is not intended as a quantitative estimate of antimicrobial properties, these results suggest that nitrile may be a viable alternative to latex in glove juice sampling methods, since nitrile avoids the risk of latex exposure.

  4. Preparation of novel film-forming armoured latexes using silica nanoparticles as a pickering emulsion stabiliser.

    Science.gov (United States)

    Shiraz, Hana; Peake, Simon J; Davey, Tim; Cameron, Neil R; Tabor, Rico F

    2018-05-15

    Film-forming polymer latex particles of diameter acrylate (BA) as co-monomers, potassium persulphate (KPS) as an initiator and a commercially available colloidal nano-silica (Ludox®-TM40). It was found that pH control before polymerisation using methacrylic acid (MAA) facilitated the formation of armoured latexes, and mechanistic features of this process are discussed. An alternative, more robust protocol was developed whereby addition of vinyltriethoxysilane (VTES) to control wettability resulted in latexes completely armoured in colloidal nano-silica. The latexes were characterised using SEM, cryo-TEM and AFM imaging techniques. The mechanism behind the adsorption was investigated through surface pressure and contact angle measurements to understand the factors that influence this irreversible adsorption. Results indicate that nanoparticle attachment (but intriguingly not latex size) is dependent on particle wettability, providing new insight into the formation of nanoparticle-armoured latexes, along with opportunities for further development of diversely functionalized inorganic/organic polymer composite particles. Copyright © 2018 Elsevier Inc. All rights reserved.

  5. Transcript Profiling of Hevea brasiliensis during Latex Flow

    Directory of Open Access Journals (Sweden)

    Jinquan Chao

    2017-11-01

    Full Text Available Latex exploitation enhances latex regeneration in rubber trees. The latex exploitation-caused latex flow lasts from 10 min to a few hours, which is convenient for exploring the transcript profiling of latex metabolism-related genes at the different stages of latex flow. In the present study, the expression pattern of 62 latex metabolism-related genes involved in water transportation, carbohydrate metabolism, natural rubber biosynthesis, hormone signaling, ROS generation and scavenging, and latex coagulum across three stages of latex flow between rubber tree clones CATAS7-33-97 and CATAS8-79 were comparatively analyzed by quantitative real-time PCR. The two clones show differences in latex regeneration and have a different duration of latex flow. The results showed that the expression levels of 38 genes were significantly higher in CATAS8-79 latex than in CATAS7-33-97 during latex regeneration, while 45 genes had a notably higher expression level in CATAS8-79 latex during latex flow. Together with the activation of the MEP pathway and jasmonate pathway in CATAS8-79 latex, HbPIP1;3, HbPIP1;4, HbSUT3, HbSus3, HbHMGS1-2, HbMK should contribute to the high latex regeneration ability. The up-regulation of ethylene signaling and Hb44KD and the down-regulation of latex coagulation-related genes in CATAS8-79 latex might contribute to its longer latex flow duration. This study provides some cues for revealing the regulation of latex metabolism in rubber trees.

  6. [Latex allergy in a population at risk].

    Science.gov (United States)

    Ruiz Fernández, M; Flores Sandoval, G; Orea Solano, M

    1999-01-01

    The allergy to latex is an illness whose prevalence has been increased in very significant form in the last years. To know the allergy incidence to latex in population of risk, as well as to identify the related sintomatology and the importance or paper that play the atopia antecedents and time of contact with latex for the development of the illness. We carry out a prospective, descriptive, experimental and traverse study in population of risk, in the service of Allergy and clinical Immunology of the Hospital Regional Lic. Adolfo López Mateos, ISSSTE. One hundred patients of both sexes were included, with age of 20 to 50 years, with the antecedent of being personal medical and paramedic and to have presented contact with latex material in a minimum period of one year. They were carried out clinical history with registration of sintomatology nasal, bronchial, cutaneous and associated to contact with latex. They were carried out cutaneous test for prick to latex with positive control with the help of histamine solution and negative control with solution of Evans and immediate reading of the same one. 22% of the patients in study, they presented positive skin test latex, with a time of exhibition 10 year-old average, 68% presented antecedent of atopy personal, family and, likewise the associate sintomatology was in a 33.3% dermatology, 54.5 nasal, nobody presented bronchial symptoms and a 9% asymptomatic was reported. We support that the immediate skin test latex for Prick is an important parameter of support diagnosis for allergy to type 1 latex.

  7. Allergy to latex in health workers

    Directory of Open Access Journals (Sweden)

    Fajardo-Zapata, Álvaro L.

    2015-01-01

    Full Text Available Introduction: A common and growing problem in hospitals is hypersensitivity to rubber latex antigens, since many products, including gloves, are manufactured from this material, with the consequent possibility of producing allergy in persons who use them. Objective: To find out if health workers at a fourth level clinic in Bogotá, Colombia, are allergic to rubber latex, in relation to the use of gloves. Materials and methods: Descriptive, cross-sectional study of a non-probabilistic intentional-type sample in each one of four hospital units. A survey was applied to participants. Results: 16 of the 26 persons (61.5% with history of allergic processes manifested some kind of reaction when they had contact with latex gloves; the problem was more significant in the nursing personnel compared to physicians. Conclusions: The exposure to latex gloves may be generating the appearance of allergic occupational disease in health workers.

  8. Latex glove sensitivity amongst diagnostic imaging healthcare ...

    African Journals Online (AJOL)

    kemrilib

    Sciences, Faculty of Health Sciences and Technology, University of Nigeria, Enugu Campus, Enugu. State, Nigeria. .... Occupation. No of .... latex protein residue and act as a hapten or .... at Work Act, 1989 and the safety, Health and Welfare at.

  9. Performance Study of the Natural Rubber Composite with Clay Minerals

    International Nuclear Information System (INIS)

    Nyo Nyo Myint; Tin Tin Aye; Kyaw Myo Naing; Nyunt Wynn

    2008-03-01

    The preparation, characterization and some applications of natural rubber clay composite have been studied. This study investigated the possibility of natural rubber latex to replace some part of natural clays. In formulation of rubber clay composite from natural rubber latex and various clay minerals, three main steps were involved (i) preparation of latex cream (ii) prevulcanization of latex cream (iii) mixing vulcanized latex compound, with other ingredients. In each step, several parameters have been carefully investigated to optimize the performance of natural rubber clay composite production. The composite products were of better quality and can be considered to be more cost effective.

  10. [Prevention of adverse effects in latex allergic patients: organizing a latex safe operating theatre].

    Science.gov (United States)

    Bonalumi, Sabrina; Barbonaglia, Patrizia; Bertocchi, Carmen

    2006-01-01

    In 2001 the General Health Direction of Region Lombardia approved (decree n. 22303) a guideline for the prevention of latex allergic reactions in patients and health care workers. This document provides general recommendations in order to standardize behaviors in regional health care facilities. The reason is due to a rise in the incident of reactions to latex products in the last 20 years. Nowadays the prevalence is higher in certain risk groups (subjected to frequent and repeated exposures) rather than the general population. The aim of the project was to organize a latex safe operating theatre in the Ospedale Maggiore Policlinico, Mangiagalli e Regina Elena of Milan (Fondazione) and to standardize behaviors in order to prevent adverse effects in latex allergic patients. Thanks to the literature review and the creation of a multidisciplinar team, we produced a protocol. Therefore, we requested manufacturers the certification of the latex content of their products. Results and conclusion. When latex allergic patients need to undergone surgery in our hospital, a latex safe operating theatre is organized by personnel following a multidisciplinar protocol. No allergic reactions were experienced during surgical procedures after the creation of an environment as free as possible from latex contamination. The project will involve an emergency room, one room or more of a ward and of the outpatients department.

  11. Radiation vulcanization of Philippine natural rubber latex

    International Nuclear Information System (INIS)

    Dela Rosa, A.M.; Abad, L.V.; Sta.Ana-Relleve, L.P.; Tranquilan-Aranilla, C.O.; Pascual, C.L.

    1996-01-01

    The response of Philippine natural rubber latex to irradiation vulcanization and the stability of the irradiated natural rubber latex (INRL) upon storage and aging were investigated. Commercially available high ammonia (HA) concentrated latices obtained from various rubber plantations in Mindanao island were treated with 5 phr of n-butyl acrylate (nBA), and gamma-irradiated at the PNRI 60 Co irradiation facility at a dose rate of 2.57 kGy/hr. Unirradiated cast latex films gave different green strengths which varied from 2-11 MPa. Cast films from INRL exhibited maximum tensile strengths were obtained from cast films with low Mg and high nitrogen contents. Thermal analysis using thermogravimetry (TG) revealed one major decomposition product at 374 o -377 o C. Its rate of decomposition decreased to a minimum at 15 kGy, then increased as radiation dose was increased. This trend correlated well with the tensile strength measurements. The stability of the INRL upon storage and aging is an essential parameter to the rubbe latex industry. For storage studies, INRL was stored for various periods of time. It was found that the pH and total solids content of the stored INRL did not change significantly after 12 months of storage; the MST values remained at above 1000 seconds, and the viscosity decreased with time. The cast films exhibited a decline in tensile strength, modulus 300% , and crosslinking density upon storage. While there were observed changes in the physical properties of the INRL during the storage period, the data indicate that these properties were within values acceptable to the latex industry. Tests on the aging properties of INRL films were undertaken. It was shown that among the chemical antioxidants presently used by the latex industry, TNPP demonstrated the highest antioxidant property, followed by Antage DAHQ and Vulcanox BKF. Our data indicate that the natural rubber latex produced and processed in the Philippines is suited for radiation vulcanization

  12. Rubber/clay nanocomposites by combined latex compounding and melt mixing: A masterbatch process

    International Nuclear Information System (INIS)

    Tan, Jinghua; Wang, Xiaoping; Luo, Yuanfang; Jia, Demin

    2012-01-01

    Highlights: → Rubber/Ca-montmorillonite nanocomposites were prepared by the masterbatch process. → Latex compounding method is efficient to improve the Ca-montmorillonite dispersion. → Exfoliated structure was obtained in the masterbatch by latex compounding method. → Intercalated and exfoliated structures were achieved in the vulcanizate. → The properties of vulcanizate are improved by the addition of Ca-montmorillonite. -- Abstract: Rubber/Ca-montmorillonite (Ca-MMT) nanocomposites with well exfoliated Ca-MMT layers were prepared by combination of latex compounding and melt mixing. Firstly, a high Ca-MMT content masterbatch was co-coagulated by natural rubber (NR) latex and modified Ca-MMT aqueous suspension through latex compounding. The masterbatch was added in the system of styrene butadiene rubber (SBR) and epoxidized natural rubber (ENR) by melt mixing subsequently. The X-ray diffraction (XRD) and transmission electronic microscopy (TEM) results showed that intercalated and exfoliated nanocomposites were obtained by the masterbatch technique. The effects of modified Ca-MMT introduction into the rubber matrix, via the masterbatch technique, on the properties of the resulting composites were studied. It was found that the vulcanization was hindered by the incorporation of modified Ca-MMT, while mechanical performances, thermal stability and aging resistance were improved. The increasingly glass transition temperature and the storage modulus with the loading of modified Ca-MMT were measured by dynamic mechanical analysis (DMA).

  13. Anti-ulcer activity of Synadenium grantii latex

    Directory of Open Access Journals (Sweden)

    Larissa L. G. Costa

    2012-10-01

    Full Text Available Synadenium grantii Hook f., Euphorbiaceae, is popularly known as leitosinha or janaúba. The diluted latex (18 drops/L of water is commonly used in the south of Brazil to treat gastric disturbances. This study evaluated phytochemical screening and toxicity using Artemia salina Leach of crude bark extract and also latex. The toxicity and the anti-ulcer activity of S. grantii latex were also tested in rats. Phytochemical results showed presence of tannins, terpenes, unsaponificable substances, coumarins and anthraquinones in the crude bark extract and terpenes in the latex. Gas chromatography-mass spectrometry (GC-MS analysis demonstrated the presence of diterpene tigliane esters in the latex, identified as 12-deoxyphorbol-13-(2-metilpropionate and phorbol 12,13,20-triacetate. The toxicity results using A. salina presented CL50 26.58μg/mL and CL50 778.66μg/mL, for the latex and the crude bark extract respectively. The toxicological hepatic parameters of the diluted latex were not different to the control group (p<0.05. The eosinophils cells showed an increase in both the diluted and pure latex groups. The pure latex showed gastric protection of 90% (p<0.05 and the diluted latex showed 6% compared to the negative control. Therefore, our data indicate that S. grantii latex, under research conditions presented gastric protection. Pure latex showed more toxicity than the diluted latex.

  14. Experimental study on the drying of natural latex medical gloves

    Science.gov (United States)

    Chankrachang, Mano; Yongyingsakthavorn, Pisit; Tohsan, Atitaya; Nontakaew, Udomkiat

    2018-01-01

    The purpose of this research was to study latex film drying at 70 °C using a laboratory drying oven. Two different total solid content (TSC) latex compounds, which 45% TSC and 35% TSC were used. The undried latex films were prepared according to the common procedures used in latex gloves manufacturers, that is, by dry coagulant dipping process. The experimental results such as initial moisture content, the amount of moisture and drying time of latex films in each latex compound formula were determined. After that, the results were projected to calculate on the production capacity expand by 1 million piece/day of natural latex medical gloves. Finally, the rate of moisture entering the latex drying oven and the energy consumption of the drying oven were estimated. The results indicated that when the 35% TSC of latex compound was used. The initial moisture content of latex film was higher than 45% TSC of latex compound about 7%. The drying time of 35% TSC was longer than 45% TSC for 2.5 min and consume more energy about 10%. As a result, the 45% TSC latex compound was the better way to saving energy and managing humidity in the production line. Therefore, it was found to very useful to an approximate design length and size of actual of latex drying oven and the rate of moisture entering the oven as well.

  15. Recombinant albumin monolayers on latex particles.

    Science.gov (United States)

    Sofińska, Kamila; Adamczyk, Zbigniew; Kujda, Marta; Nattich-Rak, Małgorzata

    2014-01-14

    The adsorption of recombinant human serum albumin (rHSA) on negatively charged polystyrene latex micro-particles was studied at pH 3.5 and the NaCl concentration range of 10(-3) to 0.15 M. The electrophoretic mobility of latex monotonically increased with the albumin concentration in the suspension. The coverage of adsorbed albumin was quantitatively determined using the depletion method, where the residual protein concentration was determined by electrokinetic measurements and AFM imaging. It was shown that albumin adsorption was irreversible. Its maximum coverage on latex varied between 0.7 mg m(-2) for 10(-3) M NaCl to 1.3 mg m(-2) for 0.15 M NaCl. The latter value matches the maximum coverage previously determined for human serum albumin on mica using the streaming potential method. The increase in the maximum coverage was interpreted in terms of reduced electrostatic repulsion among adsorbed molecules. These facts confirm that albumin adsorption at pH 3.5 is governed by electrostatic interactions and proceeds analogously to colloid particle deposition. The stability of albumin monolayers was measured in additional experiments where changes in the latex electrophoretic mobility and the concentration of free albumin in solutions were monitored over prolonged time periods. Based on these experimental data, a robust procedure of preparing albumin monolayers on latex particles of well-controlled coverage and molecule distribution was proposed.

  16. The Morphology of Emulsion Polymerized Latex Particles

    Science.gov (United States)

    Wignall, G. D.; Ramakrishnan, V. R.; Linne, M. A.; Klein, A.; Sperling, L. H.; Wai, M. P.; Gelman, R. A.; Fatica, M. G.; Hoerl, R. H.; Fisher, L. W.

    1987-11-01

    Under monomer starved feed conditions, emulsion polymerization of perdeuterated methyl methacrylate and styrene in the presence of preformed polymethylmethacrylate latexes resulted in particles with a core-shell morphology, as determined by small-angle neutron scattering (SANS) analysis for a hollow sphere. The locus of polymerization of the added deuterated monomer is therefore at the particle surface. In similar measurements a statistical copolymer of styrene and methyl methacrylate was used as seed particles for further polymerization of trideuteromethyl methacrylate. The resulting polymer latex was again shown to have a core-shell morphological structure as determined by SANS. SANS experiments were also undertaken on polystyrene latexes polymerized by equilibrium swelling methods, with deuterated polymer forming the first or second step. The experiments covered a molecular weight range of 6 x 10{sup 4} 10{sup 6} the molecular weights are consistent with the experimental errors, indicating that the deuterium labeled molecules are randomly distributed in the latex. These results led to the finding that the polymer chains were constrained in the latex particles by factors of 2 to 4 from the relaxed coil dimensions. For M molecules. Several models were examined, including the possible development of core-shell structures at lower molecular weights.

  17. Home Healthcare Workers: How to Prevent Latex Allergies

    Science.gov (United States)

    ... can help prevent allergic reactions for both home healthcare workers and their clients. LATEX EXPOSURE REACTIONS Three ... being used). • Inform your employer and your personal healthcare professionals that you have latex allergy. • Wear a ...

  18. Angiogenic activity of Synadenium umbellatum Pax latex

    Directory of Open Access Journals (Sweden)

    PR. Melo-Reis

    Full Text Available Synadenium umbellatum Pax, popularly known as "cola-nota", is a medicinal plant that grows in tropical regions. Latex of this plant is used to treat various diseases such as diabetes mellitus, Hansen´s disease, tripanosomiases, leukemia and several malignant tumors. In the present study, the angiogenic activity of S. umbellatum latex was evaluated using the chick embryo chorioallantoic membrane (CAM assay. Results showed significant increase of the vascular net (p < 0.05 compared to the negative control (H2O. The histological analysis was in accordance with the results obtained. In conclusion, our data indicate that S. umbellatum latex, under the conditions of this research, presented angiogenic effect.

  19. Radiation response of Philippine natural rubber latex

    International Nuclear Information System (INIS)

    Dela Rosa, A.M.; Abad, L.V.; Ana-Relleve, L.S.; Tranquilan-Aranilla, C.; Pascual, C.L.

    1998-01-01

    Our earlier work has shown that the natural rubber latex (NRL) produced and processed in the Philippines is suited for radiation vulcanization. The cast films from NRL with 50% TSC exhibited maximum tensile strengths of 25-32 MPa at 15 kGy, which is the vulcanization dose or Dv. In the manufacture of dipped NRL products, certain specifications such as %TSC, protein content and tensile properties, must be met to ensure an acceptable product. For radiation vulcanization of natural rubber latex (RVNRL) to be accepted as an alternative process, it must also meet the requirements. Thus, this paper presents additional data on the radiation response of local NRL at different total solids contents (TSC), leachable proteins from NRL films as a function of dose, and the thermal activities of irradiated natural rubber latex (INRL). Different formulations of NRL showed varying tolerances to nBA. Data showed that as %TSC increases, the maximum concentration of nBA that can be added without affecting the stability of the latex decreases. The Dv increases as the %TSC increases and the nBA content decreases. This difference in response may be attributed to a lower concentration of nBA in formulations with higher %TSC. These data indicate that the parameters in the radiation treatment will be dictated by the intended applications of INRL. The thermogravimetric data showed greater stability of INRL to thermal oxidation relative to the unirradiated NRL, which correlates directly with the tensile properties of the INRL. A radiation dose of 10 kGy increased the amount of proteins leached from cast latex films. The amount of extractable proteins did not increase significantly at higher doses. The SDS PAGE analysis of the extractable proteins from unirradiated latex film showed distinct bands. An additional band at 60 Kda appeared at 10 kGy. All these bands became diffuse at higher doses, indicating the radiolysis of the proteins

  20. CHARACTERIZATION AND RECYCLING OF WASTE WATER FROM GUAYULE LATEX EXTRACTION

    Science.gov (United States)

    Guayule commercialization for latex production to be used in medical products and other applications is now a reality. Currently, waste water following latex extraction is discharged into evaporation ponds. As commercialization reaches full scale, the liquid waste stream from latex extraction will b...

  1. Plant latex lipase as biocatalysts for biodiesel production | Mazou ...

    African Journals Online (AJOL)

    Plant latex lipase as biocatalysts for biodiesel production. ... This paper provides an overview regarding the main aspects of latex, such as the reactions catalyzed, physiological functions, specificities, sources and their industrial applications. Keywords: Plant latex, lipase, Transesterification, purification, biodiesel ...

  2. Thermodynamics of swelling of latex particles with two monomers

    NARCIS (Netherlands)

    Maxwell, I.A.; Kurja, J.; van Doremaele, G.H.J.; German, A.L.

    1992-01-01

    The partitioning of 2 monomers between the latex particle, monomer droplet, and aq. phases of an emulsion polymer latex are measured at satn. swelling of the latex particle phase (corresponding to intervals I and II of an emulsion polymn.). The monomer (Me acrylate, Bu acrylate, styrene) and polymer

  3. Emotion with tears decreases allergic responses to latex in atopic eczema patients with latex allergy.

    Science.gov (United States)

    Kimata, Hajime

    2006-07-01

    Allergic responses are enhanced by stress, whereas they are reduced by laughter in atopic eczema patients. Emotion with tears decreases plasma IL-6 levels in patients with rheumatoid arthritis. Thus, the effect of emotion with tears on allergic responses in patients with atopic eczema was studied. Sixty patients with atopic eczema having latex allergy viewed both the weather information video and the heart-warming movie, Kramer vs. Kramer. Just before and immediately after viewing each video, allergic responses to latex were measured. Viewing the weather information video did not cause emotion with tears in any patients, and it failed to modulate allergic responses. In contrast, viewing Kramer vs. Kramer caused emotion with tears in 44 of 60 patients, and it reduced allergic skin wheal responses to latex and latex-specific IgE production in them. Emotion with tears reduced allergic responses, and it may be useful in the treatment of allergic diseases.

  4. Exploiting epoxidized natural rubber latex (ENRL) as a starting raw material for latex-based products

    Science.gov (United States)

    Siti Nor Qamarina, M.; Fatimah Rubaizah, M. R.; Nurul Suhaira, A.; Norhanifah, M. Y.

    2017-12-01

    Epoxidized natural rubber latex (ENRL) is a chemically modified natural rubber latex produced from epoxidation process that involves usage of organic peracids. Conversion of the ENRL into dry rubber products has been known to exhibit many beneficial properties, however limited published works were found on diversifiying the ENRL latex-based products applications. In this preliminary work, different source of raw materials and neutralization systems were investigated. The objective was to explore possibilities in producing distinctive ENRL. Findings have demonstrated that different source of raw materials and neutralization systems influenced the typical ENRL specifications, stability behavior and particle size distribution. Morphological observations performed on these ENRL systems appeared to agree with the ENRL characteristics achieved. Since experimenting these two main factors resulted in encouraging ENRL findings, detailed work shall be further scrutinized to search for an optimum condition in producing marketable ENRL specifically for latex-based products applications.

  5. Preparation of highly stabilised natural rubber latex for radiation vulcanisation

    International Nuclear Information System (INIS)

    Kulatunge, S.S.; Nadarajah, M.; Kalyani, N.M.V.; Chandralal, H.N.K.K.; Devendra, R.

    1996-01-01

    There is a bright future for radiation vulcanised natural rubber latex (RVNRL) but there are problems in manufacturing it as the centrifuged latex to be used for radiation has to be kept for at least a month or sometimes even three to six months before adding the sensitisers and even then the latex sometimes coagulates on adding the sensitisers. This paper describes a process by which the latex can be stabilised by addition of an anionic soap before centrifuging so that it has a high mechanical stability and hence can be used even within one week of the manufacture of the centrifuged latex

  6. CHEMICAL EXAMINATION OF JACK TREE LATEX AND

    Indian Academy of Sciences (India)

    and on Saponification yielded fatty acids, Volatile as well as non-volatile. The unsaponifiable portion on repeated crystallisation provided a crystal- line, sharp melting compound which was identified as artostenone? from a. Latex (200 c.c.). ത്ത min- pe. Coagulum (A) Aqueous alcoholic solution (B). Acetone or ethyl acetate ...

  7. Application of recombinant latex allergens in diagnostics of occupational latex allergy

    Directory of Open Access Journals (Sweden)

    Ewa Nowakowska-Świrta

    2015-02-01

    Full Text Available Over many years, allergy to natural rubber latex has been a major problem among health care workers (HCW. The diagnosis of occupational allergy requires methods of high diagnostic accuracy in view of certification implications (e.g., a sick worker quits a job. With the development of molecular methods, the frequency of application of recombinant allergens in the diagnostics of allergic diseases continues to increase. This paper reviews the applicability of laboratory tests which use recombinant allergens in the diagnostics of occupational allergy. The diagnosis of latex allergy is based on the presence of clinical symptoms linked with exposure to latex allergens, positive skin prick tests and detection of specific IgE antibodies to latex in serum. Moreover, in some cases specific challenge tests are conducted. The analysis of literature indicates that applying the panel of recombinant latex allergens in diagnostic tests, cross-reactivity can very likely be excluded and/or sensitization can be confirmed without the need for specific challenge tests, which in case of latex allergens carries a potential risk of generalized reactions. Med Pr 2015;66(1:85–97

  8. Radiation vulcanization of Philippine natural rubber latex

    International Nuclear Information System (INIS)

    Dela Rosa, Alumanda M.; Abad, Lucille V.; Sta, Lorna P.; Ana-Relleve; Tranquilan-Aranilla, Charito O.; Pascual, Cristina L.

    1996-01-01

    The response of Philippine natural rubber latex to radiation vulcanization and the stability of the irradiated natural rubber latex (INRL) upon storage and aging were investigated. Commercially available high ammonia (HA) concentrated lattices obtained from various rubber plantations in Mindanao Island were treated with 5 phr of n-butyl acrylate (nBA), and gamma-irradiated at the PNRI sup 60 Co irradiation facility at dose rate of 2.57 KGy/hr. Unirradiated cast latex films gave different green strength which varied from 2 - 11 MPa. Cast films from INRL exhibited maximum tensile strengths of 25 - 32 MPa at a radiation dose of 15 kGy. Higher tensile strengths were obtained from cast films with low Mg and high nitrogen contents. Thermal analysis using thermogravimetry (TG) revealed one major decomposition product at 374 degree C - 377 degree C. Its rate of decomposition decreased to a minimum at 15 kGy, then increased as radiation dose increased. This trend correlated well with the tensile strength measurements. The stability of the INRL upon storage and aging is an essential parameter to the rubber latex industry. For storage studies, INRL was stored for various periods of time. It was found that the pH and total solids content of the stored INRL did not change significantly after 12 months of storage; the MST values remained at above 100 seconds, and the viscosity decreased with time. The cast films exhibited a decline in tensile strength, modulus 300% and crosslinking density upon storage. While there were observed changes in the physical properties of the IRNL during the storage period, the data indicate that these properties were within values acceptable to the latex industry. Tests on the aging properties of INRL film were undertaken. It was shown that among the chemical antioxidants presently used by the latex industry. TNPP demonstrated the highest antioxidant property, followed by Antage DAHQ and Vulcanox BKF. Our data indicate that the natural rubber latex

  9. Triterpenoid biosynthesis in Euphorbia lathyris latex

    International Nuclear Information System (INIS)

    Hawkins, D.R.

    1987-11-01

    The structures of triterpenols, not previously been known, from Euphorbia lathyris latex are reported. A method for quantifying very small amounts of these compounds was developed. Concerning the biochemistry of the latex, no exogenous cofactors were required for the biosynthesis and the addition of compounds such as NADPAH and ATP do not stimulate the biosynthesis. The addition of DTE or a similar anti-oxidant was found to help reduce the oxidation of the latex, thus increasing the length of time that the latex remains active. The requirement of a divalent cation and the preference for Mn in the pellet was observed. The effect of several inhibitors on the biosynthesis of the triterpenoids was examined. Mevinolin was found to inhibit the biosynthesis of the triterpenoids from acetate, but not mevalonate. A dixon plot of the inhibition of acetate incorporation showed an I 50 concentration of 3.2 μM. Fenpropimorph was found to have little or no effect on the biosynthesis. Tridemorph was found to inhibit the biosynthesis of all of the triterpenoids with an I 50 of 4 μM. It was also observed that the cyclopropyl containing triterpenols, cycloartenol and 24-methylenecycloartenol were inhibited much more strongly than those containing an 8-9 double bond, lanosterol and 24-methylenelanosterol. The evidence indicates, but does not definetely prove, that lanosterol and 24-methylenelanosterol are not made from cycloartenol and 24-methylenecycloartenol via a ring-opening enzyme such as cycloeucalenol-obtusifoliol isomerase. The possibilty that cycloartenol is made via lanosterol was investigated by synthesizing 4-R-4- 3 H-mevalonic acid and incubating latex with a mixture of this and 14 C-mevalonic acid. From the 3 H/ 14 C ratio it was shown that cycloartenol and 24-methylenecycloartenol are not made via an intermediate containing as 8-9 double bond. 88 refs., 15 figs., 30 tabs

  10. Triterpenoid biosynthesis in Euphorbia lathyris latex

    Energy Technology Data Exchange (ETDEWEB)

    Hawkins, D.R.

    1987-11-01

    The structures of triterpenols, not previously been known, from Euphorbia lathyris latex are reported. A method for quantifying very small amounts of these compounds was developed. Concerning the biochemistry of the latex, no exogenous cofactors were required for the biosynthesis and the addition of compounds such as NADPAH and ATP do not stimulate the biosynthesis. The addition of DTE or a similar anti-oxidant was found to help reduce the oxidation of the latex, thus increasing the length of time that the latex remains active. The requirement of a divalent cation and the preference for Mn in the pellet was observed. The effect of several inhibitors on the biosynthesis of the triterpenoids was examined. Mevinolin was found to inhibit the biosynthesis of the triterpenoids from acetate, but not mevalonate. A dixon plot of the inhibition of acetate incorporation showed an I/sub 50/ concentration of 3.2 ..mu..M. Fenpropimorph was found to have little or no effect on the biosynthesis. Tridemorph was found to inhibit the biosynthesis of all of the triterpenoids with an I/sub 50/ of 4 ..mu..M. It was also observed that the cyclopropyl containing triterpenols, cycloartenol and 24-methylenecycloartenol were inhibited much more strongly than those containing an 8-9 double bond, lanosterol and 24-methylenelanosterol. The evidence indicates, but does not definetely prove, that lanosterol and 24-methylenelanosterol are not made from cycloartenol and 24-methylenecycloartenol via a ring-opening enzyme such as cycloeucalenol-obtusifoliol isomerase. The possibilty that cycloartenol is made via lanosterol was investigated by synthesizing 4-R-4-/sup 3/H-mevalonic acid and incubating latex with a mixture of this and /sup 14/C-mevalonic acid. From the /sup 3/H//sup 14/C ratio it was shown that cycloartenol and 24-methylenecycloartenol are not made via an intermediate containing as 8-9 double bond. 88 refs., 15 figs., 30 tabs.

  11. Cement-latex grouting mortar for cementing boreholes

    Energy Technology Data Exchange (ETDEWEB)

    Kateev, I S; Golyshkina, L A; Gorbunova, I V; Kurochkin, B M; Vakula, Ya V

    1980-01-01

    The need for the development of cement-latex grouting mortar for the purpose of separating strata when reinforcing boreholes at deposits in the Tatar Associated SSR is evaluated. Results of studies of the physical and mechanical properties of cement-latex grouting mortar systems (mortar plus brick) are presented. Formulas for preparing cement-latex grouting mortor are evaluated and results of industrial tests of such mortars shown.

  12. Effect of Amphiphilic Alkyl Chain Length Upon Purified LATEX Stability

    International Nuclear Information System (INIS)

    Amira Amir Hassan; Amir Hashim Mohd Yatim

    2015-01-01

    Rubber particles in purified latex (PL) are stabilized by a film of protein and fatty acid soap (surfactant). Saturated straight-chain fatty acid soaps can assist an enhancement of latex stability. However, whether the alkyl chain length plays an important role in increasing the stability is still an issue. The aim of this study is to investigate the effect of alkyl chain length of anionic surfactant on the stability of purified latex. The fatty acid soap of decanoate (9), laurate (11), sodium dodecyl sulphate (SDS) (12) and palmitate (15) were used. The numbers in parentheses indicating the number of carbon present in alkyl chain of the soap. The results showed that the impact of alkyl chain length on the stability of latex is in the order of laurate > decanoate > SDS > palmitate > purified latex accordingly. The alkyl chain length does giving a significant effect on latex stability after longer stirring time. The particle size of latex with the presence of surfactant is greater compare to a single particle itself due to extension of particles diameter. Thus suitable interaction of the nonpolar tail of surfactant with the hydrophobic regions of latex surface played a major role in maintaining a stable latex system. (author)

  13. Aspects of Degradability and Aging of Natural Rubber Latex Films Obtained by Induced Ionizing Radiation Processes of Latex Vulcanization

    International Nuclear Information System (INIS)

    Parra, D. F.

    2006-01-01

    This study refers to the degradability of NRLF, natural rubber latex films, obtained by ionizing radiation. Three types of NRLF were prepared: irradiated latex, irradiated latex with about 1% of soy lecithin and sulfur-vulcanized latex, by cold vulcanization process. The films were buried in vases of two different kinds of soil: common soil and common soil with earthworm humus. Fast aging tests in laboratory with exposition to ultraviolet rays were done in irradiated latex films and irradiated latex films with soy lecithin. The results obtained after ten months of tests with buried films agree with the results of the fast aging tests, showing singularities of each type of soil and each kind of latex process. It also shows how weather inclemency can induce the films degradation process. The sulfur-vulcanized films were weakly degraded when buried. The films with lecithin and buried in vase with only common soil showed the biggest mass loss, but the films with lecithin buried in vases with common earthworm humus and soil increased their weigh and dimensions due to fungi formation. The irradiated latex films are more degradable then the sulfur-vulcanized films. The irradiated latex film, unlike the sulfur vulcanized film, showed high fungi colonization when buried. We conclude that the irradiated latex films are more easily biodegradable than the sulfur vulcanized latex films. The biodegradability increases with the addition of small amounts of soy lecithin (∼1%). The mechanical resistance of the buried films decreased related to the non-buried ones, proving that the outdoor aging in soil and the presence of fungi in the films can modify the mechanical properties of the irradiated latex owing to the biodegradation

  14. Follow-up Study of Latex-allergic Health Care Workers in Japan

    Directory of Open Access Journals (Sweden)

    Akiko Yagami

    2006-01-01

    Conclusions: After avoiding latex products and following our educational suggestions, the patients' allergy symptoms had generally improved. This indicates that our countermeasures against latex allergy were largely successful.

  15. [Latex allergy in a paediatric hospital. Characteristics and risk factors].

    Science.gov (United States)

    Bailey, Michael; Norambuena, Ximena; Roizen, Gigia; Rodríguez, Jorge; Quezada, Arnoldo

    The prevalence of latex sensitisation varies according to the population studied. There are various risk factors that increase latex sensitisation, such as genetic risk, atopy, and multiple surgeries. To characterise patients referred to an Immunology Unit with suspected latex allergy, and to analyse their clinical features and risk factors. A retrospective, descriptive study was conducted on children suspected of latex allergy. Their medical records were reviewed in order to assess symptoms with contact or exposure to latex materials. Known risk factors to latex sensitisation, such as pathologies requiring repeated surgery (spina bifida, myelomeningocele, scoliosis and nephro-urological alterations), atopy (rhinitis, asthma, atopic dermatitis) were investigated. A prick test and/or specific IgE to latex were also performed. A multivariate logistic regression model was performed to find associations between symptoms triggered by exposure to latex with underlying diseases and other risk conditions. A total of 106 patients were enrolled in the study, of whom 50 were evaluable. At diagnosis 96% of patients were older than five years. Most of the risk factors described were observable in these patients, such as multiple surgeries, neurological and nephro-urological malformations, surgery before one year-old, and repeated bladder catheterisation. After latex exposure, mucous cutaneous manifestations were the most common (52%), followed by respiratory symptoms (36%). All patients were sensitised and allergic to latex. Latex allergy is a significant problem in children with risk factors. The results shown in this study raise important challenges for preventive measures and awareness. Copyright © 2016 Sociedad Chilena de Pediatría. Publicado por Elsevier España, S.L.U. All rights reserved.

  16. Radiation vulcanization of natural rubber latex

    International Nuclear Information System (INIS)

    Wan Manshol bin Wan Zin; Norjanah binti Mohid

    1994-01-01

    This paper describes the experimental techniques and the results of radiation vulcanization of natural rubber latex carried out on several high ammonia latices available in the country. The efficiency of various sensitisers and stabilisers used were evaluated in terms of the gamma radiation dose required to produce the maximum tensile strengths. The extent of crosslinking of RVNRL sample films were estimated by equilibrium swelling ratio measurements. The stability of pre-irradiated and post-irradiated samples were monitored using viscosity measurements as the parameter

  17. NMR relaxation times of natural rubber latex

    International Nuclear Information System (INIS)

    Harun, S.; Aziz, H.; Basir, Z.

    1994-01-01

    NMR relaxation times T sub 1 and T sub 2 of natural rubber latex have been measured at 25 degree C on a pulsed NMR spectrometer. The work focuses on the variation of the relaxation times with the amount of water content from 0% to 50%. The water content was adjusted by centrifuging and removing a certain amount of water from the sample. The data were analysed using a biexponential fitting procedure which yields simultaneously either T sub 1a and T sub 1b or T sub 2a and T sub 2b. The amount of solid was compared with the known amount of dry rubber content

  18. Antimalarial Anthrone and Chromone from the Leaf Latex of Aloe ...

    African Journals Online (AJOL)

    In Ethiopian traditional medicine, the leaf latex of Aloe debranan Chrstian is used for the treatment of several diseases including malaria. In an ongoing search for effective, safe and cheap antimalarial agents from plants, the leaf latex of A. debrana was tested for its in vivo antimalarial activity, in a 4-day suppressive assay ...

  19. Antimicrobial activity of latex silver nanoparticles using Calotropis procera

    Directory of Open Access Journals (Sweden)

    Nadia Hussein Mohamed

    2014-11-01

    Conclusions: It can be concluded that serum latex of Calotropis procera was found to display strong potential for the synthesis of AgNPs as antimicrobial agents through rapid reduction of silver ions (Ag+ to Ag0. The green synthesized AgNPs were found to show higher antimicrobial efficacy than crude latex.

  20. Installing fonts in LaTeX a user's experience

    NARCIS (Netherlands)

    Hanssen, F.T.Y.

    2003-01-01

    This paper presents a user's experience with installing fonts for use in LaTeX. It will be shown that it is not hard to make a standard Type 1 font work, if you use modern font installation software for LaTeX. All the steps necessary to install the example fonts will be shown. The example fonts used

  1. High concentrations of natural rubber latex allergens in gloves used ...

    African Journals Online (AJOL)

    Introduction. Gloves made of natural rubber latex (NRL) are commonly used by healthcare workers because of their good qualities. However, allergic reactions to latex allergens are still commonly reported. Objective. To measure the concentrations of Hev b 1, Hev b 3, Hev b 5 and Hev b 6.02 allergens in gloves used by a ...

  2. Allergenicity of latex rubber products used in South African dental ...

    African Journals Online (AJOL)

    Fourteen latex examination gloves (powdered and non-powdered) and five dental rubber dams, representing 6 brands, from five dental academic institutions were analysed for latex allergens and total protein. Total protein content was determined using the BioRad DC protein assay kit and natural rubber allergen levels ...

  3. Rapid latex agglutination test for the serodiagnosis of human brucellosis

    NARCIS (Netherlands)

    Abdoel, Theresia H.; Smits, Henk L.

    2007-01-01

    We developed and evaluated a user-friendly latex agglutination assay for the serodiagnosis of human brucellosis. The assay was obtained by coating colored latex beads with Brucella lipopolysaccharides and drying of the activated beads onto white agglutination cards. Individual cards were sealed in a

  4. Syntheses of crosslinked latex nanoparticles using differential microemulsion polymerization

    Science.gov (United States)

    Hassmoro, N. F.; Rusop, M.; Abdullah, S.

    2013-06-01

    The differential microemulsion polymerization was used to synthesize latex nanoparticles. In this paper, 1, 3-butylene glycol dimethacrylate (1, 3-BGDMA) was used as a crosslinker respectively 1-5 weight% of monomer total. Butyl acrylate (BA), butyl methacrylate (BMA), and methacrylic acid (MAA) was used as the monomer. The thin film of latex nanoparticles were prepared by using spin coating method and have been dried at 100°C for 5 minutes. The amount of the crosslinker added in the polymerization was optimized and we found that the particle sizes fall in the range of 30-60 nm. The structural morphology of the uncrosslinked latex represented the most homogeneous image compared to the crosslinked latex. The effect of the amount of crosslinker on the particle sizes investigated by the Zeta-sizer Nano series while Atomic Force microscopy (AFM) was used to study the structural properties of latex nanoparticles.

  5. Syntheses of crosslinked latex nanoparticles using differential microemulsion polymerization

    International Nuclear Information System (INIS)

    Hassmoro, N F; Abdullah, S; Rusop, M

    2013-01-01

    The differential microemulsion polymerization was used to synthesize latex nanoparticles. In this paper, 1, 3-butylene glycol dimethacrylate (1, 3-BGDMA) was used as a crosslinker respectively 1–5 weight% of monomer total. Butyl acrylate (BA), butyl methacrylate (BMA), and methacrylic acid (MAA) was used as the monomer. The thin film of latex nanoparticles were prepared by using spin coating method and have been dried at 100°C for 5 minutes. The amount of the crosslinker added in the polymerization was optimized and we found that the particle sizes fall in the range of 30–60 nm. The structural morphology of the uncrosslinked latex represented the most homogeneous image compared to the crosslinked latex. The effect of the amount of crosslinker on the particle sizes investigated by the Zeta-sizer Nano series while Atomic Force microscopy (AFM) was used to study the structural properties of latex nanoparticles.

  6. The preparation of RVNRL using Malaysian-produced latexes

    International Nuclear Information System (INIS)

    Zin, W.M. bin W.; Mohid, N. bte; Hasan, J. bin; Noor, W.K.A. bte W.M.; Jaafar, Zulkifli

    1993-01-01

    This research project was carried out using latexes supplied by three of the suppliers in Malaysia. From the results of studies carried out in search of the best sensitiser for RVNRL preparation, the use of n-butyl acrylate (n-BA) as a sensitiser gave the most promising results. However, its use as a sensitiser is not universal to all latexes available in the country. The problem was overcome by using different formulations for different latexes. For the latex supplied by Golden Hope (Hytex), a combination of sensitisers i.e. n-BA plus 2-ethyl hexyl acrylate (2-EHA) with a 10% potassium hydroxide solution as the stabilizer, was required. Latex supplied by MARDEC (Matex), seemed to need only n-BA as the sensitiser. However, a stabilizer was still required and the use of a 10% KOH solution was found to be suitable. A large range of stabilizers and sensitisers were applicable to Guthrie latex. The use of n-BA as the sensitiser and potassium laurylic acid as the stabilizer seemed the most favourable formulation. All the results are discussed in the form of a correlation between dose and the tensile properties of RVNRL vulcanizates, equilibrium swelling ratio and standing time of the latex formulation. (author)

  7. The Synthesis and Modification of Nanosized Clickable Latex Particles

    KAUST Repository

    Almahdali, Sarah

    2013-05-01

    This research aims to add to the current knowledge available for miniemulsion polymerization reactions and to use this knowledge to synthesize multifunctional nanosized latex particles that have the potential to be used in catalysis. The physical properties of the latex can be adjusted to suit various environments due to the multiple functional groups present. For this research, styrene, pentafluorostyrene, azidomethyl styrene, pentafluorostyrene with azidomethyl styrene and pentafluorostyrene with styrene latexes were produced, and analyzed by dynamic light scattering. The latexes were synthesized using a miniemulsion polymerization technique found through this research. Potassium oleate and potassium 1,1,2,2,3,3,4,4-nonafluorobutane-1-sulfonate were used as surfactants during the miniemulsion polymerization reaction to synthesize pentafluorostyrene with azidomethyl styrene latex. Transmission electron microscopy data and dynamic light scattering data have been collected to analyze the structure of this latex, and it has been synthesized using a number of conditions, differing in reaction time, surfactant amount and sonication methods. We have also improved the solubility of the latex through a copper(I) catalyzed 1,3-dipolar azide-alkyne reaction, by clicking (polyethylene glycol)5000 onto the azide functional groups.

  8. Size effects of latex nanomaterials on lung inflammation in mice

    International Nuclear Information System (INIS)

    Inoue, Ken-ichiro; Takano, Hirohisa; Yanagisawa, Rie; Koike, Eiko; Shimada, Akinori

    2009-01-01

    Effects of nano-sized materials (nanomaterials) on sensitive population have not been well elucidated. This study examined the effects of pulmonary exposure to (latex) nanomaterials on lung inflammation related to lipopolysaccharide (LPS) or allergen in mice, especially in terms of their size-dependency. In protocol 1, ICR male mice were divided into 8 experimental groups that intratracheally received a single exposure to vehicle, latex nanomaterials (250 μg/animal) with three sizes (25, 50, and 100 nm), LPS (75 μg/animal), or LPS plus latex nanomaterials. In protocol 2, ICR male mice were divided into 8 experimental groups that intratracheally received repeated exposure to vehicle, latex nanomaterials (100 μg/animal), allergen (ovalbumin: OVA; 1 μg/animal), or allergen plus latex nanomaterials. In protocol 1, latex nanomaterials with all sizes exacerbated lung inflammation elicited by LPS, showing an overall trend of amplified lung expressions of proinflammatory cytokines. Furthermore, LPS plus nanomaterials, especially with size less than 50 nm, significantly elevated circulatory levels of fibrinogen, macrophage chemoattractant protein-1, and keratinocyte-derived chemoattractant, and von Willebrand factor as compared with LPS alone. The enhancement tended overall to be greater with the smaller nanomaterials than with the larger ones. In protocol 2, latex nanomaterials with all sizes did not significantly enhance the pathophysiology of allergic asthma, characterized by eosinophilic lung inflammation and Igs production, although latex nanomaterials with less than 50 nm significantly induced/enhanced neutrophilic lung inflammation. These results suggest that latex nanomaterials differentially affect two types of (innate and adaptive immunity-dominant) lung inflammation

  9. Radiation vulcanization of natural rubber latex with low energy accelerator

    Energy Technology Data Exchange (ETDEWEB)

    Haque, Emdadul; Makuuchi, Keizo; Ikeda, Kenichi; Yoshii, Fumio; Kume Tamikazu [Japan Atomic Energy Research Inst., Takasaki, Gunma (Japan). Takasaki Radiation Chemistry Research Establishment; Mitomo, Hiroshi [Gunma Univ., Faculty of Engineering, Department of Biological and Chemical Engineering, Kiryu, Gunma (Japan)

    2001-03-01

    The radiation vulcanization of natural rubber latex (RVNRL) with the recently installed electron beam (EB) pilot plant at Takasaki Radiation Chemistry Research Establishment, Takasaki, Japan has been discussed. The accelerating voltage and beam current of the plant are 250 kV and 10 mA respectively. The plant has a reaction vessel with the capacity of 18 liters latex to irradiate at a time. In order to obtain a suitable setting of experimental for RVNRL under EB of the plant the parameters such as irradiation time, defoamer concentration, volume of latex, beam current etc. are being optimized by varying the individual parameter at a constant set of the other variables. (author)

  10. Isolation and characterization of latex-specific promoters from Papaver somniferum L.

    OpenAIRE

    Raymond, Michelle Jean

    2004-01-01

    The pharmacologically important alkaloids morphine and codeine are found in latex of opium poppy (Papaver somniferum). Latex is harbored in laticifers, a specialized vascular cell-type. Isolation and characterization of latex-specific genes may provide a useful tool to metabolically engineer increased alkaloid production. Previous research in the Nessler laboratory identified genes that exhibit latex-specific gene expression. Latex-specific genes were an 2-oxoglutarate-dioxygense (DIOX), ...

  11. Comparative study on plant latex particles and latex coagulation in Ficus benjamina, Campanula glomerata and three Euphorbia species.

    Directory of Open Access Journals (Sweden)

    Georg Bauer

    Full Text Available Among latex-producing plants, mainly the latex of Hevea brasiliensis has been studied in detail so far, while comprehensive comparative studies of latex coagulation mechanisms among the more than 20,000 latex-bearing plant species are lacking. In order to give new insights into the potential variety of coagulation mechanisms, the untreated natural latices of five latex-bearing plants from the families Euphorbiaceae, Moraceae and Campanulaceae were visualised using Cryo-SEM and their particle size compared using the laser diffraction method. Additionally, the laticifers of these plants species were examined in planta via Cryo-SEM. Similar latex particle sizes and shape were found in Ficus benjamina and Hevea brasiliensis. Hence, and due to other similarities, we hypothesize comparable, mainly chemical, coagulation mechanisms in these two species, whereas a physical coagulation mechanism is proposed for the latex of Euphorbia spp. The latter mechanism is based on the huge amount of densely packed particles that after evaporation of water build a large surface area, which accelerates the coagulation procedure.

  12. Thermoresponsive latexes for fragrance encapsulation and release.

    Science.gov (United States)

    Popadyuk, N; Popadyuk, A; Kohut, A; Voronov, A

    2016-04-01

    To synthesize cross-linked latex particles protecting the encapsulated fragrance at ambient temperatures and facilitating the release of cargo at the temperature of the surface of the skin that varies in different regions of the body between 33.5 and 36.9°C. Poly(stearyl acrylate) (PSA), a polymer with long crystallizable alkyl side chains (undergoes order-disorder transitions at 45°C), was chosen as the main component of the polymer particles. As a result, new thermoresponsive polymer particles for fragrance encapsulation were synthesized and characterized, including assessing the performance of particles in triggered release by elevated temperature. To obtain network domains of various crystallinity, stearyl acrylate was copolymerized with dipropylene glycol acrylate caprylate (DGAC) (comonomer) in the presence of a dipropylene glycol diacrylate sebacate (cross-linker) using the miniemulsion process. Comonomers and a cross-linker were mixed directly in a fragrance during polymerization. Fragrance release was evaluated at 25, 31, 35 and 39°C to demonstrate a new material potential in personal/health care skin-related applications. Particles protect the fragrance from evaporation at 25°C. The fragrance release rate gradually increases at 31, 35 and 39°C. Two slopes were found on release plots. The first slope corresponds to a rapid fragrance release. The second slope indicates a subsequent reduction in the release rate. Crystalline-to-amorphous transition of PSA triggers the release of fragrances from cross-linked latex particles at elevated temperatures. The presence of the encapsulated fragrance, as well as the inclusion of amorphous fragments in the polymer network, reduces the particle crystallinity and enhances the release. Release profiles can be tuned by temperature and controlled by the amount of loaded fragrance and the ratio of comonomers in the feed mixture. © 2015 Society of Cosmetic Scientists and the Société Française de Cosmétologie.

  13. Incidence of latex harvesting technologies on agronomic and ...

    African Journals Online (AJOL)

    parameters and profitability of some rapid metabolic class clones of rubber ... of hormonal stimulation had no negative influence on the vegetative growth ..... yield (2597) was obtained with the control ..... metabolic energy of latex vessels as.

  14. Incidence of latex harvesting technologies on agronomic and ...

    African Journals Online (AJOL)

    Incidence of latex harvesting technologies on agronomic and physiological parameters and profitability of some rapid metabolic class clones of rubber tree ( Hevea brasiliensis ) in southwestern Côte d'Ivoire.

  15. The Synthesis and Modification of Nanosized Clickable Latex Particles

    KAUST Repository

    Almahdali, Sarah

    2013-01-01

    This research aims to add to the current knowledge available for miniemulsion polymerization reactions and to use this knowledge to synthesize multifunctional nanosized latex particles that have the potential to be used in catalysis. The physical

  16. Radiation vulcanization of natural rubber latex sensitized with commercial gases

    Energy Technology Data Exchange (ETDEWEB)

    Chirinos, H.; Lugao, A. [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil)

    2002-07-01

    The industrial activities using natural rubber latex are fully compatible with rural areas in Amazon and other places in Brazil, as well as in other tropical countries. However the classical sulfur vulcanization presents many occupational problems for the workers in rural areas. Radiation vulcanization of natural rubber latex is a much more friendly process as sulfur compounds are not needed for crosslinking, although chemicals as acrylate monomers, particularly multifunctional acrylates are still used as sensitizers for radiation processes. Two commercial gases, acetylene and butadiene, were selected as sensitizers for the radiation vulcanization of natural rubber latex instead of acrylates. These gases accelerate the crosslinking rates of the cure process and lower the radiation dose required to achieve vulcanization of natural rubber latex and improve the mechanical properties to reduce the tackiness of rubber goods. (author)

  17. Radiation vulcanization of natural rubber latex sensitized with commercial gases

    International Nuclear Information System (INIS)

    Chirinos, H.; Lugao, A.

    2002-01-01

    The industrial activities using natural rubber latex are fully compatible with rural areas in Amazon and other places in Brazil, as well as in other tropical countries. However the classical sulfur vulcanization presents many occupational problems for the workers in rural areas. Radiation vulcanization of natural rubber latex is a much more friendly process as sulfur compounds are not needed for crosslinking, although chemicals as acrylate monomers, particularly multifunctional acrylates are still used as sensitizers for radiation processes. Two commercial gases, acetylene and butadiene, were selected as sensitizers for the radiation vulcanization of natural rubber latex instead of acrylates. These gases accelerate the crosslinking rates of the cure process and lower the radiation dose required to achieve vulcanization of natural rubber latex and improve the mechanical properties to reduce the tackiness of rubber goods. (author)

  18. Assessment of adverse reactions to latex gloves use among nurses ...

    African Journals Online (AJOL)

    ... to latex is a common problem among nurses and other health care workers. ... There was significant association between family history and occurrence of ... These effects may vary in severity from skin problems to anaphylactic shock.

  19. Synthesis and characterization of novel polyacid-stabilized latexes.

    Science.gov (United States)

    Yang, Pengcheng; Armes, S P

    2012-09-18

    A series of novel polyacid macromonomers based on 2-hydroxypropyl methacrylate (HPMA) were prepared by atom transfer radical polymerization (ATRP) via a two-step route. First, a range of well-defined PHPMA homopolymer precursors were synthesized by ATRP using a tertiary amine-functionalized initiator, 2-(dimethylamino)ethyl-2-bromoisobutyrylamide, and a CuCl/2, 2'-bipyridine (bpy) catalyst in alcoholic media at 50 °C. ATRP polymerizations were relatively slow and poorly controlled in pure isopropanol (IPA), especially when targeting higher degrees of polymerization (DP > 30). Improved control was achieved by addition of water: low polydispersity (M(w)/M(n) propyl methacrylate) (PSPMA) macromonomers by quaternizing the tertiary amine end-group with excess 4-vinylbenzyl chloride, followed by esterification of the pendent hydroxyl groups using excess succinic anhydride at 20 °C. These polyacid macromonomers were evaluated as reactive steric stabilizers for polystyrene latex synthesis under either aqueous emulsion polymerization or alcoholic dispersion polymerization conditions. Near-monodisperse polystyrene latexes were obtained via aqueous emulsion polymerization using 10 wt % PSPMA macromonomer (with respect to styrene monomer) with various initiators as evidenced by scanning electron microscopy, disk centrifuge photosedimentometry and light scattering studies. PSPMA macromomer concentrations as low as 1.0 wt % also produced near-monodisperse latexes, suggesting that these PSPMA macromonomers are highly effective stabilizers. Alcoholic dispersion polymerization of styrene conducted in various ethanol/water mixtures with 10 wt % PSPMA(50) macromonomer produced relatively large near-monodisperse latexes. Increasing the water content in such formulations led to smaller latexes, as expected. Control experiments conducted with 10 wt % PSPMA(50) homopolymer produced relatively large polydisperse latexes via emulsion polymerization and only macroscopic precipitates via

  20. Radioactive iodine (125I) labeling of latex particles

    International Nuclear Information System (INIS)

    Parikh, G.C.; Ho, C.K.

    1977-01-01

    The invention disclosed in this application is directed towards developing a radioiodination method which is applicable to the labeling of 2.02 micrometer (μm) and 0.37 micrometer (μm) diameter polyvinyltoluene latex particles that have been used as an immunoadsorbent. More particularly the overall method includes using an oxidation-reduction chemical reaction for tagging latex particles. Two methods are described. One, the hydrochloric acid method; and two, the nitric acid method

  1. Immune response modulation by curcumin in a latex allergy model

    Directory of Open Access Journals (Sweden)

    Raju Raghavan

    2007-01-01

    Full Text Available Abstract Background There has been a worldwide increase in allergy and asthma over the last few decades, particularly in industrially developed nations. This resulted in a renewed interest to understand the pathogenesis of allergy in recent years. The progress made in the pathogenesis of allergic disease has led to the exploration of novel alternative therapies, which include herbal medicines as well. Curcumin, present in turmeric, a frequently used spice in Asia has been shown to have anti-allergic and inflammatory potential. Methods We used a murine model of latex allergy to investigate the role of curcumin as an immunomodulator. BALB/c mice were exposed to latex allergens and developed latex allergy with a Th2 type of immune response. These animals were treated with curcumin and the immunological and inflammatory responses were evaluated. Results Animals exposed to latex showed enhanced serum IgE, latex specific IgG1, IL-4, IL-5, IL-13, eosinophils and inflammation in the lungs. Intragastric treatment of latex-sensitized mice with curcumin demonstrated a diminished Th2 response with a concurrent reduction in lung inflammation. Eosinophilia in curcumin-treated mice was markedly reduced, co-stimulatory molecule expression (CD80, CD86, and OX40L on antigen-presenting cells was decreased, and expression of MMP-9, OAT, and TSLP genes was also attenuated. Conclusion These results suggest that curcumin has potential therapeutic value for controlling allergic responses resulting from exposure to allergens.

  2. Drying of latex films and coatings: Reconsidering the fundamental mechanisms

    DEFF Research Database (Denmark)

    Kiil, Søren

    2006-01-01

    The two existing theories describing drying of latex films or coatings are reconsidered. Subsequently, a novel mathematical drying model is presented, the simulations of which can match and explain experimental drying rate data of two previous investigations with latex films. In contrast to previ......The two existing theories describing drying of latex films or coatings are reconsidered. Subsequently, a novel mathematical drying model is presented, the simulations of which can match and explain experimental drying rate data of two previous investigations with latex films. In contrast...... to previous model studies, but in agreement with observations, simulations suggest that during the falling rate period of the drying process of a latex film, a porous skin of partly coalesced latex particles is indeed formed, which limits transport of water vapour from the receding air-liquid interphase...... to the surface of the film. The value of the effective diffusion coefficient of water vapour in the dry and partly coalesced layer (7 x 10(-7) m(2)/s at 19-24 degrees C), the adjustable parameter of the model for the falling rate period, was found to be independent of initial wet film thickness (89-1322 mu m...

  3. Troubleshooting for the observed problems in processing latex concentrate from natural resource

    International Nuclear Information System (INIS)

    Afreen, S; Haque, K R; Huda, M K

    2013-01-01

    Natural latex has special importance in the rubber industry for manufacturing different types of goods like gloves, balloons, male contraceptive and similar thin walled articles. This natural latex is much more sensitive a liquid to handle since it can easily become contaminated and thereby coagulated which makes it unfavourable for centrifuge and getting concentrate from it. Some other related measures also are included in consideration during the processing of concentrate latex from the natural raw latex. The problems that are being faced in a concentrate latex processing plant can be categorized in different groups like, problems related to the latex property, mechanical problems, electrical problems, handling and storage problems, transformation problems, problems related to environmental issues, etc. Among them, the most common and vital problems frequently observed in a concentrate latex processing plant are discussed here with a view to finding the measures for solution which will help to maintain the latex property in any latex processing plant.

  4. Studied on Virgin Coconut Oil (VCO) and Olive Oil (OO) as an Alternative for Stabilizer of Radiation Vulcanized Natural Rubber Latex (RVNRL) Preparation

    International Nuclear Information System (INIS)

    Syuhada Ramli; Sofian Ibrahim; Mohd Noorwadi Mat Lazim

    2016-01-01

    This paper presents the effects of virgin coconut oil (VCO) and olive oil (OO) as an alternative stabilizer in the radiation vulcanized natural rubber latex (RVNRL). Potassium laurite (KL) as a stabilizer considered as a control of RVNRL sample were compared to mixed ratio 1:1 KL: VCO and 1:1 KL: OO stabilizer formulation. Total solid content (TSC) and tensile strength (TS) results showed no significant different between the formulations. Mechanical stability time (MST) indicates higher stability of RVNRL with addition of VCO. The fatty acid composition in VCO indicate VCO was acting well as stabilizer for latex stabilizer formulation. (author)

  5. Copolymer natural latex in concrete: Dynamic evaluation through energy dissipation of polymer modified concrete

    Science.gov (United States)

    Andayani, Sih Wuri; Suratman, Rochim; Imran, Iswandi; Mardiyati

    2018-05-01

    Portland cement concrete have been used in construction due to its strength and ecomical value. But it has some limitations, such low flexural strength, low tensile strength, low chemical resistant and etc. Due to its limitations in flexural and tensile strength, Portland cement concrete more susceptible by seismic force. There are some methods for improving its limitations. Polymer addition into concrete mixture could be one of solution for improving the flexural and tensile strength, in aiming to get erthquake resistant properties. Also, the eartquake resistant could be achieved by improving energy dissipation capacity. In this research, the earthquake resistant evalution was approached from dynamic evaluation through energy dissipation capacity, after polymer addition as concrete additives. The polymers were natural latex (Indonesian naural resource) grafted with styrene and methacrylate, forming copolymer - natural latex methacrylate (KOLAM) and copolymer - natural latex styrene (KOLAS). They were added into concrete mixture resulting polymer modified concrete. The composition of polymer are 1%, 5% and 10% weight/weight of cement. The higher capacity of energy dissipation will give more capability in either absorbing or dissipating energy, and it was predicted would give better earthquake resistant.. The use of KOLAM gave better performance than KOLAS in energy dissipation capacity. It gave about 46% for addition of 1% w/w compared to Portland cement concrete. But for addition 5% w/w and 10% w/w, they gave about 7% and 5% higher energy dissipation capacity. The KOLAM addition into concrete mixture would reduce the maximum impact load with maximumabout 35% impact load reducing after 1% w/w addition. The higher concentration of KOLAM in concrete mixture, lower reducing of impact load, they were about 4% and 3% for KOLAM 5% and 10%. For KOLAS addition in any compositions, there were no positive trend either in energy dissipation capacity or impact load properties

  6. Antibacterial activity of the latex of Argemone ochroleuca Sweet

    International Nuclear Information System (INIS)

    Saad A. Alamri; Mahmoud F. Moustafa

    2010-01-01

    To investigate the antibacterial effect of the crude latex of Argemone ochroleuca (A. ochroleuca) as antibacterial potential against a range of human pathogenic bacteria. This study was carried out at King Khalid University, Abha, Kingdom of Saudi Arabia from January to March 2010. Seventeen ml of fresh latex from A. ochroleuca Sweet was collected, and the antibacterial activity of crude and diluted latex were examined using one ml of standardized inoculum suspension, and using the agar diffusion method test against Bacillus subtilis, Enterobacter aerogenes, Micrococcus luteus, Escherichia coli, and Staphylococcus aureus. All inoculated plates were incubated aerobically at 290C for 48 hours. The diameter of the zones of inhibition was measured to the nearest mm. The crude latex of A. ochroleuca exhibited a potent antibacterial effect on all bacterial strains examined. The zones of inhibition against the tested bacteria were found in the range of 9.30 - 40.3 mm along with their respective minimum inhibitory concentration values 100 ul/ml. The observable inhibition on selected bacteria by latex of A. ochroleuca makes it a promising alternative as a potential source of natural antibacterial (Author).

  7. Respiratory and dermal symptoms in Thai nurses using latex products.

    Science.gov (United States)

    Supapvanich, C; Povey, A C; de Vocht, F

    2013-09-01

    Despite known health risks related to the use of powdered latex gloves (PLGs), they are still widely used in hospitals in developing countries due to the high cost of alternatives. To determine the prevalence of dermal and respiratory symptoms associated with latex glove use in nurses in Thailand and evaluate the influence of previously reported occupational risk factors in this population. A cross-sectional study in female nurses working in three Thai hospitals. Participants completed a questionnaire on demographics, occupational and personal history, use of latex products at work and dermal and respiratory symptoms attributed to occupational use of latex gloves. Of 899 nurses, 18% reported health effects attributed to the use of latex products. After adjustment for confounding, occupational risk factors associated with increased reporting of dermal symptoms included wearing more than 15 pairs of PLG per day (odds ratio (OR): 2.10, 95% confidence interval (CI): [1.32-3.34]), using chlorhexidine (OR: 2.07, 95% CI: [1.22-3.52]) and being an operating theatre nurse (OR: 2.46, 95% CI: [1.47-4.12]). Being a labour ward nurse (OR: 3.52, 95% CI: [1.26-9.85]) was the only factor associated with increased reporting of respiratory symptoms. Continuing use of PLGs in Thai nurses is associated with increased prevalence of dermal symptoms compared with data from developed countries. Measures to reduce such health effects are well established and should be considered. Additionally, replacement of chlorhexidine with an alternative detergent seems advisable.

  8. Latex-modified fiber-reinforced concrete bridge deck overlay : construction/interim report.

    Science.gov (United States)

    1993-06-01

    Latex-modified concrete (LMC) is Portland cement concrete (PCC) with an admixture of latex. LMC is considered to be nearly impermeable to chlorides and is extensively used to construct bridge deck overlays. Unfortunately, some of these overlays have ...

  9. Studies on physico-chemical and mechanical properties of the irradiated latex modified mortar

    International Nuclear Information System (INIS)

    Yassene, A.A.M.A.

    2009-01-01

    This thesis contains three chapter; chapter(I): Introduction and literature review on:- Introduction to polymer. - Mechanism of polymer-cement co-matrix formation.-Sulphate attack. - Solidification /stabilization of heavy metal in cement mortar. chapter(II): Materials and experimental techniques that include: 1- Preparation of latex polymer films from different polymer latices of styrene butadine rubber latex (SBR), poly (styrene-acrylic ester) latex (SAE) and vinylacetate /versatic -ester copolymer latex (C2A). The effect of γ-irradiation dose on the physico - chemical and mechanical properties of different latex polymer films was studied.2- Preparation of latex polymer-modified cement mortar with different ratios of cement: latex polymer and different curing method.3- Solidification /stabilization (S/S) of electroplating heavy metal precipitate in latex polymer- modified mortar with different cement /electroplating heavy metal sludge ratio. chapter(III) results and discussion

  10. Science and technology of rubber reclamation with special attention to NR based waste latex products

    NARCIS (Netherlands)

    Rajan, V.V.; Dierkes, Wilma K.; Joseph, R.; Noordermeer, Jacobus W.M.

    2006-01-01

    A comprehensive overview of reclamation of cured rubber with special emphasis on latex reclamation is depicted in this paper. The latex industry has expanded over the years to meet the world demands for gloves, condoms, latex thread, etc. Due to the strict specifications for the products and the

  11. Morphology and film formation of poly(butyl methacrylate)-polypyrrole core-shell latex particles

    NARCIS (Netherlands)

    Huijs, F; Lang, J

    Core-shell latex particles made of a poly(butyl methacrylate) (PBMA) core and a thin polypyrrole (PPy) shell were synthesized by two-stage polymerization. In the first stage, PBMA latex particles were synthesized in a semicontinuous process by free-radical polymerization. PBMA latex particles were

  12. IMMEDIATE AND DELAYED HYPERSENSITIVITY REACTIONS TO LATEX GLOVES IN A DENTAL STUDENT. A case report.

    Directory of Open Access Journals (Sweden)

    Iliyana Stoeva

    2011-08-01

    Full Text Available The article presents a case of dental student with immediate and delayed hypersensitivity reaction to latex gloves. Symptoms appeared during the second year of regularly using of latex gloves. The student was with no history of allergies and no previous exposure to latex products.

  13. Co-coagulation of the NBR latex and clay aqueous suspension: preparation and characterization

    International Nuclear Information System (INIS)

    Reis, Raquel S.; Brum, Elisson; Silva, Vanessa M.; Souza, Diego H.S.; Gomes, Ailton de S.; Nunes, Regina C.R.

    2009-01-01

    Blends of nitrile rubber (NBR) and sodium montmorillonite (MMT-Na) were prepared by co-coagulation of the NBR latex with aqueous suspension of clay. The content of MMT was varied from 0 to 7 phr and different mixtures were analyzed by X-ray diffraction, light scattering, gel content, thermogravimetric analysis and the oscillating disk rheometer. The different methods used indicated that there was formation of a structure interspersed in the mixtures studied, and that increasing the content MMT-Na enhances the values obtained. Rheological measurements on compositions with NBR showed the influence of clay on increasing the time of healing in terms of its content, as is the gel content and the thermal resistance. All results were compared to composition of NBR without MMT. (author)

  14. Polybutadiene latex particle size distribution analysis utilizing a disk centrifuge

    NARCIS (Netherlands)

    Verdurmen, E.M.F.J.; Albers, J.G.; German, A.L.

    1994-01-01

    Polybutadiene (I) latexes prepd. by emulsifier-free emulsion polymn. and having particle diam. 50-300 nm for both unimodal and bimodal particles size distributions were analyzed by the line-start (LIST) method in a Brookhaven disk centrifuge photosedimentometer. A special spin fluid was designed to

  15. Marine bacterial prodigiosin as dye for rubber latex, polymethyl ...

    African Journals Online (AJOL)

    Prodigiosin is known for its immunomodulatory, antibacterial, antimycotic, antimalarial, algicidal and anticancer activities. Here, we reported the evaluation of prodigiosin pigment as a dyeing agent in rubber latex, paper and polymethyl methacrylate (PMMA) so that it can be considered as an alternative to synthetic pigments.

  16. Pilot scale experiments on radiation vulcanization of NR latex

    Science.gov (United States)

    Ridwan, M.

    The potential of irradiated latex as raw material of commercial use is under testing on pilot plant scale in Indonesia which has 225 kCi Co-60 irradiation facility and can irradiate 1000 tonnes of centrifuged latex per annum. The facility was jointly designed by BATAN of Indonesia and JAERI of Japan and was jointly financed by UNDP/IAEA, Government of Japan and Government of Indonesia under UNDP/IAEA Regional Cooperative Agreement Project on Industrial Application of Isotopes and Radiation Technology. The facility is a water pool type and can accomodate 400 kCi Co-60. The Co-60 rack has two shapes, plate and cylindrical shapes. The plate shape source is used for natural rubber latex irradiation and the cylindrical one is used for other irradiation services. The vulcanization system consists of three major components : emulsification unit ( height : 650 mm, diameter 500 mm ), mixing unit ( height : 1900mm, diameter 1200 mm ) and vulcanization reactor ( height : 1800 mm, diameter 1300 mm ). The first two components are located outside shielded room while the third one-in irradiation room. The radiation vulcanization process is a much simpler energy saving process comparedto the conventional thermal process which has two vulcanization steps before and after dipping. The physical and mechanical properties of irradiated NR Latex are comparable to those of sulfur vulcanized, and depend on many factors such as irradiation dose, sensitizer content, dry rubber content and storage time.

  17. Oil-Acrylic hybrid latexes as binders for waterborne coatings

    NARCIS (Netherlands)

    Hamersveld, E.M.S.; Es, van J.J.G.S.; German, A.L.; Cuperus, F.P.; Weissenborn, P.; Hellgren, A.C.

    1999-01-01

    The combination of the characteristics of oil, or alkyd, emulsions and acrylic latexes in a waterborne binder has been the object of various studies in the past. Strategies for combining the positive properties of alkyds, e.g. autoxidative curing, gloss and penetration in wood, with the fast drying

  18. Oil-acrylic hybrid latexes as binders for waterborne coatings

    NARCIS (Netherlands)

    Hamersveld, van E.M.S.; Es, van J.; German, A.L.; Cuperus, F.P.; Weissenborn, P.; Hellgren, A.C.

    1999-01-01

    The combination of the characteristics of oil, or alkyd, emulsions and acrylic latexes in a waterborne binder has been the object of various studies in the past. Strategies for combining the positive properties of alkyds, e.g. autoxidative curing, gloss and penetration in wood, with the fast drying

  19. The construction and commissioning of MINT's latex irradiator

    International Nuclear Information System (INIS)

    Razali Hamzah; Muhd Khairi Muhd Said; Muhd Ariff Hamzah; Wan Manshol Wan Zin; Taiman Kadni

    1996-01-01

    The construction and installation of MINT's automatic continuous latex irradiator is described. MINT cooperated with NUKEM to design the plant. Construction was done by local building consultants and local contractor. The installation of the plant includes local fabrication components and imported components. The plant is automatically controlled by a computer system. Features of plant is described

  20. Pilot scale experiments on radiation vulcanization of NR latex

    International Nuclear Information System (INIS)

    Ridwan, M.

    1985-01-01

    The potential of irradiated latex as raw material of commercial use is under testing on pilot plant scale in Indonesia which has 225 kCi Co-60 irradiation facility and can irradiate 1000 tonnes of centrifuged latex per annum. The facility was jointly designed by BATAN of Indonesia and JAERI of Japan and was jointly financed by UNDP/IAEA, Government of Japan and Government of Indonesia under UNDP/IAEA Regional Cooperative Agreement Project on Industrial Application of Isotopes and Radiation Technology. The facility is a water pool type and can accommodate 400 kCi Co-60. The Co-60 rack has two shapes, plate and cylindrical shapes. The plate shape source is used for natural rubber latex irradiation and the cylindrical one is used for other irradiation services. The vulcanization system consists of three major components: emulsification unit, mixing unit and vulcanization reactor. The first two components are located outside shielded room while the third one in irradiation room. The radiation vulcanization process is a much simpler energy saving process compared to the conventional thermal process which has two vulcanization steps before and after dipping. The physical and mechanical properties of irradiated NR latex are comparable to those of sulfur vulcanized. (author)

  1. Study of glucoamylase immobilization in butadiene nitrile latex membrane

    International Nuclear Information System (INIS)

    Miller, E.

    1992-01-01

    Attempts have been undetaken to immobilize glucoamylaze by means of butadiene nitrile latex in the presence of a chemical initiator and 60 Co γ-radiation. The activity, stability of conjugates in the membrane and permeability of oxygen in these membranes were determined. (author) 14 refs.; 5 figs

  2. Acetylcholinesterase Inhibitory and Antioxidant Properties of Euphorbiacharacias Latex

    Directory of Open Access Journals (Sweden)

    Francesca Pintus

    2013-03-01

    Full Text Available The aim of the present study was to evaluate the acetylcholinesterase inhibitory capacity and the antioxidant properties of extracts of Euphorbia characias latex, a Mediterranean shrub. We performed a new extraction method involving the use of the trichloroacetic acid. The extract showed high antioxidant activity, was rich in total polyphenolic and flavonoid content and exhibited substantial inhibition of acetylcholinesterase activity.

  3. LaTeX - Know what you are missing

    Directory of Open Access Journals (Sweden)

    Gunther Maier

    2016-11-01

    Full Text Available This article gives a brief introduction to \\LaTeX\\ and related tools. The aim is to give an overview, to demonstrate the flexibility and versatility of the software, and to assist the reader taking first steps using it. The article links to a number of valuable resources for further information.

  4. Latex allergy in an infant with acquired hydrocephalus | Ehiozw ...

    African Journals Online (AJOL)

    We report the case of a 3 month old male infant with acquired hydrocephalus undergoing ventriculo-peritoneal shunt insertion who developed wheals and suffered a respiratory arrest following contact with latex gloves. The need for anaesthetists to effectively diagnose and properly manage this rare clinical entity is ...

  5. Natural rubber latex: determination and interpretation of flow curves

    Directory of Open Access Journals (Sweden)

    Harrison Lourenço Corrêa

    2015-08-01

    Full Text Available AbstractAs consumers become more demanding, the importance grows of guaranteeing the quality of products. The employment of reliable testing techniques that assure the origin and characteristics of the inputs used by industry is a key factor in this respect. In the rubber processing industry, the most commonly used characterization tests include determination of the total solids and dry rubber content, mechanical stability, odor, color and presence of volatile compounds, among others. For the most part, these tests are sufficient for the latex transformation industry. However, in situations where there is a need to know the behavior of latex in reaction to the mechanical forces of machines (mixers, pumps, etc., other tests must be used. Rheological tests to determine viscoelastic data by means of plotting flow curves combined with the application of theoretical models can provide important details for characterization of different types of latex. This article presents the protocol employed by the Rheology and Image Laboratory of Rio de Janeiro State University (UERJ for the rheological study of Brazilian latex. The samples analyzed came from the state of São Paulo.

  6. Partial swelling of latex particles by two monomers

    NARCIS (Netherlands)

    Noel, E.F.J.; Maxwell, I.A.; German, A.L.

    1993-01-01

    The swelling of polymeric latex particles with solvent and monomer is of great importance for the emulsion polymn. process in regard to compn. drift and rate of polymn. For the monomer combination, Me acrylate-vinyl acetate, both satn. and partial swelling were detd. exptl. Theories for satn.

  7. Ten years incidence of natural rubber latex sensitization and symptoms in a prospective cohort of health care workers using non-powdered latex gloves 2000-2009.

    Science.gov (United States)

    Larese Filon, Francesca; Bochdanovits, Letizia; Capuzzo, Chiara; Cerchi, Roberto; Rui, Francesca

    2014-07-01

    To assess the incidence of sensitization and gloves-related symptoms in 10-year follow-up in a group of health care workers (9,660 person-years) using non-powdered latex gloves from 2000 to 2009 and to examine related factors. We studied 2,053 health care workers in Trieste Hospitals by means of skin prick test for latex extract, patch tests and medical examinations. We report the incidence of latex sensitization among workers using non-powdered latex gloves. The incidence of latex sensitization, rhinitis, asthma, urticaria, irritant and allergic contact dermatitis were 1.0; 0.12; 0.21; 0.72; 2.39 and 2.50 cases per 1,000 person-years, respectively. Respiratory symptoms and urticaria were positively related with latex sensitization (OR = 8.0; 95 % CL 1.27-48.6), with common allergic respiratory symptoms (OR = 4.19; 95 % CL 1.04-16.8) and with familial atopy (OR = 4.47; 95 % CL 1.1-17.9). The incidence of latex sensitization and latex-related symptoms were very low but subjects with allergic symptoms related to common allergens are at higher risk. The use of non-latex gloves is suggested for them.

  8. Alergia látex-fruta Latex-fruit allergy

    Directory of Open Access Journals (Sweden)

    Flávia Andréia MARIN

    2002-01-01

    Full Text Available O látex está sendo considerado o alergênico do ano 2000, tendo em vista que inúmeros indivíduos, principalmente profissionais da área de saúde e pacientes submetidos a várias intervenções diagnósticas e terapêuticas, estão freqüentemente expostos aos alérgenos do látex, presentes em produtos de borracha natural. As manifestações clínicas conseqüentes às reações alérgicas de hipersensibilidade imediata vão desde rinite, urticária, conjuntivite, angioedema, asma, até anafilaxia. Estudos recentes estão demonstrando que pacientes alérgicos ao látex desenvolvem concomitantemente sensibilização a certos alimentos de origem vegetal, especialmente frutas como papaia, figo, banana, abacate, kiwi, pêssego, abacaxi, melão e castanha, acreditando-se numa provável ocorrência de reações cruzadas entre os alérgenos do látex e destas frutas. Faz-se, então, uma revisão sobre a alergia ao látex, em particular sobre os grupos de risco, incluindo a presença de reatividade cruzada entre o látex e as frutas.The latex is being considered the allergenic agent of the year 2000, taking into account that several individuals, mainly health care professionals, and patients who had undergone many diagnostic and therapeutic interventions, are frequently exposed to latex allergens, which are present in natural rubber latex products. The clinical manifestations, derived from allergic reactions of immediate hypersensitivity vary from since rhinitis, conjunctivitis, urticaria, angioedema, asthma, to anaphylaxis. Recent researches are demonstrating that patients allergic to latex develop concomitantly sensitization to certain vegetable foods, especially fruits like papaya, fig, banana, avocado, kiwi, peach, pineapple, melon and chestnut, and a probable occurrence of cross reaction between allergens of latex and of these fruits is believed. A review is made about latex allergy, in particular about risk groups, including the presence of

  9. Application of radiation vulcanized natural rubber latex in Indonesia

    International Nuclear Information System (INIS)

    Soebianto, Y.S.; Wiwik Sofiarti; Razzak, M.T.

    1996-01-01

    The center has carried out R and D of Radiation Vulcanization Natural Rubber Latex (RVNRL) technology and introduced it to the industries since the inauguration and operation of the latex pilot plant in 1983. After years of experiences and the environmental consideration, n-butylacrylate (n-BA) has replaced CCI, as the sensitizer. Until now the introduction program shows that radiation vulcanized latex is more suitable for home industries than large industries. The obstacle of the program is the marketing of the dipped products. In spite of these problems, the introduction of this technology to the people in some undeveloped area of Java has supported the national program to improve their living standard. The problems of nitrosamine and protein allergic have turn up RVNRL to be the substitute of sulfur vulcanized latex in the future. The cooperation with a national condom manufacturer (PT Mitra Banjaran) has applied RVNRL for condom production in the large scale. Soft condoms with less probability of pinhole are obtained, but the technical problem is stickiness after pilling. Supply to a baby teat and a rubber thread manufacturer offers great advantages by not using any chemicals. In spite of the advantages, the problem of latex viscosity for dipping and the low modulus of elasticity of the threads arise. Through those input CAIR-BATAN is conducting the research and development in improving the crosslinking among the rubber particles that are supposed to be the reason of the stickiness and low modulus of elasticity. This effort is expected to be able to broaden the application of RVNRL, and it will be achieved only by the involvement of rubber chemist, rubber technologist, and radiation chemist

  10. A novel arctigenin-containing latex glove prevents latex allergy by inhibiting type I/IV allergic reactions.

    Science.gov (United States)

    Wang, Yong-Xin; Xue, Dan-Ting; Liu, Meng; Zhou, Zheng-Min; Shang, Jing

    2016-03-01

    The present study aimed at developing a natural compound with anti-allergic effect and stability under latex glove manufacturing conditions and investigating whether its anti-allergic effect is maintained after its addition into the latex. The effects of nine natural compounds on growth of the RBL-2H3 cells and mouse primary spleen lymphocytes were determined using MTT assay. The compounds included glycyrrhizin, osthole, tetrandrine, tea polyphenol, catechin, arctigenin, oleanolic acid, baicalin and oxymatrine. An ELISA assay was used for the in vitro anti-type I/IV allergy screening; in this process β-hexosaminidase, histamine, and IL-4 released from RBL-2H3 cell lines and IFN-γ and IL-2 released from mouse primary spleen lymphocytes were taken as screening indices. The physical stability of eight natural compounds and the dissolubility of arctigenin, selected based on the in vitro pharnacodynamaic screening and the stability evaluation, were detected by HPLC. The in vivo pharmacodynamic confirmation of arctigenin and final latex product was evaluated with a passive cutaneous anaphylaxis (PCA) model and an allergen-specific skin response model. Nine natural compounds showed minor growth inhibition on RBL-2H3 cells and mouse primary spleen lymphocytes. Baicalin and arctigenin had the best anti-type I and IV allergic effects among the natural compounds based on the in vitro pharmacodynamic screening. Arctigenin and catechin had the best physical stability under different manufacturing conditions. Arctigenin was the selected for further evaluation and proven to have anti-type I and IV allergic effects in vivo in a dose-dependent manner. The final product of the arctigenin-containing latex glove had anti-type I and IV allergic effects in vivo which were mainly attributed to arctigenin as proved from the dissolubility results. Arctigenin showed anti-type I and IV allergic effects in vitro and in vivo, with a good stability under latex glove manufacturing conditions

  11. Latex stage blending of multiwalled carbon nanotube in carboxylated acrylonitrile butadiene rubber: Mechanical and electrical properties

    International Nuclear Information System (INIS)

    Preetha Nair, K.; Thomas, Paulbert; Joseph, Rani

    2012-01-01

    Highlights: ► MWCNT can act as a reinforcing filler in XNBR at very low concentration. ► SEM and XRD analysis confirm uniform distribution of nanotube in the matrix. ► Mechanical properties showed considerable improvement. ► Thermal stability of the composite is marginally improved. -- Abstract: Multiwalled carbon nanotube (MWCNT) was dispersed in sodium dodecyl benzene sulphonate (SDBS) by sonication. The dispersed MWCNT (0.05–0.3 gm) was incorporated in carboxylated acrylonitrile butadiene rubber (XNBR) latex. Mechanical, electrical and thermal properties of these composites were studied. Mechanical properties of the composites increased up to an optimum concentration and then decreased. Dielectric properties of the composites were studied in the S band (frequency range 2–4 GHz) by Cavity Perturbation method. Direct current (DC) electrical conductivity shows a percolation behaviour and conductivity increased by about 10 orders of magnitude. Thermal studies were conducted using Differential Scanning Calorimetry (DSC) and Thermo Gravimetric Analysis (TGA). As expected with the very small concentration of multiwalled carbon nanotube, glass transition temperature (T g ) and thermal stability of the composite showed a marginal increase. Composites were characterized by Fourier transform infrared spectroscopy (FTIR), X-ray diffraction (XRD) and Scanning electron microscope (SEM) analysis.

  12. A self-cleaning coating based on commercial grade polyacrylic latex modified by TiO2/Ag-exchanged-zeolite-A nanocomposite

    International Nuclear Information System (INIS)

    Nosrati, Rahimeh; Olad, Ali; Nofouzi, Katayoon

    2015-01-01

    Graphical abstract: - Highlights: • A novel nanocomposite coating based on polyacrylic was prepared. • Nanostructured TiO 2 /Ag-exchanged-zeolite-A composite material was prepared. • Prepared nanocomposite used as additive for modification of polyacrylic latex. • Modified coatings show self-cleaning and antibacterial properties. • Modified coatings show better stability in water in versus of unmodified polymer. - Abstract: The commercial grade polyacrylic latex was modified in order to prepare a self-cleaning coating. TiO 2 /Ag-exchanged-zeolite-A nanocomposite was prepared and used as additive in the matrix of polyacrylic latex to achieve a hydrophilic and photocatalytic coating. FTIR and UV–visible spectroscopy, X-ray diffraction patterns and FESEM were used to characterize the composition and structure of the nanocomposites and coatings. The acrylic coatings, were prepared by using of TiO 2 /Ag-exchanged-zeolite-A additive, had better UV and visible light absorption, hydrophilic, degradation of organic pollutants, stability in water and antimicrobial properties than pristine commercial grade polyacrylic latex coating. According to the results, the modified polyacrylic based coating containing 0.5 wt% of TiO 2 /Ag-exchanged-zeolite-A nanocomposite additive with TiO 2 to Ag-exchanged-zeolite-A ratio of 1:2 was the best coating considering most of useful properties such as small band gap and low water contact angle. The water contact angle for unmodified polyacrylic latex coating was 68° which was decreased to less than 10° in modified coating after 24 h LED lamp illumination

  13. A self-cleaning coating based on commercial grade polyacrylic latex modified by TiO{sub 2}/Ag-exchanged-zeolite-A nanocomposite

    Energy Technology Data Exchange (ETDEWEB)

    Nosrati, Rahimeh, E-mail: ra.nosrati@gmail.com [Polymer Composite Research Laboratory, Department of Applied Chemistry, Faculty of Chemistry, University of Tabriz, Tabriz (Iran, Islamic Republic of); Olad, Ali, E-mail: a.olad@yahoo.com [Polymer Composite Research Laboratory, Department of Applied Chemistry, Faculty of Chemistry, University of Tabriz, Tabriz (Iran, Islamic Republic of); Nofouzi, Katayoon, E-mail: nofouzi@tabrizu.ac.ir [Faculty of Veterinary Medicine, University of Tabriz, Tabriz (Iran, Islamic Republic of)

    2015-08-15

    Graphical abstract: - Highlights: • A novel nanocomposite coating based on polyacrylic was prepared. • Nanostructured TiO{sub 2}/Ag-exchanged-zeolite-A composite material was prepared. • Prepared nanocomposite used as additive for modification of polyacrylic latex. • Modified coatings show self-cleaning and antibacterial properties. • Modified coatings show better stability in water in versus of unmodified polymer. - Abstract: The commercial grade polyacrylic latex was modified in order to prepare a self-cleaning coating. TiO{sub 2}/Ag-exchanged-zeolite-A nanocomposite was prepared and used as additive in the matrix of polyacrylic latex to achieve a hydrophilic and photocatalytic coating. FTIR and UV–visible spectroscopy, X-ray diffraction patterns and FESEM were used to characterize the composition and structure of the nanocomposites and coatings. The acrylic coatings, were prepared by using of TiO{sub 2}/Ag-exchanged-zeolite-A additive, had better UV and visible light absorption, hydrophilic, degradation of organic pollutants, stability in water and antimicrobial properties than pristine commercial grade polyacrylic latex coating. According to the results, the modified polyacrylic based coating containing 0.5 wt% of TiO{sub 2}/Ag-exchanged-zeolite-A nanocomposite additive with TiO{sub 2} to Ag-exchanged-zeolite-A ratio of 1:2 was the best coating considering most of useful properties such as small band gap and low water contact angle. The water contact angle for unmodified polyacrylic latex coating was 68° which was decreased to less than 10° in modified coating after 24 h LED lamp illumination.

  14. LOL2 and LOL5 loci control latex production by laticifer cells in Euphorbia lathyris.

    Science.gov (United States)

    Castelblanque, Lourdes; Balaguer, Begoña; Marti, Cristina; Orozco, Marianela; Vera, Pablo

    2018-06-07

    Laticifers are specialized plant cells capable of indefinite elongation that ramify extensively and are responsible for latex biosynthesis and accumulation. However, the mechanisms underlying laticifer cell differentiation, growth and production of latex remain largely unknown. In a search for mutants showing enhanced accumulation of latex we identified two LOT OF LATEX (LOL) loci in Euphorbia lathyris. lol2 and lol5 mutants show enhanced production of latex contained within laticifer cells. The recessive lol2 mutant carries increased biosynthesis of the plant hormone jasmonoyl-isoleucine (JA-Ile) and therefore establishes a genetic link between jasmonic acid (JA) signaling and latex production in laticifers. Instead, heightened production of latex in lol5 plants obeys to enhanced proliferation of laticifer cells. Phylogenetic analysis of laticifer-expressed genes in E. lathyris and in two other latex-bearing species, Euphorbia corallioides and Euphorbia palustris, allowed the identification of canonical JA responsive elements present in the gene promoter regions of laticifer marker genes. Moreover, we identified that the hormone JA functions not as a morphogen for laticifer differentiation but as a trigger for the fill out of laticifers with latex and the associated triterpenoids. The identification of LOL loci represents a further step towards the understanding of mechanisms controlling latex production in laticifer cells. No claim to original US Government works New Phytologist © 2018 New Phytologist Trust.

  15. A self-cleaning coating based on commercial grade polyacrylic latex modified by TiO2/Ag-exchanged-zeolite-A nanocomposite

    Science.gov (United States)

    Nosrati, Rahimeh; Olad, Ali; Nofouzi, Katayoon

    2015-08-01

    The commercial grade polyacrylic latex was modified in order to prepare a self-cleaning coating. TiO2/Ag-exchanged-zeolite-A nanocomposite was prepared and used as additive in the matrix of polyacrylic latex to achieve a hydrophilic and photocatalytic coating. FTIR and UV-visible spectroscopy, X-ray diffraction patterns and FESEM were used to characterize the composition and structure of the nanocomposites and coatings. The acrylic coatings, were prepared by using of TiO2/Ag-exchanged-zeolite-A additive, had better UV and visible light absorption, hydrophilic, degradation of organic pollutants, stability in water and antimicrobial properties than pristine commercial grade polyacrylic latex coating. According to the results, the modified polyacrylic based coating containing 0.5 wt% of TiO2/Ag-exchanged-zeolite-A nanocomposite additive with TiO2 to Ag-exchanged-zeolite-A ratio of 1:2 was the best coating considering most of useful properties such as small band gap and low water contact angle. The water contact angle for unmodified polyacrylic latex coating was 68° which was decreased to less than 10° in modified coating after 24 h LED lamp illumination.

  16. Osmotic de-swelling and swelling of latex dispersions

    International Nuclear Information System (INIS)

    Bonnet-Gonnet, Cecile

    1993-01-01

    This research thesis reports the comparison of, on the one hand, direct measurements of de-swelling resistance of latex dispersions obtained by osmotic pressure with, on the other hand, predictions made by models of electrostatic interactions. This resistance is explained in the case of sulphate-stabilised polystyrene particles (direct repulsion between charged particles), and in the case of copolymer (ps-pba) particles covered by an amphiphilic polymer (interactions between surface macromolecules and polymers). The study of de-swelling and swelling cycles highlights the existence of thresholds beyond which the concentrated dispersion has some cohesion. This irreversibility can be modelled by a Van der Waals attraction. The role of hydrophobic forces in latex destabilisation is studied [fr

  17. Extractable protein of radiation vulcanized natural rubber latex

    International Nuclear Information System (INIS)

    Soebianto, Y.S.; Upul, R.M.; Makuuchi, K.; Yoshii, F.; Kume, T.

    2000-01-01

    A new method to reduce the protein level in the latex products by irradiation is reported. Water soluble protein (WSP) solution (10%) was added into radiation vulcanized NR latex (RVNRL) as much as 3 phr in three different processes: added to RVNRL, added to re-centrifuged RVNRL, and added to RVNRL followed by centrifugation. The protein content was determined by enhanced BCA method, and identified by SDS-PAGE analysis. Addition of WSP followed by centrifugation reduces EP up to the minimum protein detection, and shortens the leaching time to 20-30 min. SDS-PAGE analysis confirms the reduction of soluble protein in the serum phase, and disappearance of protein bands in the rubber extract. Protein-WSP interaction produces water soluble complex, and removed by centrifugation. The molecular weight of WSP dictates the efficiency of protein removal. (author)

  18. [Anaphylactic reaction to latex during spinal anesthesia: a case report].

    Science.gov (United States)

    Ueda, Narumi; Kitamura, Rie; Wakamori, Takeshi; Nakamura, Kumi; Konishi, Keisuke

    2008-05-01

    A 46-year-old man, with a history of atopic dermatitis and bronchial asthma, underwent surgery for an inguinal hernia. Forty-three minutes subsequent to spinal anesthesia, the patient complained suddenly of dyspnea with wheezing. Blood pressure decreased and skin eruption was observed on his chest. Postoperative laboratory tests revealed high IgE concentration, and a skin test confirmed an allergy to latex. The patient's allergic reaction was easily overlooked because of his history of bronchial asthma and the possibility that the hypotension was caused by the high spinal anesthesia. Latex allergy should be considered in any suspicious case presenting with these symptoms during surgery. After recovery, a skin test should be used to confirm the allergy to avoid repeated allergic episodes.

  19. Extractable protein content of radiation vulcanized natural rubber latex films

    International Nuclear Information System (INIS)

    Ma'zam Md Said; Wan Manshol Wan Zin

    1996-01-01

    The effects of processing conditions on extractable protein content of coagulant dipped radiation vulcanized natural rubber latex films have been investigated. Drying of wet-gel of radiation vulcanized latex films even at a relatively low temperature of 70 degree C resulted in increases of extractable protein content of the films. The extractable protein content is dependent upon both the temperature and time of drying of wet-gel deposit. Wet-gel leaching of film alone is not adequate to reduce the extractable protein content of films to low levels. Combination of wet-gel leaching, post-leaching, a dip in corn starch slurry, followed by drying at a low temperature of 70 degree C reduces the extractable protein content of films to very low levels

  20. Extractable protein of radiation vulcanized natural rubber latex

    Energy Technology Data Exchange (ETDEWEB)

    Soebianto, Y.S. [Center for Research and Development of Isotopes and Radiation Technology, BATAN, Jakarta (Indonesia); Upul, R.M. [Rubber Research Institute of Sri Lanka, Ratmalana (Sri Lanka); Makuuchi, K.; Yoshii, F.; Kume, T. [Japan Atomic Energy Research Inst., Takasaki, Gunma (Japan). Takasaki Radiation Chemistry Research Establishment

    2000-03-01

    A new method to reduce the protein level in the latex products by irradiation is reported. Water soluble protein (WSP) solution (10%) was added into radiation vulcanized NR latex (RVNRL) as much as 3 phr in three different processes: added to RVNRL, added to re-centrifuged RVNRL, and added to RVNRL followed by centrifugation. The protein content was determined by enhanced BCA method, and identified by SDS-PAGE analysis. Addition of WSP followed by centrifugation reduces EP up to the minimum protein detection, and shortens the leaching time to 20-30 min. SDS-PAGE analysis confirms the reduction of soluble protein in the serum phase, and disappearance of protein bands in the rubber extract. Protein-WSP interaction produces water soluble complex, and removed by centrifugation. The molecular weight of WSP dictates the efficiency of protein removal. (author)

  1. A latex metabolite benefits plant fitness under root herbivore attack

    OpenAIRE

    Huber, M.; Epping, J.; Gronover, C.S.; Fricke, J.; Aziz, Z.; Brillatz, T.; Swyers, M.; Köllner, T.G.; Vogel, H.; Hammerbacher, A.; Triebwasser-Freese, D.; Robert, C.A.M.; Verhoeven, K.; Preite, V.; Gershenzon, J.

    2016-01-01

    Plants produce large amounts of secondary metabolites in their shoots and roots and store them in specialized secretory structures. Although secondary metabolites and their secretory structures are commonly assumed to have a defensive function, evidence that they benefit plant fitness under herbivore attack is scarce, especially below ground. Here, we tested whether latex secondary metabolites produced by the common dandelion (Taraxacum officinale agg.) decrease the performance of its major n...

  2. The entry of free radicals into polystyrene latex particles

    International Nuclear Information System (INIS)

    Adams, M.E.; Trau, M.; Gilbert, R.C.; Napper, D.R.

    1988-01-01

    Mechanistic understanding of the processes governing the kinetics of emulsion polymerization has both scientific and technical interest. One component of this process that is poorly understood at present is that of free radical entry into latex particles. Measurements were made of the entry rate coefficient as a function of temperature for free radicals entering polystyrene latex particles in seeded emulsion polymerizations initiated by γ-rays. The activation energy for entry was found to be less than 24 ± 3 kJ mol -1 , consistent with entry being controlled by a physical (e.g. diffusional) rather than a chemical process. Measurement of the entry rate coefficient as a function of the γ-ray dose rate suggested that the factors that determine the entry rate when the primary free radicals are uncharged are similar to those that determine the entry rate for charged free radicals derived from chemical initiation by peroxydisulfate. This result was consistent with measurements of the entry rate coefficient of charged free radicals derived from peroxydisulfate; these data were found to be virtually independent of both the extent of the latex surface coverage by the anionic surfactant sodium dodecyl sulfate and the ionic strength of the continuous phase. The data refute several proposals given in the literature for the rate-determining step for entry, being inconsistent with control by collision of free radicals with the latex particles, surfactant desorption, and an electrostatic barrier arising from the colloidal nature of the entering free radical. The origin of the activation energy for entry remains obscure

  3. Radiation vulcanised natural rubber latex (RVNRL) market and challenges

    International Nuclear Information System (INIS)

    Wan Manshol Wan Zin; Najib Mohamad Zakey; Chai Chee Keong

    2000-01-01

    RVNRL has the required properties and proven useful for the manufacturing of examination gloves, balloons and finger cots at industrial scale. To date only RVNRL finger cots are available in the market. Problems and challenges for the market of other products are identified. Further success in the on going research activities will be the reference for more applications of RVNRL in the relevant industry to produce natural rubber latex products of more competitive values

  4. Minimizing surgical skin incision scars with a latex surgical glove.

    Science.gov (United States)

    Han, So-Eun; Ryoo, Suk-Tae; Lim, So Young; Pyon, Jai-Kyung; Bang, Sa-Ik; Oh, Kap-Sung; Mun, Goo-Hyun

    2013-04-01

    The current trend in minimally invasive surgery is to make a small surgical incision. However, the excessive tensile stress applied by the retractors to the skin surrounding the incision often results in a long wound healing time and extensive scarring. To minimize these types of wound problems, the authors evaluated a simple and cost-effective method to minimize surgical incision scars based on the use of a latex surgical glove. The tunnel-shaped part of a powder-free latex surgical glove was applied to the incision and the dissection plane. It was fixed to the full layer of the dissection plane with sutures. The glove on the skin surface then was sealed with Ioban (3 M Health Care, St. Paul, MN, USA) to prevent movement. The operation proceeded as usual, with the retractor running through the tunnel of the latex glove. It was possible to complete the operation without any disturbance of the visual field by the surgical glove, and the glove was neither torn nor separated by the retractors. The retractors caused traction and friction during the operation, but the extent of damage to the postoperative skin incision margin was remarkably less than when the operation was performed without a glove. This simple and cost-effective method is based on the use of a latex surgical glove to protect the surgical skin incision site and improve the appearance of the postoperative scar. This journal requires that authors assign a level of evidence to each article. For a full description of these Evidence-Based Medicine ratings, please refer to the Table of Contents or the online Instructions to Authors www.springer.com/00266 .

  5. The criteria and the design of MINT's latex irradiator

    International Nuclear Information System (INIS)

    Razali Hamzah; Muhd Khairi Muhd Said; Muhd Ariff Hamzah; Wan Manshol Wan Zin; Wan Abd Hadi Wan Abu Bakar; Muhd Noor Muhd Yunus

    1996-01-01

    The demand for RVNRL is continually on the upsurge and the present irradiation technique at the present SINAGAMA plant is not sufficient and practical to meet the demand. A number of conceptual designs were evolved to design according to the requirements of cost-effective and highly efficient plant. The number of options are described. In 1994 MINT work with NUKEM to build an automatic continuous latex irradiation plant

  6. Progress in radiation vulcanization of natural rubber latex

    International Nuclear Information System (INIS)

    Makuuchi, Keizo

    2000-01-01

    Vulcanization dose defined as the radiation dose at which cross-linked natural rubber in latex has the maximum tensile strength can be reduced by adding carbon tetrachloride as a reaction accelerator. The radiation vulcanization of natural rubber latex was selected as one of regional projects of IAEA in 1989 and a pilot plant was built in Jakarta. The products from it were evaluated during 1983-1985, followed by IAEA decision to support the continued R and D study at Takasaki, JAERI. Various factors to improve the properties of the products have been studied. Several advantages of the process over conventional method, such as absence of N-nitrosoamines, low cytotoxicity, decomposability in the environment, transparency and softness, were confirmed. The technology has been transferred toward commercial application in Thailand, and pilot plants being set up in Indonesia, India, Malaysia and Thailand. Moreover, the process was found to be effective in reducing protein remaining in natural rubber latex products and the initial investment and irradiation cost was found to be greatly reduced by employing low energy electron accelerator. This paper reviews such progress. (S. Ohno)

  7. CDNA library from the Latex of Hevea brasiliensis

    Directory of Open Access Journals (Sweden)

    Wilaiwan Chotigeat

    2010-12-01

    Full Text Available Latex from Hevea brasiliensis contains 30-50% (w/w of natural rubber (cis-1,4-polyisoprene, the important rawmaterial for many rubber industries. We have constructed a cDNA library from the latex of H. brasiliensis to investigate theexpressed genes and molecular events in the latex. We analyzed 412 expressed sequence tags (ESTs. More than 90% of theEST clones showed homology to previously described sequences in public databases. Functional classification of the ESTsshowed that the largest category were proteins of unknown function (30.1%, 11.4% of ESTs encoded for rubber synthesisrelatedproteins (RS and 8.5% for defense or stress related proteins (DS. Those with no significant homology to knownsequences (NSH accounted for 8.7%, primary metabolism (PM and gene expression and RNA metabolism were 7.8% and6.6%, respectively. Other categories included, protein synthesis-related proteins (6.6%, chromatin and DNA metabolism(CDM 3.9%, energy metabolism (EM 3.4%, cellular transport (CT 3.2%, cell structure (CS 3.2%, signal transduction (ST2.2%, secondary metabolism (SM 1.7%, protein fate (PF 2.2%, and reproductive proteins (RP 0.7%.

  8. Extractable proteins from field radiation vulcanized natural rubber latex

    Energy Technology Data Exchange (ETDEWEB)

    Parra, Duclerc F. [Chemical and Environmental Centre, Nuclear Energy Research Institute, Av. Lineu Prestes, 2242-CEP Sao Paulo (Brazil)]. E-mail: dfparra@ipen.br; Pinto Martins, Carlos Felipe [Chemical and Environmental Centre, Nuclear Energy Research Institute, Av. Lineu Prestes, 2242-CEP Sao Paulo (Brazil); Collantes, Hugo D.C. [Chemical and Environmental Centre, Nuclear Energy Research Institute, Av. Lineu Prestes, 2242-CEP Sao Paulo (Brazil); Lugao, Ademar B. [Chemical and Environmental Centre, Nuclear Energy Research Institute, Av. Lineu Prestes, 2242-CEP Sao Paulo (Brazil)

    2005-07-01

    The type I allergy associated with the use of natural rubber latex (NRL) products is caused by the NRL proteins leached by the sweat or other body fluids. Makuuchi's group proposed for the first time the proteins removal by the addition of water-soluble polymers (WSP) on radiation vulcanization of natural rubber latex (RVNRL) that is a promising process under development in many countries. In this study, Brazilian field natural rubber was irradiated with a {sup 60}Co gamma source to reduce the content of WSP in the final product. WSP was used as additive to improve the extraction of protein. After irradiation the RVNRL was centrifuged to extract the WSP and proteins. The analytical methodology for protein content was based on the modified Lowry method according to ASTM D5712. Protein determination was carried out in serum of latex and in the extracts of the gloves. The concentration of extractable water-soluble proteins in serum of irradiated field NRL (NRL1), not irradiated one (NRL2); of twice centrifuged sample with polymer additive NRL (NRL3) and of the glove manufactured (NRLG) are compared with commercial glove (CG). The irradiation process increases the extractable water-soluble proteins, EP, as reported in the literature. In this study the use of polymeric additive on the bi-centrifugation process to remove protein was successful and the EP of the glove obtained in NRL3 was at around 40% of the commercial glove.

  9. Identification and characterization of Euphorbia nivulia latex proteins.

    Science.gov (United States)

    Badgujar, Shamkant B; Mahajan, Raghunath T

    2014-03-01

    The protein profile of latex of Euphorbia nivulia Buch.-Ham. is established. Three new proteins viz., Nivulian-I, II and III have been purified to homogeneity from the latex. The relative molecular masses of Nivulian-I, II and III are 31,486.985, 43,670.846 and 52,803.470 Da respectively. Nivulian-I is a simple type of protein while Nivulian-II and III are glycoproteins. Peptide mass fingerprint analysis revealed peptides of these proteins match with Tubulin alpha-1 chain of Eleusine indica, Maturase K of Banksia quercifolia and hypothetical protein of Zea mays respectively. Tryptic digestion profile of Nivulian-I, II and III, infer the exclusive nature of latex origin proteins and may be new and are additive molecules in the dictionaries of phytoproteins or botany. This is the first of its kind, regarding characterization and validation of Nivulian-I, II and III with respect to peptide sequencing. Copyright © 2013 Elsevier B.V. All rights reserved.

  10. Efficacy of protection by latex gloves during orthodontic therapy.

    Science.gov (United States)

    Doll, G M; Zentner, A; Balan, R; Sergl, H G

    2000-01-01

    The wearing of gloves during orthodontic or dental treatment is generally indicated for reasons of hygiene and protection against infection. This study was aimed at determining the extent and localization of perforations caused by the various orthodontic treatment techniques and interrupting the infection barrier. The impermeability was tested by means of a water retention test according to European standard EN 455, Part 1, performed on 1600 Centramed (Centramed, Koblenz), Tekmedic and SafeEx non-sterile disposable latex gloves (both by Safe Med, Switzerland) and Safe Gan latex gloves with an additional acrylate coating (also by Safe Med). The perforation rate in unused gloves was between 0.5% and 7.5%, rising on average to 11% with increasing use. 36% of the total number of lesions resulted from handling removable appliances, and 57% from handling fixed appliances, especially when replacing arch wires and elastics. Most lesions were in the thumb, index finger and palm region. Only 18% of the defects were noticed by the dentists themselves. The gloves worn by beginners in their first year of postgraduate orthodontic training had about twice as many defects as those worn by qualified orthodontists. When patients with an increased risk of infection are to be treated, additional hand disinfection measures should be taken and 2 pairs of gloves worn in view of the relatively unreliable protection offered by commercially available latex gloves.

  11. Extractable protein of radiation vulcanized natural rubber latex

    International Nuclear Information System (INIS)

    Soebianto, Y.S.; Ratnayake, U.M.; Makuuchi, Keizo; Yoshii, Fumio; Kume, Tamikazu

    2000-01-01

    Protein remained in the latex products are reported to cause serious allergy. A new method to reduce the protein level in the latex products by irradiation is reported. Water soluble protein (WSP) solution (10%) was added into radiation vulcanized NR latex (RVNRL) in three different processes. The amount of WSP was 3 phr. It was only added to RVNRL (standard), added to re-centrifuged RVNRL (pre-centrifugation), and added to RVNRL followed by centrifugation (post-centrifugation). The protein content was determined by enhanced BCA method, and identified by SDS-PAGE. Extractable protein (EP) from the rubber has been reduced up to the minimum protein detection by combining WSP addition and centrifugation. Short leaching time (20-30 min.) can be achieved after the combine treatment, and SDS-PAGE confirms the reduction of soluble protein in the serum phase, and disappearance of protein bands in the rubber extract. Protein-WSP interaction produces water soluble complex, and removed by centrifugation. The efficiency of protein removal by WSP depends on its molecular weight of WSP which relates to its water solubility. (author)

  12. Radiation vulcanization of natural rubber latex using irradiation n-butyl acrylate aqueous emulsion as sensitizer

    International Nuclear Information System (INIS)

    Vo Van Thien; Nguyen Quoc Hien; Keizo Makuuchi; Fumio Yoshii

    2000-01-01

    Natural rubber latex was vulcanized by gamma radiation with n-butyl acrylate aqueous emulsion irradiated at dose of 1.5 kGy as sensitizer. The total solid content of latex increases on the irradiation dose. The viscosity of latex on the standing time was investigated and became stable after one month of storage. The gel content of latex films increasing with irradiation dose and attained more than 94% at dose of 10 kGy. Tensile strength of films reached the values of 31MPa; 30 Mpa and 25 Mpa at vulcanization doses of 20 kGy, 15 kGy and 8 kGy for the concentrations of sensitizer 7 phr, 9 phr and 13 phr respectively. Elongation at break decreases as increasing dose. Tear strength of rubber films was from 30-40 N/mm. The tackiness of latex films decreases and smell of vulcanized latex is almost negligible. (author)

  13. Histamine mediates the pro-inflammatory effect of latex of Calotropis procera in rats

    Directory of Open Access Journals (Sweden)

    Yatin M. Shivkar

    2003-01-01

    Full Text Available Introduction: Calotropis procera is known to produce contact dermatitis and the latex of this plant produces intense inflammation when injected locally. However, the precise mode of its pro-inflammatory effect is not known. In present study we have pharmacologically characterized the inflammation induced by latex of C. procera in a rat paw edema model and determined the role of histamine in latex-induced inflammation.

  14. Latex agglutination test (LAT) for the diagnosis of typhoid fever.

    Science.gov (United States)

    Sahni, Gopal Shankar

    2013-06-01

    The efficacy of latex agglutination test in the rapid diagnosis of typhoid fever was studied and the result compared with that of blood culture. This study included 80 children suffering from typhoid fever, among which 40 were confirmed by blood culture isolation and 40 had possible typhoid fever based on high Widal's titre (a four-fold rise in the titre of antibody to typhi "O" and "H" antigen was considered as a positive Widal's test result). Eighty children, 40 with febrile illness confirmed to be other than typhoid and 40 normal healthy children were used as negative controls. The various groups were: (i) Study group ie, group I had 40 children confirmed by culture isolation of Salmonella typhi(confirmed typhoid cases). (ii) Control groups ie, (a) group II with 40 febrile controls selected from paediatrics ward where cause other than S typhi has been established, (b) group III with 40 afebrile healthy controls that were siblings of the children admitted in paediatric ward for any reason with no history of fever and TAB vaccination in the last one year, and (c) group IV with 40 children with high Widal's titre in paired sera sample. Widal's test with paired sera with a one week interval between collections were done in all 40 patients. Latex aggtutination test which could detect 900 ng/ml of antigen as observed in checker board titration, was positive in all 40 children from group I who had positive blood culture and in 30 children from group IV who had culture negative and had high Widal's titre positive. Latex agglutination test was positive in 4 children in group II and none in group III. Using blood culture positive cases as true positive and children in groups II and III as true negative, the test had a sensitivity of 100% and specificity of 96%. Latex agglutination test was found to be significantly sensitive (100%) and specific (96%) and could detect 75% more cases in group IV (possible typhoid cases). Thus latex agglutination test can be used for rapid

  15. Solubility of mixed monomers of tetrafluoroethylene and propylene in water and latex

    International Nuclear Information System (INIS)

    Watanabe, Hiromasa; Okamoto, Jiro

    1978-03-01

    For kinetical analysis of the emulsion copolymerization of tetrafluoroethylene with propylene and selection of the optimum reaction conditions, the monomer concentrations and composition of the polymer particle were measured and the relations with reaction conditions were determined. Solubilities of tetrafluoroethylene and propylene in water increase with pressure. solubility of propylene is larger than that of tetrafluoroethylene. Solubility of the mixed monomers in water and latex increases with pressure and propylene concentration and decreases with temperature. Propylene concentration in the dissolved monomers is dependent on its concentration in the gas phase and independent of pressure and temperature. The monomer concentrations and the composition were estimated from measurements. Under propylene concentration in the gas phase of 0 to 40 wt % at 30 Kg/cm 2 G and 40 0 C, the monomer concentration and propylene fraction of the polymer particle are 17 -- 27% and 0 -- 62% respectively. The amount of propylene in the particle increases with its fraction in the gas phase, but the amount of tetrafluoroethylene is independent of its fraction in the gas phase. Monomer composition of the polymer particle is dependent on monomer composition of the gas phase and independent of temperature and pressure. The concentration in the polymer particle is 17% at propylene concentration 10 mole % in the gas phase. (auth.)

  16. Effect of magnetic and thermal properties of iron oxide nanoparticles (IONs) in nitrile butadiene rubber (NBR) latex

    International Nuclear Information System (INIS)

    Ong, Hun Tiar; Julkapli, Nurhidayatullaili Muhd; Hamid, Sharifah Bee Abd; Boondamnoen, O.; Tai, Mun Foong

    2015-01-01

    Nitrile butadiene rubber (NBR) gloves are one of the most important personal protective equipments but they are possible to tear off and contaminate food or pharmaceutical and healthcare products during manufacturing and packaging process. High tendency of torn glove remaining in food or products due to white or light flesh-coloured glove is not easy to be detected by naked eyes. In this paper, iron oxide nanoparticles (IONs) selected as additive for NBR to improve its detectability by mean of magnetic properties. IONs synthesized via precipitation method and compounded with NBR latex before casting on petri dish. The properties of IONs were investigated by X-ray Diffractometry (XRD), Transmission Electron Microscope (TEM), Raman Spectroscopy and Vibrating Sample Magnetometer (VSM). Meanwhile NBR/IONs composites were studied by Thermogravimetry Analysis (TGA), Differential Scanning Calorimetry (DSC) and Vibrating Sample Magnetometer (VSM). It observed that, synthesized IONs shows of 25.28 nm crystallite with 25.86 nm semipherical (changed as) shape. Meanwhile, Magnetite and maghemite phase are found in range of 670 cm −1 and 700 cm −1 respectively, which it contributes magnetization saturation of 73.96 emu/g at 10,000 G by VSM. Thermal stability and magnetic properties were increased with incorporating IONs into NBR latex up to 20 phr. NBR/IONs 5 phr has the optimum thermal stability, lowest glass transition temperature (−14.83 °C) and acceptable range of magnetization saturation (3.83 emu/g at 10,000 G) to form NBR gloves with magnetic detectability. - Highlights: • We synthesized IONs with high magnetization saturation (M s ). • High M s of IONs were incorporated into NBR latex in order to induce magnetic properties in the NBR composite. • Introduction of IONs into NBR latex would improve thermal properties. • The produced NBR/IONs 5 phr composite exceeded the minimum magnetic moment sensor of the detector. • They have high potential for the

  17. Effect of magnetic and thermal properties of iron oxide nanoparticles (IONs) in nitrile butadiene rubber (NBR) latex

    Energy Technology Data Exchange (ETDEWEB)

    Ong, Hun Tiar; Julkapli, Nurhidayatullaili Muhd; Hamid, Sharifah Bee Abd, E-mail: sharifahbee@um.edu.my; Boondamnoen, O.; Tai, Mun Foong

    2015-12-01

    Nitrile butadiene rubber (NBR) gloves are one of the most important personal protective equipments but they are possible to tear off and contaminate food or pharmaceutical and healthcare products during manufacturing and packaging process. High tendency of torn glove remaining in food or products due to white or light flesh-coloured glove is not easy to be detected by naked eyes. In this paper, iron oxide nanoparticles (IONs) selected as additive for NBR to improve its detectability by mean of magnetic properties. IONs synthesized via precipitation method and compounded with NBR latex before casting on petri dish. The properties of IONs were investigated by X-ray Diffractometry (XRD), Transmission Electron Microscope (TEM), Raman Spectroscopy and Vibrating Sample Magnetometer (VSM). Meanwhile NBR/IONs composites were studied by Thermogravimetry Analysis (TGA), Differential Scanning Calorimetry (DSC) and Vibrating Sample Magnetometer (VSM). It observed that, synthesized IONs shows of 25.28 nm crystallite with 25.86 nm semipherical (changed as) shape. Meanwhile, Magnetite and maghemite phase are found in range of 670 cm{sup −1} and 700 cm{sup −1} respectively, which it contributes magnetization saturation of 73.96 emu/g at 10,000 G by VSM. Thermal stability and magnetic properties were increased with incorporating IONs into NBR latex up to 20 phr. NBR/IONs 5 phr has the optimum thermal stability, lowest glass transition temperature (−14.83 °C) and acceptable range of magnetization saturation (3.83 emu/g at 10,000 G) to form NBR gloves with magnetic detectability. - Highlights: • We synthesized IONs with high magnetization saturation (M{sub s}). • High M{sub s} of IONs were incorporated into NBR latex in order to induce magnetic properties in the NBR composite. • Introduction of IONs into NBR latex would improve thermal properties. • The produced NBR/IONs 5 phr composite exceeded the minimum magnetic moment sensor of the detector. • They have high

  18. Characteristics of Red Algae Bioplastics/Latex Blends under Tension

    Directory of Open Access Journals (Sweden)

    M. Nizar Machmud

    2013-10-01

    Full Text Available Cassava, corn, sago and the other food crops have been commonly used as raw materials to produce green plastics. However, plastics produced from such crops cannot be tailored to fit a particular requirement due to their poor water resistance and mechanical properties. Nowadays, researchers are hence looking to get alternative raw materials from the other sustainable resources to produce plastics. Their recent published studies have reported that marine red algae, that has been already widely used as a raw material for producing biofuels, is one of the potential algae crops that can be turned into plastics. In this work, Eucheuma Cottonii, that is one of the red alga crops, was used as raw material to produce plastics by using a filtration technique. Selected latex of Artocarpus altilis and Calostropis gigantea was separately then blended with bioplastics derived from the red algae, to replace use of glycerol as plasticizer. Role of the glycerol and the selected latex on physical and mechanical properties of the red algae bioplastics obtained under a tensile test performed at room temperature are discussed. Tensile strength of some starch-based plastics collected from some recent references is also presented in this paperDoi: 10.12777/ijse.5.2.81-88 [How to cite this article: Machmud, M.N., Fahmi, R.,  Abdullah, R., and Kokarkin, C.  (2013. Characteristics of Red Algae Bioplastics/Latex Blends under Tension. International Journal of Science and Engineering, 5(2,81-88. Doi: 10.12777/ijse.5.2.81-88

  19. A Latex Metabolite Benefits Plant Fitness under Root Herbivore Attack.

    Directory of Open Access Journals (Sweden)

    Meret Huber

    2016-01-01

    Full Text Available Plants produce large amounts of secondary metabolites in their shoots and roots and store them in specialized secretory structures. Although secondary metabolites and their secretory structures are commonly assumed to have a defensive function, evidence that they benefit plant fitness under herbivore attack is scarce, especially below ground. Here, we tested whether latex secondary metabolites produced by the common dandelion (Taraxacum officinale agg. decrease the performance of its major native insect root herbivore, the larvae of the common cockchafer (Melolontha melolontha, and benefit plant vegetative and reproductive fitness under M. melolontha attack. Across 17 T. officinale genotypes screened by gas and liquid chromatography, latex concentrations of the sesquiterpene lactone taraxinic acid β-D-glucopyranosyl ester (TA-G were negatively associated with M. melolontha larval growth. Adding purified TA-G to artificial diet at ecologically relevant concentrations reduced larval feeding. Silencing the germacrene A synthase ToGAS1, an enzyme that was identified to catalyze the first committed step of TA-G biosynthesis, resulted in a 90% reduction of TA-G levels and a pronounced increase in M. melolontha feeding. Transgenic, TA-G-deficient lines were preferred by M. melolontha and suffered three times more root biomass reduction than control lines. In a common garden experiment involving over 2,000 T. officinale individuals belonging to 17 different genotypes, high TA-G concentrations were associated with the maintenance of high vegetative and reproductive fitness under M. melolontha attack. Taken together, our study demonstrates that a latex secondary metabolite benefits plants under herbivore attack, a result that provides a mechanistic framework for root herbivore driven natural selection and evolution of plant defenses below ground.

  20. A Latex Metabolite Benefits Plant Fitness under Root Herbivore Attack.

    Science.gov (United States)

    Huber, Meret; Epping, Janina; Schulze Gronover, Christian; Fricke, Julia; Aziz, Zohra; Brillatz, Théo; Swyers, Michael; Köllner, Tobias G; Vogel, Heiko; Hammerbacher, Almuth; Triebwasser-Freese, Daniella; Robert, Christelle A M; Verhoeven, Koen; Preite, Veronica; Gershenzon, Jonathan; Erb, Matthias

    2016-01-01

    Plants produce large amounts of secondary metabolites in their shoots and roots and store them in specialized secretory structures. Although secondary metabolites and their secretory structures are commonly assumed to have a defensive function, evidence that they benefit plant fitness under herbivore attack is scarce, especially below ground. Here, we tested whether latex secondary metabolites produced by the common dandelion (Taraxacum officinale agg.) decrease the performance of its major native insect root herbivore, the larvae of the common cockchafer (Melolontha melolontha), and benefit plant vegetative and reproductive fitness under M. melolontha attack. Across 17 T. officinale genotypes screened by gas and liquid chromatography, latex concentrations of the sesquiterpene lactone taraxinic acid β-D-glucopyranosyl ester (TA-G) were negatively associated with M. melolontha larval growth. Adding purified TA-G to artificial diet at ecologically relevant concentrations reduced larval feeding. Silencing the germacrene A synthase ToGAS1, an enzyme that was identified to catalyze the first committed step of TA-G biosynthesis, resulted in a 90% reduction of TA-G levels and a pronounced increase in M. melolontha feeding. Transgenic, TA-G-deficient lines were preferred by M. melolontha and suffered three times more root biomass reduction than control lines. In a common garden experiment involving over 2,000 T. officinale individuals belonging to 17 different genotypes, high TA-G concentrations were associated with the maintenance of high vegetative and reproductive fitness under M. melolontha attack. Taken together, our study demonstrates that a latex secondary metabolite benefits plants under herbivore attack, a result that provides a mechanistic framework for root herbivore driven natural selection and evolution of plant defenses below ground.

  1. Nitrogen removal from concentrated latex wastewater by land treatment

    Directory of Open Access Journals (Sweden)

    Vikanda Thongnuekhang

    2004-05-01

    Full Text Available Most of the concentrated latex factories in the South of Thailand discharge treated wastewater that contains high level of nitrogen to a nearby river or canals leading to a water pollution problem. A study of land treatment system was conducted to treat and utilize nitrogen in treated wastewater from the concentrated latex factory. The experimental pilot-scale land treatment system was constructed at the Faculty of Engineering, Prince of Songkla University, Hat Yai Campus. It consisted of water convolvulus (Ipomea aquatica, I. Reptans, tropical carpet grass (Axonopus compresus (Swartz Beav. and control unit (no plantation. The treated wastewater from the stabilization pond system of the selected concentrated latex factoryin Songkhla was used to irrigate each experimental unit. Influent and effluent from the experimental units were analyzed for TKN, NH3-N, Org-N, NO3 --N, NO2 --N, BOD5, sulfate, pH and EC. The land treatment system resulted a high removal efficiency for nitrogen. Tropical carpet grass provided higher removal efficiency than other units for all parameters. The removal efficiency of water convolvulus and control unit were not significantly different. The average removal efficiency of TKN, NH3-N, Org-N, BOD5 and sulfate for tropical carpet grass unit were 92, 97, 61, 88 and 52%, for water convolvulus unit were 75, 80, 43, 41 and 30%, and for control unit were 74, 80, 41, 31 and 28%, respectively. Mass balance of nitrogen transformation was conducted. It revealed that plant uptake was the major mechanism for nitrogen removal in land treatment.

  2. Prevalence of Allergy to Natural Rubber Latex and Potential Cross Reacting Food in Operation Room Staff in Shiraz Hospitals -2006

    OpenAIRE

    H Nabavizade; R Amin

    2007-01-01

    Introduction & Objective: Allergic reactions to natural rubber latex have increased during past 10 years especially among health care workers and patients with high exposure to latex allergens. Allergic reaction to latex is related to many diseases like occupational asthma. This study was performed to determine the prevalence of allergy to natural rubber latex and potential cross reacting food in operation room staff in Shiraz hospitals. Materials & Methods: In this cross-sectional descr...

  3. Laboratory evaluation of a simple and rapid latex agglutination assay for the serodiagnosis of typhoid fever

    NARCIS (Netherlands)

    Abdoel, Theresia H.; Pastoor, Rob; Smits, Henk L.; Hatta, Mochammad

    2007-01-01

    A latex agglutination assay for the serodiagnosis of typhoid fever was evaluated on samples collected from patients with clinical suspicion of typhoid fever in South Sulawesi, Indonesia, where the disease is endemic. The latex assay is very easy to use, gives a rapid result and may be used as a

  4. Involvement of Ethylene in the Latex Metabolism and Tapping Panel Dryness of Hevea brasiliensis

    Science.gov (United States)

    Putranto, Riza-Arief; Herlinawati, Eva; Rio, Maryannick; Leclercq, Julie; Piyatrakul, Piyanuch; Gohet, Eric; Sanier, Christine; Oktavia, Fetrina; Pirrello, Julien; Kuswanhadi; Montoro, Pascal

    2015-01-01

    Ethephon, an ethylene releaser, is used to stimulate latex production in Hevea brasiliensis. Ethylene induces many functions in latex cells including the production of reactive oxygen species (ROS). The accumulation of ROS is responsible for the coagulation of rubber particles in latex cells, resulting in the partial or complete stoppage of latex flow. This study set out to assess biochemical and histological changes as well as changes in gene expression in latex and phloem tissues from trees grown under various harvesting systems. The Tapping Panel Dryness (TPD) susceptibility of Hevea clones was found to be related to some biochemical parameters, such as low sucrose and high inorganic phosphorus contents. A high tapping frequency and ethephon stimulation induced early TPD occurrence in a high latex metabolism clone and late occurrence in a low latex metabolism clone. TPD-affected trees had smaller number of laticifer vessels compared to healthy trees, suggesting a modification of cambial activity. The differential transcript abundance was observed for twenty-seven candidate genes related to TPD occurrence in latex and phloem tissues for ROS-scavenging, ethylene biosynthesis and signalling genes. The predicted function for some Ethylene Response Factor genes suggested that these candidate genes should play an important role in regulating susceptibility to TPD. PMID:26247941

  5. NR based curred latex material reclaimed with 2,2'-dibenzamidodiphenyldisulphide in truck tyre tread compound

    NARCIS (Netherlands)

    Rajan, V.V.; Dierkes, Wilma K.; Joseph, R.; Noordermeer, Jacobus W.M.

    2006-01-01

    It is observed that reclamation of natural rubber latex based rubber using 2,2'-dibenzamidodiphenyldisulphide as reclaiming agent is an optional methodology for recycling of waste latex rubber (WLR). For progressive replacement of virgin natural rubber by the reclaim, two alternatives curing system

  6. Thermodynamics of swelling of latex particles with two monomers: a sensitivity analysis

    NARCIS (Netherlands)

    Maxwell, I.A.; Noel, E.F.J.; Schoonbrood, H.A.S.; German, A.L.

    1993-01-01

    A sensitivity anal. is performed to det. at what conditions the simplified model for swelling of latex particles by two monomers or two solvents is valid. This model proposes that, inter alia, the fractions of two monomers in the latex particles and in the monomer droplets are equal. The model is a

  7. Towards anti-corrosion coatings from surfactant-free latexes based on maleic anhydride containing polymers

    NARCIS (Netherlands)

    Soer, W.J.; Ming, W.; Koning, C.E.; Benthem, van R.A.T.M.

    2008-01-01

    We report on the film formation of surfactant-free, artificial latexes based on copolymers containing maleic anhydride. Different metallic substrates, such as aluminum, steel and magnesium alloys, were coated with three different latexes. A commercial polyester based coating was used as a

  8. Residual monomer reduction in polymer latex products by extraction with supercritical carbon dioxide

    NARCIS (Netherlands)

    Aerts, M.; Meuldijk, J.; Kemmere, M.F.; Keurentjes, J.T.F.

    2011-01-01

    Extraction of residual monomer from a latex product with supercritical carbon dioxide ((sc)CO2) in a column was studied. Operating conditions were chosen at 35¿°C and 100 bar. For reducing the residual styrene level in a polystyrene latex from 104 ppm to 100¿ppm and from 104 ppm to 10¿ppm, a

  9. Elements of the LaTeX system for the development of large publications

    DEFF Research Database (Denmark)

    Andersen, Esben Sloth

    This document presents gives a quick overview over the LATEX system from the viewpoint of the production of books and complex papers. Thereby it provides the starting point for the author's selection of a set of LATEX packages and the development of related commands....

  10. Comparative evaluation of Type 1 latex hypersensitivity in patients with chronic urticaria, rubber factory workers and healthy control subjects

    NARCIS (Netherlands)

    Piskin, Gamze; Akyol, Aynur; Uzar, Hatice; Tulek, Necla; Boyvat, Ayse; Gurgey, Erbak

    2003-01-01

    Latex hypersensitivity manifests itself most commonly with contact urticaria. In this study, we investigated the frequency of latex hypersensitivity as a possible aetiological factor in patients with chronic urticaria (CU) and compared latex hypersensitivity of CU patients (n = 50) with that of

  11. A Reappraisal of Online Mathematics Teaching Using LaTeX

    Directory of Open Access Journals (Sweden)

    Eamon Costello

    2009-12-01

    Full Text Available The mathematics language LaTeX is often seen outside of academic circles as a legacy technology that is awkward to use. MathML - a verbose language designed for data-exchange, and to be written and understood by machines - is sometimes by contrast seen as something that will aid online mathematics and lack of browser support for it bemoaned. However LaTeX can already do many of the things that MathML might promise. LaTeX is here proposed as a language from which small fragments, with concise syntax, can be used by people to easily create and share mathematical expressions online. The capability to embed fragments of LaTeX code in online discussions is described here and its impact on a group of educators and learners evaluated. Here LaTeX is posited as a useful tool for facilitating asynchronous, online, collaborative learning of mathematics.

  12. Thrombin like activity of Asclepias curassavica L. latex: action of cysteine proteases.

    Science.gov (United States)

    Shivaprasad, H V; Rajesh, R; Nanda, B L; Dharmappa, K K; Vishwanath, B S

    2009-05-04

    To validate the scientific basis of plant latex to stop bleeding on fresh cuts. Cysteine protease(s) from Asclepias curassavica (Asclepiadaceae) plant latex was assessed for pro-coagulant and thrombin like activities. A waxy material from the latex of Asclepias curassavica latex was removed by freezing and thawing. The resulted latex enzyme fraction was assayed for proteolytic activity using denatured casein as substrate. Its coagulant activity and thrombin like activity were determined using citrated plasma and pure fibrinogen, respectively. Inhibition studies were performed using specific protease inhibitors to know the type of protease. The latex enzyme fraction exhibited strong proteolytic activity when compared to trypsin and exerted pro-coagulant action by reducing plasma clotting time from 195 to 58 s whereas trypsin reduced clotting time marginally from 195 to 155 s. The pro-coagulant activity of this enzyme fraction was exerted by selectively hydrolyzing A alpha and B beta subunits of fibrinogen to form fibrin clot when pure fibrinogen was used as substrate as assessed by fibrinogen-agarose plate method and fibrinogen polymerization assay. Trypsin failed to induce any fibrin clot under similar conditions. The electrophoretic pattern of latex enzyme fraction-induced fibrin clot was very much similar to that of thrombin-induced fibrin clot and mimic thrombin like action. The proteolytic activity including thrombin like activity of Asclepias curassavica latex enzyme fraction was completely inhibited by iodoaceticacid (IAA). Cysteine proteases from Asclepias curassavica latex exhibited strong pro-coagulant action and were found to be specific in its action (Thrombin like). This could be the basis for the use of plant latex in pharmacological applications that justify their use as folk medicine.

  13. Co-coagulation of the NBR latex and clay aqueous suspension: preparation and characterization;Co-coagulacao de latex de NBR e suspensao aquosa de argila: preparacao e caracterizacao

    Energy Technology Data Exchange (ETDEWEB)

    Reis, Raquel S.; Brum, Elisson; Silva, Vanessa M. [Nitriflex S/A Industria e Comercio, Rio de Janeiro, RJ (Brazil); Souza, Diego H.S.; Gomes, Ailton de S.; Nunes, Regina C.R., E-mail: rcnunes@ima.ufrj.b [Universidade Federal do Rio de Janeiro (IMA/UFRJ), RJ (Brazil). Inst. de Macromoleculas Profa. Eloisa Mano

    2009-07-01

    Blends of nitrile rubber (NBR) and sodium montmorillonite (MMT-Na) were prepared by co-coagulation of the NBR latex with aqueous suspension of clay. The content of MMT was varied from 0 to 7 phr and different mixtures were analyzed by X-ray diffraction, light scattering, gel content, thermogravimetric analysis and the oscillating disk rheometer. The different methods used indicated that there was formation of a structure interspersed in the mixtures studied, and that increasing the content MMT-Na enhances the values obtained. Rheological measurements on compositions with NBR showed the influence of clay on increasing the time of healing in terms of its content, as is the gel content and the thermal resistance. All results were compared to composition of NBR without MMT. (author)

  14. Cost evaluation of radiation vulcanization of natural rubber latex

    International Nuclear Information System (INIS)

    Makuuchi, K.

    2003-01-01

    Cost of radiation vulcanized NR latex was evaluated. The plant would be built in an existing dipping factory in an industrial area in a Southeast Asian country. One thousands dry tons of NR latex are vulcanized with a low energy electron accelerator. The electron accelerator is a self-shielding low energy type. The maximum accelerating voltage is 300 kV and the output power is 10 kW. The total construction cost of the plant is $400,000 including electron accelerator and other equipments. Costs of raw materials and utilities are $1.165 and $0.023 per one kg of product, respectively. The fixed costs of the plant consist of labor costs, labor overhead, maintenance, plant overhead, depreciation, and bank interest. It is $0.190/kg of product. The company overhead for operation including company management, R and D and insurance is $0.044/kg of product. Thus, the total production cost is estimated to be $1.422/kg of product. (author)

  15. Composites

    International Nuclear Information System (INIS)

    Kasen, M.B.

    1983-01-01

    This chapter discusses the roles of composite laminates and aggregates in cryogenic technology. Filamentary-reinforced composites are emphasized because they are the most widely used composite materials. Topics considered include composite systems and terminology, design and fabrication, composite failure, high-pressure reinforced plastic laminates, low-pressure reinforced plastics, reinforced metals, selectively reinforced structures, the effect of cryogenic temperatures, woven-fabric and random-mat composites, uniaxial fiber-reinforced composites, composite joints in cryogenic structures, joining techniques at room temperature, radiation effects, testing laminates at cryogenic temperatures, static and cyclic tensile testing, static and cyclic compression testing, interlaminar shear testing, secondary property tests, and concrete aggregates. It is suggested that cryogenic composite technology would benefit from the development of a fracture mechanics model for predicting the fitness-for-purpose of polymer-matrix composite structures

  16. Biochemical characterization of sap (latex) of a few Indian mango varieties.

    Science.gov (United States)

    John, K Saby; Bhat, S G; Prasada Rao, U J S

    2003-01-01

    Mango sap (latex) from four Indian varieties was studied for its composition. Sap was separated into non-aqueous and aqueous phases. Earlier, we reported that the non-aqueous phase contained mainly mono-terpenes having raw mango aroma (Phytochemistry 52 (1999) 891). In the present study biochemical composition of the aqueous phase was studied. Aqueous phase contained little amount of protein (2.0-3.5 mg/ml) but showed high polyphenol oxidase (147-214 U/mg protein) and peroxidase (401-561 U/mg protein) activities. It contained low amounts of polyphenols and protease activities. On native PAGE, all the major protein bands exhibited both polyphenol oxidase and peroxidase activities. Both polyphenol oxidase and peroxidase activities were found to be stable in the aqueous phase of sap at 4 degrees C. Sap contained large amount of non-dialyzable and non-starchy carbohydrate (260-343 mg/ml sap) which may be responsible for maintaining a considerable pressure of fluid in the ducts. Thus, the mango sap could be a valuable by-product in the mango industry as it contains some of the valuable enzymes and aroma components.

  17. Synthesis and characterization of fluorinated polyacrylate latex emulsified with novel surfactants.

    Science.gov (United States)

    Zhang, Cuifeng; Xu, Tingting; Bao, Zhongbin; Chen, Lijun

    2017-01-01

    The fluorinated polyacrylate latex were successfully prepared with semi- continuous seeded emulsion polymerization of butyl acrylate (BA), methyl methacrylate (MMA) and hexafluorobutyl methacrylate (HFMA) which was initiated with potassium persulfate (KPS) initiator and emulsified with the novel mixed surfactants of sodium lauryl glutamate (SLG) and alkylphenol ethoxylates (OP-10). The structure of the resultant latex was confirmed by Fourier transform infrared spectroscopy (FTIR). The particle size of the latex was measured by Zetatrac dynamic light scattering detector. The film of latex was tested by differential scanning calorimetry (DSC), thermogravimetric analysis (TGA) and contact angle (CA). The optimum conditions of preparing the novel fluorinated polyacrylate latex are optimized and the results are as follows: the amount of emulsifiers is 4.0%; mass ratio of SLG to OP-10 is 1:1, the amount of the initiator is 0.6%. The mass ratio of MMA to BA is 1:1 and the amount of HFMA is 7.0%. In this case, the conversion is high and the polymerization stability is good. In addition, the water resistance and thermal properties of the latex films were improved significantly in comparison with the film of the latex prepared without the fluorinated monomer.

  18. Plant latex: a promising antifungal agent for post harvest disease control.

    Science.gov (United States)

    Sibi, G; Wadhavan, Rashmi; Singh, Sneha; Shukla, Abhilasha; Dhananjaya, K; Ravikumar, K R; Mallesha, H

    2013-12-01

    Bioactive compounds from plant latex are potential source of antifungic against post harvest pathogens. Latex from a total of seven plant species was investigated for its phytochemical and antifungal properties. Six fungi namely Aspergillus fumigatus, A. niger, A. terreus, F. solani, P. digitatum and R. arrhizus were isolated from infected fruits and vegetables and tested against various solvent extracts of latex. Analysis of latex extracts with phytochemical tests showed the presence of alkaloids, flavonoids, glycosides, phenols, saponins, steroids, tannins and terpenoids. Antifungal assay revealed the potential inhibitory activity of petroleum ether extracts against the postharvest fungal isolates. Various degree of sensitivity was observed irrespective of plant species studied with A. terreus and P. digitatum as the most susceptible ones. F. solani and A. fumigatus were moderately sensitive to the latex extracts tested. Among the plants, latex of Thevetia peruviana (75.2%) and Artocarpus heterophyllus (64.8%) were having potential antifungal activity against the isolates followed by Manilkara zapota (51.1%). In conclusion, use of plant latex makes interest to control postharvest fungal diseases and is fitting well with the concept of safety for human health and environment.

  19. Antioxidant and sensitizer effect on the stability of natural rubber latex vulcanized by gamma rays

    International Nuclear Information System (INIS)

    Canavel, V.

    1993-01-01

    The natural rubber latex was vulcanized by gamma rays and electrons beam, in the presence and absence of sensitizer at room temperature. The sensitizers were the following; n-butyl acrylate (n-BA) / t-butyl hydroperoxide (t-B H) / KOH, C Cl 4 / potassium laurate and n-BA / KOH. The studied antioxidants, Irganox 1520, Vulcanox SP and Vulcanox BKF, were added to the latex after irradiation. Among the studied antioxidants in function of tensile strength (TS) after the aging of rubber plates, the Irganox was the best efficient on the gamma vulcanization in the presence of n-BA/t-B H/KOH, because only 0,20 p hr is enough to obtain the greatest increase of TS, that was 34%, 12 MPa to 16 MPa. The formulating method of latex with the sensitizer constituted the 3,0 p hr of n-BA/ 0,1 p hr of t-B H and 0,2 p hr of KOH, was evaluated respecting the TS of rubber plates. The electrons beam vulcanization produces the greatest reversible perturbance in the colloidal stability of latex after irradiation caused by radiolytic species absorption that promotes the increase of particle size. The antioxidant also contributes to reversible destabilization of gamma irradiated latex, because it is also adsorbed by particles surface. The relation between the latex viscosity and the TS of respective rubber plates is reverse, showing the latex stability affects the quality of rubber goods. (author)

  20. Aggregation and charging of sulfate and amidine latex particles in the presence of oxyanions.

    Science.gov (United States)

    Sugimoto, Takuya; Cao, Tianchi; Szilagyi, Istvan; Borkovec, Michal; Trefalt, Gregor

    2018-08-15

    Electrophoretic mobility and time resolved light scattering are used to measure the effect on charging and aggregation of amidine and sulfate latex particles of different oxyanions namely, phosphate, arsenate, sulfate, and selenate. In the case of negatively charged sulfate latex particles oxyanions represent the coions, while they represent counterions in the case of the positively charged amidine latex. Repulsive interaction between the sulfate latex surface and the coions results in weak ion specific effects on the charging and aggregation. On the other hand the interaction of oxyanions with the amidine latex surface is highly specific. The monovalent dihydrogen phosphate ion strongly adsorbs to the positively charged surface and reverses the charge of the particle. This charge reversal leads also to the restabilization of the amidine latex suspension at the intermediate phosphate concentrations. In the case of dihydrogen arsenate the adsorption to amidine latex surface is weaker and no charge reversal and restabilization occurs. Similar differences are seen between the sulfate and selenate analogues, where selenate adsorbs more strongly to the surface as compared to the sulfate ion and invokes charge reversal. The present results indicate that ion specificity is much more pronounced in the case of counterions. Copyright © 2018 Elsevier Inc. All rights reserved.

  1. Preparation of irradiated natural rubber latex-styrene copolymer for electrical gloves

    International Nuclear Information System (INIS)

    Made Sumarti Kardha

    2010-01-01

    Research on irradiated natural rubber latex-styrene copolymer to prepare electrical glove have been done. Vulcanization of natural rubber latex (NRL) was done by mixing 2 phr (per hundred of rubber) of normal butyl acrylate (n-BA) emulsion then irradiated with ã-ray "6"0Co at the dose of 30 kGy producing irradiated natural rubber latex (INRL). Natural rubber latex-styrene copolymers (SC) were prepared by mixing NRL and styrene monomer at styrene concentrations of 50 phr, 75 phr, 100 phr, 500 phr and irradiated at the doses of 15 kGy, 30 kGy and 45 kGy, then characterized their latex and film properties to obtain optimum SC of SC50. This optimum SC, SC50 then mixed with IRNL at the weight ratio of 0/100, 30/70, 50/50, 70/30 and 100/0, to produce irradiated natural rubber latex-styrene copolymer. The properties of copolymer rubber films made by dipping process i.e., % conversion, total solid content, latex viscosity, tensile strength, modulus 300 %, elongation at break, electrical resistance and dielectric constant were then characterized. Characterization result showed that (INRL-SC50) with 50/50 ratio irradiated at the dose of 30 kGy, have % conversion of 80.93 %, electrical resistivity of 1.73 x 10"1"4 Ohm cm and dielectric constant of 2.76 which fulfill the requirement as material for electrical gloves. (author)

  2. Investigation of non-isocyanate urethane functional latexes and carbon nanofiller/epoxy coatings

    Science.gov (United States)

    Meng, Lei

    This dissertation consists of two parts. In the first part, a new class of non-isocyanate urethane methacrylates was synthesized and the effect of the new monomers on the urethane functional latex was investigated. The second part focused on a comparison of carbon nanofillers in inorganic/organic epoxy coating system for anticorrosive applications. A new class of non-isocyanate urethane methacrylates (UMAs) monomers was synthesized through an environmentally friendly non-isocyanate pathway. The kinetics of seeded semibatch emulsion polymerization of UMAs with methyl methacrylate (MMA) and butyl acrylate (BA) was monitored. The particle size and morphology were investigated by dynamic light scattering (DLS), ultrasound acoustic attenuation spectroscopy (UAAS) and transmission electron microscopy (TEM). The minimum film formation temperature (MFFT), mechanical and viscoelastic properties were studied. It was found that the emulsion polymerization processes all proceeded via Smith-Ewart control, leading to the uniform morphology and particle size. The glass transition temperature (Tg) and the mechanical properties of poly(MMA/BA/UMA) decreased with the increasing chain length of urethane methacrylate monomers due to the increasing flexibility of side chains. Without the effect of Tg, lower MFFT and improved mechanical properties were observed from urethane functional latexes. The improved mechanical properties were due to the increasing particle interaction by forming hydrogen bonding. Furthermore, the effect of urethane functionality in terms of the polymer composition, the location and the concentration was investigated by the batch, single-stage and two-stage semibatch polymerization of 2-[(butylcarbamoyl)oxy]ethyl methacrylate (BEM) with MMA and BA. The core-shell and homogeneous structures were evaluated by TEM, differential scanning calorimetry (DSC), and solid state nuclear magnetic resonance (SS-NMR). The compositional drift was observed from the batch

  3. Comparing the level of dexterity offered by latex and nitrile SafeSkin gloves.

    Science.gov (United States)

    Sawyer, Jo; Bennett, Allan

    2006-04-01

    An increase in the occurrence of latex allergy has been concurrent with the increasing use of latex gloves by laboratory and healthcare workers. In recent years nitrile gloves have been used to replace latex gloves to prevent latex allergy. Nitrile gloves offer a comparable level of protection against chemical and biological agents and are more puncture resistant. However, if manual dexterity is compromised by nitrile gloves to a greater degree than latex then this may increase the risk of sharps injuries. The Purdue pegboard test, which measures both gross and fine finger dexterity, was used to test the dexterity levels of two glove types used at HPA CEPR; Kimberly-Clark SafeSkin nitrile and latex laboratory gloves. There was a statistically significant 8.6% increase in fine finger dexterity provided by latex compared with nitrile SafeSkin laboratory gloves but no difference in gross dexterity between the glove types. There was no significant relationship between glove dexterity and age or gender. The selection of glove size was influenced by the digit length of participants. Moreover, those with longer, thinner fingers appeared to have an advantage when using nitrile SafeSkin gloves. The level of dexterity provided by latex and nitrile SafeSkin gloves for tasks on a gross dexterity level are comparable and health workers will benefit from the non-allergenic properties of nitrile. For tasks requiring fine finger dexterity nitrile SafeSkin gloves may impede dexterity. Despite this, the degree of restriction appears to have a negligible impact on safety in this study when compared with the risk of latex sensitization and subsequent allergy. In addition to glove material, working practices must also take into account glove size, fit, grip and thickness, as these factors can all influence dexterity.

  4. Composition

    DEFF Research Database (Denmark)

    Bergstrøm-Nielsen, Carl

    2011-01-01

    Strategies are open compositions to be realised by improvising musicians. See more about my composition practise in the entry "Composition - General Introduction". Caution: streaming the sound files will in some cases only provide a few minutes' sample. Please DOWNLOAD them to hear them in full...

  5. Composition

    DEFF Research Database (Denmark)

    2014-01-01

    Memory Pieces are open compositions to be realised solo by an improvising musicians. See more about my composition practise in the entry "Composition - General Introduction". Caution: streaming the sound files will in some cases only provide a few minutes' sample. Please DOWNLOAD them to hear them...

  6. Latex-modified grouts for in-situ stabilization of buried transuranic/mixed waste

    International Nuclear Information System (INIS)

    Allan, M.L.

    1996-06-01

    The Department of Applied Science at Brookhaven national Laboratory was requested to investigate latex-modified grouts for in-situ stabilization of buried TRU/mixed waste for INEL. The waste exists in shallow trenches that were backfilled with soil. The objective was to formulate latex-modified grouts for use with the jet grouting technique to enable in-situ stabilization of buried waste. The stabilized waste was either to be left in place or retrieved for further processing. Grouting prior to retrieval reduces the potential release of contaminants. Rheological properties of latex-modified grouts were investigated and compared with those of conventional neat cement grouts used for jet grouting

  7. Glove powder's carrying capacity for latex protein: analysis using the ASTM ELISA test.

    Science.gov (United States)

    Beezhold, D; Horton, K; Hickey, V; Daddona, J; Kostyal, D

    2003-01-01

    Glove donning powders carry latex proteins and disperse them into the workplace environment. We have used the ASTM D6499 ELISA to quantify the amount of latex antigen bound to and carried by glove powders. We could differentiate between a small amount of protein actually bound to the powders and a larger amount carried by the powder. Enhanced binding of a major allergen, Hev b 5, to the starch powders was demonstrated by Western blot. The D6499 ELISA is able to measure total latex antigen, soluble and powder bound, simultaneously without the need to centrifuge the samples.

  8. Binding kinetics of magnetic nanoparticles on latex beads and yeast cells studied by magnetorelaxometry

    International Nuclear Information System (INIS)

    Eberbeck, Dietmar; Bergemann, Christian; Hartwig, Stefan; Steinhoff, Uwe; Trahms, Lutz

    2005-01-01

    The ion exchange mediated binding of magnetic nanoparticles (MNP) to modified latex spheres and yeast cells was quantified using magnetorelaxometry. By fitting subsequently recorded relaxation curves, the kinetics of the binding reactions was extracted. The signal of MNP with weak ion exchanger groups bound to latex and yeast cells scales linearly with the concentration of latex beads or yeast cells whereas that of MNP with strong ion exchanger groups is proportional to the square root of concentration. The binding of the latter leads to a much stronger aggregation of yeast cells than the former MNP

  9. Study on irradiation condition in radiation vulcanization of natural rubber latex

    International Nuclear Information System (INIS)

    Zhu Nankang; Wang Chunlei; Makuuchi, K.; Yoshii, F.

    1996-01-01

    The effect of gamma rays irradiation dose rates on RVNRL preparation was studied using Malaysian latex added with O.2 phr of KOH and 5 phr n-BA. The results showed, to ensure the tensile strength of the latex film meet the requirement, when applying vulcanisation doses, Dv of 20 kGy 20 and 15 kGy, irradiation dose rates should not be greater than 0. 49 kGy/hr and 1. 6 kGy/hr respectively. Its was found that within the storage time of 20 days there was no change in the physical properties of the latex films

  10. Optical response of a flat metallic surface coated with a monolayer array of latex spheres

    International Nuclear Information System (INIS)

    Shi Lei; Liu Xiaohan; Yin Haiwei; Zi Jian

    2010-01-01

    We report on the fabrication, characterization and simulation of a structure consisting of a flat metallic surface coated with a monolayer array of latex spheres. This structure shows interesting optical response: over flat metallic surfaces a series of reflection minima appear in reflection spectra. Numerical simulations revealed that the structure can support two types of surface modes: surface plasmon-polaritons bound at the metallic surface and guided modes confined to the array of latex spheres, or their hybrids. Both experimental and theoretical results indicated that these surface modes show well-defined band structures due to the introduced periodicity by the monolayer array of latex spheres.

  11. Validation for radiation sterilization of surgical latex glove

    International Nuclear Information System (INIS)

    Liu Degui

    2002-01-01

    Objective: To determine the optimal radiation mode for sterilization of surgical latex gloves. Methods: The dose distribution in the product loads inside radiation container was measured in different radiation mode. Results: Data of dose distribution in the product load in different radiation mode were obtained. Conclusion: At pre-set height of source working position and within pre-determined dwelling time of each irradiation container staying at the irradiation position, the delivered dose can meet the customers requirement by the radiation mode that, in the half cycle of radiation process, turns the horizontal middle layers of the product to the upper or lower layers, and the upper and lower layers to the middle layers

  12. A New Prenylated Xanthone from Latex of Garcinia cowa Roxb.

    Directory of Open Access Journals (Sweden)

    Zhi Na

    2013-05-01

    Full Text Available A new prenylated xanthone, 1,6-dihydroxy-3,7-dimethoxy-2-(3,7-dimethyloct-2,6-dienyl xanthone (3-O-methylcowaxanthone (1, together with four known xanthones, cowaxanthone (2, 7-O-methylgarcinone (3, α-mangostin (4 and γ-mangostin (5 were isolated from the latex of Garcinia cowa. The structure of compound 1 was elucidated on the basis of spectroscopic data interpretation, including 1D and 2D NMR and HREIMS. The cytotoxic activitiy of 1 against five human cancer cell lines, HL-60, SMMC-7721, A-549, MCF-7 and SW480, was evaluated, but it was inactive (IC 50>40μM.

  13. Purification of papain from fresh latex of Carica papaya

    Directory of Open Access Journals (Sweden)

    Rubens Monti

    2000-01-01

    Full Text Available In the present study we wish to report a method of crystallizing papain from fresh papaya latex which gave higher yields than previously reported. This method does not involve the use of sulphydryl reagents. The papain thus obtained is practically pure and shows a single band when submitted to electrophoresis on polyacrylamide gel, and is identical to the papain obtained by other methods. In routine enzymatic assays, specific activity was measured using Z-gly-pNP and BAEE as substrates. Papain crystallized by this method, without the use of high concentrations of salts or thiol-containing substances such as cysteine and dithiothreitol, is obtained in the form of a complex with natural inhibitors existent in latex which can be removed by dialysis.No presente trabalho apresenta-se um método de cristalização da papaína oriunda do látex fresco de mamão, o qual apresenta uma alta produtividade em relação aos métodos previamente descritos. A metodologia aqui descrita não envolve o uso de reagentes sulfidrílicos, a papaína foi obtida de forma praticamente pura, apresentando uma simples banda quando submetida a eletroforese, e com propriedades idênticas àquelas obtidas por outros métodos. A atividade específica foi determinada utilizando Z-gly-pNP e BAEE como substrato. A papaína obtida por essa metodologia, sem uso de substâncias tais como cisteína e ditiotreitol, apresenta-se na forma de um complexo com inibidores naturais, os quais podem ser removidos por diálise.

  14. Maillard Reaction in Natural Rubber Latex: Characterization and Physical Properties of Solid Natural Rubber

    Directory of Open Access Journals (Sweden)

    S. Montha

    2016-01-01

    Full Text Available Maillard reaction in Natural Rubber (NR latex was investigated by treating fresh NR latex with glutaraldehyde (C5H8O2 in amounts of 0, 50, 100, and 200 mmol/kg of latex. Protein cross-linking in fresh NR latex and solid NR was confirmed by using sodium dodecylsulfate polyacrylamide gel electrophoresis (SDS-PAGE and attenuated total reflection infrared (ATR-IR spectroscopy, respectively. It was found that degree of protein cross-linking in NR increased with increasing C5H8O2 concentration. Physical properties of untreated and treated NR substances in terms of gel content, initial Wallace plasticity (P0, plasticity retention index (PRI, Mooney viscosity, and tensile strength were carefully explored. Results clearly showed that the Maillard cross-linking of proteins had remarkable effect on bulk NR properties, that is, solvent resistance, hardness, resistance to oxidation, rheological behavior, and resistance to stretching out.

  15. Evaluation of apparent viscosity of Para rubber latex by diffuse reflection near-infrared spectroscopy.

    Science.gov (United States)

    Sirisomboon, Panmanas; Chowbankrang, Rawiphan; Williams, Phil

    2012-05-01

    Near-infrared spectroscopy in diffuse reflection mode was used to evaluate the apparent viscosity of Para rubber field latex and concentrated latex over the wavelength range of 1100 to 2500 nm, using partial least square regression (PLSR). The model with ten principal components (PCs) developed using the raw spectra accurately predicted the apparent viscosity with correlation coefficient (r), standard error of prediction (SEP), and bias of 0.974, 8.6 cP, and -0.4 cP, respectively. The ratio of the SEP to the standard deviation (RPD) and the ratio of the SEP to the range (RER) for the prediction were 4.4 and 16.7, respectively. Therefore, the model can be used for measurement of the apparent viscosity of field latex and concentrated latex in quality assurance and process control in the factory.

  16. Proceedings of the international symposium on radiation vulcanization of natural rubber latex

    International Nuclear Information System (INIS)

    Machi, Sueo

    1990-01-01

    The First International Symposium on Radiation Vulcanization of Natural Rubber Latex (RVNRL) was held from 26 to 28 July 1989 at Tokyo and Takasaki. In these proceedings, thirty six papers presented at the Symposium are compiled. Main topics are commercial application of RVNRL, characterization of NR latex and vulcanization, properties of radiation vulcanized NR latex, development of sensitizers, mechanism of RVNRL, RVNRL with electron beams, and new Co-60 irradiator for RVNRL. Absence of nitrosamines and low cytotoxicity of radiation vulcanized NR latex are recognized as the remarkable advantages of RVNRL. The radiation vulcanization process for the production of protective rubber gloves for radioactive contamination was presented as the first commercial success in RVNRL. It was reported that various kinds of rubber articles for medical uses have being developed in West Germany. A sensitizer system consisting of n-butyl acrylate and t-butyl hydroperoxide was found to reduce the vulcanization dose to 8 kGy. (author)

  17. Latex glove sensitivity amongst diagnostic imaging healthcare personnel: a self-reporting investigation

    International Nuclear Information System (INIS)

    Healy, Jan; Brennan, Patrick C.; Bowden, Julie Anne

    2003-01-01

    The use of latex gloves has risen dramatically among healthcare workers resulting in an increase in the number of workers experiencing reactions to gloves. Little evidence of reactions among Irish healthcare workers is available. The current, self-reporting study investigated the prevalence to latex gloves amongst four professional groups within three Diagnostic Imaging Departments. Prevalence is similar to that demonstrated elsewhere with 18.3% of individuals expressing latex associated symptoms. Symptoms included itching and redness of hands, dry cracked skin, soreness of eyes and upper respiratory tract complaints. These results indicate that latex hypersensitivity is a real problem amongst Irish healthcare workers. This preliminary work provides the basis of a much larger controlled study currently being planned

  18. Effect of gamma radiation dose and sensitizer on the physical properties of irradiated natural rubber latex

    International Nuclear Information System (INIS)

    Komgrit, R.; Thawat, C.; B, Tripob; Wirach, T.

    2009-07-01

    Full text: The vulcanization of natural rubber latex can be induced by gamma radiation, which enhances cross-linking within the rubber matrix. The purpose of this research is to investigate the effect of gamma radiation dose and sensitizers on the physical properties of irradiated natural rubber. Three sensitizers n-butyl acrylate (n-B A), tetrachloroethylene (C 2 Cl 4 ) and trichloromethane (CHCl 3 ) were mixed with natural rubber latex before irradiation with gamma ray dose varied from 14 to 22 kGy. Results showed that the mixture of three sensitizers with specific ratios effectively induced the cross-linking of natural rubber latex. The cross-linking ratio and improved physical properties increased with increasing gamma dose. Therefore, the mixture ratios of n-B A, C 2 Cl 4 and CHCl 3 have shown to be a critical parameter in the vulcanization of natural rubber latex by gamma radiation

  19. A LaTeX graphics routine for drawing Feynman diagrams

    International Nuclear Information System (INIS)

    Levine, M.J.S.

    1990-01-01

    FEYNMAN is a LaTeX macropackage which allows the user to construct a versatile range of Feynman diagrams within the text of a document. Diagrams of publication quality may be drawn with relative ease and rapidity. (orig.)

  20. Polylactide/Montmorillonite Hybrid Latex as a Barrier Coating for Paper Applications

    Directory of Open Access Journals (Sweden)

    Davide Bandera

    2016-03-01

    Full Text Available We developed a paper coating for the potential application in food packaging based on polylactide and montmorillonite. It is applied to the paper in the form of a stable, water-based latex with a solid content of 25–28 wt %. The latex is prepared from a commercially available polylactide, surfactants, montmorillonite, a plasticizer, chloroform (to be removed later and water by an emulsion/solvent evaporation procedure. This coating formulation is applied to the paper substrate by bar-coating, followed by hot-pressing at 150 °C. The coated papers achieved up to an 85% improvement in water vapor transmission rates when compared to the pristine papers. The coating latex is prepared from inexpensive materials and can be used for a solvent-free coating process. In addition, the ingredients of the latex are non-toxic; thus, the coated papers can be safely used for food packaging.

  1. Formation of Defect-Free Latex Films on Porous Fiber Supports

    KAUST Repository

    Lively, Ryan P.; Mysona, Joshua A.; Chance, Ronald R.; Koros, William J.

    2011-01-01

    a defect-free lumen-side barrier layer can be created. Film experiments examined the effect of drying rate, latex age, substrate porosity (porous vs nonporous), and substrate hydrophobicity/ hydrophilicity. Film studies show that in ideal conditions

  2. Radiation vulcanization of natural rubber latex (NRL) using low energy electron beam accelerator

    International Nuclear Information System (INIS)

    Feroza Akhtar; Keizo Makuuchi; Fumio Yoshii

    1996-01-01

    The electron beam induced vulcanization of natural rubber latex has been studied using low energy Electron Beam (EB) accelerators of 300, 250 and 175 keV ne latex was irradiated in a special type stainless steel reaction reactor with a stirrer at the bottom of the reactor. From the results it was found that 300 and 250 keV accelerators could effectively vulcanize NRL. But accelerator of 175 keV is too low energy to vulcanize the latex. At the same time a drum type irradiator where thin layer of NRL was irradiated by accelerator, was used for vulcanization of NRL. This type of irradiator also showed good physical properties of vulcanized latex. The effects of beam current and stirrer speed on vulcanization were studied

  3. Effect of heterogeneous distribution of crosslink density on physical properties of radiation vulcanized NR (Natural Rubber) latex film

    International Nuclear Information System (INIS)

    Keizo Makuuchi; Fumio Yoshii; Miura, H.; Murakami, K.

    1996-01-01

    Thus a study has been carried out to investigate the effect of particle to particle variation in crosslink density on physical properties of radiation vulcanized NR latex film. NR latex was irradiated in small bottle by γ rays without vulcanization accelerator to provide latex rubber particles having homogeneous distribution of crosslink density. The doses were 30, 50, 100, 250, 300, 400, 500 and 600 kGy. Weight swelling ratio, gel fraction, tensile strength and elongation at break of the latex film from the mixed latex were measured. The vulcanization dose of this latex was 250 kGy. Then the two different latexes were mixed in a such way to adjust the average dose of 250 kGy to prepare a latex consisting of rubber particles having heterogeneous distribution of crosslink density. Tensile strength of the latex film was depressed by mixing. The reduction increased with increasing the decrease of gel fraction by mixing. However the reduction was not serious when the dose difference of two latexes was less than 200 kGy

  4. Graft Copolymerization of Methyl Methacrylate Monomer onto Starch and Natural Rubber Latex Initiated by Gamma Irradiation

    Directory of Open Access Journals (Sweden)

    S. Iskandar

    2011-04-01

    Full Text Available To obtain the degradable plastic, the graft copolymerization of methyl methacrylate onto starch and natural rubber latex was conducted by a simultaneous irradiation technique. Gamma-ray from cobalt-60 source was used as the initiator. The grafted copolymer of starch-polymethyl methacrylate and the grafted copolymer of natural rubber-polymethyl methacrylate were mixed in the blender, and dried it in the oven. The dried grafted copolymer mixture was then molded using hydraulic press machine. The effect of irradiation dose, composition of the grafted copolymer mixture, film forming condition and recycle effect was evaluated. The parameters observed were tensile strength, gel fraction and soil burial degradability of grafted copolymer mixture. It was found that the tensile strength of grafted copolymer mixture increased by -ray irradiation. Increasing of the grafted copolymer of natural rubber-polymethyl methacrylate content, the gel fraction and tensile strength of the grafted copolymer mixture increased. The tensile strength of the grafted copolymer mixture was increased from 18 MPa to 23 MPa after recycled (film forming reprocessed 3 times. The grafted copolymer mixture was degraded completely after soil buried for 6 months

  5. Prevalence of Allergy to Natural Rubber Latex and Potential Cross Reacting Food in Operation Room Staff in Shiraz Hospitals -2006

    Directory of Open Access Journals (Sweden)

    H Nabavizade

    2007-07-01

    Full Text Available Introduction & Objective: Allergic reactions to natural rubber latex have increased during past 10 years especially among health care workers and patients with high exposure to latex allergens. Allergic reaction to latex is related to many diseases like occupational asthma. This study was performed to determine the prevalence of allergy to natural rubber latex and potential cross reacting food in operation room staff in Shiraz hospitals. Materials & Methods: In this cross-sectional descriptive study five hundred eighty operation room staff of ten private and state hospitals in Shiraz completed latex allergy questionnaire. They were questioned about personal history and previous history of latex sensitivity, symptoms of latex reactivity and about other allergies particularly to foods that may cross react with latex. Informed consent was obtained and skin prick testing was performed with natural rubber latex. Skin prick tests were done with three potentially cross reacting food (banana, Kiwi, and potato. The obtained data were analyzed with SPSS software and Chi-square test. Results: Among the 580 operation room workers 104 (17.9 % of participants were positive to latex skin test. We found a significant association between positive skin test to latex in operation room staff and atopy, urticaria and food allergy. Positive skin test to latex related to positive kiwi skin test (p<0.05. The prevalence did not vary by sex, age, education, surgical and non surgical glove users, history of contact dermatitis or smoking status. Conclusion: Latex allergy has a high prevalence in personnel of operation room. Evaluation of present symptom and prediction of future disease necessitate screening test in individuals at risk.

  6. Latex allergy and occupational asthma in health care workers: adverse outcomes.

    OpenAIRE

    Amr, Sania; Bollinger, Mary E.

    2004-01-01

    The prevalence of natural rubber latex (NRL) allergy has been estimated to be 5-18% in health care workers, and latex exposure has been one of the leading causes of occupational asthma in the last several years. We present the cases of two nurses who developed sensitivity to NRL, both with dermatologic symptoms and respiratory symptoms that included asthma. They were referred to the University of Maryland for evaluation of their allergies, then for occupational and environmental consults. The...

  7. Test trial radiation vulcanization of natural rubber latex in Jakarta Indonesia

    International Nuclear Information System (INIS)

    Devendra, R.; Kulatunge, S.S.; Chandralal, H.N.K.K.; Kalyani, N.M.V.; Seneviratne, J.; Wellage, S.

    1994-01-01

    Radiation vulcanization of natural rubber latex (RVNRL) can be used to make large quantities of specially stabilized latex. It is possible to obtain RVNRL films of tensile strength over 25 MPa. The films could be either coagulant dipped or cast. It is very important to determine the correct radiation dose which gives the maximum tensile strength. Cross linking density or prevulcanized relax modulus (PRM) at 100% is a reliable property to control the prevulcanization

  8. Soybean oil in water-borne coatings and latex film formation study by AC impedance

    Science.gov (United States)

    Jiratumnukul, Nantana

    Conventional coalescing agents such as butyl cellosolve, butyl carbitol, and TexanolRTM are widely use in the latex coatings industry to facilitate film formation at ambient temperature. Coalescent aids are composed of solvents with low evaporation rates. After water evaporates, coalescent aids would help soften polymer molecules and form continuous films, then gradually evaporates from the film. Coalescent aids, therefore, are considered as volatile organic compounds (VOC), which are of environmental concern. The main purpose of this research project was to prepare a fatty acid glycol ester from soybean oil and glycol (polyols). The soybean oil glycol ester can be used as a coalescent aid in latex paint formulation. The soybean oil glycol ester not only lowered the minimum film formation temperature of latex polymers and continuous film formed at ambient temperature, but also after it has facilitated film formation, does not substantially evaporate, but becomes part of the film. Soybean oil glycol esters, therefore, can reduce the VOC levels and facilitate film formation of latex paints. In the second part of this research AC-Impedance was used to investigate the efficiency of soybean oil coalescent aid in latex film formation relative to the conventional ones. The coating resistance showed that the efficiency of film formation was increased as a function of dry time. The coating resistance also exhibited the effect of soybean oil ester in latex film formation in the same fashion as a conventional coalescent aid, TexanolRTM.

  9. Use of micrometric latex beads to improve the porosity of hydroxyapatite obtained by chemical coprecipitation method

    Science.gov (United States)

    Webler, G. D.; Rodrigues, W. C.; Silva, A. E. S.; Silva, A. O. S.; Fonseca, E. J. S.; Degenhardt, M. F. S.; Oliveira, C. L. P.; Otubo, L.; Barros Filho, D. A.

    2018-04-01

    Hydroxyapatite is one of the most important biomaterials whose application mainly extends to implants and drug delivery. This work will discuss the changes in the pore size distribution of hydroxyapatite when there are latex beads present during the synthesis. These changes were monitored using different techniques: small angle X-ray scattering, X-ray diffraction, thermal gravimetrical analysis, N2 adsorption, scanning and transmission electron microscopy. Latex beads and hydroxyapatite form a single nanocomposite with well-distinguished inorganic and organic phases. Latex bead removal in the temperature range of 300-600 °C did not modify the original crystalline structure of hydroxyapatite. However, the latex beads favored an increase in the adsorption capacity of mesopores at temperatures higher than their glassy transition (Tg). The main result of this research work consists on the increase of surface area and pore size distribution obtained after the removal of latex beads template. Latex beads have been used in a different approach changing the porosity of hydroxyapatite scaffolds not only introducing new routes for cell integration but also broadening the pore size distribution which can result in a more high efficiency for drug release in living cells.

  10. Biodegradability and aging study of rubber films obtained by gamma radiation vulcanization processes of latex

    International Nuclear Information System (INIS)

    Martins, Carlos Felipe Pinto

    2005-01-01

    The natural rubber latex (NRL) is industrially crosslinked by the conventional process of vulcanization, which uses sulphur and heat. Otherwise, the network can also be done by the alternative process with ionizing radiation. In this work the crosslinking of NRL was studied by the comparison of the conventional vulcanization system and the ionizing radiation process of 60 C source. The products obtained, the irradiated latex, the irradiated latex with approximately 1% of soy lecithin and the sulphur vulcanized latex were tested by accelerated aging with ultraviolet (UV) and outdoor aging with compostage, tensile strength at break, swelling and gel fraction, fungi micro biota, scanning electron microscopy (SEM), infrared spectroscopy (FTIR) and thermogravimetry and differential scanning calorimetry analysis (TG and DSC). The results showed that the aging with microorganisms have a great influence in the physical properties of the samples. The thermal stability order observed showed that the sulphur vulcanized latex is more resistant, what is probably associated to a network more stable under the aging conditions. On the other hand, the irradiated latex showed intense biodegradation aspects, particularly with the presence of the soy lecithin. (author)

  11. Capacitance Regression Modelling Analysis on Latex from Selected Rubber Tree Clones

    International Nuclear Information System (INIS)

    Rosli, A D; Baharudin, R; Hashim, H; Khairuzzaman, N A; Mohd Sampian, A F; Abdullah, N E; Kamaru'zzaman, M; Sulaiman, M S

    2015-01-01

    This paper investigates the capacitance regression modelling performance of latex for various rubber tree clones, namely clone 2002, 2008, 2014 and 3001. Conventionally, the rubber tree clones identification are based on observation towards tree features such as shape of leaf, trunk, branching habit and pattern of seeds texture. The former method requires expert persons and very time-consuming. Currently, there is no sensing device based on electrical properties that can be employed to measure different clones from latex samples. Hence, with a hypothesis that the dielectric constant of each clone varies, this paper discusses the development of a capacitance sensor via Capacitance Comparison Bridge (known as capacitance sensor) to measure an output voltage of different latex samples. The proposed sensor is initially tested with 30ml of latex sample prior to gradually addition of dilution water. The output voltage and capacitance obtained from the test are recorded and analyzed using Simple Linear Regression (SLR) model. This work outcome infers that latex clone of 2002 has produced the highest and reliable linear regression line with determination coefficient of 91.24%. In addition, the study also found that the capacitive elements in latex samples deteriorate if it is diluted with higher volume of water. (paper)

  12. Latex Rubber Gloves as a Sampling Dosimeter Using a Novel Surrogate Sampling Device.

    Science.gov (United States)

    Sankaran, Gayatri; Lopez, Terry; Ries, Steve; Ross, John; Vega, Helen; Eastmond, David A; Krieger, Robert I

    2015-01-01

    Pesticide exposure during harvesting of crops occurs primarily to the workers' hands. When harvesters wear latex rubber gloves for personal safety and hygiene harvesting reasons, gloves accumulate pesticide residues. Hence, characterization of the gloves' properties may be useful for pesticide exposure assessments. Controlled field studies were conducted using latex rubber gloves to define the factors that influence the transfer of pesticides to the glove and that would affect their use as a residue monitoring device. A novel sampling device called the Brinkman Contact Transfer Unit (BCTU) was constructed to study the glove characteristics and residue transfer and accumulation under controlled conditions on turf. The effectiveness of latex rubber gloves as sampling dosimeters was evaluated by measuring the transferable pesticide residues as a function of time. The validation of latex rubber gloves as a residue sampling dosimeter was performed by comparing pesticide transfer and dissipation from the gloves, with the turf transferable residues sampled using the validated California (CA) Roller, a standard measure of residue transfer. The observed correlation (Pearson's correlation coefficient R(2)) between the two methods was .84 for malathion and .96 for fenpropathrin, indicating that the BCTU is a useful, reliable surrogate tool for studying available residue transfer to latex rubber gloves under experimental conditions. Perhaps more importantly, these data demonstrate that latex gloves worn by workers may be useful quantifiable matrices for measuring pesticide exposure.

  13. Enhanced protein adsorption and patterning on nanostructured latex-coated paper.

    Science.gov (United States)

    Juvonen, Helka; Määttänen, Anni; Ihalainen, Petri; Viitala, Tapani; Sarfraz, Jawad; Peltonen, Jouko

    2014-06-01

    Specific interactions of extracellular matrix proteins with cells and their adhesion to the substrate are important for cell growth. A nanopatterned latex-coated paper substrate previously shown to be an excellent substrate for cell adhesion and 2D growth was studied for directed immobilization of proteins. The nanostructured latex surface was formed by short-wavelength IR irradiation of a two-component latex coating consisting of a hydrophilic film-forming styrene butadiene acrylonitrile copolymer and hydrophobic polystyrene particles. The hydrophobic regions of the IR-treated latex coating showed strong adhesion of bovine serum albumin (cell repelling protein), fibronectin (cell adhesive protein) and streptavidin. Opposite to the IR-treated surface, fibronectin and streptavidin had a poor affinity toward the untreated pristine latex coating. Detailed characterization of the physicochemical surface properties of the latex-coated substrates revealed that the observed differences in protein affinity were mainly due to the presence or absence of the protein repelling polar and charged surface groups. The protein adsorption was assisted by hydrophobic (dehydration) interactions. Copyright © 2014 Elsevier B.V. All rights reserved.

  14. Composition

    DEFF Research Database (Denmark)

    Bergstrøm-Nielsen, Carl

    2014-01-01

    Cue Rondo is an open composition to be realised by improvising musicians. See more about my composition practise in the entry "Composition - General Introduction". Caution: streaming the sound/video files will in some cases only provide a few minutes' sample, or the visuals will not appear at all....... Please DOWNLOAD them to see/hear them in full length! This work is licensed under a Creative Commons "by-nc" License. You may for non-commercial purposes use and distribute it, performance instructions as well as specially designated recordings, as long as the author is mentioned. Please see http...

  15. Latex Imaging by Environmental STEM: Application to the Study of the Surfactant Outcome in Hybrid Alkyd/Acrylate Systems

    OpenAIRE

    Faucheu , Jenny; Chazeau , Laurent; Gauthier , Catherine; Cavaille , Jean-Yves; Goikoetxea , Monika; Minari , Roque; Asua , Jose M.

    2009-01-01

    International audience; Among other uses. latexes are a successful alternative to solvent-borne binders for coatings. Efforts are made to produce hybrid nanostructured latexes containing an acrylic phase and an alkyd phase, However, after the film-forming process, the surfactant used to stabilize these latexes remains in the film, and its location can have a drastic effect on the application properties. Among the processing parameters, the alkyd hydrophobicity can strongly influence this loca...

  16. The physicochemical quality and meat microstructure of post laying hen with addition of Biduri (Calotropis gigantea) latex extract

    Science.gov (United States)

    Nuhriawangsa, A. M. P.; Hertanto, B. S.; Kartikasari, L. R.; Swastike, W.; Cahyadi, M.; Rasid, S.

    2018-01-01

    The objective of this study was to evaluate the effect of extract level of Biduri latex on the meat quality of laying hens. The materials of this research were Biduri latex and thigh meat from hens strain Lohman. The latex was tapped from a young tissue stem and centrifuged for its supernatant. Meats were smeared with latex, punctured and incubated for 30 minutes. Concentrations of latex were 0, 3, 6 and 9% from the weight of meat (w/w). The variables were water, dissolved protein, crude fat content, tenderness and microstructure of meat. The statistical analysis method using ANOVA and if there was a mean difference, Duncan test was used. Descriptive analysis was used for microstructures of meat by comparing its hydrolysis conditions. The study showed that fat had significant difference (P meat structure. The fat content increased with addition of 3% latex. The value of dissolved protein increased but tenderness decreased by addition extract of 6% latex. The addition of Biduri latex extract showed that hydrolysis in the microstructure of meat. The addition of 6% latex was the best meat quality.

  17. Latex imaging by environmental STEM: application to the study of the surfactant outcome in hybrid alkyd/acrylate systems.

    Science.gov (United States)

    Faucheu, Jenny; Chazeau, Laurent; Gauthier, Catherine; Cavaillé, Jean-Yves; Goikoetxea, Monika; Minari, Roque; Asua, José M

    2009-09-01

    Among other uses, latexes are a successful alternative to solvent-borne binders for coatings. Efforts are made to produce hybrid nanostructured latexes containing an acrylic phase and an alkyd phase. However, after the film-forming process, the surfactant used to stabilize these latexes remains in the film, and its location can have a drastic effect on the application properties. Among the processing parameters, the alkyd hydrophobicity can strongly influence this location. This article aims at the imaging of these surfactant molecules in two hybrid latexes with different hydrophobicity level of the alkyd resin. A first part of this paper is dedicated to the understanding of the contrast provided by the surfactant in environmental STEM imaging of latexes. Then, the influence of surfactant-polymer affinity on the surfactant location after film-forming of those hybrid alkyd/acrylate latexes is studied by this technique. It is shown that in the hybrid latex with an alkyd shell (obtained with the most hydrophilic resin), the surfactant molecules tend to remain buried in the alkyd phase. Conversely, in the hybrid latex with an acrylate shell (in the case of the most hydrophobic resin), the surfactant molecules tend to gather into islands like in pure acrylate latex films.

  18. Ciprofloxacin release using natural rubber latex membranes as carrier.

    Science.gov (United States)

    Dias Murbach, Heitor; Jaques Ogawa, Guilherme; Azevedo Borges, Felipe; Romeiro Miranda, Matheus Carlos; Lopes, Rute; Roberto de Barros, Natan; Guedes Mazalli, Alexandre Vinicius; Gonçalves da Silva, Rosângela; Ferreira Cinman, José Luiz; de Camargo Drago, Bruno; Donizetti Herculano, Rondinelli

    2014-01-01

    Natural rubber latex (NRL) from Hevea brasiliensis is easily manipulated, low cost, is of can stimulate natural angiogenesis and cellular adhesion, is a biocompatible, material and presents high mechanical resistance. Ciprofloxacin (CIP) is a synthetic antibiotic (fluoroquinolone) used in the treatment of infection at external fixation screws sites and remote infections, and this use is increasingly frequent in medical practice. The aim of this study was to develop a novel sustained delivery system for CIP based on NRL membranes and to study its delivery system behavior. CIP was found to be adsorbed on the NRL membrane, according to results of energy dispersive X-ray spectroscopy. Results show that the membrane can release CIP for up to 59.08% in 312 hours and the mechanism is due to super case II (non-Fickian). The kinetics of the drug release could be fitted with double exponential function X-ray diffraction and Fourier transform infrared (FTIR) spectroscopy shows some interaction by hydrogen bound, which influences its mechanical behavior.

  19. Graphene network organisation in conductive polymer composites

    NARCIS (Netherlands)

    Syurik, Y.V.; Ghislandi, M.G.; Tkalya, E.; Paterson, G.; McGrouther, D.; Ageev, O.A.; Loos, J.

    2012-01-01

    A latex technique is used to prepare graphene/polystyrene and graphene/poly(propylene) composites with varying GR loadings. Their electrical properties and the corresponding volume organisation of GR networks are studied. Percolation thresholds for conduction are found to be about 0.9 and 0.4 wt%

  20. Improving of Water Resistance of Asphalt Concrete Wearing Course Using Latex-Bitumen Binder

    Directory of Open Access Journals (Sweden)

    Siswanto Henri

    2017-01-01

    Full Text Available It is well known that presence of water in a bituminous mix is a critical factor which can lead to premature failure of flexible pavements. This requires solutions one of which is to formulate an asphalt mix that has a high resistance to moisture and one way to do this is to mix latex with the asphalt mix. The purpose of this experimental study was to investigate the effect of water on Marshall stability of asphalt concrete wearing course (ACWC made with a latex-bitumen binder. Latex-bitumen was mixed with aggregate and four levels of latex content were investigated in this study, namely, 0%, 2%, 4% and 6% respectively by weight of asphalt. Wet procces was used in the blending of mixtures. The procedure used to obtain the optimum binder contents conformed to the Marshall procedure (SNI 06-2489-1991. Six Marshall specimens at optimum binder content were prepared for each binder mix investigated. Three of six specimens from each group were tested under Marshall standards. The remaining specimens were tested by immersion in a bath at 60°C for 24 hours. The Marshall index of retained stability was used to evaluate the effect of water on the Marshall stability of ACWC. The results indicated that the addition of up to 4% latex to ACWC mix increased the retained Marshall stability, whereas the addition of latex above 4% decreased the retained stability of the mixture. The addition of 4% CRM significantly improved the retained stability of the mixture and was the best latex – ACWC mix.

  1. Changes in chemical permeation of disposable latex, nitrile, and vinyl gloves exposed to simulated movement.

    Science.gov (United States)

    Phalen, Robert N; Le, Thi; Wong, Weng Kee

    2014-01-01

    Glove movement can affect chemical permeation of organic compounds through polymer glove products. However, conflicting reports make it difficult to compare the effects of movement on chemical permeation through commonly available glove types. The aim of this study was to evaluate the effect of movement on chemical permeation of an organic solvent through disposable latex, nitrile, and vinyl gloves. Simulated whole-glove permeation testing was conducted using ethyl alcohol and a previously designed permeation test system. With exposure to movement, a significant decrease (p ≤ 0.001) in breakthrough time (BT) was observed for the latex (-23%) and nitrile gloves (-31%). With exposure to movement, only the nitrile glove exhibited a significant increase (p ≤ 0.001) in steady-state permeation rate (+47%) and cumulative permeation at 30 min (+111%). Even though the nitrile glove provided optimum chemical resistance against ethyl alcohol, it was most affected by movement. With exposure to movement, the latex glove was an equivalent option for overall worker protection, because it was less affected by movement and the permeation rate was lower than that of the nitrile glove. In contrast, the vinyl glove was the least affected by movement, but did not provide adequate chemical resistance to ethyl alcohol in comparison with the nitrile and latex gloves. Glove selection should take movement and polymer type into account. Some glove polymer types are less affected by movement, most notably the latex glove in this test. With nitrile gloves, at least a factor of three should be used when attempting to assign a protection factor when repetitive hand motions are anticipated. Ultimately, the latex gloves outperformed nitrile and vinyl in these tests, which evaluated the effect of movement on chemical permeation. Future research should aim to resolve some of the observed discrepancies in test results with latex and vinyl gloves.

  2. Effect of magnetic and thermal properties of iron oxide nanoparticles (IONs) in nitrile butadiene rubber (NBR) latex

    Science.gov (United States)

    Ong, Hun Tiar; Julkapli, Nurhidayatullaili Muhd; Hamid, Sharifah Bee Abd; Boondamnoen, O.; Tai, Mun Foong

    2015-12-01

    Nitrile butadiene rubber (NBR) gloves are one of the most important personal protective equipments but they are possible to tear off and contaminate food or pharmaceutical and healthcare products during manufacturing and packaging process. High tendency of torn glove remaining in food or products due to white or light flesh-coloured glove is not easy to be detected by naked eyes. In this paper, iron oxide nanoparticles (IONs) selected as additive for NBR to improve its detectability by mean of magnetic properties. IONs synthesized via precipitation method and compounded with NBR latex before casting on petri dish. The properties of IONs were investigated by X-ray Diffractometry (XRD), Transmission Electron Microscope (TEM), Raman Spectroscopy and Vibrating Sample Magnetometer (VSM). Meanwhile NBR/IONs composites were studied by Thermogravimetry Analysis (TGA), Differential Scanning Calorimetry (DSC) and Vibrating Sample Magnetometer (VSM). It observed that, synthesized IONs shows of 25.28 nm crystallite with 25.86 nm semipherical (changed as) shape. Meanwhile, Magnetite and maghemite phase are found in range of 670 cm-1 and 700 cm-1 respectively, which it contributes magnetization saturation of 73.96 emu/g at 10,000 G by VSM. Thermal stability and magnetic properties were increased with incorporating IONs into NBR latex up to 20 phr. NBR/IONs 5 phr has the optimum thermal stability, lowest glass transition temperature (-14.83 °C) and acceptable range of magnetization saturation (3.83 emu/g at 10,000 G) to form NBR gloves with magnetic detectability.

  3. Study of Antibacterial Activity and Bacteriology of Latex from Asclepias syriaca L

    Science.gov (United States)

    McCay, Steven; Mahlberg, Paul

    1973-01-01

    Whole and fractionated latex of Asclepias syriaca was tested for antimicrobial or growth-promoting activity with 16 genera and species of bacteria. Latex and extracted fractions (distilled water, acetic acid, sodium bicarbonate, sulfuric acid, and ethyl ether) possessed no detectable antimicrobial activity. Comparison of growth curves of selected bacteria incubated with serum and rubber fractions, as well as controls, revealed no detectable inhibition of growth, except for a slight inhibitory response to autoclaved serum. Most bacteria were capable of utilizing latex for a substrate as indicated by the increased growth rate in the exponential phase. The stationary phase was entered simultaneously by both the treated cultures and the controls. Various bacteria cultured in a litmus latex mixture yielded populations which ranged from <104 organisms/ml for Lactobacillus casei, Staphylococcus aureus and Micrococcus lysodeikticus to 1.1 × 1010 organisms/ml for Clostridium acetobutylicum. Whole latex, as well as the serum and rubber fractions, support the growth of various bacteria, but under field conditions there is no evidence for systemic infection of this type of cell by bacteria. PMID:4790590

  4. Latex allergy: new insights to explain different sensitization profiles in different risk groups.

    Science.gov (United States)

    Peixinho, C; Tavares-Ratado, P; Tomás, M R; Taborda-Barata, L; Tomaz, C T

    2008-07-01

    Differences in latex allergen sensitization profiles have been described between children subjected to repetitive surgical interventions and health care workers (HCW). 'Major' allergens for patients with spina bifida are Hev b 1, 3 and 7, while for HCW, 'major' allergens are Hev b 2, 5, 6.01 and 13. The reason for these differential sensitization profiles is currently unknown. To investigate latex allergen profiles on internal and external surfaces of natural rubber latex gloves. Eighty-two samples of commonly used surgical gloves (41 glove brands) were used for analysis. Specific allergen levels of Hev b 1, 3, 5 and 6.02 on both surfaces of the gloves were quantified using an enzyme immunometric assay, a FITkit (FIT Biotech, Tampere, Finland). Differences in allergen levels were observed between internal and external surfaces of all glove types. Concentrations of Hev b 1 and Hev b 3 were significantly higher on external surfaces, while internal surfaces had higher allergen levels of Hev b 5 and Hev b 6.02. Analysis of surgical and examination gloves, powdered and nonpowdered gloves also showed that the content of Hev b 5 and Hev b 6.02 was significantly higher on internal surfaces while that of Hev b 1 and Hev b 3 was higher on external surfaces. Our study showed different allergen profiles on internal and external surfaces of natural rubber latex gloves. These results may suggest a relationship between latex allergen localization and sensitization routes in different risk groups.

  5. Color Spectrum Properties of Pure and Non-Pure LATEX in Discriminating Rubber Clone Series

    International Nuclear Information System (INIS)

    Noor Aishah Khairuzzaman; Hadzli Hashim; Nina Korlina Madzhi; Noor Ezan Abdullah; Faridatul Aima Ismail; Ahmad Faiz Sampian; Azhana Fatnin Che Will

    2015-01-01

    A study of color spectrum properties for pure and non-pure latex in discriminating rubber clone series has been presented in this paper. There were five types of clones from the same series being used as samples in this study named RRIM2002, RRIM2007, RRIM2008, RRIM2014, and RRIM3001. The main objective is to identify the significant color spectrum (RGB) from pure and non-pure latex that can discriminate rubber clone series. The significant information of color spectrum properties for pure and non-pure latex is determined by using spectrometer and Statistical Package for the Social Science (SPSS). Visible light spectrum (VIS) is used as a radiation light of the spectrometer to emit light to the surface of the latex sample. By using SPSS software, the further numerical analysis of color spectrum properties is being conducted. As the conclusion, blue color spectrum for non-pure is able to discriminate for all rubber clone series whereas only certain color spectrum can differentiate several clone series for pure latex. (author)

  6. Status RVNRL in German latex industry and its introduction to the European market

    International Nuclear Information System (INIS)

    Bez, W.

    1996-01-01

    Reasons to look for an alternative crosslinking system avoiding sulphur curing was the restrictive policy of the German Health Authorities concerning nitrosamines. It was concluded that radiation curing offers further advantages . By avoiding the accelerators, type IV allergy is excluded, cytotoxicity is minimised to a very low level, films have better clarity and when thoroughly leached higher electrical resistance. Treatment of waste give no SO sub 2 emissions by burning, no Zinc in the ashes and possibly better microbial degradation. A development was carried out to irradiate natural latex by electron beam with a Dynamitron equipment. It was found trimethylolpropanetrimethacrylate to be a suitable sensitizer. Because of to high prices this development was interrupted. For future application trials and efforts to introduce RVNRL in the market gamma ray radiated natural latex either from Batan, Indonesia or MINT, Malaysia are used. Mainly dipped goods were produce, but radiated natural latex has shown good results in other processes. During discussions with customers it has proved necessary to establish specifications for RVNRL. A serious problem using natural latex for the production of medical devices is the type I allergy. Attempts are made to dip surgical gloves, leach them thoroughly and control extractable proteins were reduced to the very low level of 6.5 μg/g. Out of 18 patients sensitive to natural latex protein wearing gloves made from RVNRL only six have shown a positive response. That means RVNRL could help to solve the protein allergy problem. Further developments on this line are scheduled

  7. Labbtex: Toolbox para generación de informes en LATEX para Matlab

    Directory of Open Access Journals (Sweden)

    José Luis Almazán Gárate

    2012-10-01

    Full Text Available En este artículo se presenta el software desarrollado por el Equipo H3lite dentro del Departamento de Ingeneniería Civil. Transportes de la Escuela de Ingenieros de Caminos, Canales y Puertos de la Universidad Politécnica de Madrid para la generación de informes enLATEX mediante el software Matlab® y la integración en sus rutinas, Labbtex.La librería Labbtex proporciona un marco flexible para mezclar texto y código Matlab® para la generación automática de documentos. Un rchivo fuente simple contiene el texto de documentación y el código Matlab, al correr la aplicación se genera un documento final LATEX que contiene el texto, gráficos y tablas indicados con el formato de un documento LATEX. El código Matlab genera un documento LATEX usando la sintaxis. Así, LATEX (para composición de texto de alta calidad y Matlab® (para cálculo matemático pueden usarse simultáneamente. Esto permite la generación de informes en tiempo real con un uso de recursos mínimo.

  8. Silver nanoparticles delivery system based on natural rubber latex membranes

    International Nuclear Information System (INIS)

    Guidelli, Éder José; Kinoshita, Angela; Ramos, Ana Paula; Baffa, Oswaldo

    2013-01-01

    The search for new materials for biomedical applications is extremely important. Here, we present results on the performance of a silver nanoparticles delivery system using natural rubber latex (NRL) as the polymeric matrix. Our aim was to obtain an optimized wound dressing by combining materials with potential healing action. The synthesis of silver nanoparticles and their characterization by UV–Vis spectroscopy, transmission electron microscopy, zeta potential, dynamic light scattering, and Fourier transform infrared spectroscopy (FTIR) are depicted. The NRL membranes are good matrix for silver nanoparticles and allow for their gradual release. The release of 30 nm silver nanoparticles by the NRL membranes depends on their mass percentage in NRL membranes. The total concentration of AgNP released by the NRL membranes was calculated. The AgNP attached to the cis-isoprene molecules in the NRL matrix remain attached to the membrane (∼0.1 % w/w). So, only the AgNP bound to the non-rubber molecules are released. FTIR spectra suggest that non-rubber molecules, like aminoacids and proteins, associated with the serum fraction of the NRL may be attached to the surfaces of the released nanoparticles, thereby increasing the release of such molecules. The released silver nanoparticles are sterically stabilized, more stable and well dispersed. Because the serum fraction of the NRL is responsible for the angiogenic properties of the matrix, the silver nanoparticles could increment the angiogenic properties of NRL. This biomaterial has desirable properties for the fabrication of a wound dressing with potential healing action, since it combines the angiogenic and antibacterial properties of the silver nanoparticles with the increased angiogenic properties of the NRL.Graphical AbstractThe AgNP attached to the cis-isoprene molecules remain in the NRL matrix and only the AgNP bound to the non-rubber molecules (NRL serum fraction) are released. The released AgNP are sterically

  9. Silver nanoparticles delivery system based on natural rubber latex membranes

    Energy Technology Data Exchange (ETDEWEB)

    Guidelli, Eder Jose, E-mail: ederguidelli@gmail.com [Universidade de Sao Paulo/FFCLRP-DF (Brazil); Kinoshita, Angela [Universidade do Sagrado Coracao (Brazil); Ramos, Ana Paula [Universidade de Sao Paulo/FFCLRP-DQ (Brazil); Baffa, Oswaldo [Universidade de Sao Paulo/FFCLRP-DF (Brazil)

    2013-04-15

    The search for new materials for biomedical applications is extremely important. Here, we present results on the performance of a silver nanoparticles delivery system using natural rubber latex (NRL) as the polymeric matrix. Our aim was to obtain an optimized wound dressing by combining materials with potential healing action. The synthesis of silver nanoparticles and their characterization by UV-Vis spectroscopy, transmission electron microscopy, zeta potential, dynamic light scattering, and Fourier transform infrared spectroscopy (FTIR) are depicted. The NRL membranes are good matrix for silver nanoparticles and allow for their gradual release. The release of 30 nm silver nanoparticles by the NRL membranes depends on their mass percentage in NRL membranes. The total concentration of AgNP released by the NRL membranes was calculated. The AgNP attached to the cis-isoprene molecules in the NRL matrix remain attached to the membrane ({approx}0.1 % w/w). So, only the AgNP bound to the non-rubber molecules are released. FTIR spectra suggest that non-rubber molecules, like aminoacids and proteins, associated with the serum fraction of the NRL may be attached to the surfaces of the released nanoparticles, thereby increasing the release of such molecules. The released silver nanoparticles are sterically stabilized, more stable and well dispersed. Because the serum fraction of the NRL is responsible for the angiogenic properties of the matrix, the silver nanoparticles could increment the angiogenic properties of NRL. This biomaterial has desirable properties for the fabrication of a wound dressing with potential healing action, since it combines the angiogenic and antibacterial properties of the silver nanoparticles with the increased angiogenic properties of the NRL.Graphical AbstractThe AgNP attached to the cis-isoprene molecules remain in the NRL matrix and only the AgNP bound to the non-rubber molecules (NRL serum fraction) are released. The released AgNP are

  10. Natural rubber latex: past, present and future in Latin America

    International Nuclear Information System (INIS)

    Lugao, A.B.; Miranda, A.; Mindrisz, A.C.; Andrade e Silva, L.G. de

    1996-01-01

    The origin of the Hevea braziliensis tree was the Amazonian region in South America, particularly the Brazilian jungle. The rubber expansion at the end of 9th century brought prosperity and determined the borders of Amazonian countries. In spite of that, the Brazilian government has failed in establishing a successful policy for improving the NR production in the jungle. However, rubber plantations were successfully introduced recently near marginal areas of the humid forest in the Amazon due to the absence of the fungus Microcyclos ulei. Both, extraction of wild rubber and plantation have a key role in the maintenance of the forest health. The market for dipping products is small but is growing very fast and is expected to follow this pattern as the sanitary conditions are improved by the health authority. The history of the Brazilian NR products industry is contemporary and is based on the policy of market protection and on the lack of investments due to extremely high interest rates. As a result, the industry was not competitive. It was concluded that, in order to cope with the future challenge, the industry is required to invest in very modern technologies to produce first class goods with international acceptance. Latin America would follow the world trend for nitrosamine and protein free products. The radiation vulcanization of natural rubber latex could prove itself as a profitable solution and not only a quality solution. It was also concluded that both wild rubber and rubber plantations in Brazil have their future coupled with the future of a regional dipping industry. Moreover, the buildup of the dipping industry will be beneficial to the protection of the humid forest and the recovery of degraded areas

  11. Radiation graft copolymerization of n-butyl acrylate on natural rubber latex

    International Nuclear Information System (INIS)

    Sundardi, F.; Kadariah, S.

    1986-01-01

    A method of radiation graft copolymerization of n-butyl acrylate (NBA) on natural rubber (NR) latex has been studied. The rate of conversion increases with the increase of NBA in latex. An irradiation dose of about 12 kGy is needed to obtain 90% conversion with 40 phr of NBA in latex. Tensile strength, tear strength, and elongation at break of grafted NR are found to decrease with increasing degree of grafting. The physical strength of a vulcanizate prepared from a mixture of NR and ply-NBA was found to be better than that of NBA-NR graft copolymer vulcanizate. The graft copolymerization reaction takes place in the outer layer of NR particles, and because the secondary bonds between poly-NBA molecules may be weaker than those between NR molecules, the existence of a poly-NBA layer in NR particles will decrease its physical strength

  12. Effects of radio sensitizers in the vulcanization of natural rubber latex induced by gamma radiation

    International Nuclear Information System (INIS)

    Souza, A. de; Canavel, V.; Araujo, S.C. de; Guedes, S.M.L.

    1992-01-01

    The effect of C Cl 4 and n-butyl acrylate as a sensitizer for radiation vulcanization of 60% DRC natural rubber latex with gamma rays, was studied relating tensile strength of vulcanized latex. The vulcanization dose is 200 kGy for natural rubber latex and it decreases to 40 kGy and to 9 kGy in the presence of C Cl 4 / potassium laureate and n-butyl acrylate / t-butyl hydroperoxide, respectively. The H 2 O 2 as a co-sensitizer does not change the efficiency of the combination of these sensitizers. The IV spectra show the formation of C=O after the irradiation as consequence of oxidation reactions. (author)

  13. Extractable proteins from electron beam (EB) irradiated natural rubber (NR) latex

    International Nuclear Information System (INIS)

    Feroza Akhtar; Fumio Yoshii; Keizo Makuuchi

    1996-01-01

    The protein assay of natural rubber latex (NRL) vulcanized by low energy electron beam (EB, 300 keV, 30 mA) has been carried out using Bicinchoninic acid (BCA) reagent. Extractable protein in irradiated latex film was determined by measuring the absorption of colored solution at 562 nm using UV spectrometer. The effect of various radiation doses on the extractable protein content of NRL was investigated. It was ,found that the quantities of extractable protein increases with radiation dose. When compared with ,gamma-ray irradiated samples the same trend was observed. Electron beam irradiated latex films are leached in 1% (ammonia water for various lengths of time. From the results it was established that within 2 hours of leaching in ammonia water most of the extractable protein (96%) were removed from rubber film

  14. Extraction and comparison of proteins from natural rubber latex by conventional and ionizing radiation methods

    International Nuclear Information System (INIS)

    Rogero, Sizue O.; Spencer, Patrick J.; Campos, Vania E.; Lusvarghi, Fabio M.; Higa, Olga Z.

    1997-01-01

    Several proteins in natural rubber latex (NRL) have been assigned to be significant allergens. It is known that proteins submitted to ionizing radiation suffer denaturation and immunochemical modification resulting in low antigenic reactivity. The aim of this study was to extract and compare water extractable proteins from NRL films vulcanized by conventional and by ionizing radiation methods. SDS-polyacrylamide gel electrophoresis (SDS--PAGE) and high pressure liquid chromatography (HPLC) showed a diffuse protein band of about 14 KDa, which we believe is rubber elongation factor (REF), in both eluates, but smaller in latex film vulcanized by ionizing radiation. REF has been suggested to be a major latex allergen. These data suggest that ionizing radiation vulcanization could be an useful method for the production of NRL goods with low antigenicity. (author). 8 refs., 2 figs., 1 tab

  15. Trialed production of low protein irradiated natural rubber latex in factory scale by gamma irradiation technique

    International Nuclear Information System (INIS)

    Utama, Marga; Herwinarni, S.; Halik, H.M.; Siswanto; Suharyanto; Syamsu, Y.; Handoko, B.

    2006-01-01

    Four tons fresh field natural rubber latex (FNRL) with total solid content 30% were added with 2 phr (part hundred ratio of rubber) normal butyl acrylate (nBA) then irradiated by gamma rays at 25 kGy. The irradiated FNRL was centrifuged, then the properties of irradiated centrifuged natural rubber latex (INRL) and its film were measured before and after storage for 5 months. It is found that the INRL is stable latex during storage in 5 months, with lowest protein, and free nitrosamine content. The tensile strength of INRL film was 24-27 MPa, and modulus 600% was 1,5-2,0 MPa, elongation at break was 900%, and hardness was 27-29 Shore A, while the extractable protein content less than 100 μg/g. (author)

  16. Development assessment of natural latex membranes: a new proposal for the treatment of amblyopia

    Energy Technology Data Exchange (ETDEWEB)

    Ribeiro, Jaqueline Alves; Rosa, Suelia Rodrigues Fleury, E-mail: jackalvesribeiro@gmail.com [Laboratorio de Engenharia e Biomaterial (BioEngLab), Faculdade Gama, Universidade de Brasilia (UnB), DF (Brazil); Leite, Cicilia Raquel Maia; Vasconcelos, Claudio Lopes; Soares, Joao Maria [Universidade do Estado do Rio Grande do Norte (UERN), Mossoro, RN (Brazil)

    2017-05-15

    The ophthalmic dysfunction amblyopia, commonly known as lazy eye, is characterized by decreased vision in one eye due to improper development in childhood. The aim of this study was to obtain and characterize natural rubber membranes and to assess their utility as an eye film capable of altering the passage of light. The latex membranes were produced using the Van Gogh method and the deposition technique and were analyzed by physical and chemical methods to determine the properties of latex in natura and of natural rubber membranes. The materials were characterized by X-ray diffractometry, scanning electron microscopy, thermogravimetry, differential scanning calorimetry, analysis of water sorption and light crossing analysis. We report here a new approach to the treatment of patients with amblyopia using latex membranes. (author)

  17. Development assessment of natural latex membranes: a new proposal for the treatment of amblyopia

    International Nuclear Information System (INIS)

    Ribeiro, Jaqueline Alves; Rosa, Suelia Rodrigues Fleury; Leite, Cicilia Raquel Maia; Vasconcelos, Claudio Lopes; Soares, Joao Maria

    2017-01-01

    The ophthalmic dysfunction amblyopia, commonly known as lazy eye, is characterized by decreased vision in one eye due to improper development in childhood. The aim of this study was to obtain and characterize natural rubber membranes and to assess their utility as an eye film capable of altering the passage of light. The latex membranes were produced using the Van Gogh method and the deposition technique and were analyzed by physical and chemical methods to determine the properties of latex in natura and of natural rubber membranes. The materials were characterized by X-ray diffractometry, scanning electron microscopy, thermogravimetry, differential scanning calorimetry, analysis of water sorption and light crossing analysis. We report here a new approach to the treatment of patients with amblyopia using latex membranes. (author)

  18. Production Of Hollow Toy Product From Radiation Pre vulcanized Natural Rubber Latex (RVNRL) By Using Casting And Moulding Technique

    International Nuclear Information System (INIS)

    Mohd Noorwadi Mat Lazim; Sofian Ibrahim; Muhammad Saiful Omar

    2013-01-01

    Hollow toy products are very synonym to the child from the age of months since it able to stimulating each of their sense such as sight, hearing, taste, touch and smell. Most of hollow toy products are made from natural rubber latex by using moulding and casting technique. The moulding and casting technique is a manufacturing process by pored liquid latex into a mould, which contain cavity of the desired shape. The mould made from plaster of Paris able to absorbs water from latex meanwhile the presence of calcium ions from plaster of Paris will tend to diffuse into latex thus promote formation of deposit on surface of cavity mould. To improve the quality and safety of hollow toy product made from latex, Radiation Pre vulcanized Natural Rubber Latex (RVNRL) has been identified to be used because it can fulfill the standard requirement for latex and also due to its special abilities such as lower modulus (soft latex products), nitrosamines free, low in nitrosatables, free from chemical accelerators induced allergies and better biodegradability. This paper identify the problem appears from the process of making hollow toy products from RVNRL by using moulding and casting technique. (author)

  19. Preliminary study of semi-refined carrageenan (SRC) as secondary gelling agent in natural rubber (NR) latex foam

    Science.gov (United States)

    Norhazariah, S.; Azura, A. R.; Azahari, B.; Sivakumar, R.

    2017-12-01

    Semi-refined carrageenan (SRC) product is considerably cheaper and easier to produce as a natural polysaccharide, which was utilized in food and other product application. However, the application in latex is limited. The aim of this work is to evaluate the SRC produced from low industrial grade seaweed (LIGS) in the latex foam application. The FTIR spectra showed the SRC produced as kappa type carrageenan with lower sulfur content compared to native LIGS. NR latex foam is produced by using the Dunlop method with some modifications. The effect of SRC loading as a secondary gelling agent in NR latex foam is investigated. The density and morphology of the NR latex foam with the addition of the SRC are analyzed. NR latex foam density increased with SRC loading and peaked at 1.8 phr SRC. The addition of SRC has induced the bigger cell size compared to the cell size of the control NR latex foam, as shown in the optical micrograph. It can be concluded that SRC LIGS could be acted as secondary gelling agent in NR latex foam.

  20. Hierarchically structured self-supported latex films for flexible and semi-transparent electronics

    International Nuclear Information System (INIS)

    Määttänen, Anni; Ihalainen, Petri; Törngren, Björn; Rosqvist, Emil; Pesonen, Markus; Peltonen, Jouko

    2016-01-01

    Graphical abstract: - Highlights: • Transparent self-supported latex films were fabricated by a peel-off process. • Various template substrates were used for creating e.g. hierarchically structured latex films. • Ultra-thin and semi-transparent conductive gold electrodes were evaporated on the latex films.Electrochemical experiments were carried out to verify the applicability of the electrodes. - Abstract: Different length scale alterations in topography, surface texture, and symmetry are known to evoke diverse cell behavior, including adhesion, orientation, motility, cytoskeletal condensation, and modulation of intracellular signaling pathways. In this work, self-supported latex films with well-defined isotropic/anisotropic surface features and hierarchical morphologies were fabricated by a peel-off process from different template surfaces. In addition, the latex films were used as substrates for evaporated ultrathin gold films with nominal thicknesses of 10 and 20 nm. Optical properties and topography of the samples were characterized using UV–vis spectroscopy and Atomic Force Microscopy (AFM) measurements, respectively. The latex films showed high-level transmittance of visible light, enabling the fabrication of semi-transparent gold electrodes. Electrochemical impedance spectroscopy (EIS) measurements were carried out for a number of days to investigate the long-term stability of the electrodes. The effect of 1-octadecanethiol (ODT) and HS(CH_2)_1_1OH (MuOH) thiolation and protein (human serum albumin, HSA) adsorption on the impedance and capacitance was studied. In addition, cyclic voltammetry (CV) measurements were carried out to determine active medicinal components, i.e., caffeic acid with interesting biological activities and poorly water-soluble anti-inflammatory drug, piroxicam. The results show that the fabrication procedure presented in this study enables the formation of platforms with hierarchical morphologies for multimodal (optical and

  1. Hierarchically structured self-supported latex films for flexible and semi-transparent electronics

    Energy Technology Data Exchange (ETDEWEB)

    Määttänen, Anni, E-mail: anni.maattanen@abo.fi [Laboratory of Physical Chemistry, Faculty of Science and Engineering, Center for Functional Materials, Åbo Akademi University, Porthaninkatu 3, 20500, Turku (Finland); Ihalainen, Petri, E-mail: petri.ihalainen@abo.fi [Laboratory of Physical Chemistry, Faculty of Science and Engineering, Center for Functional Materials, Åbo Akademi University, Porthaninkatu 3, 20500, Turku (Finland); Törngren, Björn, E-mail: bjorn.torngren@abo.fi [Laboratory of Physical Chemistry, Faculty of Science and Engineering, Center for Functional Materials, Åbo Akademi University, Porthaninkatu 3, 20500, Turku (Finland); Rosqvist, Emil, E-mail: emil.rosqvist@abo.fi [Laboratory of Physical Chemistry, Faculty of Science and Engineering, Center for Functional Materials, Åbo Akademi University, Porthaninkatu 3, 20500, Turku (Finland); Pesonen, Markus, E-mail: markus.pesonen@abo.fi [Physics, Faculty of Science and Engineering, Center for Functional Materials, Åbo Akademi University, Porthaninkatu 3, 20500, Turku (Finland); Peltonen, Jouko, E-mail: jouko.peltonen@abo.fi [Laboratory of Physical Chemistry, Faculty of Science and Engineering, Center for Functional Materials, Åbo Akademi University, Porthaninkatu 3, 20500, Turku (Finland)

    2016-02-28

    Graphical abstract: - Highlights: • Transparent self-supported latex films were fabricated by a peel-off process. • Various template substrates were used for creating e.g. hierarchically structured latex films. • Ultra-thin and semi-transparent conductive gold electrodes were evaporated on the latex films.Electrochemical experiments were carried out to verify the applicability of the electrodes. - Abstract: Different length scale alterations in topography, surface texture, and symmetry are known to evoke diverse cell behavior, including adhesion, orientation, motility, cytoskeletal condensation, and modulation of intracellular signaling pathways. In this work, self-supported latex films with well-defined isotropic/anisotropic surface features and hierarchical morphologies were fabricated by a peel-off process from different template surfaces. In addition, the latex films were used as substrates for evaporated ultrathin gold films with nominal thicknesses of 10 and 20 nm. Optical properties and topography of the samples were characterized using UV–vis spectroscopy and Atomic Force Microscopy (AFM) measurements, respectively. The latex films showed high-level transmittance of visible light, enabling the fabrication of semi-transparent gold electrodes. Electrochemical impedance spectroscopy (EIS) measurements were carried out for a number of days to investigate the long-term stability of the electrodes. The effect of 1-octadecanethiol (ODT) and HS(CH{sub 2}){sub 11}OH (MuOH) thiolation and protein (human serum albumin, HSA) adsorption on the impedance and capacitance was studied. In addition, cyclic voltammetry (CV) measurements were carried out to determine active medicinal components, i.e., caffeic acid with interesting biological activities and poorly water-soluble anti-inflammatory drug, piroxicam. The results show that the fabrication procedure presented in this study enables the formation of platforms with hierarchical morphologies for multimodal

  2. Effect of cellulose nanocrystals from corn cob with dispersion agent polyvinyl pyrrolidone in natural rubber latex film after aging treatment

    Science.gov (United States)

    Harahap, H.; Ridha, M.; Halimatuddahliana; Taslim; Iriany

    2018-02-01

    This study about the resistance of natural rubber latex films using nanocrystals cellulose filler from corn cob waste by aging treatment. Corn cob used as organic filler composed of cellulose, hemicellulose, and lignin. Each component has a potential for reuse, such as cellulose. Cellulose from corn cob has potential application as a filler prepared by hydrolysis process using a strong acid. The producing of natural rubber latex films through coagulant dowsing process. This research started with the pre-vulcanization process of natural rubber latex at 70 °C and followed by process of vulcanization at 110 °C for 20 minutes. Natural rubber latex films that have been produced continued with the aging treatment at 70 °C for 168 hours. The mechanical properties of natural rubber latex films after aging treatment are the tensile strength, elongation at break, M100 and M300 have performed.

  3. Effect of rootstock on the scion of Hevea brasiliensis through metabolic analysis of latex samples by 1H NMR

    Directory of Open Access Journals (Sweden)

    Eduardo Sanches Pereira do Nascimento

    2011-01-01

    Full Text Available In this study, the effect of rootstock on grafting through metabolomic analysis of latex (Hevea brasiliensis samples was verified by 1H nuclear magnetic resonance (NMR and multivariate data analysis. Sixteen metabolites present in the latex cytosol were characterized by NMR. PCA analysis showed that the latex samples of the RR and GR groups can be differentiated. The GR group samples present a metabolic profile similar to the RR group samples, while the RG group is in an intermediate position between RR and GG groups. Sucrose and formate contributed greatly to the separation obtained by PCA, presenting a good correlation between the results. 1H NMR was an efficient technique to differentiate latex samples from different types of rootstocks and grafting and in the future could be used to predict rubber production by latex analysis.

  4. The evolution and use of a personal LaTeX metapackage

    DEFF Research Database (Denmark)

    Andersen, Esben Sloth

    This document defines and describes esameta.sty and its variant esametaps.sty. They are personal LATEX packages that largely consist of calls of other packages. These 'metapackages' are selected to help the development of the author's complex book and paper projects-but some of his decisions migh...... be of more general relevance. The use of the LATEX system of 'literate programming' and the testing the compatibility of new commands and packages with the previously included parts of the metapackage should also be noticed....

  5. Mechanism of n-butyl acrylate sensitization action in radiation vulcanization of natural rubber latex

    International Nuclear Information System (INIS)

    Sabharwal, S.; Chaudhari, C.V.; Bhardwaj, Y.K.; Majali, A.B.; Das, T.N.

    1996-01-01

    In order to understand the role of n-butyl acrylate (nBA) in radiation vulcanization of natural rubber latex, pulse radiolysis technique has been utilized to study the reactions of the transient species produced by reaction of OH . , e- aq and H . atoms with nBA in aqueous solutions. The results show that transients produced by reaction of e- aq with nBA alone are capable of propagating the polymerization reaction and enhance the vulcanization process. These results have been further confirmed by studying the effect of electron scavengers on the vulcanization behaviour of natural rubber latex in presence of nBA. (author). 3 refs., 3 figs

  6. Radiation vulcanization of natural rubber latex using 250 keV electron beam machine

    Energy Technology Data Exchange (ETDEWEB)

    Chirinos, H.; Yoshii, F.; Makuuchi, K.; Lugao, A. E-mail: ablugao@net.ipen.br

    2003-08-01

    The sensitized radiation vulcanization of natural rubber latex has been carried out with 250 keV electrons. Latex was irradiated over a range of the beam current from 5 to 20 mA in the presence of sensitizers like the n-butyl acrylate (n-BA). The vulcanization dose decreases with increasing beam current condition. The rate of vulcanization (R{sub vul}) depends on the beam current (I) as given by the equation R{sub vul}=kI{sup 0.6}.

  7. Anticancer activity of flavonol and flavan-3-ol rich extracts from Croton celtidifolius latex.

    Science.gov (United States)

    Biscaro, Fernanda; Parisotto, Eduardo Benedetti; Zanette, Vanilde Citadini; Günther, Tania Mara Fischer; Ferreira, Eduardo Antonio; Gris, Eliana Fortes; Correia, João Francisco Gomes; Pich, Claus Tröger; Mattivi, Fulvio; Filho, Danilo Wilhelm; Pedrosa, Rozangela Curi

    2013-06-01

    Croton celtidifolius Baill (Euphorbiaceae) is a tree found in the Atlantic Forest in Southern Brazil, where it is commonly known as "Sangue-de-Dragão". Its red latex is used traditionally for treating ulcers, diabetes and cancer. To evaluate antitumor activities of Croton celtififolius latex in vitro and in vivo. Phytochemical analyses were conducted using HPLC-DAD-MS. Cytotoxic, nuclease and pro-apoptotic properties were determined using the tetrazolium salt assay (MTT), plasmid DNA damage assay and ethidium bromide (EB)/acridine orange methods, respectively, and antitumor activity was determined in the Ehrlich ascites carcinoma (EAC) mouse model. Phytochemical studies indicated a high phenol content of flavonols (45.67 ± 0.24 and 18.01 ± 0.23 mg/mL of myricetin and quercetin, respectively) and flavan-3-ols (114.12 ± 1.84 and 1527.41 ± 16.42 mg/L of epicatechin and epigallocatechin, respectively) in latex. These compounds reduced MCF-7 and EAC cell viability in the MTT assay (IC50 = 169.0 ± 1.8 and 187.0 ± 2.2 μg/mL, respectively). Latex compounds caused significant DNA fragmentation and increased the number of apoptotic cells (negative control (NC), 12%; latex, 41%) as indicated by differential staining in the EB/acridine orange assay. The in vivo latex treatment at 3.12 mg/kg/day reduced the body weight by 7.57 ± 2.04 g and increased median survival time to 17.5 days when compared to the NC group (13.0 days). In addition, the highest latex concentration inhibited tumor growth by 56%. These results agree with ethno-pharmacological reports showing cytotoxicity and antitumor activity of C. celtidifolius latex. The mechanism of antitumor action may be related to direct DNA fragmentation that reduces survival and induces apoptosis.

  8. Trial Production of Surgical Gloves from Irradiated Natural Rubber Latex on Factory Scale

    Directory of Open Access Journals (Sweden)

    M. Utama

    2005-07-01

    Full Text Available Trial production of surgical gloves from irradiated natural rubber latex at the PT. Laxindo Utama Serang Banten glove factory has been carried out. The variation of heating temperature and leaching time during processing were evaluated. The physical and mechanical properties and the protein allergen respond of surgical gloves using ELISA method were measured. The results showed that the physical and mechanical of surgical gloves such as tensile strength, modulus, and elongation at break arefound to meet the requirements of the ISO or SNI standard for surgical gloves. While the allergic response through clinical tested latex-sensitive protein allergen known as ELISA test is found to be negative.

  9. Radiation Vulcanization of Natural Rubber Latex (RVNRL): A Potential Material for Nuclear Power Plant Gloves

    International Nuclear Information System (INIS)

    Pairu Ibrahim; Wan Manshol Wan Zain; Keong, C.C.; Mohd Noorwadi Mat Lazim

    2011-01-01

    Radiation vulcanization of natural rubber latex has great potential for the production of nuclear power plant gloves due to its low ash and mineral content. And this is in-line with the role played by Malaysian Nuclear Agency as Technical Supporting Organization for Nuclear Power Program. This paper discussed the evaluation done to determine ash content in RVNRL and SVNRL films. Both samples were prepared using casting technique and the properties were compared. Films prepared from raw latex without any vulcanizing agent were regarded as a control. (author)

  10. Gamma irradiator design concepts for radiation vulcanisation of natural rubber latex

    International Nuclear Information System (INIS)

    Aggarwal, K.S.; Muralidharan, P.; Apte, M.G.; Kalurkar, A.R.; Shah, B.M.

    1990-01-01

    Radiation vulcanisation of natural rubber latex (NRL) is a new and yet unproven technology and one which involves undefined problems of consumer acceptance and high degree of radiation risk. Therefore, the designer should take care that the initial capital cost of the plant is as low as possible to keep the unit processing cost low during the initial lean period of the product requirement by the market. Three irradiators to process natural rubber latex have been designed as per capacity requirement of the user. Their salient features are described. (author). 2 tabs., 24 figs

  11. Low field NMR study of the latex derived from Brosimum parinarioides - Moraceae

    International Nuclear Information System (INIS)

    Miguez, Eduardo; Tavares, Maria Ines B.

    2009-01-01

    Brosimum parinarioides is a tree found in the Amazonia forest and its latex (Leite de Amapa) is often used like food and by the popular medicine in the treatment of tuberculosis and asthma. Being swallowed in nature, its necessary determinate the stability degree of this latex in the storage conditions in which is used in Amazonia. The analyses of T 2 data showed that the limit of stability is not longer than six month in the storage conditions used by the population of Amazonia. The Low field NMR proved to be an efficient method for this kind of study. (author)

  12. Mechanical and morphological properties of kenaf powder filled natural rubber latex foam

    Energy Technology Data Exchange (ETDEWEB)

    Karim, Ahmad Fikri Abdul, E-mail: a.fikri-89@yahoo.com; Ariff, Zulkifli Mohamad [School of Materials and Mineral Resources Engineering, Engineering Campus, Universiti Sains Malaysia, 14300 Nibong Tebal, Pulau Pinang (Malaysia); Ismail, Hanafi [Cluster for Polymer Composites (CPC), Science and Engineering Research Centre, Engineering Campus, Universiti Sains Malaysia,14300 Nibong Tebal, Pulau Pinang (Malaysia)

    2015-07-22

    This research is carried out by incorporate kenaf powder with natural rubber latex (NRL) compound and is foamed to make natural rubber latex foam (NRLF) by using a well known technique called Dunlop method. Different loading of kenaf powder was added to NRL compound and was foamed to make NRLF. The tensile properties, and morphology of kenaf filled NRLF was studied. Increase in kenaf loading reduced the tensile strength and elongation at break and of a compound. Modulus at 100% elongation of the compound increased with increased in filler loading. The morphological and micro structural characterization has been performed by using scanning electron microscopy (SEM)

  13. Mechanical and morphological properties of kenaf powder filled natural rubber latex foam

    International Nuclear Information System (INIS)

    Karim, Ahmad Fikri Abdul; Ariff, Zulkifli Mohamad; Ismail, Hanafi

    2015-01-01

    This research is carried out by incorporate kenaf powder with natural rubber latex (NRL) compound and is foamed to make natural rubber latex foam (NRLF) by using a well known technique called Dunlop method. Different loading of kenaf powder was added to NRL compound and was foamed to make NRLF. The tensile properties, and morphology of kenaf filled NRLF was studied. Increase in kenaf loading reduced the tensile strength and elongation at break and of a compound. Modulus at 100% elongation of the compound increased with increased in filler loading. The morphological and micro structural characterization has been performed by using scanning electron microscopy (SEM)

  14. Analysis of Aqueous Extractable Protein in Radiation Pre vulcanized Natural Rubber Latex (RVNRL) And Sulphur Pre vulcanized Natural Rubber Latex (SVNRL)

    International Nuclear Information System (INIS)

    Sofian Ibrahim; Mohd Noor Wadi Mat Lazim; Syuhada Ramli; Keong, C.C.; Khairul Hisyam Mohd Yusof; Muhammad Saiful Omar; Najib Mohd Zakey; Hafizuddin Maseri; Noor Hasni Mohd Ali

    2015-01-01

    The use of radiation do not only produces Radiation Pre vulcanized Natural Rubber Latex (RVNRL) that can be used for the production of nitrosamines free products, moreover, RVNRL also able to exclude type IV allergy that caused by high protein content in the products. Leaching water from production of finger coat from RVNRL and Sulphur Pre vulcanized Natural rubber Latex (SVNRL) has been collected. Extractable protein content from water samples measured according to the test protocol ASTM D5712-2010. Water from leaching process of finger coat made from RVNRL showed a higher protein content than SVNRL. This explains why RVNRL based products contain very low protein content and thus reduce the risk of Type IV allergy. (author)

  15. Antimicrobial activity of a 48-kDa protease (AMP48) from Artocarpus heterophyllus latex.

    Science.gov (United States)

    Siritapetawee, J; Thammasirirak, S; Samosornsuk, W

    2012-01-01

    Artocarpus heterophyllus (jackfruit) is a latex producing plant. Plant latex is produced from secretory cells and contains many intergradients. It also has been used in folk medicine. This study aimed to purify and characterize the biological activities of a protease from jackfruit latex. A protease was isolated and purified from crude latex of a jackfruit tree by acid precipitation and ion exchange chromatography. The proteolytic activities of protein were tested using gelatin- and casein-zymography. The molecular weight and isoelectric point (pl) of protein were analysed by SDS/12.5% PAGE and 2D-PAGE, respectively. Antimicrobial activity of protein was analysed by broth microdilution method. In addition, the antibacterial activity of protein against Pseudomonas aeruginosa ATCC 27853 was observed and measured using atomic force microscopy (AFM) technique. The purified protein contained protease activity by digesting gelatin- and casein-substrates. The protease was designated as antimicrobial protease-48 kDa or AMP48 due to its molecular mass on SDS-PAGE was approximately 48 kDa. The isoelectric point (pl) of AMP48 was approximately 4.2. In addition, AMP48 contained antimicrobial activities by it could inhibit the growths of Pseudomonas aeruginosa ATCC 27853 and clinical isolated Candida albicans at minimum inhibitory concentration (MIC) 2.2 mg/ml and Minimum microbicidal concentration (MMC) 8.8 mg/ml. AFM image also supported the antimicrobial activities of AMP48 by the treated bacterial morphology and size were altered from normal.

  16. Reduction of residual monomer in latex products by enhanced polymerization and extraction in supercritical carbon dioxide

    NARCIS (Netherlands)

    Kemmere, M.F.; Schilt, van M.A.; Cleven, M.H.W.; Herk, van A.M.; Keurentjes, J.T.F.

    2002-01-01

    The redn. of Me methacrylate (MMA) in a PMMA latex was chosen as a representative model system. Pulsed electron beam expts. were performed to study the effect of supercrit. carbon dioxide (scCO2) on the monomer concn. inside the polymer particles during the polymn. reaction. The partitioning

  17. Evaluation of peptides release using a natural rubber latex biomembrane as a carrier.

    Science.gov (United States)

    Miranda, M C R; Borges, F A; Barros, N R; Santos Filho, N A; Mendonça, R J; Herculano, R D; Cilli, E M

    2018-05-01

    The biomembrane natural (NRL-Natural Rubber Latex), manipulated from the latex obtained from the rubber tree Hevea brasiliensis, has shown great potential for application in biomedicine and biomaterials. Reflecting the biocompatibility and low bounce rate of this material, NRL has been used as a physical barrier to infectious agents and for the controlled release of drugs and extracts. The aim of the present study was to evaluate the incorporation and release of peptides using a latex biomembrane carrier. After incorporation, the release of material from the membrane was observed using spectrophotometry. Analyses using HPLC and mass spectroscopy did not confirm the release of the antimicrobial peptide [W 6 ]Hylin a1 after 24 h. In addition, analysis of the release solution showed new compounds, indicating the degradation of the peptide by enzymes contained in the latex. Additionally, the release of a peptide with a shorter sequence (Ac-WAAAA) was evaluated, and degradation was not observed. These results showed that the use of NRL as solid matrices as delivery systems of peptide are sequence dependent and could to be evaluated for each sequence.

  18. Crystallization of Hevamine, an Enzyme with Lysozyme/Chitinase Activity from Hevea brasiliensis Latex

    NARCIS (Netherlands)

    ROZEBOOM, HJ; BUDIANI, A; BEINTEMA, JJ

    1990-01-01

    Hevamine, an enzyme with both lysozyme and chitinase activity, was isolated and purified from Hevea brasiliensis (rubber tree) latex. The enzyme (molecular weight 29,000) is homologous to certain “pathogenesis-related” proteins from plants, but not to hen egg-white or phage T4 lysozyme. To

  19. The effect of emulsifier on the stability of irradiated LA-TZ latex

    International Nuclear Information System (INIS)

    Made Sumarti K; Utama, Marga; Puspitasari, Tita

    1998-01-01

    The effect of six kinds of stabilizer on the stability of the concentrated LA-TZ latex which contains n-BA have been studied. The six stabilizers are: 1. Naphthalene sulfonic acid formaldehyde condensate, 2. Sodium dialkyl sulfosuccinate, 3. Triethanol amine lauryl sulfate, 4. Sodium polyoxyethylene alkyl phenol ether sulfate, 5. Dodecyl benzene sulfonic acid (Neopelex FS), and 6. Ammonium laurat. The concentrations of the stabilizers are in the range of 0,1 to 0,3% and of the n-BA is 5phr (per hundred rubber). The field natural rubber latex was stabilized by Tetramethyl tiuram disulfide - Zine oxide (TMTD-ZnO) and ammonium gas, and was concentrated by centrifuge. The obtain concentrated LA-TZ latex was added by the n-BA and was kept with various storage time i.e. o, 2, 4, 6, 18, and 24 hours. It was found that the stable latex was irradiated by 15 kGy dose and the physical properties was tested, then the maximum tensile strength of 223,3 kg/cm 2 was found on Neopelex FS concentrate at 0,1%. (authors)

  20. Enhancing Student Writing and Computer Programming with LATEX and MATLAB in Multivariable Calculus

    Science.gov (United States)

    Sullivan, Eric; Melvin, Timothy

    2016-01-01

    Written communication and computer programming are foundational components of an undergraduate degree in the mathematical sciences. All lower-division mathematics courses at our institution are paired with computer-based writing, coding, and problem-solving activities. In multivariable calculus we utilize MATLAB and LATEX to have students explore…

  1. Synthesis, Characterization and Gold Loading of Polystyrene-Poly(pyridyl methacrylate) Core-Shell Latex Systems

    NARCIS (Netherlands)

    Oláh, A.; Hempenius, Mark A.; Vancso, Gyula J.

    2004-01-01

    In this research, novel 3-(2-pyridyl)propyl methacrylate and 3-(3-pyridyloxy)propyl methacrylate monomers were synthesized and emulsion polymerized on colloidal polystyrene seeds, resulting in core–shell latex systems. The cores and the core–shell particles were characterized by static light

  2. Radiation prevulcanized natural rubber latex: Cytotoxicity and safety evaluation on animal

    Energy Technology Data Exchange (ETDEWEB)

    Keong, C C; Zin, W M Wan; Ibrahim, P; Ibrahim, S, E-mail: chai@nuclearmalaysia.gov.my [Malaysian Nuclear Agency, Bangi, 43000 Kajang, Selangor (Malaysia)

    2010-05-15

    Radiation prevulcanized natural rubber latex (RVNRL) was claimed to be more user friendly than natural rubber latex prevulcanized by sulphur curing system. The absence of Type IV allergy inducing chemicals in RVNRL make it a suitable material for manufacturing of many kinds of latex products, especially those come into direct contact with users. This paper reveals and discusses the findings of cytotoxicity test and safety evaluation on animal for RVNRL. The test was done on RVNRL films prepared by coagulant dipping method and RVNRL dipped products produced by latex dipped product manufacturers. Cytotocixity test was carried out on mammalian cell culture American Type Culture Collection CCL 81, Vero. Results indicated that no cytotoxic effect from RVNRL films and products was found on the cell culture. Two animal studies, namely dermal sensitization study and primary skin irritation study, were done on gloves made from RVNRL. Albino white guinea pigs were used as test subjects in dermal sensitization study and results showed no sensitization induced by the application of test material in the guinea pigs. Primary skin irritation study was done on New Zealand white rabbits and results showed that the product tested was not corrosive and was not a primary irritant

  3. Radiation vulcanization of natural rubber latex with low energy accelerator-II

    Energy Technology Data Exchange (ETDEWEB)

    Haque, Md. Emdadul; Makuuchi, Keizo; Ikeda, Kenichi; Yoshii, Fumio; Kume, Tamikazu [Japan Atomic Energy Research Inst., Takasaki, Gunma (Japan). Takasaki Radiation Chemistry Research Establishment; Mitomo, Hiroshi [Gunma Univ., Faculty of Engineering, Dept. of Biological and Chemical Engineering, Kiryu, Gunma (Japan)

    2002-03-01

    The natural rubber latex (NRL) was radiation vulcanized under a low energy electron accelerator. Accelerating voltage and maximum beam current of this accelerator are 250 kV and 10 mA respectively. Irradiation was carried out in a reaction vessel with constant stirring. The capacity of the vessel is 18 liters. Radiation vulcanization accelerators (RVA) were normal butyl acrylate (n-BA) and nonane-diol-diacrylate (NDDA). NDDA has no bad smell like that of n-BA. 20 minutes irradiation time is enough to vulcanize 14 liters of latex when 5 phr RVA (both types) are used. Maximum of {approx}30 MPa tensile strength was obtained with 5 phr NDD-A. However the remained NDDA is difficult to remove due to high molecular weight. Water-extractable proteins content was determined in dipped films for various leaching conditions without and with additive (polyvinyl alcohol, PVA). Water extractable proteins content is reduced to {<=} 41 by adding 5 phr PVA and leaching for 8 hours. The tackiness of the dipped films is reduced to 0.1 from 9 gf by mixing 6 phr PVA with the irradiated latex. Hand gloves (surgical and examination) were successfully produced from the irradiated latex. (author)

  4. Latex paint as a delivery vehicle for diethylphthalate and di-n-butylphthalate

    DEFF Research Database (Denmark)

    Schripp, Tobias; Salthammer, Tunga; Fauck, Christian

    2014-01-01

    gas-phase concentration at steady state(y). For both, DEP and DnBP, the y0 obtained was lower than the respective saturation vapor pressure (Ps). Furthermore, for both phthalates in latex paint, the material/air partition coefficient (C0/y0) was close in value to the octanol/air partition coefficient...

  5. Marketing techniques and cost calculations of radiation vulcanised natural rubber latex (RVNRL)

    International Nuclear Information System (INIS)

    Wan Manshol Wan Zin; Chai Chee Keong; Najib Mohammed Zakey; Hafizuddin Maseri

    2005-01-01

    This paper describes how RVNRL is promoted to the latex based industries locally and abroad. RVNRL promotion requires patience and very challenging. This is a fact since the product is new to the market. Cost is important in deciding its market and potential usage. The elements that contribute to the cost is described in this paper. (Author)

  6. The effects of temperature and pH bacterial degradation of latex ...

    African Journals Online (AJOL)

    The goal of this study was to integrate the activities of paint deterioration of microbial communities (microcosms) on the basis of environmental factors. The effect of temperature and pH on bacterial degradation of latex paint under humid condition by bacterial isolates was studied. Results obtained revealed that paint ...

  7. THE PRIMARY STRUCTURE OF HEVAMINE, AN ENZYME WITH LYSOZYME CHITINASE ACTIVITY FROM HEVEA-BRASILIENSIS LATEX

    NARCIS (Netherlands)

    JEKEL, PA; HARTMANN, JBH; BEINTEMA, JJ

    1991-01-01

    The primary structure of hevamine, an enzyme with lysozyme/chitinase activity from Hevea brasiliensis latex, has been determined predominantly with conventional non-automatic methods. The positions of three disulfide bridges have been determined. The sequence has about 60% identity with that of a

  8. Lipid transfer protein from Hevea brasiliensis (Hev b 12), a cross-reactive latex protein

    NARCIS (Netherlands)

    Beezhold, Donald H.; Hickey, Vicky L.; Kostyal, David A.; Puhl, Henry; Zuidmeer, Laurian; van Ree, Ronald; Sussman, Gordon L.

    2003-01-01

    BACKGROUND: Latex-allergic individuals experience clinical cross-reactivity to a large number of fruits and vegetables. Much of the cross-reactivity can be attributed to Hev b 6, but evidence indicates that additional cross-reactive allergens may be present. A common pan-allergen, which has not

  9. Adsorption of immunoglobulin G on core-shell latex particles precoated with chaps

    NARCIS (Netherlands)

    Giacomelli, CE; Vermeer, AWP; Norde, W

    2000-01-01

    The aim of this work is to investigate the adsorption behavior of a monoclonal antibody (immunoglobulin G, IgG) on latex particles, possessing reactive chloromethyl groups, precoated with 3-([3-cholamidopropyl]dimethylammonio-1-propansulfonate (Chaps). The amount and reactivity of the surface

  10. Adsorption of immunoglobulin G on core-shell latex particles precoated with chaps

    NARCIS (Netherlands)

    Giacomelli, C.E.; Vermeer, A.W.P.; Norde, W.

    2000-01-01

    The aim of this work is to investigate the adsorption behavior of a monoclonal antibody (immunoglobulin G, IgG) on latex particles, possessing reactive chloromethyl groups, precoated with 3-([3-cholamidopropyl]dimethylammonio-1-propanesulfonate (Chaps). The amount and reactivity of the surface

  11. Costs and return analysis in rubber latex production in Edo State ...

    African Journals Online (AJOL)

    The study examined the costs and return analysis in rubber latex production in Edo Sate, Nigeria. Multi-stage sampling method was adopted to select 96 smallholder rubber framers for the study. The first stage was a purposive sampling of two LGAs and then simple random sampling of 6 villages each from the two LGA.

  12. Latex allergy: assessment of knowledge, appropriate use of gloves and prevention practice among hospital healthcare workers.

    Science.gov (United States)

    Al-Niaimi, F; Chiang, Y Z; Chiang, Y N; Williams, J

    2013-01-01

    Healthcare workers and patients are often exposed to natural rubber latex (NRL) through contact with gloves and various healthcare products, which can potentially cause allergic reactions, with varying degrees of severity. In 2008, the Royal College of Physicians published their first evidence-based guidance on occupational health interventions for latex allergy, which emphasized the importance of healthcare workers having knowledge of latex allergy. This study aimed to survey the knowledge of healthcare workers (n = 156) about latex gloves and NRL allergy, routine prevention practice and the appropriate use of gloves in patient care. Healthcare workers in a large teaching hospital were surveyed using a standard questionnaire. We found that only 1% of healthcare workers were able to correctly match the appropriate gloves to the specifically designed procedure. More than half (n = 74.53%) were unable to recognize the presentation of type 1 allergy to NRL. Of the 156 participants, 131 (84%) considered that they would benefit from training about NRL allergy and the use of different types of gloves in clinical care. This survey indicates the importance of education regarding appropriate use of gloves and prevention of NRL allergy among healthcare workers, and dermatologists should play an important role in facilitating this. © The Author(s). CED © 2012 British Association of Dermatologists.

  13. Formation of Defect-Free Latex Films on Porous Fiber Supports

    KAUST Repository

    Lively, Ryan P.

    2011-09-28

    We present here the creation of a defect-free polyvinylidene chloride barrier layer on the lumen-side of a hollow fiber sorbent. Hollow fiber sorbents have previously been shown to be promising materials for enabling low-cost CO 2 capture, provided a defect-free lumen-side barrier layer can be created. Film experiments examined the effect of drying rate, latex age, substrate porosity (porous vs nonporous), and substrate hydrophobicity/ hydrophilicity. Film studies show that in ideal conditions (i.e., slow drying, fresh latex, and smooth nonporous substrate), a defect-free film can be formed, whereas the other permutations of the variables investigated led to defective films. These results were extended to hollow fiber sorbents, and despite using fresh latex and relatively slow drying conditions, a defective lumen-side layer resulted. XRD and DSC indicate that polyvinylidene chloride latex develops crystallinity over time, thereby inhibiting proper film formation as confirmed by SEM and gas permeation. This and other key additional challenges associated with the porous hollow fiber substrate vs the nonporous flat substrate were overcome. By employing a toluene-vapor saturated drying gas (a swelling solvent for polyvinylidene chloride) a defect-free lumen-side barrier layer was created, as investigated by gas and water vapor permeation. © 2011 American Chemical Society.

  14. Diagnosis of toxoplasmosis in pregnancy. Evaluation of latex-protein complexes by immnunoagglutination.

    Science.gov (United States)

    Peretti, Leandro E; Gonzalez, Verónica D G; Marcipar, Iván S; Gugliotta, Luis M

    2017-07-01

    The aim of this work was to obtain a reagent based on latex particles for ruling out acute toxoplasmosis in pregnant women by immunoagglutination (IA). Latex-protein complexes (LPC) were previously synthesized coupling the recombinant protein of Toxoplasma gondii P22Ag and the homogenate of the parasite to latex particles with different size, chemical functionality and charge density. LPC were tested in IA assays against a panel of 72 pregnant women serum samples. Results were analysed through receiver operating characteristic curves, determining area under the curve (AUC), sensitivity, specificity positive and negative predictive values (PPV and NPV, respectively). It was observed that the antigenicity of proteins was not affected during sensitization by either physical adsorption or covalent coupling. The best results in the sense of maximizing discrimination of low avidity sera from chronic ones were observed for the IA test based on latex particles with carboxyl functionality and the recombinant P22Ag, obtaining an AUC of 0·94, a sensitivity of 100% and a NPV of 100%. In this way, the proposed test could be useful for the toxoplasmosis diagnosis in pregnant women, with the advantages of being cheap, rapid and easy to be implemented.

  15. Latex particle template lift-up guided gold wire-networks via evaporation lithography

    KAUST Repository

    Lone, Saifullah; Vakarelski, Ivan Uriev; Chew, Basil; Wang, Zhihong; Thoroddsen, Sigurdur T

    2014-01-01

    We describe a hybrid methodology that combines a two dimensional (2D) monolayer of latex particles (with a pitch size down to 1 μm) prepared by horizontal dry deposition, lift-up of a 2D template onto flat surfaces and evaporation lithography to fabricate metal micro- and nano wire-networks. This journal is

  16. Dynamics of ballistically injected latex particles in living human endothelial cells

    NARCIS (Netherlands)

    Li, Y.; Vanapalli Veera, V.S.A.R.; Vanapalli, Srinivas; Duits, Michael H.G.

    2009-01-01

    We studied the dynamics of ballistically injected latex particles (BIP) inside endothelial cells, using video particle tracking to measure the mean squared displacement (MSD) as a function of lag time. The MSD shows a plateau at short times and a linear behavior at longer times, indicating that the

  17. Insights on the Phytochemical Profile (Cyclopeptides and Biological Activities of Calotropis procera Latex Organic Fractions

    Directory of Open Access Journals (Sweden)

    Thiago Lustosa Jucá

    2013-01-01

    Full Text Available Calotropis procera is a medicinal plant whose pharmacological properties are associated with its latex. Here, the Calotropis procera latex fractions were investigated in an attempt to trace its phytochemical profile and measure its anti-inflammatory and toxicity activity. The crude latex was partitioned, yielding five fractions (49.4% hexane, 5.2% dichloromethane, 2.0% ethyl acetate, 2.1% n-butanol, and 41.1% aqueous. Phytochemical screening and spectroscopy analysis revealed that dichloromethane is the most chemically diverse fraction. Triterpenes were detected in both the hexane and dichloromethane fractions, while flavonoids were detected in the dichloromethane and ethyl acetate fractions. These fractions were cytotoxic to cancer cell lines (LD50 0.05 to 3.9 μg/mL and lethal to brine shrimp (LD50 10.9 to 65.7 μg/mL. Reduced neutrophil migration in rats was observed in carrageenan-induced peritonitis for the dichloromethane (67%, ethyl acetate (56%, and aqueous (72% fractions. A positive reaction with tolidine and ninhydrin suggested that cyclopeptides are in the ethyl acetate fraction. It is therefore concluded that Calotropis procera latex dichloromethane and ethyl acetate fractions exhibit both in vitro and in vivo activities as well as anti-inflammatory properties. Cyclopeptide detection is especially interesting because previous attempts to investigate these low-molecular cyclic amino acid sequences in C. procera have failed.

  18. Radiation prevulcanized natural rubber latex: Cytotoxicity and safety evaluation on animal

    International Nuclear Information System (INIS)

    Keong, C C; Zin, W M Wan; Ibrahim, P; Ibrahim, S

    2010-01-01

    Radiation prevulcanized natural rubber latex (RVNRL) was claimed to be more user friendly than natural rubber latex prevulcanized by sulphur curing system. The absence of Type IV allergy inducing chemicals in RVNRL make it a suitable material for manufacturing of many kinds of latex products, especially those come into direct contact with users. This paper reveals and discusses the findings of cytotoxicity test and safety evaluation on animal for RVNRL. The test was done on RVNRL films prepared by coagulant dipping method and RVNRL dipped products produced by latex dipped product manufacturers. Cytotocixity test was carried out on mammalian cell culture American Type Culture Collection CCL 81, Vero. Results indicated that no cytotoxic effect from RVNRL films and products was found on the cell culture. Two animal studies, namely dermal sensitization study and primary skin irritation study, were done on gloves made from RVNRL. Albino white guinea pigs were used as test subjects in dermal sensitization study and results showed no sensitization induced by the application of test material in the guinea pigs. Primary skin irritation study was done on New Zealand white rabbits and results showed that the product tested was not corrosive and was not a primary irritant

  19. [Detection of anti-Leptospira antibodies in sera of patients in the latex agglutination test].

    Science.gov (United States)

    Volina, E G; Sarukhanova, L E; Iashina, N V; Prokopov, N I; Shkarlat, P E; Barysheva, I V

    2001-01-01

    The results of the preliminary evaluation of the sensitivity and specificity of the newly developed diagnostic test based on the determination of genus-specific antibodies to leptospires in the latex agglutination test, are presented. This test makes it possible to detect anti-Leptospira antibodies of any serogroup. The advantages of the developed test have been determined.

  20. Dynamic speciation analysis of atrazine in aqueous latex nanoparticle dispersions using solid phase microextraction (SPME)

    NARCIS (Netherlands)

    Benhabib, K.; Town, R.M.; Leeuwen, van H.P.

    2009-01-01

    Solid phase microextraction (SPME) is applied in the dynamic speciation analysis of the pesticide atrazine in an aqueous medium containing sorbing latex nanoparticles. It is found that the overall rate of extraction of the analyte is faster than in the absence of nanoparticles and governed by the

  1. Pilot Scale Production of Irradiated Natural Rubber Latex and its Dipping Products

    Directory of Open Access Journals (Sweden)

    M. Utama

    2005-07-01

    Full Text Available One hundred and fifty kg natural rubber latex (NRL before and after concentration were added with 3 phr (part hundred ratio of rubber normal butyl acrylate, then the mixture were irradiated at 25 kGy by gamma rays of 60Co in pilot scale. The irradiated natural rubber latex (INRL were then being to use for producing rubber products such as condom, surgical gloves, and spygmomanometer in factory scale. The quality of INRL and rubber products such as : total solid content (TSC, dry rubber content (DRC, KOH, VFA and MST number, tensile strength, modulus, elongation at break, extractable protein content, and response against Type I allergy etc. were evaluated. The economic aspect for producing INRL by means of Gamma Irradiator (GI and Electron Beam Machine (EBM such as payback period (PP, net present value (NPV and internal rate return (IRR were calculated. The results showed that the latex properties of INRL such as DRC, TSC, KOH, VFA, and MST number are not only found to the requirement of the ISO 2004 standard but also the latex has low protein, lipid, and carbohydrate content. The physical and mechanical properties (tensile strength, modulus, and elongation at break of rubber dipping products such as condom, gloves, and sphygmomanometer are not only found to the requirement of ISO 4074, ISO 10282, and ANSI/AAMI SP-1994 standards, but also the allergic response tested clinical latex-sensitive protein allergen by ELISA test on gloves, and by SPT test on condom are found to be negative. It indicates that production of INRL or PVNRL or RVNRL by EBM 250 keV/10 mA, was more cheap than by using gamma γ irradiator 200 kCi, or sulfur vulcanization. The value of PBP (payback period was 2,1 years, NPV (net present value was 4,250 US $, PI (profitability index 1,06 and IRR (internal rate of returns was 25,0%.

  2. Manipulating the percolation threshold of carbon nanotubes in polymeric composites

    NARCIS (Netherlands)

    Hermant, M.C.

    2009-01-01

    The latex-based technique to introduce carbon nanotubes (CNTs) into polymers has shown to be highly versatile and to produce conductive composites with low loadings of CNTs (<1wt%). For certain applications, these loadings are still too high to be commercially viable. In this work we have examined

  3. First record of the behavior of latex drainage by Trigona spinipes (Fabricius (Hymenoptera, Apidae in laticiferous flowers

    Directory of Open Access Journals (Sweden)

    Cristiana Koschnitzke

    2011-09-01

    Full Text Available This paper describes the behavior of the bee Trigona spinipes, to avoid the latex, when piercing the base of the tubular corolla of the flowers of Mandevilla guanabarica in order to steal the nectar.

  4. Biodegradability and aging study of rubber films obtained by gamma radiation vulcanization processes of latex; Estudo da biodegradabilidade e envelhecimento de filmes de borracha obtidos por processos de vulcanizacao do latex por radiacao induzida de fonte gama

    Energy Technology Data Exchange (ETDEWEB)

    Martins, Carlos Felipe Pinto

    2005-07-01

    The natural rubber latex (NRL) is industrially crosslinked by the conventional process of vulcanization, which uses sulphur and heat. Otherwise, the network can also be done by the alternative process with ionizing radiation. In this work the crosslinking of NRL was studied by the comparison of the conventional vulcanization system and the ionizing radiation process of {sup 60}C source. The products obtained, the irradiated latex, the irradiated latex with approximately 1% of soy lecithin and the sulphur vulcanized latex were tested by accelerated aging with ultraviolet (UV) and outdoor aging with compostage, tensile strength at break, swelling and gel fraction, fungi micro biota, scanning electron microscopy (SEM), infrared spectroscopy (FTIR) and thermogravimetry and differential scanning calorimetry analysis (TG and DSC). The results showed that the aging with microorganisms have a great influence in the physical properties of the samples. The thermal stability order observed showed that the sulphur vulcanized latex is more resistant, what is probably associated to a network more stable under the aging conditions. On the other hand, the irradiated latex showed intense biodegradation aspects, particularly with the presence of the soy lecithin. (author)

  5. Colloid stable sorbents for cesium removal: Preparation and application of latex particles functionalized with transition metals ferrocyanides

    Energy Technology Data Exchange (ETDEWEB)

    Avramenko, Valentin [Institute of Chemistry, Far Eastern Branch, Russian Academy of Sciences, 159 ave 100-letiya Vladivostoka, Vladivostok 690022 (Russian Federation); Bratskaya, Svetlana, E-mail: sbratska@ich.dvo.ru [Institute of Chemistry, Far Eastern Branch, Russian Academy of Sciences, 159 ave 100-letiya Vladivostoka, Vladivostok 690022 (Russian Federation); Zheleznov, Veniamin; Sheveleva, Irina [Institute of Chemistry, Far Eastern Branch, Russian Academy of Sciences, 159 ave 100-letiya Vladivostoka, Vladivostok 690022 (Russian Federation); Voitenko, Oleg [Far Eastern Federal University, Laboratory of Electron Microscopy and Image Processing, 27, Oktyabr' skaya Street, Vladivostok 690950 (Russian Federation); Sergienko, Valentin [Institute of Chemistry, Far Eastern Branch, Russian Academy of Sciences, 159 ave 100-letiya Vladivostoka, Vladivostok 690022 (Russian Federation)

    2011-02-28

    In this paper we suggest a principally new approach to preparation of colloid stable selective sorbents for cesium uptake using immobilization of transition metals (cobalt, nickel, and copper) ferrocyanides in nanosized carboxylic latex emulsions. The effects of ferrocyanide composition, pH, and media salinity on the sorption properties of the colloid stable sorbents toward cesium ions were studied in solutions containing up to 200 g/L of sodium nitrate or potassium chloride. The sorption capacities of the colloid sorbents based on mixed potassium/transition metals ferrocyanides were in the range 1.3-1.5 mol Cs/mol ferrocyanide with the highest value found for the copper ferrocyanide. It was shown that the obtained colloid-stable sorbents were capable to penetrate through bulk materials without filtration that made them applicable for decontamination of solids, e.g. soils, zeolites, spent ion-exchange resins contaminated with cesium radionuclides. After decontamination of liquid or solid radioactive wastes the colloid-stable sorbents can be easily separated from solutions by precipitation with cationic flocculants providing localization of radionuclides in a small volume of the precipitates formed.

  6. Deposition behavior of polystyrene latex particles on solid surfaces during migration through an artificial fracture in a granite rock sample

    International Nuclear Information System (INIS)

    Chinju, Hirofumi; Tanaka, Satoru; Kuno, Yoshio

    2001-01-01

    The deposition behavior of colloids during transport through heterogeneous media was observed by conducting column experiments to study migration of polystyrene latex particles (diameter=309 nm) through columns packed with artificially fractured granite rock (length=300 and 150 mm). The experiments were conducted under conditions of different ionic strengths and flow rates. The results were similar to those for colloid deposition in columns packed with glass beads reported previously; the colloid breakthrough curves showed three stages, characterized by different rates of change in the concentration of effluent. Colloid deposition on the fracture surfaces was described by considering strong and weak deposition sites. Scanning Electron Microscopy (SEM) observations indicated the existence of strong and weak sites on the fracture surfaces regardless of mineral composition. The observations also showed that the strong deposition sites tended to exist on surface irregularities such as cracks or protrusions. The degree of colloid deposition increased with increasing ionic strength and decreasing flow rate. The dependencies on ionic strength and flow rate agreed qualitatively with the DLVO theory and the previous experimental results, respectively. (author)

  7. Prevalence of manufacturing defects in latex examination gloves used in selected dental practices in central Saudi Arabia.

    Science.gov (United States)

    Al-Swuailem, Abdullah S

    2014-07-01

    To assess the defect rates in latex examination gloves used in selected dental practices in Riyadh, Saudi Arabia. In this cross-sectional study, a total of 796 latex examination gloves were collected from 5 governmental hospitals and 5 private dental practices between April 2012 and May 2012. The gloves were assessed for presence of defects visually (VT) and using water inflation test (WIT). One and 2 sample t-tests were used to assess significant differences in defect rates among each latex brand, and between governmental hospitals and private dental practices. Defects in latex gloves were more likely to be identified using WIT compared with VT (20.2% versus 4.3%, p=0.000). Using WIT, examined latex gloves had a defect rate approximately 8 times the acceptable quality level of 2.5% (20.2%, p=0.000). Using WIT, gloves used in private dental practices had significantly higher defect rates compared with governmental dental clinics (25.6% versus 14.6%, p=0.006). Most latex examination gloves used in the sampled governmental dental clinics and private dental practices in Riyadh had significantly higher preexisting defect rates than acceptable standard levels.

  8. Frequent IgE sensitization to latex, cow's milk, and egg in children with short bowel syndrome.

    Science.gov (United States)

    Mazon, Angel; Solera, Eva; Alentado, Noemi; Oliver, Fernando; Pamies, Rafael; Caballero, Luis; Nieto, Antonio; Dalmau, Jaime

    2008-03-01

    Children with short bowel syndrome (SBS) undergo frequent operations, so they are at risk for sensitizing to latex. There have been isolated reports of sensitization to food in these children. In a cross-sectional study, we assessed sensitization to latex, cow's milk, and egg with skin prick tests (SPT) and serum-specific immunoglobulin E (IgE) in 14 children with SBS. Data were collected about the number of operations with latex devices, serum total IgE, and history of feeding with milk formula. Ten children were sensitized to latex (specific IgE median: 6.7 kU/l, range: 0.5-33). Compared with those non-sensitized, sensitized children had significantly (p range: 0.5-21.1 kU/l), and five to egg (specific IgE median: 0.68, range: 0.58-2.17 kU/l). Except for some isolated days with cow's milk formula, the children had been initially fed with a diet without intact cow's milk proteins. Sensitization to latex, cow's milk, and egg is very frequent in children with SBS. They should be treated in a latex-free environment since the very early stages of the disease, and should be routinely studied regarding food sensitization, as this might contribute as an added factor in the chronic diarrhea of these patients.

  9. Studies on the effect of nano-TiO{sub 2} on vinyl acetate-butyl acrylate latex-based surface coating

    Energy Technology Data Exchange (ETDEWEB)

    Suma, K.K. [Dept. of Polymer Science and Rubber Technology, Cochin University of Science and Technology, Kochi 22, Kerala (India); Dept. of Chemistry, Maharaja' s College, Ernakulam, Kerala (India); Jacob, Sinto [Dept. of Polymer Science and Rubber Technology, Cochin University of Science and Technology, Kochi 22, Kerala (India); Joseph, Rani, E-mail: rani@cusat.ac.i [Dept. of Polymer Science and Rubber Technology, Cochin University of Science and Technology, Kochi 22, Kerala (India)

    2010-04-15

    Vinyl acetate-butyl acrylate (VAc-BuA) copolymer latex was prepared by emulsion polymerization. The polymerization conditions and the composition were optimized. The 85/15 wt.% (vinyl acetate/butyl acrylate) gave good tensile strength of the order of 15.6 MPa and a glass transition temperature (T{sub g}) value of -6.49 deg. C. This copolymer was used as a binder in the paint formulation. In this formulation nanosized TiO{sub 2} sol was used as a pigment instead of conventional rutile TiO{sub 2}. Nanosized TiO{sub 2} is prepared by wet process. These nanosized TiO{sub 2} rutile colloidal sol has improved properties such as photostability, UV shielding, dispersion stability, etc. The surface properties of paint were found to be superior compared to commercially used paint.

  10. Effect of chemical composition on the flocculation dynamics of latex-based synthetic activated sludge

    International Nuclear Information System (INIS)

    Tan Phong Nguyen; Hankins, Nicholas P.; Hilal, Nidal

    2007-01-01

    This study investigates the effect of calcium, alginate, fibrous cellulose, and pH on the flocculation dynamics and final properties of synthetic activated sludges. A laboratory-scale batch reactor, fed with standard synthetic sludges was used. The effects of varying calcium concentration (5-25 mM), alginate concentration (25-125 mg/L), fibrous cellulose concentration (0.2-0.8 g/L) and pH (3-9) on the sludge characteristics were studied by varying one parameter whilst keeping the others constant. The results from experiments indicated that the calcium, alginate, fibrous cellulose, and pH had the critical effect on the aggregation rate, flocs size, and made the improvement of the final properties of sludge. Dynamic measurements have established the optimum conditions for floc formation and can accurately reflect the state of formation of the synthetic activated sludge flocs. These correlate well with measurements of settleability and turbidity of the synthetic activated sludge. The results of this study support the bonding theory and indicate that formation of cations-polymer complexes and polymer gelation are important means of flocculation. The development of synthetic activated sludges is suggested also to be a possible surrogate for studying the final properties of activated sludge

  11. Radiation-induced grafting polymerization of MMA onto polybutadiene rubber latex

    International Nuclear Information System (INIS)

    Peng Jing; Wang Maolin; Qiao Jinliang; Wei Genshuan

    2005-01-01

    The grafting of methyl methacrylate (MMA) onto polybutadiene rubber latex by the direct radiation method was carried out. The effects of monomer concentration, absorbed dose and dose rate of gamma rays on the grafting yield were investigated. The graft copolymers were characterized by transmission electron microscopy (TEM), FTIR spectroscopy, and differential scanning calorimetry. TEM photographs revealed that the core-shell structures of latex particles are formed at low MMA content, and with the increasing of MMA content, the semi-IPN-like structure with core-shell could be developed due to the high gel fraction of polybutadiene (PBD) seed particles. In addition, infrared analysis confirmed that MMA could be grafted onto PBD molecular chains effectively under appropriate irradiation conditions. The interfacial adhesion between PBD rubber (core) and PMMA (shell) phases could be enhanced with the increase of MMA concentration

  12. EVALUATION OF CYTOTOXIC, ANTIMICROBIAL AND ANTIINFLAMMATORY PROPERTIES FROM THE LATEX OF IPOMEA STAPHYLINA

    Directory of Open Access Journals (Sweden)

    Prasanthi Narra

    2014-04-01

    Full Text Available The plant Ipomoea staphylina has been used in diverse traditional medication for the treatment of diseases and illness of human beings. The crude latex extract obtained from the stem of Ipomea staphylina was evaluated for cytotoxic, antimicrobial and wound healing properties. Cell viability and cytotoxicity assays such as Colony Formation method and Enzyme based methods that determined cell viability with a colorimetric method were performed to evaluate the medicinal properties of Ipomea staphylina. Similarly Microbiological Antibiotic Assay to determine the antimicrobial properties and wound healing properties were tested by determining the potent anti-inflammatory molecules that inhibited COX and LOX enzymes. Results showed that the latex crude extract of Ipomea staphylina showed potent Antimicrobial and Antiinflamatory properties, but the viability of the cells were unaffected.

  13. Tensile properties of latex paint films with TiO2 pigment

    Science.gov (United States)

    Hagan, Eric W. S.; Charalambides, Maria N.; Young, Christina T.; Learner, Thomas J. S.; Hackney, Stephen

    2009-05-01

    The tensile properties of latex paint films containing TiO2 pigment were studied with respect to temperature, strain-rate and moisture content. The purpose of performing these experiments was to assist museums in defining safe conditions for modern paintings held in collections. The glass transition temperature of latex paint binders is in close proximity to ambient temperature, resulting in high strain-rate dependence in typical exposure environments. Time dependence of modulus and failure strain is discussed in the context of time-temperature superposition, which was used to extend the experimental time scale. Nonlinear viscoelastic material models are also presented, which incorporate a Prony series with the Ogden or Neo-Hookean hyperelastic function for different TiO2 concentrations.

  14. n-BA/KOH/t-BHP behaviour in the natural rubber latex vulcanization by gamma rays

    International Nuclear Information System (INIS)

    Souza, A. de.

    1994-01-01

    Natural rubber latex was vulcanized in the absence and in the presence of sensitizer (S), with gamma ray from 60 Co source, panoramic type, at the dose rate range of 1,20-1,33 kGy/h. The components of used S were n-butyl acrylate (n-BA), the KOH as stabilizer and t-butyl hydroperoxide (t-BHP) as co-S. The purpose of this work was to study the efficiency and the behaviour of each component of S in the irradiated latex crosslinking by tensile strength (T b ), volume fraction and permanent set. In the absence of S occur straight crosslinking between macromolecular adjacent radicals. IN the presence of S, the n-BA participates in the crosslinking through acrylic bridges between macromolecules. (author)

  15. The effect of proteins on the aging properties of radiation vulcanized natural rubber latex

    International Nuclear Information System (INIS)

    Abad, L.V.

    1993-01-01

    The effect of natural rubber latex (NRL) proteins on the aging properties of NRL films was investigated. SDS-PAGE electrophoresis of the rubber proteins in NRL (Sri-Lanka) indicated a total of 18 proteins. A sharp decrease in tensile strength was observed after aging when NRL films were leached in 1% NH 4 OH. However, when these films were soaked in ethanol prior to leaching, the aging properties approximated those of the unleashed samples. Electrophoretic analysis of the proteins present in the NH 3 extracts of leached RVNRL films showed a high concentration of the protein herein. This protein was not found in the NH 3 extracts of ethanol soaked films. NRL proteins were shown to decelerate the aging process of Radiation Vulcanized Natural Rubber Latex (RVNRL) films. Among the proteins, herein exhibited good anti-aging properties. The hydrolyzates from NR proteins also enhanced considerably the aging properties of RVNRL. (auth.). 8 refs.; 40 figs.; 30 tabs

  16. texreg: Conversion of Statistical Model Output in R to LATEX and HTML Tables

    Directory of Open Access Journals (Sweden)

    Philip Leifeld

    2013-11-01

    Full Text Available A recurrent task in applied statistics is the (mostly manual preparation of model output for inclusion in LATEX, Microsoft Word, or HTML documents usually with more than one model presented in a single table along with several goodness-of-fit statistics. However, statistical models in R have diverse object structures and summary methods, which makes this process cumbersome. This article first develops a set of guidelines for converting statistical model output to LATEX and HTML tables, then assesses to what extent existing packages meet these requirements, and finally presents the texreg package as a solution that meets all of the criteria set out in the beginning. After providing various usage examples, a blueprint for writing custom model extensions is proposed.

  17. The role of proteins on the thermal oxidative aging of radiation vulcanized natural rubber latex

    International Nuclear Information System (INIS)

    Abad, L.V.; Rosa, A. de la; Keizo Makuuchi; Fumio Yoshii

    1996-01-01

    The effect of Hevea latex proteins on the aging properties of radiation vulcanized natural rubber latex (RVNRL) was investigated. Unpurified RVNRL films exhibited better aging properties than the purified RVNRL films. A sharp decrease in tensile strength was observed after aging when RVNRL films were leached in 1% NH sub 4 OH. However, when these films were soaked in ethanol prior to leaching, the aging properties approximated those of the unleached samples. Kjeldahl and FT-IR analyses of the leached and unleached RVNRL films indicated a higher protein content for both the unleached and ethanol-soaked films than for leached films. Electrophoretic analysis of the proteins present in the NH, extracts of leached RVNRL films showed a high concentration of hevein. This protein was not found in the ATH, extracts of ethanol soaked films. Hevein was shown to improve the aging properties of RVNRL

  18. Numerical Simulation and Experimental Validation of the Inflation Test of Latex Balloons

    Directory of Open Access Journals (Sweden)

    Claudio Bustos

    Full Text Available Abstract Experiments and modeling aimed at assessing the mechanical response of latex balloons in the inflation test are presented. To this end, the hyperelastic Yeoh material model is firstly characterized via tensile test and, then, used to numerically simulate via finite elements the stress-strain evolution during the inflation test. The numerical pressure-displacement curves are validated with those obtained experimentally. Moreover, this analysis is extended to a biomedical problem of an eyeball under glaucoma conditions.

  19. Study on grafting of monomer onto natural rubber latex by radiation technique

    International Nuclear Information System (INIS)

    Nguyen Tan Man; Le Hai; Tran Thi Tam; Le Huu Tu, Pham Thi Sam; Dao Minh Phuong; Ha Thuc Huy

    2004-01-01

    Radiation vulcanization of natural rubber latex has been extensively developed through programmers assisted by the IAEA and UNDP under RCA in Asia and Pacific Region. R-D has been done in most of the Member States with technical assistance from Japan's Takasaki Radiation Chemistry Establishment. Radiation vulcanized natural rubber latex (RVNRL) has many advantages over the conventional sulfur vulcanized latex, such as absence of nitrosamine and low cytotoxicity. Radiation crosslinking is a room temperature process, itself an important cost advantage, it is easily controlled and desired extend of crosslinking is easily achieved by controlling the dose (irradiation time). Disadvantages of RVNRL to be improved are poor physical properties of film such as low tensile strength and tear strength. The research groups of Japan, Thailand and Indonesia concentrated on the improvement of physical properties of RVNRL using radiation grafted PMMA as additive [2]. F. Sundardi and W. Sofiarti have reported that tensile strength and hardness increased by radiation grafting of styrene onto NR [5]. Ono et al have reported the grafting of MMA onto NR by gamma irradiation at a dose of 5 kGy for producing thermoplastic elastomers [4]. The objective of this project is to report the results of studies of radiation graft-copolymerization of methyl methacrylate (MMA) or styrene (St) onto natural rubber latex in order to improve their physico-mechanical properties and evaluation of grafted material using Small-Angle Neutron Scattering through FNCA Project. The grafting degree of MMA and St onto NR increased with the increase of irradiation dose and monomer concentration. The alteration of grafted products structure was determined by IR method. Tensile strength, Shore A hardness, 100% modulus of grafted products increased with the increase of monomer concentration and irradiation dose while elongation at break decreased. The grafted products were characterized by Transmission Electron

  20. Numerical Simulation and Experimental Validation of the Inflation Test of Latex Balloons

    OpenAIRE

    Bustos, Claudio; Herrera, Claudio García; Celentano, Diego; Chen, Daming; Cruchaga, Marcela

    2016-01-01

    Abstract Experiments and modeling aimed at assessing the mechanical response of latex balloons in the inflation test are presented. To this end, the hyperelastic Yeoh material model is firstly characterized via tensile test and, then, used to numerically simulate via finite elements the stress-strain evolution during the inflation test. The numerical pressure-displacement curves are validated with those obtained experimentally. Moreover, this analysis is extended to a biomedical problem of an...

  1. The influence of temperature and reaction time in the degradation of natural rubber latex

    International Nuclear Information System (INIS)

    Siti Zaleha Isa; Rosiyah Yahya; Aziz Hassan; Mohd Tahir

    2007-01-01

    Liquid natural rubber (LNR /LENR) should be considered as a new material instead of a new type of rubber though they have the same configuration as the rubber used. In this work, thermal degradation of natural rubber latex was carried out to obtain LNR/LENR by varying the reaction time at different temperatures. The degraded polymers were characterized structurally using FTIR and NMR spectroscopies and the average molecular weights were determined by membrane-osmometry and viscometry. (author)

  2. Study on preparation of new antioxidants for radiation vulcanized natural rubber latex product. Antioxidant from keratin

    International Nuclear Information System (INIS)

    Nguyen Quoc Hien; Nguyen Van Toan; Vo Tan Thien; Le Hai

    2000-01-01

    The thermo-oxidative aging resistance of radiation vulcanization of natural rubber latex (RVNRL) products should be adequately by using suitable antioxidants or new kind of effective antioxidant. This work presents the results of preparation of natural antioxidant from hair keratin. Characteristics and effectiveness of resultant antioxidant are also presented. The results obtained indicates that antioxidant made from hair keratin is safe and effective for rubber products from RVNRL. (author)

  3. Comparison of the effect of using latex and nitrile gloves hand dexterity among Iranian population

    Directory of Open Access Journals (Sweden)

    T. Allahyari

    2014-02-01

    .Conclusion: Considering that there was no significant difference in the score of both fine finger and gross hand dexterity while using nitrile gloves as compared to the control condition (without gloves, means that use of nitrile gloves has no adverse effect on hand dexterity therefore, using nitrile gloves is recommended as a alternative for the latex gloves, considering the additional advantage of no allergic reaction in this gloves.

  4. Expression of VEGF and collagen using a latex biomembrane as bladder replacement in rabbits

    Directory of Open Access Journals (Sweden)

    André Luís Alonso Domingos

    2012-08-01

    Full Text Available OBJECTIVE: To investigate the VEGF expression and collagen deposition using a latex biomembrane as bladder replacement in rabbits. MATERIALS AND METHODS: After partial cystectomy, a patch of a non-vulcanized latex biomembrane (2 x 2 cm was sewn to the bladder of rabbits with 5/0 monofilament polydioxanone sulfate sutures in a watertight manner. Groups of 5 animals were killed at 15, 45 and 90 days after surgery and the bladder was removed. Sections of 5µm were cut and stained with picrosirius-red in order to estimate the amount of extracellular matrix in the graft. To confirm the presence of VEGF in tissues, protein expression was determined by immunohistochemistry. RESULTS: No death, urinary leakage or graft extrusion occurred in any group. All bladders showed a spherical shape. A progressive reduction in the amount of collagen occurred in the graft area and was negatively and linearly correlated with time (p < 0.001. VEGF expression was higher in grafted areas when compared to controls at 15 and 45 days after surgery and decreased with time (p < 0.001. CONCLUSION: The latex biomembrane as a matrix for partial bladder replacement in rabbits promotes temporary collagen deposition and stimulates the angiogenic process.

  5. Cytotoxicity Comparison of the Nanoparticles Deposited on Latex Rubber Bands between the Original and Stretched State

    Directory of Open Access Journals (Sweden)

    Jung-Hwan Lee

    2014-01-01

    Full Text Available Understanding the biocompatibility of nanoparticles in dental materials is essential for their safe usage in the oral cavity. In this study, we investigated whether nanoparticles deposited on orthodontic latex rubber bands are involved in the induction of cytotoxicity. A method of stretching to three times (“3L” the length of the latex rubber bands was employed to detach the particles using the original length (“L” for comparison. The cytotoxicity tests were performed on extracts with mouse fibroblasts (L929 and human gingival fibroblasts (HGFs. Fourier transform infrared spectroscopy, ion chromatography, elemental analysis, and inductively coupled plasma mass spectrometry (ICP-MS were performed to detect the harmful components in the extracts from rubber bands. There was a significant decrease in the cell viability in the “L” samples compared with the “3L” samples (P<0.05 in the L929 and HGF cells. This was due to the Ni single crystal nanoparticles (~50nm from the inner surface of “L” samples that were detached in the “3L” samples as well as the Zn ion (~9 ppm detected in the extract. This study revealed that the Ni nanoparticles, as well as Zn ions, were involved in the induction of cytotoxicity from the latex rubber bands.

  6. Sequence and expression analyses of ethylene response factors highly expressed in latex cells from Hevea brasiliensis.

    Directory of Open Access Journals (Sweden)

    Piyanuch Piyatrakul

    Full Text Available The AP2/ERF superfamily encodes transcription factors that play a key role in plant development and responses to abiotic and biotic stress. In Hevea brasiliensis, ERF genes have been identified by RNA sequencing. This study set out to validate the number of HbERF genes, and identify ERF genes involved in the regulation of latex cell metabolism. A comprehensive Hevea transcriptome was improved using additional RNA reads from reproductive tissues. Newly assembled contigs were annotated in the Gene Ontology database and were assigned to 3 main categories. The AP2/ERF superfamily is the third most represented compared with other transcription factor families. A comparison with genomic scaffolds led to an estimation of 114 AP2/ERF genes and 1 soloist in Hevea brasiliensis. Based on a phylogenetic analysis, functions were predicted for 26 HbERF genes. A relative transcript abundance analysis was performed by real-time RT-PCR in various tissues. Transcripts of ERFs from group I and VIII were very abundant in all tissues while those of group VII were highly accumulated in latex cells. Seven of the thirty-five ERF expression marker genes were highly expressed in latex. Subcellular localization and transactivation analyses suggested that HbERF-VII candidate genes encoded functional transcription factors.

  7. Latex-mediated synthesis of ZnS nanoparticles: green synthesis approach

    Energy Technology Data Exchange (ETDEWEB)

    Hudlikar, Manish; Joglekar, Shreeram [University of Pune, Division of Biochemistry, Department of Chemistry (India); Dhaygude, Mayur [National Chemical Laboratory, Polymer Science and Engineering Division (India); Kodam, Kisan, E-mail: kodam@chem.unipune.ac.in [University of Pune, Division of Biochemistry, Department of Chemistry (India)

    2012-05-15

    A low-cost, green synthesis of ZnS nanoparticles is reported using 0.3 % latex solution prepared from Jatropha curcas L. ZnS nanoparticles were characterized by X-ray diffraction, selected area electron diffraction, transmission electron microscopy, energy dispersive analysis of X-rays, UV-vis optical absorption and photoluminescence techniques. Fourier Transform Infrared Spectroscopy was performed to find the role of cyclic peptides namely curcacycline A (an octapeptide), curcacycline B (a nonapeptide) and curcain (an enzyme) as a possible reducing and stabilizing agents present in the latex of J. curcas L. The average size of ZnS nanoparticles was found to be 10 nm. Latex of J. curcas L. itself acts as a source of sulphide (S{sup -2}) ions that are donated to Zn ions under present experimental conditions. Source of sulphide (S{sup -2}) ions is still unclear, but we speculate that cysteine or thiol residues present in enzyme curcain may be donating these sulphide (S{sup -2}) ions.

  8. Latex-mediated synthesis of ZnS nanoparticles: green synthesis approach

    Science.gov (United States)

    Hudlikar, Manish; Joglekar, Shreeram; Dhaygude, Mayur; Kodam, Kisan

    2012-05-01

    A low-cost, green synthesis of ZnS nanoparticles is reported using 0.3 % latex solution prepared from Jatropha curcas L. ZnS nanoparticles were characterized by X-ray diffraction, selected area electron diffraction, transmission electron microscopy, energy dispersive analysis of X-rays, UV-vis optical absorption and photoluminescence techniques. Fourier Transform Infrared Spectroscopy was performed to find the role of cyclic peptides namely curcacycline A (an octapeptide), curcacycline B (a nonapeptide) and curcain (an enzyme) as a possible reducing and stabilizing agents present in the latex of J. curcas L. The average size of ZnS nanoparticles was found to be 10 nm. Latex of J. curcas L. itself acts as a source of sulphide (S-2) ions that are donated to Zn ions under present experimental conditions. Source of sulphide (S-2) ions is still unclear, but we speculate that cysteine or thiol residues present in enzyme curcain may be donating these sulphide (S-2) ions.

  9. Latex-mediated synthesis of ZnS nanoparticles: green synthesis approach

    International Nuclear Information System (INIS)

    Hudlikar, Manish; Joglekar, Shreeram; Dhaygude, Mayur; Kodam, Kisan

    2012-01-01

    A low-cost, green synthesis of ZnS nanoparticles is reported using 0.3 % latex solution prepared from Jatropha curcas L. ZnS nanoparticles were characterized by X-ray diffraction, selected area electron diffraction, transmission electron microscopy, energy dispersive analysis of X-rays, UV–vis optical absorption and photoluminescence techniques. Fourier Transform Infrared Spectroscopy was performed to find the role of cyclic peptides namely curcacycline A (an octapeptide), curcacycline B (a nonapeptide) and curcain (an enzyme) as a possible reducing and stabilizing agents present in the latex of J. curcas L. The average size of ZnS nanoparticles was found to be 10 nm. Latex of J. curcas L. itself acts as a source of sulphide (S −2 ) ions that are donated to Zn ions under present experimental conditions. Source of sulphide (S −2 ) ions is still unclear, but we speculate that cysteine or thiol residues present in enzyme curcain may be donating these sulphide (S −2 ) ions.

  10. Safety Evaluation Test on Human for Radiation Pre vulcanised Natural Rubber Latex (RVNRL)

    International Nuclear Information System (INIS)

    Pairu Ibrahim; Wan Manshol Wan Zain; Chai, Chee Keong; Sofian Ibrahim; Saadiah Sulaiman; Sharifah Ismail

    2010-01-01

    This paper discussed about clinical test conducted to determine safety evaluations on human for latex examination gloves and latex films made from Radiation Vulcanized Natural Rubber Latex (RVNRL). Two types of test were being adopted which are i) Modified Draize-95 test and ii) Patch Test on Sensitized Individuals. Modified Draize-95 test was conducted on 200 non-sensitized human subjects and Patch Test on Sensitized Individuals was conducted on 25 individuals who are allergic to the defined major chemical sensitizer presents in natural rubber product. It was found that Modified Draize-95 test has prove that there is no clinical evidence on the presence of residual chemical additives at the level that may induce Type IV allergy in the un sensitized general user population in the RVNRL gloves. Meanwhile Patch Test on Sensitized Individuals has proved that the patch test conducted using the test article on 25 individuals who are allergic to the defined major chemical sensitizers present in natural rubber products, thiuram, carbamates or thiazoles produced a negative response, meeting the pre requirement for the claim of reduced reaction-inducing potential. (author)

  11. Hierarchically structured self-supported latex films for flexible and semi-transparent electronics

    Science.gov (United States)

    Määttänen, Anni; Ihalainen, Petri; Törngren, Björn; Rosqvist, Emil; Pesonen, Markus; Peltonen, Jouko

    2016-02-01

    Different length scale alterations in topography, surface texture, and symmetry are known to evoke diverse cell behavior, including adhesion, orientation, motility, cytoskeletal condensation, and modulation of intracellular signaling pathways. In this work, self-supported latex films with well-defined isotropic/anisotropic surface features and hierarchical morphologies were fabricated by a peel-off process from different template surfaces. In addition, the latex films were used as substrates for evaporated ultrathin gold films with nominal thicknesses of 10 and 20 nm. Optical properties and topography of the samples were characterized using UV-vis spectroscopy and Atomic Force Microscopy (AFM) measurements, respectively. The latex films showed high-level transmittance of visible light, enabling the fabrication of semi-transparent gold electrodes. Electrochemical impedance spectroscopy (EIS) measurements were carried out for a number of days to investigate the long-term stability of the electrodes. The effect of 1-octadecanethiol (ODT) and HS(CH2)11OH (MuOH) thiolation and protein (human serum albumin, HSA) adsorption on the impedance and capacitance was studied. In addition, cyclic voltammetry (CV) measurements were carried out to determine active medicinal components, i.e., caffeic acid with interesting biological activities and poorly water-soluble anti-inflammatory drug, piroxicam. The results show that the fabrication procedure presented in this study enables the formation of platforms with hierarchical morphologies for multimodal (optical and electrical) real-time monitoring of length-scale-dependent biomaterial-surface interactions.

  12. Evaluation of force degradation characteristics of orthodontic latex elastics in vitro and in vivo.

    Science.gov (United States)

    Wang, Tong; Zhou, Gang; Tan, Xianfeng; Dong, Yaojun

    2007-07-01

    To evaluate the characteristics of force degradation of latex elastics in clinical applications and in vitro studies. Samples of 3/16-inch latex elastics were investigated, and 12 students between the ages of 12 and 15 years were selected for the intermaxillary and intramaxillary tractions. The elastics in the control groups were set in artificial saliva and dry room conditions and were stretched 20 mm. The repeated-measure two-way analysis of variance and nonlinear regression analysis were used to identify statistical significance. Overall, there were statistically significant differences between the different methods and observation intervals. At 24- and 48-hour time intervals, the force decreased during in vivo testing and in artificial saliva (P .05). In intermaxillary traction the percentage of initial force remaining after 48 hours was 61%. In intramaxillary traction and in artificial saliva the percentage of initial force remaining was 71%, and in room conditions 86% of initial force remained. Force degradation of latex elastics was different according to their environmental conditions. There was significantly more force degradation in intermaxillary traction than in intramaxillary traction. The dry room condition caused the least force loss. There were some differences among groups in the different times to start wearing elastics in intermaxillary traction but no significant differences in intramaxillary traction.

  13. Natural membranes of Hevea brasiliensis latex as delivery system for Casearia sylvestris leaf components

    Directory of Open Access Journals (Sweden)

    Flávio A. Carvalho

    Full Text Available ABSTRACT Natural latex from Hevea brasiliensis (Wild. ex A.Juss Müll.Arg., Euphorbiaceae, showed angiogenic action and Casearia sylvestris Sw., Salicaceae, leaf derivatives presented anti-inflammatory and wound healing activities. Therefore, an association of these effects was interesting for wound healing applications. The aims of this study were the development of membranes of natural latex incorporated with C. sylvestris leaf derivatives (ethanolic extract, diterpene concentrated fraction and casearin J, their chemical and physical characterization, and the evaluation of in vitro skin permeation and retention of C. sylvestris bioactive secondary metabolites (diterpenes and phenolic compounds. The membranes were developed mixing hydroethanolic solutions of C. sylvestris derivatives with latex and drying them in a desiccator. They were characterized by infrared spectroscopy, scanning electron microscopy, water vapor permeability and mechanical resistance assays, demonstrating that all membranes were permeable, resistant and homogeneous in surfaces. The permeation and retention assays demonstrated dermal penetration of phenolic compounds for ethanolic extract membrane and of casearin-like clerodane diterpenes for all membranes, indicating that these membranes have great potential for therapeutical application as a topical system for C. sylvestris components releasing.

  14. Clonal stability of latex yield in eleven clones of Hevea brasiliensis Muell. Arg.

    Directory of Open Access Journals (Sweden)

    K.O. Omokhafe

    2003-01-01

    Full Text Available Eleven Hevea brasiliensis clones were evaluated for clonal stability of latex yield. A randomized complete block design was used with four replicates, two locations, seven years and three periods per year. Stability analysis was based on clone x year and clone x year x location interactions. Five stability parameters viz environmental variance, shukla's stability variance, regression of clonal latex yield on environmental index, variance due to regression and variance due to deviation from regression were applied. There was significant clone x environment effect at the two levels of interaction. Among the eleven clones, C 162 was outstanding for clonal stability and it can serve as donor parent for stability alleles. Three clones (C 76, C 150 and C 154 were also stable. The four stable clones (C 76, C 150, C 154 and C 162 are suitable for broad-spectrum recommendation for latex yield. Five clones (C 83, C 143, C 163, C 202 and RRIM 600 will require environment-specific recommendation because of their unstable phenotype. The stability feature of two clones (C 145 and C 159 was not clear and this will be investigated in subsequent studies.

  15. Antimalarial Activity of the Chemical Constituents of the Leaf Latex of Aloe pulcherrima Gilbert and Sebsebe.

    Science.gov (United States)

    Teka, Tekleab; Bisrat, Daniel; Yeshak, Mariamawit Yonathan; Asres, Kaleab

    2016-10-28

    Malaria is one of the three major global public health threats due to a wide spread resistance of the parasites to the standard antimalarial drugs. Considering this growing problem, the ethnomedicinal approach in the search for new antimalarial drugs from plant sources has proven to be more effective and inexpensive. The leaves of Aloe pulcherrima Gilbert and Sebsebe, an endemic Ethiopian plant, are locally used for the treatment of malaria and other infectious diseases. Application of the leaf latex of A. pulcherrima on preparative silica gel TLC led to the isolation of two C -glycosylated anthrones, identified as nataloin ( 1 ) and 7-hydroxyaloin ( 2 ) by spectroscopic techniques (UV, IR, ¹H- and 13 C-NMR, HR-ESIMS). Both the latex and isolated compounds displayed antimalarial activity in a dose-independent manner using a four-day suppressive test, with the highest percent suppression of 56.2% achieved at 200 mg/kg/day for 2 . The results indicate that both the leaf latex of A. pulcherrima and its two major constituents are endowed with antiplasmodial activities, which support the traditional use of the leaves of the plant for the treatment of malaria.

  16. Content of Asthmagen Natural Rubber Latex Allergens in Commercial Disposable Gloves.

    Science.gov (United States)

    Bittner, C; Garrido, M V; Krach, L H; Harth, V

    The use of natural rubber latex (NRL) gloves in many occupations may lead to latex sensitization, allergic asthma, and skin reactions. Due to their good properties and environmental safety NRL gloves are still being used in the healthcare setting, but also in the food industry, by hairdressers, cleaners, etc. The aim of our study was to assess the protein and NRL allergen content in commercial gloves by different methods, including a new assay. Twenty commercially available NRL gloves were analyzed. Protein extraction was performed according to the international standard ASTM D-5712. Total protein content was measured with a modified Lowry method, NRL content with the CAP Inhibition Assay, the Beezhold ELISA Inhibition Assay, and an innovative ELISA with IgY-antibodies extracted from eggs of NRL-immunized hens (IgY Inhibition Assay). We found a high protein content in a range of 215.0-1304.7 μg/g in 8 out of the 20 NRL gloves. Seven of the 20 gloves were powdered, four of them with a high protein content. In gloves with high protein content, the immunological tests detected congruently high levels of NRL allergen. We conclude that a high percentage of commercially available NRL gloves still represent a risk for NRL allergy, including asthma. The modified Lowry Method allows to infer on the latex allergen content.

  17. Prevalence and clinical impact of sensitization to latex and fruits in dentistry students at the University of Antioquia, and its relationship with allergy to fruits

    Directory of Open Access Journals (Sweden)

    Echenique Manrique, Alejandro

    2015-04-01

    Full Text Available Objective: To determine the prevalence and clinical impact of sensitization to latex and to five tropical fruits (banana, avocado, kiwi, pineapple and passion fruit in dentistry students. Methods: Analytical cross-sectional study of 128 dentistry students at University of Antioquia in Medellín, Colombia. Information was collected by means of a questionnaire and skin prick tests with latex and fruits were done. Results: All students reported having had contact with latex. Nine of them informed at least one episode of adverse reaction to contact with latex without proof of sensitization to it. Five reported at least one reaction with one of the fruits, but skin prick tests were negative. Four of the 14 students who reported gastrointestinal symptoms were sensitized to latex or to one of the tested fruits. Overall, latex sensitization rate was 3.1%. Conclusion: This percentage of sensitization to latex is lower than that in other studies; this may be due to the expression of immune mechanisms other than IgE mediation. We failed to demonstrate a higher sensitization rate to latex as students advanced in their career. The association between gastrointestinal symptoms and sensitization to both fruit and latex is to be emphasized.

  18. Assessment of the mutagenic and antimutagenic activity of Synadenium umbellatum Pax latex by micronucleus test in mice

    Directory of Open Access Journals (Sweden)

    PR. Melo-Reis

    Full Text Available Synadenium umbellatum Pax, popularly known as "cola-nota", is a medicinal plant that grows in tropical regions. The latex of this plant is used against various diseases, such as diabetes mellitus, leprosy, tripanosomiasis, leukemia, and several malignant tumors. The mutagenic, antimutagenic, and cytotoxic effects of the latex of this plant were investigated by measuring the frequency of micronuclei in mice bone marrow cells. To evaluate mutagenicity, the animals were treated with four doses of latex (10, 30, 50, and 100 mg/kg body weight. To study the antimutagenic activity, the animals were simultaneously treated with latex and mitomycin C (4 mg/kg. The cytotoxicity was evaluated by polychromatic and normochromatic erythrocytes ratio. Our results showed a significant increase of frequency of micronucleated polychromatic erythrocytes (MNPCE compared to the negative control group (p 0.05 was detected at the doses of 50 and 100 mg/kg. Under our experimental conditions, the results obtained indicate strong mutagenic and cytotoxic activity of S. umbellatum latex except the dose of 10 mg/kg and moderate antimutagenic effect at lower doses.

  19. Effect of Copolymer Latexes on Physicomechanical Properties of Mortar Containing High Volume Fly Ash as a Replacement Material of Cement

    Directory of Open Access Journals (Sweden)

    El-Sayed Negim

    2014-01-01

    Full Text Available This paper investigates the physicomechanical properties of mortar containing high volume of fly ash (FA as partial replacement of cement in presence of copolymer latexes. Portland cement (PC was partially replaced with 0, 10, 20, 30 50, and 60% FA. Copolymer latexes were used based on 2-hydroxyethyl acrylate (2-HEA and 2-hydroxymethylacrylate (2-HEMA. Testing included workability, setting time, absorption, chemically combined water content, compressive strength, and scanning electron microscopy (SEM. The addition of FA to mortar as replacement of PC affected the physicomechanical properties of mortar. As the content of FA in the concrete increased, the setting times (initial and final were elongated. The results obtained at 28 days of curing indicate that the maximum properties of mortar occur at around 30% FA. Beyond 30% FA the properties of mortar reduce and at 60% FA the properties of mortar are lower than those of the reference mortar without FA. However, the addition of polymer latexes into mortar containing FA improved most of the physicomechanical properties of mortar at all curing times. Compressive strength, combined water, and workability of mortar containing FA premixed with latexes are higher than those of mortar containing FA without latexes.

  20. Effect of copolymer latexes on physicomechanical properties of mortar containing high volume fly ash as a replacement material of cement.

    Science.gov (United States)

    Negim, El-Sayed; Kozhamzharova, Latipa; Gulzhakhan, Yeligbayeva; Khatib, Jamal; Bekbayeva, Lyazzat; Williams, Craig

    2014-01-01

    This paper investigates the physicomechanical properties of mortar containing high volume of fly ash (FA) as partial replacement of cement in presence of copolymer latexes. Portland cement (PC) was partially replaced with 0, 10, 20, 30 50, and 60% FA. Copolymer latexes were used based on 2-hydroxyethyl acrylate (2-HEA) and 2-hydroxymethylacrylate (2-HEMA). Testing included workability, setting time, absorption, chemically combined water content, compressive strength, and scanning electron microscopy (SEM). The addition of FA to mortar as replacement of PC affected the physicomechanical properties of mortar. As the content of FA in the concrete increased, the setting times (initial and final) were elongated. The results obtained at 28 days of curing indicate that the maximum properties of mortar occur at around 30% FA. Beyond 30% FA the properties of mortar reduce and at 60% FA the properties of mortar are lower than those of the reference mortar without FA. However, the addition of polymer latexes into mortar containing FA improved most of the physicomechanical properties of mortar at all curing times. Compressive strength, combined water, and workability of mortar containing FA premixed with latexes are higher than those of mortar containing FA without latexes.

  1. Identification, quantification, spatiotemporal distribution and genetic variation of major latex secondary metabolites in the common dandelion (Taraxacum officinale agg.).

    Science.gov (United States)

    Huber, Meret; Triebwasser-Freese, Daniella; Reichelt, Michael; Heiling, Sven; Paetz, Christian; Chandran, Jima N; Bartram, Stefan; Schneider, Bernd; Gershenzon, Jonathan; Erb, Matthias

    2015-07-01

    The secondary metabolites in the roots, leaves and flowers of the common dandelion (Taraxacum officinale agg.) have been studied in detail. However, little is known about the specific constituents of the plant's highly specialized laticifer cells. Using a combination of liquid and gas chromatography, mass spectrometry and nuclear magnetic resonance spectrometry, we identified and quantified the major secondary metabolites in the latex of different organs across different growth stages in three genotypes, and tested the activity of the metabolites against the generalist root herbivore Diabrotica balteata. We found that common dandelion latex is dominated by three classes of secondary metabolites: phenolic inositol esters (PIEs), triterpene acetates (TritAc) and the sesquiterpene lactone taraxinic acid β-D-glucopyranosyl ester (TA-G). Purification and absolute quantification revealed concentrations in the upper mgg(-1) range for all compound classes with up to 6% PIEs, 5% TritAc and 7% TA-G per gram latex fresh weight. Contrary to typical secondary metabolite patterns, concentrations of all three classes increased with plant age. The highest concentrations were measured in the main root. PIE profiles differed both quantitatively and qualitatively between plant genotypes, whereas TritAc and TA-G differed only quantitatively. Metabolite concentrations were positively correlated within and between the different compound classes, indicating tight biosynthetic co-regulation. Latex metabolite extracts strongly repelled D. balteata larvae, suggesting that the latex constituents are biologically active. Copyright © 2015 Elsevier Ltd. All rights reserved.

  2. Assay of anti-HBs antibodies using a recombinant antigen and latex particle counting: comparison with five commercial tests.

    Science.gov (United States)

    Galanti, L M; Cornu, C; Masson, P L; Robert, A R; Becheanu, D; Lamy, M E; Cambiaso, C L

    1991-05-01

    An assay of anti-HBs antibodies based on agglutination of latex particles coated with recombinant HBs-antigen was compared with Abbott radioimmunoassay (Abbott-RIA), which uses a human plasma-derived antigen. The population examined consisted of 76 Abbott-RIA anti-HBs-negative prevaccinated subjects and 1044 serum samples anti-HBs found positive by Abbott-RIA, including 283 samples of subjects vaccinated either with a human plasma-derived vaccine (group A; n = 180) or with a recombinant vaccine (group B; n = 103). Correlation coefficients between the two techniques were respectively r = 0.89 for the whole population (n = 1044), r = 0.98 in group A and r = 0.74 in group B. Anti-HBs titres were higher with latex than with RIA in group B as shown by the regression slopes: latex = 508 + 1.11 RIA in group A and latex = -1138 + 3.97 RIA in group B, suggesting that some vaccinated subjects from group B produced antibodies against epitopes proper to the recombinant antigen. In the prevaccinated population and in group A, the latex results were compared with those of radioimmunoassays (Abbott, Sorin) and enzyme immunoassays (Behring, Roche, Pasteur). Only the Roche-EIA detected anti-HBs in the prevaccinated subjects. The correlation between the various immunoassays was r greater than 0.96 only for values higher than 100 IU/l.

  3. Engineering Multifunctional Living Paints: Thin, Convectively-Assembled Biocomposite Coatings of Live Cells and Colloidal Latex Particles Deposited by Continuous Convective-Sedimentation Assembly

    Science.gov (United States)

    Jenkins, Jessica Shawn

    Advanced composite materials could be revolutionized by the development of methods to incorporate living cells into functional materials and devices. This could be accomplished by continuously and rapidly depositing thin ordered arrays of adhesive colloidal latex particles and live cells that maintain stability and preserve microbial reactivity. Convective assembly is one method of rapidly assembling colloidal particles into thin (advantages over thicker randomly ordered composites, including enhanced cell stability and increased reactivity through minimized diffusion resistance to nutrients and reduced light scattering. This method can be used to precisely deposit live bacteria, cyanobacteria, yeast, and algae into biocomposite coatings, forming reactive biosensors, photoabsorbers, or advanced biocatalysts. This dissertation developed new continuous deposition and coating characterization methods for fabricating and characterizing 90 hours) photohydrogen production under anoxygenic conditions. Nutrient reduction slows cell division, minimizing coating outgrowth, and promotes photohydrogen generation, improving coating reactivity. Scanning electron microscopy of microstructure revealed how coating reactivity can be controlled by the size and distribution of the nanopores in the biocomposite layers. Variations in colloid microsphere size and suspension composition do not affect coating reactivity, but both parameters alter coating microstructure. Porous paper coated with thin coatings of colloidal particles and cells to enable coatings to be used in a gas-phase without dehydration may offer higher volumetric productivity for hydrogen production. Future work should focus on optimization of cell density, light intensity, media cycling, and acetate concentration.

  4. Synthesis and characterization of novel fluoroalkyl-terminated hyperbranched polyurethane latex

    Science.gov (United States)

    Xu, Wei; Zhao, Weijia; Hao, Lifen; Wang, Sha; Pei, Mengmeng; Wang, Xuechuan

    2018-04-01

    Waterborne polyurethane (PU) emulsions are widely used in various fields and the demand for them is ever-increasing over the years. However, the hydrophilic chain extender inevitably bonded into the PU backbone can affect the water tolerance of PU. Thus, it is of great importance to improve PU water resistance effectively. Herein, novel fluoroalkyl-terminated hyperbranched polyurethane (HBPUF) latex was accordingly synthesized by graft reaction of perfluorohexyl ethyl alcohol and hyperbranched polyurethane (HBPU), which was previously obtained from interaction between hydroxyl-terminated hyperbranched polymer and PU prepolymer manufactured via the acetone process, as well as using neutralization, adding water, and high-speed stirring operations. We characterized the resultants and investigated its surface properties by IR, NMR, TEM, XRD, TGA, DSC, FE-SEM, AFM, XPS, and contact angle measurements, etc. IR and NMR tests confirmed that the fluorinated fragments had been grafted onto the tail end of HBPU. TEM, XRD, DSC, and FE-SEM results all accounted for the fact that there were multi-crystals in PU, HBPU and HBPUF. TGA results showed that thermal stabilities of the PU, HBPU, and HBPUF latex films were enhanced in turn. XPS and AFM analyses demonstrated that the fluorine-containing segments from the HBPUF terminals were prone to migrate and enrich on the film-air surface of the HBPUF latex film, which made water contact angle and water absorption of the HBPUF film be as 113.9° and 11.1%, respectively, compared to those of the PU film (77.8° and 136.2%). This research indicates that water resistance of the PU film can be efficiently enhanced by fluorinated polyurethane with novel fluoroalkyl-terminated hyperbranched structure.

  5. Physical-biopolymer characterization of polyhydroxybutyrate-co-hydroxyvalerate (PHBV) blended with natural rubber latex

    Energy Technology Data Exchange (ETDEWEB)

    Kuntanoo, K., E-mail: thip-kk@hotmail.com [Graduate School of Khon Kaen University, Khon Kaen, 40002 Thailand (Thailand); Promkotra, S., E-mail: sarunya@kku.ac.th [Department of Geotechnology, Faculty of Technology, Khon Kaen University, Khon Kaen 40002 Thailand (Thailand); Kaewkannetra, P., E-mail: paknar@kku.ac.th [Department of Biotechnology, Faculty of Technology, Khon Kaen University, Khon Kaen 40002 Thailand (Thailand)

    2015-03-30

    A biopolymer of polyhydroxybutyrate-co-hydroxyvalerate (PHBV) is blended with bio-based materials, natural rubber latex, to improve their microstructures. The various ratios between PHBV and natural rubber latex are examined to develop their mechanical properties. In general, physical properties of PHBV are hard, brittle and low flexible while natural rubber (NR) is presented itself as high elastic materials. Concentrations of the PHBV solution are constituted at 1%, 2% and 3% (w/v). The mixtures of their PHBV solutions to natural rubber latex are produced the blended films in three different ratios of 4:6, 5:5 and 6:4, respectively. They are characterized by appearance analyses which are the scanning electron microscope (SEM), universal testing machine (UTM) and differential scanning calorimetry (DSC). The SEM photomicrographs of the blended films and the controlled PHBV can provide the void distribution in the range of 12-14% and 19-21%, respectively. For mechanical properties of the blended films, the various elastic moduli of 1%, 2% and 3% (w/v) PHBV are the average of 773, 956 and 1,007 kPa, respectively. The tensile strengths of the blends increase with the increased concentrations of PHBV, similarly trend to the elastic modulus. The crystallization and melting behavior of unmixed PHBV and the blends are determined by DSC. Melting transition temperatures (T{sub m}) of the unmixed PHBV are stated two melting peak at 154°C and 173°C. Besides, the melting peaks of the blends alter in the range of 152-156°C and 168-171°C, respectively. According to morphology of the blends, the void distribution decreases twice compared to the unmixed PHBV. The results of mechanical properties and thermal analysis indicate that the blended PHBV can be developed their properties by more resilient and wide range of temperature than usual.

  6. Isolation of natural inhibitors of papain obtained from Carica papaya latex

    Directory of Open Access Journals (Sweden)

    Rubens Monti

    2004-09-01

    Full Text Available Studies were carried out to natural papain inhibitor from papaya latex. Fresh latex from green fruits of Carica papaya was collected and immediately transported in ice bath to the lab, from which three fractions with inhibitor effect of esterase papain activity were isolated by latex dialysis, Sephadex G-25 gel filtration and ionic exchange chromatography in SP-Sephadex C-25. The isolated fractions, identified as inhibitors I and II, showed a negative reaction with ninhydrin; however, the fraction identified as P-III showed positive reaction with ninhydrin. Kinetics data showed non-competitive inhibition (inhibitor I and uncompetitive (inhibitors II and P-III.Este trabalho apresenta novos dados sobre inibidores naturais de papaína. O látex fresco de frutos verdes de Carica papaya foi coletado pela manhã em plantações da região de Araraquara, SP, Brasil e imediatamente transportado ao laboratório em banho de gelo. Três frações com efeito inibitório da atividade esterásica da papaína foram isoladas a partir do látex fresco, através de diálise, filtração em Sephadex G-25 e cromatografia em SP-Sephadex C-25. As frações isoladas identificadas como inibidores I e II, mostraram reação negativa à ninidrina; entretanto, a fração identificada como P-III mostrou reação positiva. Dados cinéticos revelaram inibição não-competitiva (inibidor I e incompetitiva (inibidores II e P-III.

  7. Toxicological evaluation of natural rubber films from vulcanized latex by the conventional process and the alternative process with ionizing radiation

    International Nuclear Information System (INIS)

    Campos, Vania Elisabeth

    1997-01-01

    The industrial vulcanization of natural rubber latex (NRL) is made all over the world by conventional process using sulphur and heat but it can be made by an alternative process using ionizing radiation. In this research the NRL was tested by 13 physical, chemical and mechanical assays which showed its good quality. It was done a preliminary study of the toxicological properties of 4 natural rubber films obtained by casting process of NRL: one non vulcanized, other vulcanized by the conventional process and two vulcanized by the alternative process. In the alternative process the films were obtained by irradiation of NRL by gamma rays from the 60 Co source at 250 kGy in the absence of sensitizer and irradiated NRL at 12 kGy in the presence of 4ph r of n-butyl acrylate / 0.2 phr of KOH. These vulcanization doses were determined from broken tensile strength. In the conventional process, sulphur vulcanized NRL was made using a classical composition. Another film was made with non vulcanized NRL. The preliminary evaluation of the toxicological properties was made from in vitro cytotoxicity and in vivo systemic toxicity assays. The LBN films vulcanized by the alternative process have less cytotoxicity than the NRL film vulcanized by the conventional process. The sensitized vulcanized films by gamma rays and non vulcanized films showed similar cytotoxicity while the vulcanized films without sensitizer showed a slight lower cytotoxicity. The non vulcanized NRL film and the NRL films vulcanized by the alternative process did not show toxic effects int he 72 hours period of the systemic toxicity assay. However the NRL film vulcanized with sulphur induced effects like allaying and motor in coordination on the animals treated with an oil extract at the fourth hour and recovering after that. The alternative process promoted lower toxic effects than conventional process because there was no toxic substances present. (author)

  8. ENHANCEMENT OF RESISTANCE TO OXIDATIVE DEGRADATION OF NATURAL RUBBER THROUGH LATEX DEGRADATION

    Institute of Scientific and Technical Information of China (English)

    1998-01-01

    A fully characterised natural rubber latex was subjected to mechanical degradation by stirring at intervals. The resistance to oxidative degradation of the different samples were studied by measuring the Plasticity retention indices (PRI).The results show that there is an enhancement of the PRI from 57% for the undegraded rubber to 79% for the one-hour degraded sample. Further degradation resulted in decrease of PRI as time of degradation increased. Therefore, the one-hour degraded sample is a special rubber with high oxidation resistance which is of great importance in engineering.

  9. Posters y trípticos (Brochures) en LATEX con Beamer y Leaflet

    OpenAIRE

    Borbón, Alexánder

    2013-01-01

    Resumen. En este artículo se muestra la manera en que se puede realizar posters y trípticos (panfletos o brochures) con LATEX. Para realizar los posters se utiliza la clase beamer que usualmente se utiliza para hacer presentaciones, se utiliza el paquete beamerposter para poder utilizarla para posters. Los trípticos se realizan de dos formas, la primera utilizando la clase beamer con el paquete geometry y la segunda utilizando la clase leaflet que es una clase especializada para hacer este ti...

  10. The influence of radiolytic sensitizers in natural rubber latex vulcanization induced by ionizing radiation

    International Nuclear Information System (INIS)

    Guedes, S.M.L.; Souza, A. de

    1991-01-01

    This work made on radiation vulcanization of natural rubber latex process by gamma rays from 60 Co source and electron beam of 1.5 MeV, 25 m A by Dynamitron, instead of classic process using sulfur. The experiment was carried out to study the influence of sensitizers (C Cl 4 and n-butyl acrylate) and was reported the vulcanization dose for each sensitizers, related to maximum tensile strength. The results show the possibility to introduce the volatile sensitizer (n-butyl acrylate) instead of C Cl 4 (toxic) in industry applications. (author)

  11. Surgical gloves fabrication using natural rubber latex vulcanized with gamma radiation

    International Nuclear Information System (INIS)

    Collantes, Hugo David Chirinos.

    1995-01-01

    Surgical gloves were manufactured by immersion coagulant method from vulcanized natural rubber latex by gamma rays at dose of 10 kGy in the air, at room temperature, using the following sensitizer vulcanization An-B 3 phr/KOH 0.2 phr. The influence of the parameter in the thickness of the surgical gloves manufacture, studied through fractional factorial designs technic, can be resumed by empirical linear correlation: y = 0.213 + 0.025 [Ca Cl 2 ] + 0.019 t. (author). 49 refs., 13 figs., 31 tabs

  12. Effect of Antioxidants on Radiation Vulcanization Natural Rubber Latex (RVNRL) Film

    International Nuclear Information System (INIS)

    Syuhada Ramli; Sofian Ibrahim; Muhammad Saiful Omar

    2015-01-01

    This paper presents the results on the effects of different antioxidants used in Radiation Vulcanization Natural Rubber Latex (RVNRL)) films between 0 to 10 weeks monitoring. Antioxidants used for the RVNRL formulation were Aquanox LP, Irganox and Wingstay L. Color difference evaluation by using Chroma Meter CR-400 found that RVNRL film with Irganox was the most stained yellowish after 8 weeks monitoring. Tensile strength for RVNRL with Aquanox found achieved the optimum strength between 25.4 to 27.13 mPa. The scanner electron microscopic (SEM) indicated more Aquanox molecules to penetrate and interact with the rubber molecule, thus becoming more effective inhibitor against its oxidative ageing. (author)

  13. Cytotoxicity of latex and pharmacobotanical study of leaves and stem of Euphorbia umbellata (Janaúba

    Directory of Open Access Journals (Sweden)

    Lívia E.C. Luz

    Full Text Available AbstractIn southern Brazil, the bottled latex of Synadenium grantii Hook f., Euphorbiaceae, is popularly used as a treatment of all types of cancer. Similarly, Synadenium umbellatum Pax. is used in the central western region of Brazil for the same purpose and in the same manner of use. Both plants are popularly known as janaúba or leitosinha. The objectives of this study were to use pharmacobotanical analysis to verify whether these two species, which are considered to be distinct, are actually the same to determine anatomical markers; to assist in the identification and differentiation of other Euphorbia; and to evaluate the cytotoxic activity of the latex in relation to HeLa and HRT-18 cells. Leaves and stems of the species were collected in Goiânia and Ponta Grossa and were investigated using scanning electron microscopy and optical microscopy techniques. The latex was also collected and analyzed in relation to its cytotoxic effect by employing MTT and NR techniques. The pharmacobotanical study of the specimens in both localities showed that they were the same species, namely Euphorbia umbellata (Pax Bruyns, which is the scientific nomenclature accepted and confirmed by an expert taxonomist who specializes in Euphorbia. The pharmacobotanical characteristics highlighted in this study can assist in the identification of the taxon and contribute to the control of the quality of this plant drug. The evaluation of the latex in relation to HRT-18 cells demonstrated action after 48 h of experiment. In contrast, in relation to HeLa cells its induced cytotoxicity in all times and a dose-dependent manner. The IC50 values (72 h observed were 252.58 ± 18.51 µg/ml and 263.42 ± 15.92 µg/ml to MTT experiment and 250.18 ± 19.48 µg/ml and 430.56 ± 19.71 µg/ml to NR experiment for the HeLa and HRT-18 cells, respectively.

  14. Modification of Iraqi Asphalt 40/50 Properties Using Saw Dust (SD and Natural Rubber Latex

    Directory of Open Access Journals (Sweden)

    Rusul l M. Darwesh

    2018-04-01

    Full Text Available The aim of this research is to enhance the fundamental properties for asphalt binder as those spec-ifications relate to performance of asphalt mixtures. In this paper studied the effect of add (2, 4 % SD in different sizes and (3, 5 and 7% Natural rubber latex to the straight asphalt 40/50 produced from Al-Dura refinery at 160C, it was added each additive separately and then added together to asphalt in same temperature, then tested physically and mechanically according to the American Society for Testing and Materials (ASTM, the result showed largely improvement.

  15. An evidence-based approach to medication preparation for the surgical patient at risk for latex allergy: is it time to stop being stopper poppers?

    Science.gov (United States)

    Heitz, James W; Bader, Stephen O

    2010-09-01

    The prevalence of latex allergy is increasing in surgical patient populations. Avoidance of exposure to the allergen is essential to minimizing perioperative complications in patients suspected to be at risk. Natural rubber latex has historically been ubiquitous in medical devices containing rubber. In 1998, the Food and Drug Administration (FDA) began to require the labeling of medical devices made from natural rubber latex; since that time substantial progress has been made in identifying latex-free alternatives. However, the rubber stoppers commonly found in pharmaceutical vial closures are exempt from FDA labeling requirements. Examination of the clinical and basic science literature regarding pharmaceutical vial closures supports limiting the rubber stopper to a single needle puncture as a safer practice, with the caveat that no strategy exists for the complete elimination of risk as long as stoppers made from natural rubber latex are used in pharmaceutical vials intended for human use. Copyright © 2010 Elsevier Inc. All rights reserved.

  16. Preparation of Low Allergenic Protein Concentrated Natural Rubber Latex Using Suitable Low Molecular Weight Cellulose Derivatives Induced by Gamma Irradiation

    International Nuclear Information System (INIS)

    Siri-Upathum, Chyagrit; Boonyawat, Jariya

    2007-08-01

    Full text: Low molecular weight carboxy methyl cellulose (CMC), hydroxyl ethyl cellulose (HEC), hydroxyl propyl cellulose (HPC) and methyl cellulose (MC) prepared by radiation-induced degradation were added into diluted natural concentrated latex prior to centrifuge for a purpose of reducing allergenic rubber protein in the latex. Optimum molecular weight (Mv) of CMC and HEC for such a purpose was found to be 17-18 kDa which decreased allergenic rubber protein (14-94 kDa) to an undetectable amount as determined by SDS PAGE method

  17. Technology of Anticorrosive Protection of Steel Constructions by Coatings Based on Rapid-Hardening Bitumen-Latex Emulsion

    Directory of Open Access Journals (Sweden)

    Nykyforchyn, H.M.

    2016-01-01

    Full Text Available The recipes of rapid-hardening bitumen-latex emulsions and coatings on its base are created, in-laboratory tests of their physical, chemical and anticorrosive properties are carried out. The technology of anticorrosive protection and the installation technical documentation for making of aqueous bitumen-latex emulsion is developed, installation is mounted and a pilot lot of rapid-hardening emulsion is produced. Experimental-industrial approbation of the technology of coating formation on pipes in oil and gas industry is carried out.

  18. Purification and autolysis of the ficin isoforms from fig (Ficus carica cv. Sabz) latex.

    Science.gov (United States)

    Zare, Hamid; Moosavi-Movahedi, Ali Akbar; Salami, Maryam; Mirzaei, Morteza; Saboury, Ali Akbar; Sheibani, Nader

    2013-03-01

    Ficin (EC 3.4.22.3), a cysteine endoproteolytic protease in fig trees' latex, has multiple isoforms. Until now, no data on autolysis of individual ficins (ficin isoforms) are available. Following purification, ficins' autolysis was determined by HPLC chromatogram changes and ultrafiltrations at different temperatures and storage times. These results showed that the number of HPLC peaks in latex proteins purification of Ficus carica cv. Sabz varied from previous fig varieties or cultivars. Proteolytic activity of ficins was inhibited by specific cysteine protease inhibitors, confirming the participation of the cysteine residue in the active site. The zeta potential of the first two eluted peaks (I and II) was negative, while that of other peaks were positive. All ficins were susceptible to autolysis when stored at high temperatures. In contrast, only the last two ficins (B, C) were prone to autolysis at cold temperature after long storage period. The rate of degradation of the ficins was significantly increased with the increased storage time. The ficin (A) related to peak (III) had the highest and the lowest surface hydrophobic patches and ratio of autolytic to proteolytic activity, respectively. Copyright © 2012 Elsevier Ltd. All rights reserved.

  19. Calotropis procera Latex-Induced Inflammatory Hyperalgesia—Effect of Antiinflammatory Drugs

    Directory of Open Access Journals (Sweden)

    Raman Sehgal

    2005-01-01

    Full Text Available The milky white latex of plant Calotropis procera produces inflammation of the skin and mucous membranes on accidental exposure. It produces edema on local administration due to the release of histamine and prostaglandins and is associated with hyperalgesia. In the present study we have evaluated the antiedematous and analgesic activity of antiinflammatory drugs against inflammatory response induced by dried latex (DL of C procera in rat paw edema model. An aqueous extract of DL of C procera was injected into the subplantar surface of the rat paw and the paw volume was measured by a plethysmometer at 0, 1, 2, 6, 12, and 24 hours. Concomitantly the hyperalgesic response was also evaluated by motility test, stair climbing ability test, dorsal flexion pain test, compression test, and observing the grooming behavior. The inhibitory effect of diclofenac and rofecoxib on edema formation and hyperalgesic response was compared with cyproheptadine (CPH. DL-induced edema formation was maximum at 2 hours that was associated with decreased pain threshold, functional impairment, and grooming. Treatment with antiinflammatory drugs and CPH significantly attenuated the edematous response and grooming, increased the pain threshold, and improved functional parameters. Both antiinflammatory and antiserotonergic drugs significantly inhibited the hyperalgesia associated with DL-induced paw edema. Rofecoxib was found to be superior than diclofenac and was as effective as CPH in ameliorating the hyperalgesia. However, it was found to be less effective than CPH in attenuating edema formation.

  20. Diagnostic value of latex agglutination test in diagnosis of acute bacterial meningitis

    Directory of Open Access Journals (Sweden)

    Syeda Fasiha Mohammadi

    2013-01-01

    Full Text Available Objectives: To know the incidence of bacterial meningitis in children below five years of age. To compare conventional culture and antigen detection methods ( Latex agglutination test. Materials and Methods: 100 CSF samples of clinically suspected meningitis cases in children below 5 years of age were included. The samples were subjected to cell count, Gram stain, culture and LAT. The organisms isolated in the study were characterized according to standard procedures. Results: Of the 100 cases studied, 31 cases were diagnosed as ABM by Gram stain, culture and latex agglutination test as per WHO criteria. The hospital frequency of ABM was 1.7%. 15 (48.38 cases were culture positive. Gram stain was positive in 22(70.96 cases and LAT in 17(54.83 cases. Haemophilus influenzae was the most common causative agent of acute bacterial meningitis followed by S.pneumoniae. Case fatality rate was 45.16%.The sensitivity and specificity of LAT was 66.66% and 87.91% respectively. Conclusion : Bacterial meningitis is a medical emergency and early diagnosis and treatment is life saving and reduces chronic morbidity. LAT was more sensitive compared to conventional Gram stain and Culture technique in identifying the fastidious organisms like H.influenzae, S.pneumoniae and Group B Streptococcus. However, the combination of Gram stain, Culture and LAT proved to be more productive than any of the single tests alone.

  1. Purification and biochemical characterization of asclepain c I from the latex of Asclepias curassavica L.

    Science.gov (United States)

    Liggieri, Constanza; Arribére, M Cecilia; Trejo, Sebastián A; Canals, Francesc; Avilés, Francesc X; Priolo, Nora S

    2004-08-01

    In this work we report the isolation, purification and characterization of a new protease from latex of Asclepias curassavica L. Crude extract (CE) was obtained by gathering latex on 0.1 M citric-phosphate buffer with EDTA and cysteine with subsequent ultracentrifugation. Proteolytic assays were made on casein or azocasein as substrates. Caseinolytic activity was completely inhibited by E-64. Stability at different temperatures, optimum pH and ionic strength were evaluated by measuring the residual caseinolytic activity at different times after the incubation. CE showed the highest caseinolytic activity at pH 8.5 in the presence of 12 mM cysteine. CE was purified by cation exchange chromatography (FPLC). Two active fractions, homogeneous by SDS-PAGE, were isolated. The major purified protease (asclepain cI) showed a molecular mass of 23.2 kDa by mass spectrometry and a pI higher than 9.3. The N-terminal sequence showed a high similarity with those of other plant cysteine proteinases. When assayed on N-alpha-CBZ-aminoacid-p-nitrophenyl esters, the enzyme showed higher preference for the glutamine derivative. Determinations of kinetic parameter (km and Kcat) were performed with PFLNA.

  2. Severe complications caused by dissolution of latex with consequent self-disintegration of esophageal plastic tubes.

    Science.gov (United States)

    Löser, C

    2000-09-01

    A case of decisive material degeneration of an esophageal Celestin tube is described: a 50-year-old man with adenocarcinoma of the distal esophagus received a Celestin tube for palliative endoscopic treatment and 8 months later presented with suddenly occurring complete dysphagia. Dissolution of the latex layer in the proximal as well as the distal part of the tube had caused self-disintegration of the Celestin tube and had liberated the monofilament nylon coil which completely obstructed the lumen of the tube. Endoscopic tube removal was only possible by careful attachment of a balloon catheter and peroral extraction after insufflation with contrast medium up to 5 atm. A Medline-based review of the literature revealed different but predominantly severe complications (perforation, hemorrhage, obstruction, and peritonitis) based on material fatigue of the latex layer in esophageal Celestin tubes. At least 6 months after placement of a Celestin tube, regular fluoroscopic controls should be performed to detect early disintegration of the tube. Indication for the placement of Celestin tubes in patients with benign esophageal strictures and longer life expectancy should be assessed very critically.

  3. Development of an efficient process for radiation vulcanization of natural rubber latex using hydroperoxide with sensitizer

    International Nuclear Information System (INIS)

    Siri-upathum, C.; Sonsuk, M.

    1996-01-01

    An attempt was made to reduce irradiation dose for radiation vulcanization of natural rubber latex. A promising method was to partially crosslink the latex by radiation vulcanization using n-butyl acrylate (n-BA) as sensitizer and t-butyl hydroperoxide (BHPO) as a co-sensitizer followed by redox vulcanization using residual BHPO as an oxidant and either fructose or tetra ethylene penta mine as reducing agents. It was found that the irradiation dose was reduced to 4 kGy with 5 phr n-BA as sensitizer and 0.1 phr BHPO as co-sensitizer. Successive crosslinking to full vulcanization was done by redox vulcanization using either 4 phr fructose at 60 degree C for 3 hours of 0.4 phr tetra-ethylene penta mine at room temperature for 1 hour. The rubber films obtained had tensile strength of about 25 MPa, modulus 300% of 0.9 MPa and crosslink density of about 1.5 x 10 19 crosslink/cm 3 . It was noted that the rubber film from the co-vulcanization was the average value of the values obtained by radiation vulcanization and redox vulcanization

  4. A simple kit for rapid field diagnosis of potato virus Y by latex serological test

    Directory of Open Access Journals (Sweden)

    Aarne Kurppa

    1987-07-01

    Full Text Available A simple kit for rapid detection of potato virus Y by latex serological test was developed. The test is carried out on a white cardboard sheet and the results can be read by naked eye in two minutes. A test card of 10 x 6 cm holds latex sensitized antibodies, buffers and other necessary ingredients as dry blue colored formulate on the ringed areas of the card. A test card includes space for six tests and positive and negative controls. The kit also includes disposable plastic sticks for mixing the samples with test reagents and a hand press with disposable plastic tips. For testing, dried reagents are dissolved in drops of sample and mixed. After gentle rotation, samples containing virus appear clearly granulated while samples from healthy plants remain unagglutinated. The testing of undiluted extracts of evenly developed tuber sprouts resulted in over 91 % identity with the results obtained with ELISA that was used as a control method. Testing of diluted leaf extracts reached the same reliability but undiluted leaf extracts from glasshouse grown potatoes were not well suitable as test samples because of their dark green color. No such problems occurred with field grown material and a complete identity with the ELISA readings was true when the samples included secondarily infected potato plants. No reaction to other potato viruses than PVY was obtained by the test kit.

  5. Influence of wearing latex gloves on electric pulp tester readings in children.

    Science.gov (United States)

    Holan, G

    1993-12-01

    Electric pulp testers operated by completing an electric circuit. Latex examination gloves have been claimed to interrupt this circuit and lead to false-negative results. This study was conducted to evaluate the influence of wearing latex gloves on electric pulp tester (EPT) readings. The pulps of 80 maxillary permanent incisors of 22 children 10-13 1/2 years old were tested using the Pelton & Crane 'Vitapulp' instrument. Each tooth was tested twice: with gloves and with bare hands. Teeth failing to respond to the EPT without gloves were excluded from the study. All EPT readings ranged between 1 and 9.5. Five teeth gave the same responses with gloved and ungloved hands. Only five teeth did not respond when gloves were worn, and all of these gave readings near the top of the EPT scale when tested without gloves. The other 70 teeth presented significantly higher readings with gloves than without gloves. It is concluded that removal of examination gloves during the operation of the EPT is necessary only if no response is obtained.

  6. Natural rubber latex used as drug delivery system in guided bone regeneration (GBR

    Directory of Open Access Journals (Sweden)

    Rondinelli Donizetti Herculano

    2009-06-01

    Full Text Available In this work, we propose natural rubber latex (NRL membranes as a protein delivery system. For this purpose Bovine Serum Albumin (BSA was incorporated into the latex solution for in vitro protein delivery experiments. Different polymerization temperatures were used, from -10 to 27 °C, in order to control the membrane morphology. These membranes were characterized by Scanning Electron Microscopy (SEM, Atomic Force Microscopy (AFM, as well as the Lowry Method to measure the BSA release. SEM and AFM microscopy analysis showed that the number, size and distribution of pores in NRL membranes can be varied, as well as its overall morphology. We have found that the morphology of the membrane is the predominant factor for higher protein release, compared with pore size and number of pores. Results demonstrated that the best drug-delivery system was the membrane polymerized at RT (27 °C, which does release 66% of its BSA content for up to 18 days. Our results indicate that NRLb could be used in the future as an active membrane that could accelerate bone healing in GBR.

  7. Determination of immune status in dogs against CPV-2 by recombinant protein based latex agglutination test.

    Science.gov (United States)

    Thomas, Jobin; Singh, Mithilesh; Goswami, T K; Glora, Philma; Chakravarti, Soumendu; Chander, Vishal; Upmanyu, Vikramaditya; Verma, Suman; Sharma, Chhavi; Mahendran, K

    2017-09-01

    Canine parvoviral enteritis is a highly contagious viral illness caused by canine parvovirus-2 (CPV-2) which affects puppies of mainly 6-20 weeks of age. Vaccination is pivotal in preventing and controlling CPV-2 infection. Determination of antibody status is a critical determinant for successful vaccination. The hemagglutination inhibition (HI) test is 'gold standard' test for quantification of antibodies specific to CPV-2, although the execution of this test is not feasible under field conditions. The present study was undertaken to develop a point of care testing to determine immune status prior to CPV-2 vaccination or to detect seroconversion in immunized dogs by latex agglutination test (LAT) using recombinant antigen. Truncated portion of VP2 protein (tVP2) of CPV-2 was selected on the basis of antigenic indices, overexpressed the recombinant protein in E. coli system and was subsequently used in development of LAT. A total of 59 serum samples obtained from vaccinated (n = 54) and healthy unvaccinated (n = 5) dogs were tested. The positivity was observed in 85% (46/54) of these dogs with varying agglutination pattern. The overall sensitivity and specificity of latex agglutination test in comparison to HI test was recorded as 90% and 88% respectively with an agreement value of 90% (CI = 95%). Copyright © 2017 International Alliance for Biological Standardization. Published by Elsevier Ltd. All rights reserved.

  8. Green synthesis of colloidal silver nanoparticles using natural rubber latex extracted from Hevea brasiliensis.

    Science.gov (United States)

    Guidelli, Eder José; Ramos, Ana Paula; Zaniquelli, Maria Elisabete D; Baffa, Oswaldo

    2011-11-01

    Colloidal silver nanoparticles were synthesized by an easy green method using thermal treatment of aqueous solutions of silver nitrate and natural rubber latex (NRL) extracted from Hevea brasiliensis. The UV-Vis spectra detected the characteristic surface plasmonic absorption band around 435 nm. Both NRL and AgNO(3) contents in the reaction medium have influence in the Ag nanoparticles formation. Lower AgNO(3) concentration led to decreased particle size. The silver nanoparticles presented diameters ranging from 2 nm to 100 nm and had spherical shape. The selected area electron diffraction (SAED) patterns indicated that the silver nanoparticles have face centered cubic (fcc) crystalline structure. FTIR spectra suggest that reduction of the silver ions are facilitated by their interaction with the amine groups from ammonia, which is used for conservation of the NRL, whereas the stability of the particles results from cis-isoprene binding onto the surface of nanoparticles. Therefore natural rubber latex extracted from H. brasiliensis can be employed in the preparation of stable aqueous dispersions of silver nanoparticles acting as a dispersing and/or capping agent. Moreover, this work provides a new method for the synthesis of silver nanoparticles that is simple, easy to perform, pollutant free and inexpensive. Copyright © 2011 Elsevier B.V. All rights reserved.

  9. Rubber elongation factor (REF, a major allergen component in Hevea brasiliensis latex has amyloid properties.

    Directory of Open Access Journals (Sweden)

    Karine Berthelot

    Full Text Available REF (Hevb1 and SRPP (Hevb3 are two major components of Hevea brasiliensis latex, well known for their allergenic properties. They are obviously taking part in the biosynthesis of natural rubber, but their exact function is still unclear. They could be involved in defense/stress mechanisms after tapping or directly acting on the isoprenoid biosynthetic pathway. The structure of these two proteins is still not described. In this work, it was discovered that REF has amyloid properties, contrary to SRPP. We investigated their structure by CD, TEM, ATR-FTIR and WAXS and neatly showed the presence of β-sheet organized aggregates for REF, whereas SRPP mainly fold as a helical protein. Both proteins are highly hydrophobic but differ in their interaction with lipid monolayers used to mimic the monomembrane surrounding the rubber particles. Ellipsometry experiments showed that REF seems to penetrate deeply into the monolayer and SRPP only binds to the lipid surface. These results could therefore clarify the role of these two paralogous proteins in latex production, either in the coagulation of natural rubber or in stress-related responses. To our knowledge, this is the first report of an amyloid formed from a plant protein. This suggests also the presence of functional amyloid in the plant kingdom.

  10. A system for treatment of diabetic foot ulcers using led irradiation and natural latex

    Directory of Open Access Journals (Sweden)

    Gustavo Adolfo Marcelino de Almeida Nunes

    Full Text Available Abstract Introduction: We developed and tested a new system for inducing the healing of diabetic foot ulcers. The system relies on the regenerative properties of its two components: an insole with a sheet of natural latex and a device that contains a matrix of light emitting diodes with wavelength of 635 nm. Methods The electronic and latex based devices were developed, and a four weeks test was performed in one control group (CG of five ulcers and one experimental group (EG of eight ulcers. The CG was treated with a standard approach, based on a silver-releasing foam dressing, and the EG was treated with the system under test. For each ulcer, an index for quantifying the percentage ulcer recovery, named CRU(%, has been calculated; a CRU(% = 0% means no healing, and a CRU(% = 100% means total healing. Results There were statistically significant increases of CRU(% of 51.8% (p = 0.022, for the CG, and of 78.4% (p < 0.001, for the EG. The increase in the EG was higher than the increase in the CG, and the difference was statistically significant (p < 0.001. The results showed that the proposed method had, for these particular sets of ulcers, faster healing rates, than for the standard method. Conclusion The results hint that the proposed method seems promising as a future treatment method. However, the technique must undergo further testing before it can be considered for extensive clinical applications.

  11. Properties and Characterization of Kenaf-Filled Natural Rubber Latex Foam

    Directory of Open Access Journals (Sweden)

    Ahmad Fikri Abdul Karim

    2015-12-01

    Full Text Available Kenaf powder was incorporated with natural rubber latex (NRL compound and foamed to make natural rubber latex foam (NRLF by using a well known technique called the Dunlop method. Different loadings of kenaf powder were added to NRL compound and was foamed to make NRLF. The mechanical properties, density, compression, thermal, and micro-structural characterization of control NRLF and kenaf incorporated NRLF were studied. Increasing content of kenaf reduced the tensile strength, elongation at break, and compressive strength of a NRLF. Modulus at 100% elongation and density of the NRLF increased with an increase in filler loading. Higher kenaf loading indicated higher elasticity of kenaf-filled NRLF, but the recovery percentage of kenaf-filled NRLF decreased with increasing kenaf loading. From thermogravimetric analysis (TGA result, an increase in the amount of kenaf loading from 1 to 7 phr increased the thermal stability of kenaf-filled NRLF. Morphological and micro-structural characterization performed by using scanning electron microscopy (SEM showed that kenaf powder filled up the micro-sized pores in the open cell structure of kenaf-filled NRLF.

  12. Radio-vulcanization of natural rubber in the latex phase. Study of an experimental 1 tonne per hour production; Radio-vulcanisation du caoutchouc naturel en phase latex. Etude d'une production experimentale de 1 tonne par heure

    Energy Technology Data Exchange (ETDEWEB)

    Leveque, P; Puig, J R; Roudeix, H [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1968-07-01

    After briefly reviewing the main research carried out on the radio-vulcanization of latex and elastomers, a description is given of 4 types of cell which have been used successively with a view to industrial irradiation. They have made it possible to acquire the information necessary for resolving the main problem arising during irradiation - the formation of coagulum. The first two cell are designed for irradiation by a horizontal beam ('Dynamitron'), the two others use a vertical beam ('Circe'). The study of the properties of the rubber obtained shows it to compare favorably with 'Revultex'. In the appendix are given some characteristics of natural latex and information about its processing. (authors) [French] Apres un rappel des principales etudes sur la radio-vulcanisation du latex et des elastomeres, on decrit les quatre types de cellules successivement essayes en vue de l'irradiation industrielle. Ils ont permis d'acquerir les informations necessaires a la resolution du probleme principal pose par l'irradiation, la formation de coagulum au cours de celle,-ci. Les deux premiers sont concus pour l'irradiation par un faisceau horizontal ('Dynamitron'), les derniers par un faisceau vertical ('Circe'). L'etude des proprietes du caoutchouc obtenu montre qu'il se compare favorablement au 'Revultex'. Un apercu est donne en annexe des caracteristiques du latex naturel et de sa mise en oeuvre. (auteurs)

  13. Sequencing and characterization of asclepain f: the first cysteine peptidase cDNA cloned and expressed from Asclepias fruticosa latex.

    Science.gov (United States)

    Trejo, Sebastián A; López, Laura M I; Caffini, Néstor O; Natalucci, Claudia L; Canals, Francesc; Avilés, Francesc X

    2009-07-01

    Asclepain f is a papain-like protease previously isolated and characterized from latex of Asclepias fruticosa. This enzyme is a member of the C1 family of cysteine proteases that are synthesized as preproenzymes. The enzyme belongs to the alpha + beta class of proteins, with two disulfide bridges (Cys22-Cys63 and Cys56-Cys95) in the alpha domain, and another one (Cys150-Cys201) in the beta domain, as was determined by molecular modeling. A full-length 1,152 bp cDNA was cloned by RT-RACE-PCR from latex mRNA. The sequence was predicted as an open reading frame of 340 amino acid residues, of which 16 residues belong to the signal peptide, 113 to the propeptide and 211 to the mature enzyme. The full-length cDNA was ligated to pPICZalpha vector and expressed in Pichia pastoris. Recombinant asclepain f showed endopeptidase activity on pGlu-Phe-Leu-p-nitroanilide and was identified by PMF-MALDI-TOF MS. Asclepain f is the first peptidase cloned and expressed from mRNA isolated from plant latex, confirming the presence of the preprocysteine peptidase in the latex.

  14. Dynamics of polyelectrolyte adsorption and colloidal flocculation upon mixing studied using mono-dispersed polystyrene latex particles

    NARCIS (Netherlands)

    Feng, Lili; Cohen Stuart, Martien; Adachi, Yasuhisa

    2015-01-01

    The dynamic behavior of polyelectrolytes just after their encounter with the surface of bare colloidal particles is analyzed, using the flocculation properties of mono-dispersed polystyrene latex (PSL) particles. Applying a Standardized Colloid Mixing (SCM) approach, effects of ionic strength and

  15. Diagnosis of Trichomonous vaginalis by microscopy, latex agglutination, diamond's media, and PCR in symptomatic women, Khartoum, Sudan.

    Science.gov (United States)

    Saleh, Amir M; Abdalla, Hamid S; Satti, Abdelsalam B; Babiker, Suad M; Gasim, Gasim I; Adam, Ishag

    2014-03-06

    Trichomoniasis is the most common sexually transmitted disease. However, limited data are available on an effective technique for the diagnosis of Trichomonas vaginalis. A cross-sectional study was conducted to evaluate the accuracy of wet mount microscopy, latex agglutination, Diamond's media, and polymerase chain reaction (PCR) for detection of T. vaginalis among symptomatic women who attended the gynecological clinic at Khartoum, Sudan. Of the 297 women studied, 252 (84.8%) were positive for T. vaginalis by wet mount microscopy, 257 (86.5%) by latex agglutination, 253 (85.2%) by Diamond's media, and 253 (85.2%) by PCR. The sensitivity and specificity of wet mount microscopy were 99.2% and 97.7%, respectively, compared with PCR. The sensitivity and specificity of latex agglutination and Diamond's media were 99.6% and 88.6%, and 100.0% and 86.4%, respectively, compared with PCR. In this study, wet mount microscopy, latex agglutination, and Diamond's media were found to be highly sensitive and specific. However, the availability and cost effectiveness might limit the use of Diamond's media and PCR in routine practice. The virtual slide(s) for this article can be found here: http://www.diagnosticpathology.diagnomx.eu/vs/7859723851211496.

  16. Dragon Fruit Foliage Plant-Based Coagulant for Treatment of Concentrated Latex Effluent: Comparison of Treatment with Ferric Sulfate

    Directory of Open Access Journals (Sweden)

    Juferi Idris

    2013-01-01

    Full Text Available The effectiveness of dragon fruit foliage as a natural coagulant for treatment of concentrated latex effluent was investigated and compared with ferric sulfate, a chemical coagulant. Dragon fruit is a round and often red-colored fruit with scales-like texture and is native to south American countries which is also cultivated and heavily marketed in southeast Asian countries. Its foliage represents a part of its overall plant system. Latex effluent is one of the main byproduct from rubber processing factories in Malaysia. Three main parameters investigated were chemical oxygen demand (COD, suspended solids (SS, and turbidity of effluent. Coagulation experiments using jar test were performed with a flocculation system where the effects of latex effluent pH as well as coagulation dosage on coagulation effectiveness were examined. The highest recorded COD, SS, and turbidity removal percentages for foliage were observed for effluent pH 10 at 94.7, 88.9, and 99.7%, respectively. It is concluded that the foliage showed tremendous potential as a natural coagulant for water treatment purposes. The foliage could be used in the pretreatment stage of Malaysian latex effluent prior to secondary treatment.

  17. Detection of latex allergens by immunoelectron microscopy in ambient air (PM10) in Oslo, Norway (1997-2003).

    Science.gov (United States)

    Namork, Ellen; Kurup, Viswanath P; Aasvang, Gunn Marit; Johansen, Bjørn V

    2004-11-01

    The authors collected ambient air along two highways in Oslo to investigate the annual variations in particulate matter (PM10) and the presence of latex as an outdoor allergen. PMI, was monitored for a period of five years, during which time the use of studded winter tires was reduced. The presence of latex and of common aeroallergens was examined directly on the collection filters with immunoelectron microscopy visualized in a scanning electron microscope. The annual variation in PM10 was similar over the five years of sampling, with increased mass concentrations in winter. Statistical analysis indicated no major effect from the change to nonstudded tires. The most important factors influencing the PM10 concentration were meteorological parameters like wind and rain. Immnunolabeling of the filters showed latex as an outdoor allergen that adhered to carbon aggregates from vehicle emission. The results also indicated cross-reactive epitopes among the common allergens investigated, which for sensitized subjects may add to the risk of developing latex allergy.

  18. The patatin-like protein from the latex of Hevea brasiliensis (Hev b 7) is not a vacuolar protein

    NARCIS (Netherlands)

    Jekel, PA; Hofsteenge, J; Beintema, JJ

    Upon centrifugation, rubber latex is divided into a layer of rubber particles, the cytosol, and the lutoid-body fraction, which is of vacuolar origin. One of the proteins isolated from the lutoid-body fraction is a protein with a molecular mass of 43 kDa, which has esterase activity on

  19. Banyan latex: a facile fuel for the multifunctional properties of MgO nanoparticles prepared via auto ignited combustion route

    International Nuclear Information System (INIS)

    Anil Kumar, M R; Nagaswarupa, H P; Gurushantha, K; Pratapkumar, C; Prashantha, S C; Shashishekar, T R; Anantharaju, K S; Nagabhushana, H; Sharma, S C; Vidya, Y S; Daruka Prasad, B; Vivek Babu, C S; Vishnu Mahesh, K R

    2015-01-01

    MgO nanoparticles (MNPs) were prepared by a solution combustion route using banyan tree (BT) latex and glycine as fuels. The powder x-ray diffraction results indicate the formation of a single cubic phase and the crystallite size obtained from transmission electron microscopy was found to be ∼10–15 nm. Scanning electron microscopy result reveals spherical-shaped particles obtained with BT latex. However, in a chemical route, porous and agglomerated particles were obtained. The energy band gap of MNPs obtained using BT latex and a chemical route were found to be in the range 4.85–5.0 eV. Photoluminescence peaks observed at 473, 514, and 588 nm when excited at 433 nm, which were attributed to surface defects. The enhanced photocatalytic activities of spherical MgO were due to smaller crystallite size, higher surface defects, dye sensitization, and capability to reduce the electron–hole pair recombination. Further, green-synthesized MNPs exhibit superior antifungal activity against various plant pathogens. The present studies demonstrated a green engineering route for the synthesis of multifunctional MNPs using BT latex. (paper)

  20. Barrier and adhesion properties of anti-corrosion coatings based on surfactant-free latexes from anhydride-containing polymers

    NARCIS (Netherlands)

    Soer, W.J.; Ming, W.; Koning, C.E.; Benthem, van R.A.T.M.; Mol, J.M.C.; Terryn, H.

    2009-01-01

    We have successfully obtained surfactant-free latexes from anhydride-containing polymers, including poly(styrene-alt-maleic anhydride) (PSMA), maleinized polybutadiene (PBDMA), and poly(octadecene-alt-maleic anhydride) (POMA). Here we report barrier and adhesion properties of the coatings made from

  1. Sulfonated macro-RAFT agents for the surfactant-free synthesis of cerium oxide-based hybrid latexes

    NARCIS (Netherlands)

    Garnier, J.; Warnant, J.; Lacroix-Desmazes, P.; Dufils, P.E.; Vinas, J.; Herk, van A.M.

    2013-01-01

    Three types of amphiphatic macro-RAFT agents were employed as compatibilizers to promote the polymerization reaction at the surface of nanoceria for the synthesis of CeO2-based hybrid latexes. Macro-RAFT copolymers and terpolymers were first synthesized employing various combinations of butyl

  2. Enzymic and structural studies on processed proteins from the vacuolar (lutoid-body) fraction of latex of Hevea brasiliensis

    NARCIS (Netherlands)

    Subroto, T; de Vries, H; Schuringa, JJ; Soedjanaatmadja, UMS; Hofsteenge, J; Jekel, PA; Beintema, JJ

    2001-01-01

    The lutoid-body (bottom) fraction of latex from the rubber tree (Hevea brasiliensis) contains a limited number of major proteins. These are the chitin-binding protein hevein, its precursor and C-terminal fragment of the precursor, a basic chitinase/lysozyme, and a beta-1,3-glucanase. The content and

  3. Effect of Hevea brasiliensis latex sap gel on healing of acute skin wounds induced on the back of rats

    Directory of Open Access Journals (Sweden)

    Maria Vitória Carmo Penhavel

    Full Text Available Objective : to evaluate the effect of topical delivery of latex cream-gel in acute cutaneous wounds induced on the back of rats. Methods : we subjected sixteen rats to dermo-epidermal excision of a round dorsal skin flap, with 2.5cm diameter. We divided the animals into two groups: Latex Group: application of cream-gel-based latex throughout the wound bed on postoperative days zero, three, six and nine; Control group: no treatment on the wound. Photographs of the lesions were taken on the procedure day and on the 6th and 14th postoperative days, for analyzing the area and the larger diameter of the wound. We carried out euthanasia of all animals on the 14th postoperative day, when we resected he dorsal skin and the underlying muscle layer supporting the wound for histopathological study. Results : there was no statistically significant difference in the percentage of wound closure, in the histopathological findings or in the reduction of the area and of the largest diameter of the wounds among the groups studied on the 14th postoperative day. Conclusion : according to the experimental conditions in which the study was conducted, latex cream-gel did not interfere in the healing of acute cutaneous wounds in rats.

  4. Latex Allergy

    Science.gov (United States)

    American Academy of Allergy Asthma & Immunology Menu Search Main navigation Skip to content Conditions & Treatments Allergies Asthma Primary Immunodeficiency Disease Related Conditions Drug Guide Conditions Dictionary Just ...

  5. Latex Allergy

    Science.gov (United States)

    ... Conditions Drug Guide Conditions Dictionary Just for Kids Library School Tools Videos Virtual Allergist Education & Training Careers in ... Support the AAAAI Foundation Donate Utility navigation Español Journals Annual Meeting Member Login / My Membership Search navigation ...

  6. Latex Allergy

    Science.gov (United States)

    ... Kids and Teens Pregnancy and Childbirth Women Men Seniors Your Health Resources Healthcare Management End-of-Life Issues Insurance & Bills Self Care Working With Your Doctor Drugs, Procedures & Devices Over-the- ...

  7. Mechanical and Permeability Characteristics of Latex-Modified Pre-Packed Pavement Repair Concrete as a Function of the Rapid-Set Binder Content

    Directory of Open Access Journals (Sweden)

    Jae-Woong Han

    2015-10-01

    Full Text Available We evaluated the strength and durability characteristics of latex-polymer-modified, pre-packed pavement repair concrete (LMPPRC with a rapid-set binder. The rapid-set binder was a mixture of rapid-set cement and silica sand, where the fluidity was controlled using a latex polymer. The resulting mix exhibited a compressive strength of ¥21 MPa and a flexural strength of ¥3.5 MPa after 4 h of curing (i.e., the traffic opening term for emergency repairs of pavement. The ratio of latex polymer to rapid-set binder material was varied through 0.40, 0.33, 0.29, and 0.25. Mechanical characterization revealed that the mechanical performance, permeability, and impact resistance increased as the ratio of latex polymer to rapid-set binder decreased. The mixture exhibited a compressive strength of ¥21 MPa after 4 h when the ratio of latex polymer to rapid-set binder material was ¤0.29. The mixture exhibited a flexural strength of ¥3.5 MPa after 4 h when the ratio of latex polymer to rapid-set binder material was ¤0.33. The permeability resistance to chloride ions satisfied 2000 C after 7 days of curing for all ratios. The ratio of latex polymer to rapid-set binder material that satisfied all conditions for emergency pavement repair was ¤0.29.

  8. Detection and toxicity assessment of nitrosamines migration from latex gloves in the Chinese market.

    Science.gov (United States)

    Feng, Di; Wang, Huiping; Cheng, Xuelian; Wang, Jiedong; Ning, Lifeng; Zhou, Qingfeng; Zhou, Yue; Yang, Quanli

    2009-09-01

    Nitrosamines are potent carcinogens and have been found in latex products. In 2007, twenty-seven natural latex gloves including sterile gloves, examination gloves and household use gloves were sampled from the Chinese market. This study monitored the migration of nitrosamines and nitrosatable substance from these gloves, and evaluated their mutagenicity using a Salmonella typhimurium mutation assay (Ames assay) with the strains TA98, TA97, TA100 and TA102 and by a micronucleus test (MN test) using ICR mice. In addition, the cytotoxicity of these compounds was determined by a MTT assay. N-nitrosodimethylamine (NDMA), N-nitrosodiethylamine (NDEA) and N-nitrosodibutylamine (NDBA) were all found in samples treated with artificial sweat for 4h at 37 degrees C, and total nitrosamines varied from 18.89 to 244.51microg/Kg. The nitrosamine mixture of NDMA, NDEA and NDBA was used in both the Ames assay and the MN test. The proportion of NDMA, NDEA and NDBA (1:10:20) was selected according to the proportion of nitrosamines migration from sample E05. In the Ames assay, the lowest dose (1.98 x 10(-3)microg per plate) produced a positive result in the TA98 strain, corresponding to nitrosamines migration from sample E05 of 0.016g (the total nitrosamines migration from glove E05 was 122.55 microg/kg). The TA100 strain responded positively at a dose of 4.96 x 10(-2)microg per plate, corresponding to nitrosamines migration from glove E05 of 0.040g. The MN test showed nitrosamine migration of 3.04 mg from 2066 pairs of sample E05 and could induce micronuclei in one mouse weighing 28g (average weight of one E05 glove was 6g). Extracts from gloves were found to be cytotoxic and there was a significant correlation between cytotoxicity (IC50) and the release level of nitrosamines. In conclusion, in view of the high content of nitrosamines in latex gloves and the potential toxicity of nitrosamines migration from these gloves, it is suggested that both an effective and feasible detection

  9. Type I allergy to natural rubber latex and type IV allergy to rubber chemicals in health care workers with glove-related skin symptoms.

    Science.gov (United States)

    Nettis, E; Assennato, G; Ferrannini, A; Tursi, A

    2002-03-01

    It has been established that there are type I and type IV allergens in latex gloves. The purpose of the study was to establish the prevalence of rubber glove-induced skin symptoms among health care workers in one Italian hospital. Health care workers (n = 1584) were evaluated using a written questionnaire and 295 respondents with glove-induced skin symptoms were tested. We performed: skin prick test with latex glove extract and commercial latex, and environmental and food allergens; glove use test; patch tests with a rubber additive series; and RASTs. Hospital employees who used or had used latex gloves at work were 1294. Three hundred and sixteen (24.4%) reported glove-induced symptoms, namely, cutaneous symptoms in all the cases and non-cutaneous symptoms in 105 subjects (8.1%). Twenty-seven of the 295 symptomatic employees tested (9.1%) were latex sensitive. Thirty-one patients (10.5%) exhibited positive patch test to rubber-related allergens. The most positive readings were obtained from the Thiuram mix and the Carba mix, with 12 and 9 positivities, respectively. The risk factors for latex skin sensitization were: a previous history of atopy and asthma; history of surgery; pre-existing hand dermatitis; work-related symptoms; and positive skin tests to common inhalant and certain foods (P skin complaints of latex gloves are related to skin irritation rather than to allergy. The immediate allergy to latex and the delayed allergy to rubber chemicals suggest that all the health care workers with glove-related dermatitis should undergo both skin prick test and glove use test to detect type I hypersensitivity to latex, and patch test to detect type IV hypersensitivity to rubber chemicals.

  10. Preparation and Characterization of Conducting Polymer Latices by Chemical Polymerization of Aniline or Anisidine in Presence of Latex: Study of Their Electroactivity and Anti-Corrosion Properties

    Directory of Open Access Journals (Sweden)

    Bakhshali Massoumi

    2013-06-01

    Full Text Available Poly (vinylacetate-co-butylmethacrylate was prepared in presence of potassium persulphate as an oxidizing agent in aqueous solution of dodecylbenzene sulfonate sodium as an emulsifying agent. Then, aniline was polymerized by chemical oxidation method at three different concentrations of aniline monomer (0.1, 0.2 and 0.3 M in toluene in presence of poly(vinylacetate-co-butylmethacrylate in order to obtain polyaniline/poly(vinylacetate-co-butylmethacrylate. To prepare conducting-latex of polyanisidine/poly(vinylacetate-co-butylmethacrylate the same method was employed as above for aniline monomer in obtaining conducting polyaniline/poly(vinylacetate-co-butylmethacrylate latex. In addition, the purification of conducting-latex polymers, polyaniline/poly(vinylacetate-co-butylmethacrylate and polyanisidine/poly(vinylacetate-co-butylmethacrylate was conducted and preparation of tin layer films of conducting-latex polymers was carried out by casting method on glassy lames. The electroactivity properties of the prepared latex-polymers, polyaniline/poly(vinylacetate-co-butylmethacrylate and polyanisidine/poly(vinylacetate-co-butylmethacrylate were investigated by cyclic voltammetery (CV. The voltamogrames showed that the latex films were electroactive. Because of conductivity and electroactivity, the obtained films may find applications in anti-corrosion coatings. The anti-corrosion properties of conducting-latex polymers were studied on aluminum surface by impedance technique. The structure of the prepared conducting-latex polymers was confirmed by Fourier transform infrared (FTIR. Finally, the electrical conductivity of synthesized conducting-latex polymers, polyaniline/poly(vinylacetate-co-butylmethacrylate and polyanisidine/poly(vinylacetate-co-butylmethacrylate was measured by four probe technique.

  11. Particle size, morphology and color tunable ZnO:Eu{sup 3+} nanophosphors via plant latex mediated green combustion synthesis

    Energy Technology Data Exchange (ETDEWEB)

    Chandrasekhar, M. [Prof. C.N.R. Rao Centre for Advanced Materials, Tumkur University, Tumkur 572 103 (India); Department of Physics, Acharya Institute of Technology, Bangalore 560 107 (India); Nagabhushana, H., E-mail: bhushanvlc@gmail.com [Prof. C.N.R. Rao Centre for Advanced Materials, Tumkur University, Tumkur 572 103 (India); Sharma, S.C. [B.S. Narayan Centre of Excellence for Advanced Materials, B.M.S. Institute of Technology, Yelahanka, Bangalore 560 064 (India); Department of Mechanical Engineering, B.M.S. Institute of Technology, Yelahanka, Bangalore 560 064 (India); Sudheer kumar, K.H. [Department of Environmental Science, Kuvempu University, Shankarghatta, Shimoga 577 451 (India); Department of Chemistry, B.M.S. Institute of Technology, Yelahanka, Bangalore 560 064 (India); B.S. Narayan Centre of Excellence for Advanced Materials, B.M.S. Institute of Technology, Yelahanka, Bangalore 560 064 (India); Dhananjaya, N. [Department of Physics, B.M.S. Institute of Technology, Yelahanka, Bangalore 560 064 (India); B.S. Narayan Centre of Excellence for Advanced Materials, B.M.S. Institute of Technology, Yelahanka, Bangalore 560 064 (India); Sunitha, D.V. [Prof. C.N.R. Rao Centre for Advanced Materials, Tumkur University, Tumkur 572 103 (India); Shivakumara, C. [Solid State and Structural Chemistry Unit, Indian Institute of Science, Bangalore 560 012 (India); Nagabhushana, B.M. [Department of Chemistry, M.S. Ramaiah Institute of Technology, Bangalore 560 054 (India)

    2014-01-25

    Highlights: • ZnO:Eu{sup 3+} phosphors were prepared by green synthesis route. • Morphology and particle size was tuned by varying the concentration of plant latex. • The phosphor show excellent chromaticity coordinates in the white region. -- Abstract: Efficient ZnO:Eu{sup 3+} (1–11 mol%) nanophosphors were prepared for the first time by green synthesis route using Euphorbia tirucalli plant latex. The final products were well characterized by powder X-ray diffraction (PXRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM), UV–visible spectroscopy (UV–Vis), Fourier transform infrared spectroscopy (FTIR), etc. The average particle size of ZnO:Eu{sup 3+} (7 mol%) was found to be in the range 27–47 nm. With increase of plant latex, the particle size was reduced and porous structure was converted to spherical shaped particles. Photoluminescence (PL) spectra indicated that the peaks situated at ∼590, 615, 648 and 702 nm were attributed to the {sup 5}D{sub 0} → {sup 7}F{sub j(j=1,2,3,4)} transitions of Eu{sup 3+} ions. The highest PL intensity was recorded for 7 mol% with Eu{sup 3+} ions and 26 ml plant latex concentration. The PL intensity increases with increase of plant latex concentration up to 30 ml and there after it decreases. The phosphor prepared by this method show spherical shaped particles, excellent chromaticity co-ordinates in the white light region which was highly useful for WLED’s. Further, present method was reliable, environmentally friendly and alternative to economical routes.

  12. Study of the effect of ionizing radiation on the structure of natural rubber latex by positron annihilation technique

    International Nuclear Information System (INIS)

    Lopez Saldana, I.R.

    1993-01-01

    At the present research, were studied the changes in natural rubber latex structure, due to electron beam by a 3 MeV, 25 m A Dynamitron electron accelerator. The natural rubber latex was irradiated at 30, 40 and 50 kGy/s dose rate, over a total dose range from 150 to 250 kGy, for each dose rate used. From natural rubber latex irradiated films were prepared by casting with 0.7 mm. thickness. In the main part, the study was made by positron annihilation lifetime (PAL), this technique is unique in the determination of free-volume properties due to the fact that positronium atom (Ps) is found to be preferentially localized in the free-volume region of polymeric materials. The positron lifetime measurements were performing using a gamma-gamma coincidence system. These results were analyzed by PATFIT-88 program computer into three components, the long-lived component for orthopositronium (o-Ps) with parameters lifetime (τ 3 ) and formation intensity (I 3 ), were plotted and analyzed for each dose rate and total dose used. Besides with τ 3 were calculated the mean free-volume size based on the spherical model for the free-volume bubble, found that the free-volume decrease slightly with the total dose due to the crosslinking of natural rubber latex. Besides was studied the effect of dose rate on tensile strength, the tensile strength is increased with the total dose although there was not a clear effect due to the dose rate. Also the films were subjected to aging in order to determined the thermal stability of natural rubber latex irradiated, the results show that the films have good stability. Besides was used the infrared spectroscopy to determine the changes due to the crosslinking by variations in the characteristically absorption bands for cis 1,4-polyisoprene. (Author)

  13. High Performance Graphene Oxide Based Rubber Composites

    Science.gov (United States)

    Mao, Yingyan; Wen, Shipeng; Chen, Yulong; Zhang, Fazhong; Panine, Pierre; Chan, Tung W.; Zhang, Liqun; Liang, Yongri; Liu, Li

    2013-01-01

    In this paper, graphene oxide/styrene-butadiene rubber (GO/SBR) composites with complete exfoliation of GO sheets were prepared by aqueous-phase mixing of GO colloid with SBR latex and a small loading of butadiene-styrene-vinyl-pyridine rubber (VPR) latex, followed by their co-coagulation. During co-coagulation, VPR not only plays a key role in the prevention of aggregation of GO sheets but also acts as an interface-bridge between GO and SBR. The results demonstrated that the mechanical properties of the GO/SBR composite with 2.0 vol.% GO is comparable with those of the SBR composite reinforced with 13.1 vol.% of carbon black (CB), with a low mass density and a good gas barrier ability to boot. The present work also showed that GO-silica/SBR composite exhibited outstanding wear resistance and low-rolling resistance which make GO-silica/SBR very competitive for the green tire application, opening up enormous opportunities to prepare high performance rubber composites for future engineering applications. PMID:23974435

  14. Preparation of magnetic latexes functionalized with chloromethyl groups via emulsifier-free miniemulsion polymerization

    International Nuclear Information System (INIS)

    Faridi-Majidi, Reza; Sharifi-Sanjani, Naser

    2007-01-01

    Functionalized crosslinked polystyrene-co-divinylbenzene-co-chloromethylstyrene magnetic latex particles were prepared via emulsifier-free miniemulsion polymerization using 2, 2' azobis (2-amidinopropane) dihydrochloride (V-50) as an initiator and in the presence of magnetite nanoparticles in the monomers. Transmission electron microscopy (TEM) proved the presence of magnetite nanoparticles in polymer particles. Differential scanning calorimetery (DSC) analysis of the product showed an exothermic signal due to crosslinking of chains through electrophilic aromatic substitution of phenyl groups with chloromethyl groups in the presence of the dispersed Fe 3 O 4 as Lewis acid. This was proven by thermogravimetric analysis (TGA) via the loss of gaseous HCl. The results were also compared with those of magnetite-free miniemulsion polymerization using V-50

  15. Preparation of magnetic latexes functionalized with chloromethyl groups via emulsifier-free miniemulsion polymerization

    Energy Technology Data Exchange (ETDEWEB)

    Faridi-Majidi, Reza [School of Chemistry, University College of Science, Tehran University, Tehran (Iran, Islamic Republic of)]. E-mail: refaridi@khayam.ut.ac.ir; Sharifi-Sanjani, Naser [School of Chemistry, University College of Science, Tehran University, Tehran (Iran, Islamic Republic of)

    2007-04-15

    Functionalized crosslinked polystyrene-co-divinylbenzene-co-chloromethylstyrene magnetic latex particles were prepared via emulsifier-free miniemulsion polymerization using 2, 2' azobis (2-amidinopropane) dihydrochloride (V-50) as an initiator and in the presence of magnetite nanoparticles in the monomers. Transmission electron microscopy (TEM) proved the presence of magnetite nanoparticles in polymer particles. Differential scanning calorimetery (DSC) analysis of the product showed an exothermic signal due to crosslinking of chains through electrophilic aromatic substitution of phenyl groups with chloromethyl groups in the presence of the dispersed Fe{sub 3}O{sub 4} as Lewis acid. This was proven by thermogravimetric analysis (TGA) via the loss of gaseous HCl. The results were also compared with those of magnetite-free miniemulsion polymerization using V-50.

  16. Antifungal activity of fluconazole-loaded natural rubber latex against Candida albicans.

    Science.gov (United States)

    Yonashiro Marcelino, Mônica; Azevedo Borges, Felipe; Martins Costa, Ana Flávia; de Lacorte Singulani, Junya; Ribeiro, Nathan Vinícius; Barcelos Costa-Orlandi, Caroline; Garms, Bruna Cambraia; Soares Mendes-Giannini, Maria José; Herculano, Rondinelli Donizetti; Fusco-Almeida, Ana Marisa

    2018-03-01

    This work aimed to produce a membrane based on fluconazole-loaded natural rubber latex (NRL), and study their interaction, drug release and antifungal susceptibility against Candida albicans. Fluconazole-loaded NRL membrane was obtained by casting method. The Fourier Transform Infrared Spectroscopy showed no modifications either in NRL or fluconazole after the incorporation. Mechanical test presented low Young's modulus and high strain, indicating the membranes have sufficient elasticity for biomedical application. The bio-membrane was able to release the drug and inhibit the growth of C. albicans as demonstrated by disk diffusion and macrodilution assays. The biomembrane was able to release fluconazole and inhibit the growth of C. albicans, representing a promising biomaterial for skin application.

  17. Formation of protein complex with the aid of polyethylene glycol for deproteinized natural rubber latex

    Science.gov (United States)

    Wei, Lim Keuw; Ing, Wong Kwee; Badri, Khairiah Haji; Ban, Wong Chong

    2013-11-01

    The effect of polyethylene glycol (PEG) as a deproteinizing agent in commercial natural rubber latex (NRL) onto the physicochemical properties of the NRL was investigated. Three types of PEG were used namely PEG200, PEG4000 and PEG20000 (molecular weight of 200, 4000 and 20000 g/mol respectively). The optimum amount of PEG in NRL was determined from viscosity changes, protein content and Fourier Transform Infrared spectroscopy. Level of protein reduction was affected by molecular weight of PEG. The addition of PEG in NRL reduced the protein content of NRL (3.30 %) to the lowest (2.01 %) at 0.40 phr of PEG200 due to more attractive hydrophobic interactions between short chains PEG compared to PEG4000 (2.24%) and PEG20000 (2.15%). This was verified through FTIR spectroscopy analysis by observing the primary and secondary amide peak where PEG4000 has lesser absorption at the region compared to with PEG20000.

  18. Diclofenac Potassium Transdermal Patches Using Natural Rubber Latex Biomembranes as Carrier

    Directory of Open Access Journals (Sweden)

    Natan Roberto de Barros

    2015-01-01

    Full Text Available The aim of this study was to design a compound transdermal patch containing diclofenac potassium (Dic-K using natural rubber latex (NRL biomembrane. The NRL from Hevea brasiliensis is easily manipulated and low cost and presents high mechanical resistance. It is a biocompatible material which can stimulate natural angiogenesis and is capable of adhering cells on its surface. Recent researches have used the NRL for Transdermal Drug Delivery Systems (TDDSs. Dic-K is used for the treatment of rheumatoid arthritis and osteoarthritis and pain relief for postoperative and posttraumatic cases, as well as inflammation and edema. Results showed that the biomembrane can release Dic-K for up to 216 hours. The kinetics of the Dic-K release could be fitted with double exponential function. X-ray diffraction and Fourier Transform Infrared (FTIR spectroscopy show some interaction by hydrogen bound. The results indicated the potential of the compound patch.

  19. Characteristic of natural rubber latex-methyl metha-crylate copolymer in mineral lubricant base oil

    International Nuclear Information System (INIS)

    Meri Suhartini; Rahmawati

    2010-01-01

    Natural rubber latex-methyl methacrylate copolymer was diluted in xylene, then diluted in four types of lubricant base oil with concentrations of 0.25%, 1%, 5%, and 10%. The mixed solutions were analyzed to obtain kinematics viscosity, viscosity index, density, ash content, metal content, flash point, shear stability and total alkali number. The viscosity index of sample, increased by adding the copolymer solution. The results showed that lubricant base oil of High Viscosity index (HVI) 60 and mixed HVI 60: HVI 650 gave optimum viscosity index. The higher concentration of polymer added into base lubricant oil, the higher viscosity index obtained. The shear stability test showed that the kinematics viscosity of sample decreased 6.5% after 60 minutes of treatment test. (author)

  20. Production and testing of 244Cm-labeled fluorescent polystyrene latex microspheres

    International Nuclear Information System (INIS)

    Guilmette, R.A.; Mueller, H.L.; Brodbeck, R.D.

    1988-01-01

    To provide a useful tool for studying the mechanisms of retention and translocation of respirable-sized, alpha-emitting particles, we have developed a method of incorporating 244 Cm into fluorescent polystyrene latex microspheres. The resultant particles contain alpha radioactivity comparable to μm-size (AMAD) 239 Pu0 2 particles, but are easily visible by fluorescent light microscopy. Preliminary testing of the particles with dog macrophages in vitro has shown that the initial uptake of these Cm-labeled particles is more rapid than uptake of unlabeled particles of similar size. We are continuing to develop procedures for achieving better particle yields, smaller dispersity of particle size distributions and improved retention of the Cm label by the particles. (author)

  1. Production and testing of {sup 244}Cm-labeled fluorescent polystyrene latex microspheres

    Energy Technology Data Exchange (ETDEWEB)

    Guilmette, R A; Mueller, H L; Brodbeck, R D

    1988-12-01

    To provide a useful tool for studying the mechanisms of retention and translocation of respirable-sized, alpha-emitting particles, we have developed a method of incorporating {sup 244}Cm into fluorescent polystyrene latex microspheres. The resultant particles contain alpha radioactivity comparable to {mu}m-size (AMAD) {sup 239}Pu0{sub 2} particles, but are easily visible by fluorescent light microscopy. Preliminary testing of the particles with dog macrophages in vitro has shown that the initial uptake of these Cm-labeled particles is more rapid than uptake of unlabeled particles of similar size. We are continuing to develop procedures for achieving better particle yields, smaller dispersity of particle size distributions and improved retention of the Cm label by the particles. (author)

  2. Fluorescent Labeling and Biodistribution of Latex Nanoparticles Formed by Surfactant-Free RAFT Emulsion Polymerization.

    Science.gov (United States)

    Poon, Cheuk Ka; Tang, Owen; Chen, Xin-Ming; Kim, Byung; Hartlieb, Matthias; Pollock, Carol A; Hawkett, Brian S; Perrier, Sébastien

    2017-10-01

    The authors report the preparation of a novel range of functional polyacrylamide stabilized polystyrene nanoparticles, obtained by surfactant-free reversible addition-fragmentation chain transfer (RAFT) emulsion polymerization, their fluorescent tagging, cellular uptake, and biodistribution. The authors show the versatility of the RAFT emulsion process for the design of functional nanoparticles of well-defined size that can be used as drug delivery vectors. Functionalization with a fluorescent tag offers a useful visualization tool for tracing, localization, and clearance studies of these carriers in biological models. The studies are carried out by labeling the sterically stabilized latex particles chemically with rhodamine B. The fluorescent particles are incubated in a healthy human renal proximal tubular cell line model, and intravenously injected into a mouse model. Cellular localization and biodistribution of these particles on the biological models are explored. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  3. Toxicological evaluation of natural rubber latex film vulcanized with ionizing radiation

    International Nuclear Information System (INIS)

    Campos, Vania E.; Higa, Olga Z.; Guedes, Selma M.L.; Hanada, Seico

    1999-01-01

    The industrial vulcanization of natural rubber latex (NRL) is made worldwide by conventional process using sulphur, but it can be made by an alternative process using ionizing radiation. The main advantages of this process are related to absence of toxic effect promoted by chemical substances added to the NRL on the conventional process. In this research was tested the toxicological properties of the films vulcanized by the alternative process in relation to that vulcanized by the conventional process. The toxicity was evaluated by in vitro cytotoxicity assay and in vivo systemic toxicity assay. The results showed that vulcanized films by gamma ray are less cytotoxic. The systemic toxicity assay showed that only the vulcanized film using sulphur induced allaying and motor in coordination on the animals for a short period of time. these results evidence the less cytotoxic properties of vulcanized films by gamma ray in relation to that vulcanized by conventional process using sulphur. (author)

  4. Latex content and biomass increase in Mycorrhizal guayule (Parthenium argentatum) under field conditions

    Energy Technology Data Exchange (ETDEWEB)

    Bloss, H.E.; Pfeiffer, C.M.

    1984-01-01

    Guayule seedlings were inoculated with two Glomus species in pasteurised soil and grown in the glasshouse without added fertilizer for 8 weeks prior to transplanting to the field. The survival rate of transplanted guayule seedlings was increased by inoculation with vesicular arbuscular mycorrhizal fungi compared wtih uninoculated controls. Inoculated guayule had greater concentrations of Ca, Fe, Mg and Mn at six months of age, and greater concentrations of Ca, Mg, and Zn at 12 months of age than did uninoculated plants. The latex content of both roots and shoots of guayule was greater in inoculated than in uninoculated guayule plants at 12 and 18 months of age. The resin content remained unchanged between treatments irrespective of sampling date.

  5. Quality and quantity of latex which can be produced from natural vegetation in Greece

    Energy Technology Data Exchange (ETDEWEB)

    Margaris, N.S.; Vokou, D.; Diamantopoulos, J.

    1985-01-01

    Euphorbiaceae is one of the major latex producing families very promising in terms of exploitation as energy sources. Research in the Greek areas proved that Euphorbia species are very numerous with high contribution in biomass terms in many of them. Provided are data concerning growth characteristics of E. dendroides and E. acanthothamnos to answer the question of the feasibility of harvesting. E. helioscopia is proved to be a very promising species with many ecotypes. Its occurrence and extremely increased growth in olive, almonds, and pear plantations makes it a very important species needing further research to evaluate the possibility of combined cultivation with the above mentioned trees. It is estimated the oil production that such plantations may yield.

  6. Enhancement of sludge granulation in anaerobic treatment of concentrated latex wastewater

    Directory of Open Access Journals (Sweden)

    Nugul Intrasungkha

    2008-04-01

    Full Text Available Recently, the upflow anaerobic sludge blanket (UASB reactor has become attractive for wastewater treatment with low energy requirement and biogas production. However, the start-up of an UASB reactor depends on the formation of granules. Therefore, this research aims to study the effect of AlCl3, CaCl2 and temperature on the granule formation process using real concentrated latex wastewater. The result shows that the optimum chemicals concentration of AlCl3 at 300 mg/l enhanced the biomass accumulation and sludge formation process. Approximately 50% of large granular size (0.5 mm 0.8 mm within 35 days, whereas the large granular sizes in reactorwithout AlCl3 supplement (R2 became visible within 63 days. Moreover, this experiment found that R1, R2 and R3 could reach steady state within 40, 55 and 45 days, respectively.

  7. Finite Element Analysis of Simple Rectangular Microstrip Sensor for Determination Moisture Content of Hevea Rubber Latex

    Science.gov (United States)

    Yahaya, NZ; Ramli, MR; Razak, NNANA; Abbas, Z.

    2018-04-01

    The Finite Element Method, FEM has been successfully used to model a simple rectangular microstrip sensor to determine the moisture content of Hevea rubber latex. The FEM simulation of sensor and samples was implemented by using COMSOL Multiphysics software. The simulation includes the calculation of magnitude and phase of reflection coefficient and was compared to analytical method. The results show a good agreement in finding the magnitude and phase of reflection coefficient when compared with analytical results. Field distributions of both the unloaded sensor as well as the sensor loaded with different percentages of moisture content were visualized using FEM in conjunction with COMSOL software. The higher the amount of moisture content in the sample the more the electric loops were observed.

  8. Ficus carica latex prevents invasion through induction of let-7d expression in GBM cell lines.

    Science.gov (United States)

    Tezcan, Gulcin; Tunca, Berrin; Bekar, Ahmet; Yalcin, Murat; Sahin, Saliha; Budak, Ferah; Cecener, Gulsah; Egeli, Unal; Demir, Cevdet; Guvenc, Gokcen; Yilmaz, Gozde; Erkan, Leman Gizem; Malyer, Hulusi; Taskapilioglu, Mevlut Ozgur; Evrensel, Turkkan; Bilir, Ayhan

    2015-03-01

    Glioblastoma multiforme (GBM) is one of the deadliest human malignancies. A cure for GBM remains elusive, and the overall survival time is less than 1 year. Thus, the development of more efficient therapeutic approaches for the treatment of these patients is required. Induction of tumor cell death by certain phytochemicals derived from medicinal herbs and dietary plants has become a new frontier for cancer therapy research. Although the cancer suppressive effect of Ficus carica (fig) latex (FCL) has been determined in a few cancer types, the effect of this latex on GBM tumors has not been investigated. Therefore, in the current study, the anti-proliferative activity of FCL and the effect of the FCL-temozolomide (TMZ) combination were tested in the T98G, U-138 MG, and U-87 MG GBM cell lines using the WST-1 assay. The mechanism of cell death was analyzed using Annexin-V/FITC and TUNEL assays, and the effect of FCL on invasion was tested using the chick chorioallantoic membrane assay. To determine the effect of FCL on GBM progression, the expression levels of 40 GBM associated miRNAs were analyzed in T98G cells using RT-qPCR. According to the obtained data, FCL causes cell death in GBM cells with different responses to TMZ, and this effect is synergistically increased in combination with TMZ. In addition, the current study is the first to demonstrate the effect of FCL on modulation of let-7d expression, which may be an important underlying mechanism of the anti-invasive effect of this extract.

  9. The Latex Protein MLX56 from Mulberry (Morus multicaulis Protects Plants against Insect Pests and Pathogens

    Directory of Open Access Journals (Sweden)

    Ying-Ping Gai

    2017-08-01

    Full Text Available Biotic stresses are major constraints limiting the leaf quality and productivity of mulberry. MLX56 is a unique chitin-binding protein isolated from Shin-Ichinose (Morus alba latex that displays toxicity against lepidopteran caterpillars. In this study, the full-length cDNA encoding MLX56 was isolated from Husang 32 (M. multicaulis and designated HMLX56. Amino acid sequence analysis and protein modeling of three MLX56 proteins showed that they were highly conserved among Morus species. Tissue expression pattern analysis showed that the HMLX56 gene was strongly expressed in mulberry bark and leaves but only slightly expressed in fruits. In addition, analysis of GUS expression indicated that the promoter of HMLX56 showed higher transcriptional activity along the vascular strands, and its activity can be regulated by various environmental factors. Like the MLX56 protein from M. alba, the HMLX56 protein showed toxicity to Plutella xylostella. Moreover, when the HMLX56 gene was ectopically expressed in Arabidopsis, the transgenic plants showed enhanced resistance to aphids, the fungal pathogen Botrytis cinerea and the bacterial pathogen Pseudomonas syringae pv. tomato DC3000. Our data suggest that the HMLX56 protein has a lectin-like molecular structure consisting of two hevein-like chitin-binding domains which provide not only chitin-binding activities but also other mechanisms of defense. The information provided here improves our understanding of the potential functions and defense mechanisms of MLX56 proteins, enabling in-depth functional analysis of latex exudates and perhaps facilitating mulberry genetic improvement in the future.

  10. Biochemical analysis of a papain-like protease isolated from the latex of Asclepias curassavica L.

    Science.gov (United States)

    Liggieri, Constanza; Obregon, Walter; Trejo, Sebastian; Priolo, Nora

    2009-02-01

    Most of the species belonging to Asclepiadaceae family usually secrete an endogenous milk-like fluid in a network of laticifer cells in which sub-cellular organelles intensively synthesize proteins and secondary metabolites. A new papain-like endopeptidase (asclepain c-II) has been isolated and characterized from the latex extracted from petioles of Asclepias curassavica L. (Asclepiadaceae). Asclepain c-II was the minor proteolytic component in the latex, but showed higher specific activity than asclepain c-I, the main active fraction previously studied. Both enzymes displayed quite distinct biochemical characteristics, confirming that they are different enzymes. Crude extract was purified by cation exchange chromatography (FPLC). Two active fractions, homogeneous by sodium dodecyl sulphate-polyacrylamide gel electrophoresis and mass spectrometry, were isolated. Asclepain c-II displayed a molecular mass of 23,590 Da, a pI higher than 9.3, maximum proteolytic activity at pH 9.4-10.2, and showed poor thermostability. The activity of asclepain c-II is inhibited by cysteine proteases inhibitors like E-64, but not by any other protease inhibitors such as 1,10-phenantroline, phenylmethanesulfonyl fluoride, and pepstatine. The Nterminal sequence (LPSFVDWRQKGVVFPIRNQGQCGSCWTFSA) showed a high similarity with those of other plant cysteine proteinases. When assayed on N-alpha-CBZ-amino acid-p-nitrophenyl esters, the enzyme exhibited higher preference for the glutamine derivative. Determinations of kinetic parameters were performed with N-alpha-CBZ-L-Gln-p-nitrophenyl ester as substrate: K(m)=0.1634 mM, k(cat)=121.48 s(-1), and k(cat)/K(m)=7.4 x 10(5) s(-1)/mM.

  11. Thermal-kinetic study of natural rubber latex films vulcanized by using gamma radiation; Estudo termo-cinetico de filmes de latex de borracha natural de Hevea brasiliensis vulcanizada por radiacao gama

    Energy Technology Data Exchange (ETDEWEB)

    Leal, Ana Paula Pinho Rodrigues; Barros, Glaucione Gomes de [Brasilia Univ., DF (Brazil). Inst. de Quimica; Guedes, Selma M.L. [Instituto de Pesquisa em Energia Nuclear, Sao Paulo, SP (Brazil)

    1999-07-01

    Vulcanization of natural rubber latex by ionization radiation produces the crosslink in disperse latex particles. Advantages over conventional process of vulcanization are: the absence of carcinogenic nitrosamines, low cytotoxicity and better degradation at room conditions, due to mainly to the absence of sulfur, zinc oxide and dithiocarbamates. Thermogravimetric analysis (TG) is the measurement of the weight change of a material as a function of temperature and time. TG data different heat speed provide an alternative model of the kinetics of degradation of polymeric materials. The kinetic studies of this material showed a single degradation process at least for 76,5% of mass loss. The activation energy was 49 Kcal/mol. For higher mass loss (85%) the degradation was characterized by associate mechanism. (author)

  12. Antifungal Activity of Leaf and Latex Extracts of Calotropis procera (Ait.) against Dominant Seed-Borne Storage Fungi of Some Oil Seeds

    OpenAIRE

    Manoorkar V B; Mandge S V; B D Gachande

    2015-01-01

    In present study, aqueous and ethanol extracts of leaf & latex of Calotropis procera (Ait.) was tested for their antifungal activity against dominant storage seed-borne fungi of some oil seeds such as groundnut, soybean, sunflower and mustard. The antifungal effect of ethanol and aqueous extracts of leaf & latex of Calotropis procera (Ait.) against ten seed-borne dominant fungi viz., Cuvularia lunata, Alternaria alternata, Rhizoctonia solani, Fusarium solani, Penicillium chrysogenum, Asperg...

  13. 15-demethylisoplumieride acid, a new iridoid isolated from the bark of Plumeria rubra and latex of Himatanthus sucuuba; Acido 15-desmetilisoplumierideo, um novo iridoide isolado das cascas de Plumeria rubra e do latex de Himatanthus sucuuba

    Energy Technology Data Exchange (ETDEWEB)

    Barreto, Alaide de Sa; Amaral, Ana Claudia F. [Fundacao Inst. Oswaldo Cruz (FIOCRUZ), Rio de Janeiro, RJ (Brazil). Instituto de Tecnologia em Farmacos -Farmanguinhos. Lab. de Plantas Medicinais e Derivados; Silva, Jefferson Rocha de A. [Universidade Federal do Amazonas, Manaus, AM (Brazil). Dept. de Quimica]. E-mail: jrocha_01@ufam.edu.br; Schripsema, Jan [Universidade Estadual do Norte Fluminense (UENF), Campos dos Goytacazes, RJ (Brazil). Setor de Quimica de Produtos Naturais; Rezende, Claudia M.; Pinto, Angelo C. [Universidade Federal do Rio de Janeiro (UFRJ), RJ (Brazil). Inst. de Quimica

    2007-09-15

    Himatanthus sucuuba and Plumeria rubra are used in folk medicine in Brazil to treat various ailments. The isolation of the new iridoid 15-demethylisoplumieride from the bark of Plumeria rubra L. var. acutifolia (Ait) Woodson and latex of Himatanthus sucuuba (Spruce) Woodson is reported. Other iridoid glycosides were obtained from both plants. The structures of these substances were elucidated by spectral analysis and comparison with data already reported. (author)

  14. First record of the behavior of latex drainage by Trigona spinipes (Fabricius (Hymenoptera, Apidae in laticiferous flowers Primeiro registro do comportamento de drenagem de latex de Trigona spinipes (Fabricius (Hymenoptera, Apidae em flores latescentes

    Directory of Open Access Journals (Sweden)

    Cristiana Koschnitzke

    2011-09-01

    Full Text Available This paper describes the behavior of the bee Trigona spinipes, to avoid the latex, when piercing the base of the tubular corolla of the flowers of Mandevilla guanabarica in order to steal the nectar.Este trabalho descreve o comportamento da abelha Trigona spinipes para evitar o látex quando perfura a base da corola tubular das flores de Mandevilla guanabarica ao roubar néctar.

  15. The rapid determination of volatile fatty acid number in para rubber latex using fourier transform-near infrared spectroscopy based on quantification and discrimination model

    Directory of Open Access Journals (Sweden)

    Sureeporn Narongwongwattana

    2015-09-01

    Full Text Available Volatile Fatty Acid number (VFA no. is one of the parameters indicating the state of quality of Para rubber latex at that particular time. Most factories analyze this parameter using standard analytical method as in ISO 506:1992(E. Nevertheless, this procedure is complicated, chemical and time consuming, as well as skilled analyst required. Therefore, near infrared (NIR spectroscopy which is rapid, accurate and nonchemicals method was applied to determine the VFA no. in field latex and concentrated latex based on quantification and discriminant model. The best calibration equation was obtained from standard normal variate (SNV spectra in the region of 6109.7–5770.3, 4613.1–4242.9 cm-1 with R = 0.832, SECV = 0.036 and no bias. From the performance check, statistically it was found that SECV and bias were low enough for practical acceptance and the predicted VFA no. was not different significantly from actual VFA no. at 95% confidence intervals. In addition, discriminant model was developed to separate good quality latex from the deteriorated latex using VFA no. at 0.06 as standard as in ISO 2004:2010(E. The discriminant model can be used to screen the latex with overall accuracy of 91.86% in validation set.

  16. Whole-transcriptome survey of the putative ATP-binding cassette (ABC) transporter family genes in the latex-producing laticifers of Hevea brasiliensis.

    Science.gov (United States)

    Zhiyi, Nie; Guijuan, Kang; Yu, Li; Longjun, Dai; Rizhong, Zeng

    2015-01-01

    The ATP-binding cassette (ABC) proteins or transporters constitute a large protein family in plants and are involved in many different cellular functions and processes, including solute transportation, channel regulation and molecular switches, etc. Through transcriptome sequencing, a transcriptome-wide survey and expression analysis of the ABC protein genes were carried out using the laticiferous latex from Hevea brasiliensis (rubber tree). A total of 46 putative ABC family proteins were identified in the H. brasiliensis latex. These consisted of 12 'full-size', 21 'half-size' and 13 other putative ABC proteins, and all of them showed strong conservation with their Arabidopsis thaliana counterparts. This study indicated that all eight plant ABC protein paralog subfamilies were identified in the H. brasiliensis latex, of which ABCB, ABCG and ABCI were the most abundant. Real-time quantitative reverse transcription-polymerase chain reaction assays demonstrated that gene expression of several latex ABC proteins was regulated by ethylene, jasmonic acid or bark tapping (a wound stress) stimulation, and that HbABCB15, HbABCB19, HbABCD1 and HbABCG21 responded most significantly of all to the abiotic stresses. The identification and expression analysis of the latex ABC family proteins could facilitate further investigation into their physiological involvement in latex metabolism and rubber biosynthesis by H. brasiliensis.

  17. Preservation of H2 production activity in nanoporous latex coatings of Rhodopseudomonas palustris CGA009 during dry storage at ambient temperatures: Preservation of R. palustris latex coatings

    Energy Technology Data Exchange (ETDEWEB)

    Piskorska, M. [Univ. of South Carolina, Aiken, SC (United States); Soule, T. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Gosse, J. L. [North Carolina State Univ., Raleigh, NC (United States); Milliken, C. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Flickinger, M. C. [North Carolina State Univ., Raleigh, NC (United States); Smith, G. W. [Univ. of South Carolina, Aiken, SC (United States); Yeager, C. M. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2013-01-21

    To assess the applicability of latex cell coatings as an ‘off-the-shelf’ biocatalyst, the effect of osmoprotectants, temperature, humidity and O2 on preservation of H2 production in Rhodopseudomonas palustris coatings was evaluated. Immediately following latex coating coalescence (24 h) and for up to 2 weeks of dry storage, rehydrated coatings containing different osmoprotectants displayed similar rates of H2 production. Beyond 2 weeks of storage, sorbitol-treated coatings lost all H2 production activity, whereas considerable H2 production was still detected in sucrose- and trehalose-stabilized coatings. The relative humidity level at which the coatings were stored had a significant impact on the recovery and subsequent rates of H2 production. After 4 weeks storage under air at 60% humidity, coatings produced only trace amounts of H2 (0–0.1% headspace accumulation), whereas those stored at < 5% humidity retained 27–53% of their H2 production activity after 8 weeks of storage. In conWhen stored in argon at < 5% humidity and room temperature, R. palustris coatings retained full H2 production activity for 3 months, implicating oxidative damage as a key factor limiting coating storage. Overall, the results demonstrate that biocatalytic latex coatings are an attractive cell immobilization platform for preservation of bioactivity in the dry state.

  18. Defining and comparing learning actions in two simulation modalities: students training on a latex arm and each other's arms.

    Science.gov (United States)

    Ravik, Monika; Havnes, Anton; Bjørk, Ida Torunn

    2017-12-01

    To explore, describe and compare learning actions that nursing students used during peripheral vein cannulation training on a latex arm or each other's arms in a clinical skills centre. Simulation-based training is thought to enhance learning and transfer of learning from simulation to the clinical setting and is commonly recommended in nursing education. What students actually are doing during simulation-based training is, however, less explored. The analysis of learning actions used during simulation-based training could contribute to development and improvement of simulation as a learning strategy in nursing education. A qualitative explorative and descriptive research design, involving content analysis of video recordings, was used. Video-supported observation of nine nursing students practicing vein cannulation was conducted in a clinical skills centre in late 2012. The students engaged in various learning actions. Students training on a latex arm used a considerably higher number of learning actions relative to those training on each other's arms. In both groups, students' learning actions consisted mainly of seeking and giving support. The teacher provided students training on each other's arms with detailed feedback regarding insertion of the cannula into the vein, while those training on a latex arm received sparse feedback from the teacher and fellow students. The teacher played an important role in facilitating nursing students' practical skill learning during simulation. The provision of support from both teachers and students should be emphasised to ensure that nursing students' learning needs are met. This study suggest that student nurses may be differently and inadequately prepared in peripheral vein cannulation in two simulation modalities used in the academic setting; training on a latex arm and on each other's arms. © 2017 John Wiley & Sons Ltd.

  19. Use of a latex biomembrane for bladder augmentation in a rabbit model: biocompatibility, clinical and histological outcomes

    Directory of Open Access Journals (Sweden)

    Andre L. A. Domingos

    2009-04-01

    Full Text Available PURPOSE: To investigate histological features and biocompatibility of a latex biomembrane for bladder augmentation using a rabbit model. MATERIAL AND METHODS: After a partial cystectomy, a patch of a non-vulcanized latex biomembrane (2x4 cm was sewn to the bladder with 5/0 monofilament polydioxanone sulfate in a watertight manner. Groups of 5 animals were sacrificed at 15, 45 and 90 days after surgery and the bladder was removed. The 5-µm preparations obtained from grafted area and normal bladder were stained with hematoxylin-eosin. Immunohistochemical staining was performed with a primary antibody against alpha-actin to assess muscle regeneration. RESULTS: No death, urinary leakage or graft extrusion occurred in any group. All bladders showed a spherical shape. Macroscopically, after 90 days, the latex biomembrane was not identifiable and the patch was indistinguishable from normal bladder. A bladder stone was found in one animal (6.6%. On the 90th day, histology revealed continuity of transitional epithelium of host bladder tissue on the patch area. At this time, the muscle layers were well organized in a similar fashion to native bladder muscle layers. The inflammatory process was higher on grafted areas when compared to controls: 15 days - p < 0.0001, 45 days - p < 0.001, and 90 days - p < 0.01. The anti alpha-actin immunoexpression peaked at 45 days, when the graft was observed covered by muscle cells. CONCLUSION: The latex biomembrane is biocompatible and can be used in models for bladder augmentation in rabbits. It promotes epithelium and muscle regeneration without urinary leakage.

  20. Comparative Transcriptome Analysis of Latex Reveals Molecular Mechanisms Underlying Increased Rubber Yield in Hevea brasiliensis Self-Rooting Juvenile Clones

    OpenAIRE

    Li, Hui-Liang; Guo, Dong; Zhu, Jia-Hong; Wang, Ying; Chen, Xiong-Ting; Peng, Shi-Qing

    2016-01-01

    Rubber tree (Hevea brasiliensis) self-rooting juvenile clones (JCs) are promising planting materials for rubber production. In a comparative trial between self-rooting JCs and donor clones (DCs), self-rooting JCs exhibited better performance in rubber yield. To study the molecular mechanism associated with higher rubber yield in self-rooting JCs, we sequenced and comparatively analyzed the latex of rubber tree self-rooting JCs and DCs at the transcriptome level. Total raw reads of 34,632,012 ...

  1. A Mixed Application of Geographically Weighted Regression and Unsupervised Classification for Analyzing Latex Yield Variability in Yunnan, China

    Directory of Open Access Journals (Sweden)

    Oh Seok Kim

    2017-05-01

    Full Text Available This paper introduces a mixed method approach for analyzing the determinants of natural latex yields and the associated spatial variations and identifying the most suitable regions for producing latex. Geographically Weighted Regressions (GWR and Iterative Self-Organizing Data Analysis Technique (ISODATA are jointly applied to the georeferenced data points collected from the rubber plantations in Xishuangbanna (in Yunnan province, south China and other remotely-sensed spatial data. According to the GWR models, Age of rubber tree, Percent of clay in soil, Elevation, Solar radiation, Population, Distance from road, Distance from stream, Precipitation, and Mean temperature turn out statistically significant, indicating that these are the major determinants shaping latex yields at the prefecture level. However, the signs and magnitudes of the parameter estimates at the aggregate level are different from those at the lower spatial level, and the differences are due to diverse reasons. The ISODATA classifies the landscape into three categories: high, medium, and low potential yields. The map reveals that Mengla County has the majority of land with high potential yield, while Jinghong City and Menghai County show lower potential yield. In short, the mixed method can offer a means of providing greater insights in the prediction of agricultural production.

  2. Determination of the content of alkyl ketene dimer in its latex by an ionic-liquid assisted headspace gas chromatography.

    Science.gov (United States)

    Yan, Ning; Wan, Xiao-Fang; Chai, Xin-Sheng; Chen, Run-Quan; Chen, Chun-Xia

    2017-12-29

    This paper reports on an ionic-liquid assisted headspace gas chromatographic (HS-GC) for the determination of the content of alkyl ketene dimer (AKD) in its latex samples, in which the GC system was equipped with a thermal conductivity detector (TCD). The method was based on the AKD hydrolysis conducted in 1-butyl-3-methylimidazolium chloride (ionic-liquid) added medium at 100°C for 10min in a closed headspace sample vial, and the measured CO 2 (the resulting product of the hydrolysis) by HS-GC. The results showed that the present method has a good measurement precision (RSD <2.3%) and accuracy (recoveries from 96 - 105%), and the limit of quantitation (LOQ) is 0.9%. The present method is very suitable to be used for the routine check of AKD content in its latex sample in mill applications. The study also showed that the content of AKD in the tested commercial latex samples were in the range of 3.5-12%. Copyright © 2017 Elsevier B.V. All rights reserved.

  3. Purification and characterization of a heteromultimeric glycoprotein from Artocarpus heterophyllus latex with an inhibitory effect on human blood coagulation.

    Science.gov (United States)

    Siritapetawee, Jaruwan; Thammasirirak, Sompong

    2011-01-01

    Plant latex has many health benefits and has been used in folk medicine. In this study, the biological effect of Artocarpus heterophyllus (jackfruit) latex on human blood coagulation was investigated. By a combination of heat precipitation and ion-exchange chromatography, a heat stable heteromultimeric glycoprotein (HSGPL1) was purified from jackfruit milky latex. The apparent molecular masses of the monomeric proteins on SDS/PAGE were 33, 31 and 29 kDa. The isoelectric points (pIs) of the monomers were 6.63, 6.63 and 6.93, respectively. Glycosylation and deglycosylation tests confirmed that each subunit of HSGPL1 formed the native multimer by sugar-based interaction. Moreover, the multimer of HSGPL1 also resisted 2-mercaptoethanol action. Peptide mass fingerprint analysis indicated that HSGPL1 was a complex protein related to Hsps/chaperones. HSGPL1 has an effect on intrinsic pathways of the human blood coagulation system by significantly prolonging the activated partial thrombin time (APTT). In contrast, it has no effect on the human extrinsic blood coagulation system using the prothrombin time (PT) test. The prolonged APTT resulted from the serine protease inhibitor property of HSGPL1, since it reduced activity of human blood coagulation factors XI(a) and α-XII(a).

  4. Trial production of low protein irradiated natural rubber latex by low energy electron beam in pilot scale

    International Nuclear Information System (INIS)

    Utama, Marga; Yoshii, F.; Kume, T.

    2006-01-01

    Three importance factors for producing low protein by low energy electron beam (250 keV/10 mA) irradiation in pilot scale (20 liters per bath) with 1,9-nonediol diacrylate (NDA) namely: maturation time of natural rubber latex before irradiation, treatment of irradiated natural rubber latex (INRL) before and after centrifugation, and standard irradiation method has been carried out. The results showed that the optimum irradiation time for producing INRL with 5 phr (part hundred ratio of rubber) of NDA as sensitize agent, and with the rotation speed of agitation 210 rpm (rotation per minutes) was between 20-30 minutes. By using this condition tensile strength of the INRL film was 26 MPa. The maturation of natural rubber latex before irradiation is the key for driving the quality of INRL. Water extractable protein content of INRL after leaching in 1% ammonia solution for 30 minutes at room temperature was around 47 μ/g, and after adding with 1 phr of PVA (poly vinyl alcohol) or 0.1 phr CMC (carboxy methyl cellulose) the water extractable protein content decrease less than 6 μ/g. (author)

  5. Efficiency of 1,9- Nonane-diol-diacrylate as a radiation vulcanization accelerator for natural rubber latex

    International Nuclear Information System (INIS)

    Haque, M.E.

    2003-09-01

    The efficiency of 1,9- Nonane-diol-diacrylate (NDDA) as a radiation vulcanization accelerator (RVA) for natural rubber latex (NRL) was investigated. Both gamma rays and electron beam (EB) were used for vulcanizing NRL with NDDA. The radiation dose of gamma rays, concentration of NDDA required to vulcanize the latex were optimized. 20 kGy radiation dose of gamma rays and 5 phr concentration of NDDA were found optimum to get maximum tensile and related properties. NRL was vulcanized under EB to find out the optimum condition of irradiation with this RVA. The defoamer concentrations, length of irradiation time under EB, concentration of RVA were optimizer by changing various parameters of the EB machine with a constant set of the others. 0.2 phr defoamer concentration, 30 minutes irradiation time and 5 phr concentration of NDDA were found optimum for irradiation of NRL under the EB machine. Effect of low current and optimum volume of latex charged in the reaction vessel suitable for vulcanization at a time were found out. (author)

  6. Surfactant and counter-ion distribution in styrene-butyl acrylate-acrylic acid dry latex submonolayers

    Directory of Open Access Journals (Sweden)

    Keslarek Amauri José

    2004-01-01

    Full Text Available Styrene-butyl acrylate-acrylic acid latex submonolayers prepared using a non-reactive phosphate surfactant together with a reactive sulfonate surfactant were examined in a transmission microscope using electron energy loss spectroscopy imaging (ESI-TEM. Phosphorus is nearly absent from the particles core but it is detected in a thick shell and in unusual, strongly scattering structures with a low carbon content, and largely made out of inorganic phosphate. P is also dispersed outside the particles, while S is uniformly distributed within then. The Na and N elemental maps show that the respective monovalent ions (Na+ and NH4+ have different distributions, in the latex: Na signal within the particles is stronger than in the background, while N is accumulated at the particle borders. The distributions of surfactant and counter-ions are thus different from some current assumptions, but they support recent results on the distribution of ionic constituents in latex films, by scanning electric potential microscopy.

  7. Sulfonated macro-RAFT agents for the surfactant-free synthesis of cerium oxide-based hybrid latexes.

    Science.gov (United States)

    Garnier, Jérôme; Warnant, Jérôme; Lacroix-Desmazes, Patrick; Dufils, Pierre-Emmanuel; Vinas, Jérôme; van Herk, Alex

    2013-10-01

    Three types of amphiphatic macro-RAFT agents were employed as compatibilizers to promote the polymerization reaction at the surface of nanoceria for the synthesis of CeO2-based hybrid latexes. Macro-RAFT copolymers and terpolymers were first synthesized employing various combinations of butyl acrylate as a hydrophobic monomer and acrylic acid (AA) and/or 2-acrylamido-2-methylpropane sulfonic acid (AMPS) as hydrophilic monomers. After characterizing the adsorption of these macro-RAFT agents at the cerium oxide surface by UV-visible spectrometry, emulsion copolymerization reactions of styrene and methyl acrylate were then carried out in the presence of the surface-modified nanoceria. Dynamic Light Scattering and cryo-Transmission Electron Microscopy were employed to confirm the hybrid structure of the final CeO2/polymer latexes, and proved that the presence of acrylic acid units in amphiphatic macro-RAFT agents enabled an efficient formation of hybrid structures, while the presence of AMPS units, when combined with AA units, resulted in a better distribution of cerium oxide nanoclusters between latex particles. Copyright © 2013 Elsevier Inc. All rights reserved.

  8. Analysis of sulfidic linkages formed in natural rubber latex medical gloves by using X-ray absorption near edge structure

    Science.gov (United States)

    Chankrachang, M.; Limphirat, W.; Yongyingsakthavorn, P.; Nontakaew, U.; Tohsan, A.

    2017-09-01

    A study of sulfidic linkages formed in natural rubber (NR) latex medical gloves by using X-ray Absorption Near Edge Structure (XANES) is presented in this paper. The NR latex compound was prepared by using prevulcanization method, that is, it was prevulcanized at room temperature for 24 hrs before utilization. After the 24 hrs of prevulcanization, the latex film samples were obtained by dipping process. The dipped films were subjected to vulcanize at 110°C for 5 to 25 min. It was observed that after the compound was prevulcanized for 24 hrs, polysulfidic linkages were mainly formed in the sample. It was however found that after curing at 110°C for 5-25 min, the polysulfidic linkages are tended to change into disulfide linkages. Especially, in the case of 25 minutes cured sample, disulfide linkages are found to be the main linkages. In term of tensile strength, it was observed that when cure time increased from 5 - 10 min, tensile strengths were also increased. But when the cure time of the film is 25 minutes, tensile strength was slightly dropped. The dropped of tensile strength when cure time is longer than 10 minutes can be ascribed to a degradation of polysulfidic and disulfidic linkages during curing. Therefore, by using XANES analysis, it was found to be very useful to understand the cure characteristic, thus it can be very helpful to optimize cure time and tensile properties of the product.

  9. Evaluation of wound healing treated with latex derived from rubber trees and Aloe Vera extract in rats.

    Science.gov (United States)

    Brandão, Marcelo Luiz; Reis, Paulo Roberto Melo; Araújo, Lilhian Alves de; Araújo, Ana Carolina Vicente; Santos, Maisa Helena de Abreu Silva; Miguel, Marina Pacheco

    2016-09-01

    To compare the use of latex derivative and Aloe vera extract to wound healing. Twenty one rats were randomly divided into three groups and each one had a wound made by incision. The treatment consisted in: derivative of latex (GL), Aloe vera extract (GA) and saline solution (GC). The wound area was measured on the 7th, 14th and 21st days and macroscopic and microscopic evaluation were done. The comparison between the measurements of the wounds presented statistical difference in GC and GA from the 7th day of evaluation and GL from the 14th day. The extent of the wound was significantly smaller by the 7th day in GL. Histologically, in GL, the neovascularization was significant on the 7th, 14th and 21st days. On the 21st day the scar was large and little mature. In GA and GC, the findings were similar on the 7th, 14th and 21st days with a slight better organization of skin and collagen on the 21st in GA. Statistical analysis did not allow for the definition of the best topical agent. The latex had the highest angiogenesis, but a possible foreign body granuloma. Aloe vera has revealed a healing process adequated temporally in histology.

  10. A novel serine protease with human fibrino(geno)lytic activities from Artocarpus heterophyllus latex.

    Science.gov (United States)

    Siritapetawee, Jaruwan; Thumanu, Kanjana; Sojikul, Punchapat; Thammasirirak, Sompong

    2012-07-01

    A protease was isolated and purified from Artocarpus heterophyllus (jackfruit) latex and designated as a 48-kDa antimicrobial protease (AMP48) in a previous publication. In this work, the enzyme was characterized for more biochemical and medicinal properties. Enzyme activity of AMP48 was strongly inhibited by phenylmethanesulfonyl fluoride and soybean trypsin inhibitor, indicating that the enzyme was a plant serine protease. The N-terminal amino acid sequences (A-Q-E-G-G-K-D-D-D-G-G) of AMP48 had no sequence similarity matches with any sequence databases of BLAST search and other plant serine protease. The secondary structure of this enzyme was composed of high α-helix (51%) and low β-sheet (9%). AMP48 had fibrinogenolytic activity with maximal activity between 55 and 60°C at pH 8. The enzyme efficiently hydrolyzed α followed by partially hydrolyzed β and γ subunits of human fibrinogen. In addition, the fibrinolytic activity was observed through the degradation products by SDS-PAGE and emphasized its activity by monitoring the alteration of secondary structure of fibrin clot after enzyme digestion using ATR-FTIR spectroscopy. This study presented the potential role to use AMP48 as antithrombotic for treatment thromboembolic disorders such as strokes, pulmonary emboli and deep vein thrombosis. Copyright © 2012 Elsevier B.V. All rights reserved.

  11. Comparison of the cytotoxic effect of polystyrene latex nanoparticles on planktonic cells and bacterial biofilms

    International Nuclear Information System (INIS)

    Nomura, Toshiyuki; Fujisawa, Eri; Itoh, Shikibu; Konishi, Yasuhiro

    2016-01-01

    The cytotoxic effect of positively charged polystyrene latex nanoparticles (PSL NPs) was compared between planktonic bacterial cells and bacterial biofilms using confocal laser scanning microscopy, atomic force microscopy, and a colony counting method. Pseudomonas fluorescens, which is commonly used in biofilm studies, was employed as the model bacteria. We found that the negatively charged bacterial surface of the planktonic cells was almost completely covered with positively charged PSL NPs, leading to cell death, as indicated by the NP concentration being greater than that required to achieve single layer coverage. In addition, the relationship between surface coverage and cell viability of P. fluorescens cells correlated well with the findings in other bacterial cells (Escherichia coli and Lactococcuslactis). However, most of the bacterial cells that formed the biofilm were viable despite the positively charged PSL NPs being highly toxic to planktonic bacterial cells. This indicated that bacterial cells embedded in the biofilm were protected by self-produced extracellular polymeric substances (EPS) that provide resistance to antibacterial agents. In conclusion, mature biofilms covered with EPS exhibit resistance to NP toxicity as well as antibacterial agents.

  12. Comparison of the cytotoxic effect of polystyrene latex nanoparticles on planktonic cells and bacterial biofilms

    Energy Technology Data Exchange (ETDEWEB)

    Nomura, Toshiyuki, E-mail: nomura@chemeng.osakafu-u.ac.jp; Fujisawa, Eri; Itoh, Shikibu; Konishi, Yasuhiro [Osaka Prefecture University, Department of Chemical Engineering (Japan)

    2016-06-15

    The cytotoxic effect of positively charged polystyrene latex nanoparticles (PSL NPs) was compared between planktonic bacterial cells and bacterial biofilms using confocal laser scanning microscopy, atomic force microscopy, and a colony counting method. Pseudomonas fluorescens, which is commonly used in biofilm studies, was employed as the model bacteria. We found that the negatively charged bacterial surface of the planktonic cells was almost completely covered with positively charged PSL NPs, leading to cell death, as indicated by the NP concentration being greater than that required to achieve single layer coverage. In addition, the relationship between surface coverage and cell viability of P. fluorescens cells correlated well with the findings in other bacterial cells (Escherichia coli and Lactococcuslactis). However, most of the bacterial cells that formed the biofilm were viable despite the positively charged PSL NPs being highly toxic to planktonic bacterial cells. This indicated that bacterial cells embedded in the biofilm were protected by self-produced extracellular polymeric substances (EPS) that provide resistance to antibacterial agents. In conclusion, mature biofilms covered with EPS exhibit resistance to NP toxicity as well as antibacterial agents.

  13. Potential of quixaba (Sideroxylon obtusifolium latex as a milk-clotting agent

    Directory of Open Access Journals (Sweden)

    Anna Carolina da Silva

    2013-09-01

    Full Text Available There are several obstacles to the use of chymosin in cheese production. Consequently, plant proteases have been studied as possible rennet substitutes, but most of these enzymes are unsuitable for the manufacture of cheese. The aim of this study was to evaluate the potential of latex from Sideroxylon obtusifolium as a source of milk-clotting proteases and to partially characterize the enzyme. The enzyme extract showed high protease and coagulant activities, with an optimal pH of 8.0 and temperature of 55 °C. The enzyme was stable in wide ranges of temperature and pH. Its activity was not affected by any metal ions tested; but was inhibited by phenylmethanesulfonyl fluoride and pepstatin. For the coagulant activity, the optimal concentration of CaCl2 was 10 µmol L- 1. Polyacrylamide gel electrophoresis showed four bands, with molecular weights between 17 and 64 kDa. These results indicate that the enzyme can be applied to the cheese industry.

  14. Determination of antinucleic factors and anti-DNA antibodies with immunefluorescence, radioimmunoassay and latex-test

    International Nuclear Information System (INIS)

    Lemmel, E.M.; Hoffmann, R.; Botzenhardt, U.; Mainz Univ.

    1976-01-01

    The results obtained with the 3 test methods are not completely equal. This is, on the one hand, based on the fact that at least in the fluorescence test other antibodies than in the DNS-compound test are also detected. Quantitatively, however, the two tests show a good correlation to the progress of the illness; strong positive DNA-compound is practically only found in SLE. The authors were able to prove that the addition of purified C1 or C1q components of the complementary system to the test can result in a DNA binding of over 50% and, consequently, in incorrect positive values in the compound test. The Latex test is less suitable for diagnosis and course observation since it relatively often renders negative results at established cases of SLE with distinct illness activity on the one hand, while on the other hand, quantitative evidence, which is desirable for assessing the illness activity, is not possible. (orig./GSE) [de

  15. Improved mechanical and functional properties of elastomer/graphite nanocomposites prepared by latex compounding

    International Nuclear Information System (INIS)

    Yang Jian; Tian Ming; Jia Qingxiu; Shi Junhong; Zhang Liqun; Lim Szuhui; Yu Zhongzhen; Mai Yiuwing

    2007-01-01

    The facile latex approach has been adopted to finely incorporate graphite nanosheets into elastomeric polymer matrix to obtain high-performance elastomeric nanocomposites with improved mechanical properties and functional properties. Scanning electron microscopy, transmission electron microscopy and X-ray diffraction experiments show that the nanostructures of the final nanocomposites exhibit a high degree of exfoliation and intercalation of graphite in the nitrile-butadiene rubber (NBR) matrix. Mechanical and dynamic-mechanical tests demonstrate that the NBR/graphite nanocomposites possess greatly increased elastic modulus and tensile strength, and desirably strong interfaces. The unexpected self-crosslinking of elastomer/graphite nanocomposites was discovered and then verified by oscillating disc rheometry and equilibrium swelling experiments. After critically examining various polymer types by X-ray photoelectron spectroscopy, electron spin resonance and Fourier transform infrared spectroscopy, a radical initiation mechanism was proposed to explain the self-crosslinking reaction. These NBR/graphite nanocomposites possess significantly improved wear resistance and gas barrier properties, and superior electrical/thermal conductivity. Such versatile functional properties make NBR nanocomposites a promising new class of advanced materials

  16. Measurement of filtration efficiency of Nuclepore filters challenged with polystyrene latex nanoparticles: experiments and modeling

    International Nuclear Information System (INIS)

    Ling, Tsz Yan; Wang Jing; Pui, David Y. H.

    2011-01-01

    Membrane filtration has been demonstrated to be effective for the removal of liquid-borne nanoparticles (NPs). Such technique can be applied to purify and disinfect drinking water as well as remove NPs in highly pure chemicals used in the industries. This study aims to study the filtration process of a model membrane filter, the Nuclepore filter. Experiments were carried out using standard filtration tools and the nanoparticle tracking analysis (NTA) technique was used to measure particle (50–500 nm) concentration upstream and downstream of the filter to determine the filtration efficiency. The NTA technique has been calibrated using 150-nm polystyrene latex particles to determine its accuracy of particle concentration measurement. Measurements were found reliable within a certain concentration limit (about 10 8 –10 10 particles/cm 3 ), which is dependent on the camera settings during the measurement. Experimental results are comparable with previously published data obtained using the aerosolization method, validating the capability of the NTA technique. The capillary tube model modified from that developed for aerosol filtration was found to be useful to represent the experimental results, when a sticking coefficient of 0.15 is incorporated. This suggests that only 15% of the particle collisions with the filter results in successful attachment. The small sticking coefficient found can be explained by the unfavorable surface interactions between the particles and the filter medium.

  17. Improved mechanical and functional properties of elastomer/graphite nanocomposites prepared by latex compounding

    Energy Technology Data Exchange (ETDEWEB)

    Yang Jian [Key Laboratory for Nano-materials, Beijing University of Chemical Technology, Ministry of Education of China, Beijing 100029 (China); Key Laboratory on Preparation and Processing of Novel Polymer Materials, Beijing University of Chemical Technology, Beijing 100029 (China); Tian Ming [Key Laboratory for Nano-materials, Beijing University of Chemical Technology, Ministry of Education of China, Beijing 100029 (China); Jia Qingxiu [Key Laboratory on Preparation and Processing of Novel Polymer Materials, Beijing University of Chemical Technology, Beijing 100029 (China); Shi Junhong [Key Laboratory for Nano-materials, Beijing University of Chemical Technology, Ministry of Education of China, Beijing 100029 (China); Zhang Liqun [Key Laboratory for Nano-materials, Beijing University of Chemical Technology, Ministry of Education of China, Beijing 100029 (China); Key Laboratory on Preparation and Processing of Novel Polymer Materials, Beijing University of Chemical Technology, Beijing 100029 (China)], E-mail: zhanglq@mail.buct.edu.cn; Lim Szuhui; Yu Zhongzhen [Centre for Advanced Materials Technology (CAMT), School of Aerospace, Mechanical and Mechatronic Engineering (J07), University of Sydney, Sydney, NSW 2006 (Australia); Mai Yiuwing [Centre for Advanced Materials Technology (CAMT), School of Aerospace, Mechanical and Mechatronic Engineering (J07), University of Sydney, Sydney, NSW 2006 (Australia)], E-mail: y.mai@usyd.edu.au

    2007-10-15

    The facile latex approach has been adopted to finely incorporate graphite nanosheets into elastomeric polymer matrix to obtain high-performance elastomeric nanocomposites with improved mechanical properties and functional properties. Scanning electron microscopy, transmission electron microscopy and X-ray diffraction experiments show that the nanostructures of the final nanocomposites exhibit a high degree of exfoliation and intercalation of graphite in the nitrile-butadiene rubber (NBR) matrix. Mechanical and dynamic-mechanical tests demonstrate that the NBR/graphite nanocomposites possess greatly increased elastic modulus and tensile strength, and desirably strong interfaces. The unexpected self-crosslinking of elastomer/graphite nanocomposites was discovered and then verified by oscillating disc rheometry and equilibrium swelling experiments. After critically examining various polymer types by X-ray photoelectron spectroscopy, electron spin resonance and Fourier transform infrared spectroscopy, a radical initiation mechanism was proposed to explain the self-crosslinking reaction. These NBR/graphite nanocomposites possess significantly improved wear resistance and gas barrier properties, and superior electrical/thermal conductivity. Such versatile functional properties make NBR nanocomposites a promising new class of advanced materials.

  18. Vulcanization of polybutadiene latex induced by 60Co γ-rays irradiation

    International Nuclear Information System (INIS)

    Liu Yuguang; Huang Yudong; Hou Jing; Gao Deyu; Zhang Xuequan

    2007-01-01

    Fully vulcanized polybutadiene rubber particles (FVBR) were prepared by polybutadiene latex (PBL) vulcanization induced by 60 Co γ-rays irradiation, and the effect of absorbed dose on crosslinking behavior was studied. Mean diameter, diameter distribution and morphology of the particles in the PBL irradiated at different doses as well as in the FVBR were characterized by laser particle analyzer and AFM. The crosslinking effect on the mechanical properties of the films, by casting from PBL at different doses correspondingly, was evaluated by mechanical and dynamic mechanical analysis (DMA) respectively. The results showed that the diameter and swelling property decreased with absorbed dose, while crosslink density and gel fraction increased. Moreover, the decrease of the tensile strength and elongation at break, the increase of the hardness in shore A and young's modulus (E), and the increase of storage modulus (E') and narrowing of loss tangent peak (Tan 8) were all accounted for the increment of crosslinking. The Charlesby-Pinner equation fits well with the PBL vulcanization in the range of absorbed doses from 0 to 200kGy. (authors)

  19. Effect of wine inhibitors on the proteolytic activity of papain from Carica papaya L. latex.

    Science.gov (United States)

    Benucci, Ilaria; Esti, Marco; Liburdi, Katia

    2015-01-01

    The influence of potential inhibitors naturally present in wine on the proteolytic activity of papain from Carica papaya latex was investigated to evaluate its applicability in white wine protein haze stabilization. Enzymatic activity was tested against a synthetic tripeptide chromogenic substrate in wine-like acidic medium that consisted of tartaric buffer (pH 3.2) supplemented with ethanol, free sulfur dioxide (SO2 ), grape skin and seed tannins within the average ranges of concentrations that are typical in wine. The diagnosis of inhibition type, performed with the graphical method, demonstrated that all of tested wine constituents were reversible inhibitors of papain. The strongest inhibition was exerted by free SO2 , which acted as a mixed-type inhibitor, similar to grape skin and seed tannins. Finally, when tested in table white wines, the catalytic activity of papain, even when if it was ascribable to the hyperbolic behavior of Michaelis-Menten equation, was determined to be strongly affected by free SO2 and total phenol level. © 2014 American Institute of Chemical Engineers.

  20. Flow cytometric quantitation of phagocytosis in heparinized complete blood with latex particles and Candida albicans

    Directory of Open Access Journals (Sweden)

    Jesús M. Egido

    1997-12-01

    Full Text Available We report a rapid method for the flow cytometric quantitation of phagocytosis in heparinized complete peripherial blood (HCPB, using commercially available phycoerythrin-conjugated latex particles of 1µm diameter. The method is faster and shows greater reproducibility than Bjerknes' (1984 standard technique using propidium iodide-stained Candida albicans, conventionally applied to the leukocytic layer of peripherial blood but here modified for HCPB. We also report a modification of Bjerknes' Intracellular Killing Test to allow its application to HCPB.Se da cuenta de un método rápido para la cuantización del flujo citométrico de la fagocitosis en sangre periférica completamente heparinizada (HCPB, mediante la utilización de partículas de látex phycoerythrin-conjugadas de 1µm de diámetro disponibles comercialmente. El método es más rápido y presenta mayor reproducibilidad que la técnica estandar de Bjerknes' (1984 utilizando propidium iodide-teñida Candida albicans, aplicada convencionalmente a la capa leucocitica de sangre periférica pero modificada por HCPB. Tambien damos cuenta de una modificación de Bjerknes' Intracellular Killing Test para permitir su aplicación a HCPB.

  1. Force degradation of orthodontic latex elastics: An in-vivo study.

    Science.gov (United States)

    Qodcieh, Sadeq M Adel; Al-Khateeb, Susan N; Jaradat, Ziad W; Abu Alhaija, Elham S J

    2017-03-01

    Our objectives were to assess the force degradation of orthodontic latex elastics over 48 hours in vivo and to study the relationship between the amount of mouth opening and the degree of force decay. Fifty-two orthodontic patients wearing fixed appliances using Class II elastics were asked to wear premeasured-force 3/16-in heavy and medium intermaxillary elastics. The force amounts were measured and compared at different time intervals. Fifty percent of the force was lost after 3.9 hours for the medium elastics and after 4.9 hours for the heavy elastics. A continuous significant force drop in all elastics was seen at all time intervals (P elastics compared with the medium elastics in vivo at all time intervals (P degradation occurred in the first 4 to 5 hours. Because of breakage and for oral hygiene purposes, orthodontic elastics should be changed daily; otherwise, elastics can be used for 48 hours. Force decay of the elastics was correlated to the lateral distance between the maxillary canine and the mandibular first molar in occlusion. Copyright © 2016 American Association of Orthodontists. Published by Elsevier Inc. All rights reserved.

  2. Long-term clearance of inhaled magnetite and polystyrene latex from the lung: a comparison

    Energy Technology Data Exchange (ETDEWEB)

    Schlesinger, R.B.; Halpern, M.; Lippmann, M. (New York Univ., NY (USA). Inst. of Environmental Medicine)

    1982-01-01

    As part of a larger study evaluating the applicability of a magnetic detection technique for monitoring lung retention of inhaled particles, simultaneous radiological measurements of the retention of magnetite and polystyrene latex particles in four donkeys were performed. The radiometric measurements were performed using a scintillation detector series modified for separation of the higher energy ..gamma..-emissions of /sup 59/Fe and /sup 85/Sr. In all animals, after 24 hr post-exposure, both polystyrene and magnetite exhibited a relatively rapid phase for 80 days (Tsub(1/2) = 15-22 days) which, in three donkeys, was clearly followed by a slower phase (Tsub(1/2) = 42-173 days); activity levels after 80 days in the fourth donkey were too low to permit determination of clearance rate. During the second phase, a deviation in pattern was clearly observed between the two aerosols, the polystyrene being cleared consistently faster than the magnetite. It is suggested that this deviation implies that, beginning at this time, there were functional differences between the dominant clearance mechanisms for the two aerosols. Exactly what these mechanisms were, or whether the difference was attributable to specific differences in particle characteristics, could not be determined.

  3. Long-term clearance of inhaled magnetite and polystyrene latex from the lung: a comparison

    International Nuclear Information System (INIS)

    Schlesinger, R.B.; Halpern, M.; Lippmann, M.

    1982-01-01

    As part of a larger study evaluating the applicability of a magnetic detection technique for monitoring lung retention of inhaled particles, simultaneous radiological measurements of the retention of magnetite and polystyrene latex particles in four donkeys were performed. The radiometric measurements were performed using a scintillation detector series modified for separation of the higher energy γ-emissions of 59 Fe and 85 Sr. In all animals, after 24 hr post-exposure, both polystyrene and magnetite exhibited a relatively rapid phase for 80 days (Tsub(1/2) = 15-22 days) which, in three donkeys, was clearly followed by a slower phase (Tsub(1/2) = 42-173 days); activity levels after 80 days in the fourth donkey were too low to permit determination of clearance rate. During the second phase, a deviation in pattern was clearly observed between the two aerosols, the polystyrene being cleared consistently faster than the magnetite. It is suggested that this deviation implies that, beginning at this time, there were functional differences between the dominant clearance mechanisms for the two aerosols. Exactly what these mechanisms were, or whether the difference was attributable to specific differences in particle characteristics, could not be determined. (U.K.)

  4. Mechanical and Physical Studies on Different Doses of Radiation Pre vulcanized Natural Rubber Latex (RVNRL)

    International Nuclear Information System (INIS)

    Syuhada Ramli; Sofian Ibrahim; Muhammad Saiful Omar; Mohd Noorwadi Mat Lazim; Khairul Hisyam Mohamed Yusof; Najib Mohammmad Zakey; Hafizuddin Maseri

    2014-01-01

    RVNRL mixture of 12 kGy (RVNRL12) and 25 kGy (RVNRL25) at different blending ratios were prepared by stirring the mixture using a magnetic stirrer RVNRL at a speed of 1-3 rpm overnight to get the dough consistency. RVNRL12 with RVNRL25 attendance at a ratio of 90:10, 80:20, 70:30, 60:40 and 50:50 investigated. The study of physical and mechanical properties of 12/ 25 blends RVNRL performed on film samples prepared by immersion method coagulant. RVNRL25 result of the addition of the mixture RVNRL12 showed an increase in tensile strength mixture ratio of 90:10 RVNRL12 / RVNRL25 and tensile strength are declining at a ratio higher RVNRL25 content. Increase the tensile strength was found to increase due to the impact of lower doses of dough RVNRL12 and RVNRL25. This shows that blending RVNRL lower doses help improve the physical properties of latex due to exposure dose exceeding the dose required RVNRL. (author)

  5. Controlling adsorption of albumin with hyaluronan on silica surfaces and sulfonated latex particles.

    Science.gov (United States)

    Berts, Ida; Fragneto, Giovanna; Porcar, Lionel; Hellsing, Maja S; Rennie, Adrian R

    2017-10-15

    Polysaccharides are known to modify binding of proteins at interfaces and this paper describes studies of these interactions and how they are modified by pH. Specifically, the adsorption of human serum albumin on to polystyrene latex and to silica is described, focusing on how this is affected by hyaluronan. Experiments were designed to test how such binding might be modified under relevant physiological conditions. Changes in adsorption of albumin alone and the co-adsorption of albumin and hyaluronan are driven by electrostatic interactions. Multilayer binding is found to be regulated by the pH of the solution and the molecular mass and concentration of hyaluronan. Highest adsorption was observed at pH below 4.8 and for low molecular mass hyaluronan (≤150kDa) at concentrations above 2mgml -1 . On silica with grafted hyaluronan, albumin absorption is reversed by changes in solvent pH due to their strong electrostatic attraction. Albumin physisorbed on silica surfaces is also rinsed away with dilute hyaluronan solution at pH 4.8. The results demonstrate that the protein adsorption can be controlled both by changes of pH and by interaction with other biological macromolecules. Copyright © 2017 Elsevier Inc. All rights reserved.

  6. Cytotoxicity of functionalized polystyrene latex nanoparticles toward lactic acid bacteria, and comparison with model microbes

    Energy Technology Data Exchange (ETDEWEB)

    Nomura, Toshiyuki, E-mail: nomura@chemeng.osakafu-u.ac.jp; Kuriyama, Yuta; Tokumoto, Hayato; Konishi, Yasuhiro [Osaka Prefecture University, Department of Chemical Engineering (Japan)

    2015-02-15

    The cytotoxicity and colloidal behavior of surface-functionalized polystyrene latex (PSL) nanoparticles (NPs) (nominal diameter: 100 nm) toward a model gram positive bacterium Lactococcus lactis JCM 5805 were examined. Nearly all the L. lactis cells exposed to the negatively charged PSL NPs survived because the surface of the bacterial cell was charged negatively, and the NPs therefore hardly adhere to the cell surface. In contrast, the positively charged PSL NPs adhered to the L. lactis cell surface but were not entrapped within the cell, and cell death subsequently occurred. The bacterial growth curves after the toxic NP exposure suggested that NP toxicity did not affect the specific growth phase, but did affect lag time. These results indicated that the cells were damaged by the cell disruption that resulted from the adhesion of the NPs to the cell surface. Finally, the cytotoxicity of the toxic, positively charged PSL NPs toward L. lactis was compared with that displayed toward a model gram negative bacterium Escherichia coli and a model eukaryote Saccharomyces cerevisiae. The cytotoxic behaviors of NPs on L. lactis and E. coli were similar, and depended not on the bacterial surface structure, but rather the environmental ionic strength. In contrast, the cytotoxicity of the prokaryote bacteria was higher than that toward the model eukaryote S. cerevisiae. The difference between the NP sensitivities of the prokaryote and eukaryote resulted from the prokaryote’s lack of an endocytotic pathway.

  7. Comparison of the cytotoxic effect of polystyrene latex nanoparticles on planktonic cells and bacterial biofilms

    Science.gov (United States)

    Nomura, Toshiyuki; Fujisawa, Eri; Itoh, Shikibu; Konishi, Yasuhiro

    2016-06-01

    The cytotoxic effect of positively charged polystyrene latex nanoparticles (PSL NPs) was compared between planktonic bacterial cells and bacterial biofilms using confocal laser scanning microscopy, atomic force microscopy, and a colony counting method. Pseudomonas fluorescens, which is commonly used in biofilm studies, was employed as the model bacteria. We found that the negatively charged bacterial surface of the planktonic cells was almost completely covered with positively charged PSL NPs, leading to cell death, as indicated by the NP concentration being greater than that required to achieve single layer coverage. In addition, the relationship between surface coverage and cell viability of P. fluorescens cells correlated well with the findings in other bacterial cells ( Escherichia coli and Lactococcus lactis). However, most of the bacterial cells that formed the biofilm were viable despite the positively charged PSL NPs being highly toxic to planktonic bacterial cells. This indicated that bacterial cells embedded in the biofilm were protected by self-produced extracellular polymeric substances (EPS) that provide resistance to antibacterial agents. In conclusion, mature biofilms covered with EPS exhibit resistance to NP toxicity as well as antibacterial agents.

  8. Cytotoxicity of functionalized polystyrene latex nanoparticles toward lactic acid bacteria, and comparison with model microbes

    Science.gov (United States)

    Nomura, Toshiyuki; Kuriyama, Yuta; Tokumoto, Hayato; Konishi, Yasuhiro

    2015-02-01

    The cytotoxicity and colloidal behavior of surface-functionalized polystyrene latex (PSL) nanoparticles (NPs) (nominal diameter: 100 nm) toward a model gram positive bacterium Lactococcus lactis JCM 5805 were examined. Nearly all the L. lactis cells exposed to the negatively charged PSL NPs survived because the surface of the bacterial cell was charged negatively, and the NPs therefore hardly adhere to the cell surface. In contrast, the positively charged PSL NPs adhered to the L. lactis cell surface but were not entrapped within the cell, and cell death subsequently occurred. The bacterial growth curves after the toxic NP exposure suggested that NP toxicity did not affect the specific growth phase, but did affect lag time. These results indicated that the cells were damaged by the cell disruption that resulted from the adhesion of the NPs to the cell surface. Finally, the cytotoxicity of the toxic, positively charged PSL NPs toward L. lactis was compared with that displayed toward a model gram negative bacterium Escherichia coli and a model eukaryote Saccharomyces cerevisiae. The cytotoxic behaviors of NPs on L. lactis and E. coli were similar, and depended not on the bacterial surface structure, but rather the environmental ionic strength. In contrast, the cytotoxicity of the prokaryote bacteria was higher than that toward the model eukaryote S. cerevisiae. The difference between the NP sensitivities of the prokaryote and eukaryote resulted from the prokaryote's lack of an endocytotic pathway.

  9. Removal of bisphenol A and some heavy metal ions by polydivinylbenzene magnetic latex particles.

    Science.gov (United States)

    Marzougui, Zied; Chaabouni, Amel; Elleuch, Boubaker; Elaissari, Abdelhamid

    2016-08-01

    In this study, magnetic polydivinylbenzene latex particles MPDVB with a core-shell structure were tested for the removal of bisphenol A (BPA), copper Cu(II), lead Pb(II), and zinc Zn(II) from aqueous solutions by a batch-adsorption technique. The effect of different parameters, such as initial concentration of pollutant, contact time, adsorbent dose, and initial pH solution on the adsorption of the different adsorbates considered was investigated. The adsorption of BPA, Cu(II), Pb(II), and Zn(II) was found to be fast, and the equilibrium was achieved within 30 min. The pH 5-5.5 was found to be the most suitable pH for metal removal. The presence of electrolytes and their increasing concentration reduced the metal adsorption capacity of the adsorbent. Whereas, the optimal pH for BPA adsorption was found 7, both hydrogen bonds and π-π interaction were thought responsible for the adsorption of BPA on MPDVB. The adsorption kinetics of BPA, Cu(II), Pb(II), and Zn(II) were found to follow a pseudo-second-order kinetic model. Equilibrium data for BPA, Cu(II), Pb(II), and Zn(II) adsorption were fitted well by the Langmuir isotherm model. Furthermore, the desorption and regeneration studies have proven that MPDVB can be employed repeatedly without impacting its adsorption capacity.

  10. Evaluation of latex agglutination test (KAtex) for early diagnosis of kala-azar.

    Science.gov (United States)

    Ahsan, M M; Islam, M N; Mollah, A H; Hoque, M A; Hossain, M A; Begum, Z; Islam, M T

    2010-07-01

    Kala-azar is one of the major public health problem in Bangladesh. But the diagnosis of the problem often is difficult, unusual and time consuming, a simple, noninvasive, easy to perform, reliable and rapid diagnostic test has been a long-felt need of the clinicians. Therefore, the present study was conducted to see the sensitivity and specificity of Latex Agglutination test (KAtex) to detect leishmanial antigen from urine of kala-azar cases. The study was carried out in the department of Paediatrics, Mymensingh Medical College and Hospital, Bangladesh during July to December, 2008. A total of 100 urine samples were collected of which 50 were confirmed kala-azar cases and 50 were age and sex matched controls. Out of 50 kala-azar cases 47 showed positive result of KAtex. The test was also positive in 01 out of 30 healthy controls. None of the febrile controls was positive by KAtex. The sensitivity, specificity, positive predictive value and negative predictive value of the test using presence of LD bodies in splenic and/or bone marrow aspirate as gold standard were 94%, 98%, 97.91% and 94.23% respectively. KAtex is simple, noninvasive, easy to perform, rapid and reliable test for diagnosing kala-azar in endemic area and useful for small, less equipped laboratories as well as for the laboratories with better facilities.

  11. Cytotoxicity of functionalized polystyrene latex nanoparticles toward lactic acid bacteria, and comparison with model microbes

    International Nuclear Information System (INIS)

    Nomura, Toshiyuki; Kuriyama, Yuta; Tokumoto, Hayato; Konishi, Yasuhiro

    2015-01-01

    The cytotoxicity and colloidal behavior of surface-functionalized polystyrene latex (PSL) nanoparticles (NPs) (nominal diameter: 100 nm) toward a model gram positive bacterium Lactococcus lactis JCM 5805 were examined. Nearly all the L. lactis cells exposed to the negatively charged PSL NPs survived because the surface of the bacterial cell was charged negatively, and the NPs therefore hardly adhere to the cell surface. In contrast, the positively charged PSL NPs adhered to the L. lactis cell surface but were not entrapped within the cell, and cell death subsequently occurred. The bacterial growth curves after the toxic NP exposure suggested that NP toxicity did not affect the specific growth phase, but did affect lag time. These results indicated that the cells were damaged by the cell disruption that resulted from the adhesion of the NPs to the cell surface. Finally, the cytotoxicity of the toxic, positively charged PSL NPs toward L. lactis was compared with that displayed toward a model gram negative bacterium Escherichia coli and a model eukaryote Saccharomyces cerevisiae. The cytotoxic behaviors of NPs on L. lactis and E. coli were similar, and depended not on the bacterial surface structure, but rather the environmental ionic strength. In contrast, the cytotoxicity of the prokaryote bacteria was higher than that toward the model eukaryote S. cerevisiae. The difference between the NP sensitivities of the prokaryote and eukaryote resulted from the prokaryote’s lack of an endocytotic pathway

  12. Comparison of the Emulsion Mixing and In Situ Polymerization Techniques for Synthesis of Water- Borne Reduced Graphene Oxide/Polymer Composites: Advantages and Drawbacks

    Czech Academy of Sciences Publication Activity Database

    Arzac, A.; Leal, G.L.; Fajgar, Radek; Tomovska, R.

    2014-01-01

    Roč. 31, č. 1 (2014), s. 143-151 ISSN 0934-0866 Grant - others:BG(ES) NanoIker 2012–2013; NATO(US) SfP 984399 Institutional support: RVO:67985858 Keywords : polymerization * composite films * latex blends Subject RIV: CA - Inorganic Chemistry Impact factor: 3.081, year: 2014

  13. Preliminary Investigation into Tree Dryness in Hevea brasiliensis (Wild. Ex Adr. De Juss Muell. Arg. by Path Analysis of Tree Dryness and Latex Parameters

    Directory of Open Access Journals (Sweden)

    Omokhafe, KO.

    2001-01-01

    Full Text Available The correlative path analysis between tree dryness and four latex parameters was studied in eleven clones of Hevea brasiliensis. The latex parameters used for evaluation were initial volume, initial flow rate, final volume and plugging index with tree dryness as the dependent factor. Estimates of direct and indirect effects of each of the latex parameters on tree dryness were calculated through linear correlation and path analysis. The correlation coefficient between initial volume and initial flow rate was 1.00 and both characters had the same correlation coefficients with other latex parameters and tree dryness. This implies that initial volume and initial flow rate are alternatives for evaluation of correlation between latex parameters and tree dryness. There was significant correlation between initial volume, initial flow rate and tree dryness at V = -0.52 and high indirect effect of initial volume and initial flow rate through final volume. In addition, despite the low correlation coefficient of V = -0.20 between final volume and tree dryness, the direct effect of final volume on tree dryness was high at 0.812. Final volume is therefore an important factor in the incidence of tree dryness.

  14. Concentrations, Stability, and Isolation of the Furan Fatty Acid 9-(3-Methyl-5-pentylfuran-2-yl)-nonanoic Acid from Disposable Latex Gloves.

    Science.gov (United States)

    Müller, Marco; Hogg, Melanie; Ulms, Kerstin; Vetter, Walter

    2017-09-13

    Because of their antioxidant properties, furan fatty acids (furan-FAs) are valuable minor compounds with a widespread occurrence in all living matter. Unfortunately, pure standards are not readily available, because they usually contribute only 1% to the lipid fraction. A known exception of this is the milky fluid of Hevea brasiliensis, commonly known as latex, in which the furan-FA 9-(3-methyl-5-pentylfuran-2-yl)-nonanoic acid (9M5) contributes about 90% to the triacylglycerides. In this study, we investigated the content of 9M5 in 30 different disposable latex gloves, which ranged from 0.7 to 8.2 mg/g of glove. The light degradability of 9M5 in latex gloves was investigated, and different amounts of 9M5 in disposable latex gloves were attributed to varying exposure time to light. Additionally, over 100 mg of the methyl or ethyl ester of 9M5 (purity of >98%) could be extracted from disposable latex gloves, employing cold extraction and silver ion chromatography. With this method, standards for the quantitation of furan-FAs are obtained easily and rapidly in all laboratories.

  15. Hevea brasiliensis natural rubber latex film vulcanization by gamma radiation containing n-butyl acrylate: properties and morphology; Filme de latex de borracha natural de Hevea brasiliensis vulcanizado por radiacao gama contendo acrilato de n-butila: propriedades e morfologia

    Energy Technology Data Exchange (ETDEWEB)

    Rodrigues, Ana Paula Pinho; Barros, Glaucione Gomes de [Brasilia Univ., DF (Brazil). Dept. de Quimica; Guedes, Selma M.L. [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil)

    1997-07-01

    Radiation vulcanization of natural rubber latex (RVNRL) in the presence of n-butyl acrylate (n-Ba) as sensitizer was carried out. The RVNRL films were investigated with respect to their thermal properties and morphology. The films presented two T{sub g} values obtained by DSC which were identified as due to linear and crosslinked domains. The thermal stability of the material was similar to that of linear material rubber. The morphology showed smooth regular surface characteristic of homogeneous phase domains. (author)

  16. Outcomes of a natural rubber latex control program in an Ontario teaching hospital.

    Science.gov (United States)

    Tarlo, S M; Easty, A; Eubanks, K; Parsons, C R; Min, F; Juvet, S; Liss, G M

    2001-10-01

    Allergy to natural rubber latex (NRL) has been frequently reported in health care workers. However, there is little published evidence of the outcome of hospital intervention programs to reduce exposure and detect cases of sensitization early. This study assesses the effects of intervention to reduce NRL allergy in an Ontario teaching hospital with approximately 8000 employees. A retrospective review assessed annual numbers of employees visiting the occupational health clinic, allergy clinic, or both for manifestations of NRL allergy compared with the timing of introduction of intervention strategies, such as worker education, voluntary medical surveillance, and hospital conversion to low-protein, powder-free NRL gloves. The number of workers identified with NRL allergy rose annually, from 1 in 1988 to 6 in 1993. When worker education and voluntary medical surveillance were introduced in 1994, a further 25 workers were identified. Nonsterile gloves were changed to low-protein, powder-free NRL gloves in 1995: Diagnoses fell to 8 workers that year, and 2 of the 3 nurses who had been off work because of asthma-anaphylaxis were able to return to work with personal avoidance of NRL products. With a change to lower protein, powder-free NRL sterile gloves in 1997, allergy diagnoses fell to 3, and only 1 new case was identified subsequently up to May 1999. No increased glove costs were incurred as a result of consolidated glove purchases. This program to reduce NRL allergy in employees was effectively achieved without additional glove costs while reducing expenses from time off work and workers' compensation claims.

  17. Fiber Bragg Grating Sensor to Monitor Stress Kinetics in Drying Process of Commercial Latex Paints

    Directory of Open Access Journals (Sweden)

    Ivo de Lourenço

    2010-05-01

    Full Text Available In this paper, we report a study about the application of packaged fiber Bragg gratings used as strain sensors to monitor the stress kinetics during the drying process of commercial latex paints. Three stages of drying with distinct mechanical deformation and temporal behaviors were identified for the samples, with mechanical deformation from 15 μm to 21 μm in the longitudinal film dimension on time intervals from 370 to 600 minutes. Drying time tests based on human sense technique described by the Brazilian Technical Standards NBR 9558 were also done. The results obtained shows that human sense technique has a limited perception of the drying process and that the optical measurement system proposed can be used to characterize correctly the dry-through stage of paint. The influence of solvent (water addition in the drying process was also investigated. The paint was diluted with four parts paint and one part water (80% paint, and one part paint and one part water (50% paint. It was observed that the increase of the water ratio mixed into the paint decreases both the mechanical deformation magnitude and the paint dry-through time. Contraction of 5.2 μm and 10.4 μm were measured for concentrations of 50% and 80% of paint in the mixture, respectively. For both diluted paints the dry-through time was approximately 170 minutes less than undiluted paint. The optical technique proposed in this work can contribute to the development of new standards to specify the drying time of paint coatings.

  18. Evaluation of sodium diclofenac release using natural rubber latex as carrier

    International Nuclear Information System (INIS)

    Aielo, Patricia B.; Borges, Felipe A.; Romeira, Karoline M.; Herculano, Rondinelli D.; Miranda, Matheus Carlos Romeiro; Arruda, Larisa B. de; Lisboa Filho, Paulo Noronha; Drago, Bruno de C.

    2014-01-01

    Sodium Diclofenac is a non-steroidal anti-inflammatory drug (NSAID) taken to reduce inflammation and, as an analgesic, reduce pain. Although this drug is widely used in the general population, properties such as the short half-time and some side effects restrict its clinical use. The most common side effects are: gastric irritation, gastritis, peptic ulcer and bleeding. Studies involving biomaterials as carrier for drug release have been proving their efficiency in overcoming those problems and better controlling the release rate and targeting of the drug. Natural rubber latex (NRL) has been proven excellent for its biocompatibility and ability to stimulate angiogenesis, cellular adhesion and the formation of extracellular matrix, promoting the replacement and regeneration of tissue. In this work, a NRL membrane is used to deliver sodium diclofenac. Sodium diclofenac (NaDic) was found to be adsorbed on the NRL membrane, with little or no incorporation into the membrane bulk, according to energy dispersive Scanning Electron Microscopy with X-Ray microanalysis (SEM-EDS) spectroscopy. In addition, FT-IR shows that there is no molecular-level interaction between drug and NRL. Already, the X-Ray Diffraction (XRD) of NaDic-NRL shows a broader one spectrum than the sharper halo (amorphous characteristic XRD spectrum) of pure NRL. More importantly, the release time of diclofenac in a NRL membrane in vitro was increased from the typical 2-3 h for oral tablets to ca. 74 h. The kinetics of the drug release could be fitted with a double exponential function, with two characteristic times of 0.899 and 32.102 h. In this study, we demonstrated that the interesting properties provided by NRL membranes combined with a controlled release of drug is relevant for biomedical applications.(author)

  19. Evaluation of sodium diclofenac release using natural rubber latex as carrier

    Energy Technology Data Exchange (ETDEWEB)

    Aielo, Patricia B.; Borges, Felipe A.; Romeira, Karoline M.; Herculano, Rondinelli D., E-mail: rond@assis.unesp.br [Universidade Estadual Paulista Julio de Mesquita Filho (UNESP), Assis, SP (Brazil). Fac. de Ciencias e Letras. Dept. de Ciencias Biologicas; Miranda, Matheus Carlos Romeiro [Universidade Estadual Paulista Julio de Mesquita Filho (UNESP), Araraquara, SP (Brazil). Inst. de Quimica; Arruda, Larisa B. de; Lisboa Filho, Paulo Noronha; Drago, Bruno de C. [Universidade Estadual Paulista Julio de Mesquita Filho (UNESP), Bauru, SP (Brazil). Fac. de Ciencias. Dept. de Fisica

    2014-08-15

    Sodium Diclofenac is a non-steroidal anti-inflammatory drug (NSAID) taken to reduce inflammation and, as an analgesic, reduce pain. Although this drug is widely used in the general population, properties such as the short half-time and some side effects restrict its clinical use. The most common side effects are: gastric irritation, gastritis, peptic ulcer and bleeding. Studies involving biomaterials as carrier for drug release have been proving their efficiency in overcoming those problems and better controlling the release rate and targeting of the drug. Natural rubber latex (NRL) has been proven excellent for its biocompatibility and ability to stimulate angiogenesis, cellular adhesion and the formation of extracellular matrix, promoting the replacement and regeneration of tissue. In this work, a NRL membrane is used to deliver sodium diclofenac. Sodium diclofenac (NaDic) was found to be adsorbed on the NRL membrane, with little or no incorporation into the membrane bulk, according to energy dispersive Scanning Electron Microscopy with X-Ray microanalysis (SEM-EDS) spectroscopy. In addition, FT-IR shows that there is no molecular-level interaction between drug and NRL. Already, the X-Ray Diffraction (XRD) of NaDic-NRL shows a broader one spectrum than the sharper halo (amorphous characteristic XRD spectrum) of pure NRL. More importantly, the release time of diclofenac in a NRL membrane in vitro was increased from the typical 2-3 h for oral tablets to ca. 74 h. The kinetics of the drug release could be fitted with a double exponential function, with two characteristic times of 0.899 and 32.102 h. In this study, we demonstrated that the interesting properties provided by NRL membranes combined with a controlled release of drug is relevant for biomedical applications.(author)

  20. Structures of two Arabidopsis thaliana major latex proteins represent novel helix-grip folds

    Energy Technology Data Exchange (ETDEWEB)

    Lytle, Betsy L.; Song, Jikui; de la Cruz, Norberto B.; Peterson, Francis C.; Johnson, Kenneth A.; Bingman, Craig A.; Phillips, Jr., George N.; Volkman, Brian F.; (MCW); (UW)

    2009-06-02

    Here we report the first structures of two major latex proteins (MLPs) which display unique structural differences from the canonical Bet v 1 fold described earlier. MLP28 (SwissProt/TrEMBL ID Q9SSK9), the product of gene At1g70830.1, and the At1g24000.1 gene product (Swiss- Prot/TrEMBL ID P0C0B0), proteins which share 32% sequence identity, were independently selected as foldspace targets by the Center for Eukaryotic Structural Genomics. The structure of a single domain (residues 17-173) of MLP28 was solved by NMR spectroscopy, while the full-length At1g24000.1 structure was determined by X-ray crystallography. MLP28 displays greater than 30% sequence identity to at least eight MLPs from other species. For example, the MLP28 sequence shares 64% identity to peach Pp-MLP119 and 55% identity to cucumber Csf2.20 In contrast, the At1g24000.1 sequence is highly divergent (see Fig. 1), containing a gap of 33 amino acids when compared with all other known MLPs. Even when the gap is excluded, the sequence identity with MLPs from other species is less than 30%. Unlike some of the MLPs from other species, none of the A. thaliana MLPs have been characterized biochemically. We show by NMR chemical shift mapping that At1g24000.1 binds progesterone, demonstrating that despite its sequence dissimilarity, the hydrophobic binding pocket is conserved and, therefore, may play a role in its biological function and that of the MLP family in general.

  1. Characterization of papain-like isoenzymes from latex of Asclepias curassavica by molecular biology validated by proteomic approach.

    Science.gov (United States)

    Obregón, Walter D; Liggieri, Constanza S; Trejo, Sebastian A; Avilés, Francesc X; Vairo-Cavalli, Sandra E; Priolo, Nora S

    2009-01-01

    Latices from Asclepias spp are used in wound healing and the treatment of some digestive disorders. These pharmacological actions have been attributed to the presence of cysteine proteases in these milky latices. Asclepias curassavica (Asclepiadaceae), "scarlet milkweed" is a perennial subshrub native to South America. In the current paper we report a new approach directed at the selective biochemical and molecular characterization of asclepain cI (acI) and asclepain cII (acII), the enzymes responsible for the proteolytic activity of the scarlet milkweed latex. SDS-PAGE spots of both purified peptidases were digested with trypsin and Peptide Mass Fingerprints (PMFs) obtained showed no equivalent peptides. No identification was possible by MASCOT search due to the paucity of information concerning Asclepiadaceae latex cysteine proteinases available in databases. From total RNA extracted from latex samples, cDNA of both peptidases was obtained by RT-PCR using degenerate primers encoding Asclepiadaceae cysteine peptidase conserved domains. Theoretical PMFs of partial polypeptide sequences obtained by cloning (186 and 185 amino acids) were compared with empirical PMFs, confirming that the sequences of 186 and 185 amino acids correspond to acI and acII, respectively. N-terminal sequences of acI and acII, characterized by Edman sequencing, were overlapped with those coming from the cDNA to obtain the full-length sequence of both mature peptidases (212 and 211 residues respectively). Alignment and phylogenetic analysis confirmed that acI and acII belong to the subfamily C1A forming a new group of papain-like cysteine peptidases together with asclepain f from Asclepias fruticosa. We conclude that PMF could be adopted as an excellent tool to differentiate, in a fast and unequivocal way, peptidases with very similar physicochemical and functional properties, with advantages over other conventional methods (for instance enzyme kinetics) that are time consuming and afford less

  2. Latex constituents from Calotropis procera (R. Br. display toxicity upon egg hatching and larvae of Aedes aegypti (Linn.

    Directory of Open Access Journals (Sweden)

    Márcio Viana Ramos

    2006-08-01

    Full Text Available Calotropis procera R. Br. (Asclepiadaceae is a well-known medicinal plant with leaves, roots, and bark being exploited by popular medicine to fight many human and animal diseases. This work deals with the fractionation of the crude latex produced by the green parts of the plant and aims to evaluate its toxic effects upon egg hatching and larval development of Aedes aegypti. The whole latex was shown to cause 100% mortality of 3rd instars within 5 min. It was fractionated into water-soluble dialyzable (DF and non-dialyzable (NDF rubber-free materials. Both fractions were partially effective to prevent egg hatching and most of individuals growing under experimental conditions died before reaching 2nd instars or stayed in 1st instars. Besides, the fractions were very toxic to 3rd instars causing 100% mortality within 24 h. When both fractions were submitted to heat-treatment the toxic effects were diminished considerably suggesting low thermostability of the toxic compounds. Polyacrylamide gel electrophoresis of both fractions and their newly fractionated peaks obtained through ion exchange chromatography or desalting attested the presence of proteins in both materials. When submitted to protease digestion prior to larvicidal assays NDF lost most of its toxicity but DF was still strongly active. It may be possible that the highly toxic effects of the whole latex from C. procera upon egg hatching and larvae development should be at least in part due to its protein content found in NDF. However the toxicity seems also to involve non protein molecules present in DF.

  3. Comparative Transcriptome Analysis of Latex Reveals Molecular Mechanisms Underlying Increased Rubber Yield in Hevea brasiliensis Self-Rooting Juvenile Clones.

    Science.gov (United States)

    Li, Hui-Liang; Guo, Dong; Zhu, Jia-Hong; Wang, Ying; Chen, Xiong-Ting; Peng, Shi-Qing

    2016-01-01

    Rubber tree (Hevea brasiliensis) self-rooting juvenile clones (JCs) are promising planting materials for rubber production. In a comparative trial between self-rooting JCs and donor clones (DCs), self-rooting JCs exhibited better performance in rubber yield. To study the molecular mechanism associated with higher rubber yield in self-rooting JCs, we sequenced and comparatively analyzed the latex of rubber tree self-rooting JCs and DCs at the transcriptome level. Total raw reads of 34,632,012 and 35,913,020 bp were obtained from the library of self-rooting JCs and DCs, respectively, by using Illumina HiSeq 2000 sequencing technology. De novo assemblies yielded 54689 unigenes from the library of self-rooting JCs and DCs. Among 54689 genes, 1716 genes were identified as differentially expressed between self-rooting JCs and DCs via comparative transcript profiling. Functional analysis showed that the genes related to the mass of categories were differentially enriched between the two clones. Several genes involved in carbohydrate metabolism, hormone metabolism and reactive oxygen species scavenging were up-regulated in self-rooting JCs, suggesting that the self-rooting JCs provide sufficient molecular basis for the increased rubber yielding, especially in the aspects of improved latex metabolisms and latex flow. Some genes encoding epigenetic modification enzymes were also differentially expressed between self-rooting JCs and DCs. Epigenetic modifications may lead to gene differential expression between self-rooting JCs and DCs. These data will provide new cues to understand the molecular mechanism underlying the improved rubber yield of H. brasiliensis self-rooting clones.

  4. Irradiation grafting of natural rubber latex with maleic anhydride and its compatibilization of poly(lactic acid)/natural rubber blends

    Science.gov (United States)

    Pongsathit, Siriwan; Pattamaprom, Cattaleeya

    2018-03-01

    Maleic anhydride (MA) is an interesting monomer to be grafted onto natural rubber(NR) due to its potential as a compatibilizer of hydrophobic rubbers and polymers with higher polarity. So far, radiation grafting of MA onto NR in latex state has not been reported. In this study, the grafting of NR with MA in latex state was investigated by exposing the latex to cobalt-60 gamma irradiation at a fixed MA content of 9% and a varied absorbed doses from 2 to 10 kGy. The FTIR spectrometer, 1H NMR spectrometer and gel content analysis have confirmed successful grafting of MA onto NR after irradiation. The grafted NRs were then used to increase the compatibility and the impact property of PLA/NR blends. It was found that the highest impact strength of the blends was achieved when the grafting was carried out at the absorbed dose of 4 kGy.

  5. Caracterização da hipersensibilidade a luvas de látex em profissionais da odontologia = Rubber latex gloves hypersensitivities in dental workers

    Directory of Open Access Journals (Sweden)

    Flávia Sukekava

    2007-01-01

    Full Text Available As reações alérgicas ao látex vêm aumentando em profissionais da saúde e se manifestam como um incômodo local ou sintomatologia sistêmica. Para conhecer a freqüência das manifestações alérgicas nos usuários de luvas de látex foi realizada busca entre os profissionais da odontologia via aplicação de questionários. Foram aplicados 450questionários e, dentre os respondedores (140, 19% relataram manifestar reações locais ao contato com as luvas de látex e 5% reações sistêmicas a outros produtos de látex. Cerca de 2,5% declararam dermatite de contato e reações sistêmicas (anafiláticas, 1,5% apenas dermatite de contato e 1% sintomas de anafilaxia ao uso das luvas. Vinte por cento dos profissionais atenderam pacientes com alergia ao látex e 29% declararam questionar, durante a anamnese, a respeito de alergia ao látex. As reações alérgicas a luvas de látex foram freqüentes e é objeto de preocupação entre os profissionais da odontologia.Allergic reactions to natural rubber latex have increased in dental practice affecting both the professional and the patients. Allergic reactions may range from skin disease to asthma and anaphylaxis. This study aimed at determining the incidence of latex gloves allergy amongdental care workers. 450 allergy questionnaires were used to collect information on latex gloves reactions and 140 dental works answered them. Latex gloves reaction occurred in 19% of them and 5% reported allergic reactions to other latex products. 2.5% reported symptoms suggesting contact dermatitis and anaphylaxis hypersensitivities, 1.5% contact dermatitis, and 1% reported anaphylaxis symptoms when wearing them. 20% of them had patients who presented symptoms suggestive of anaphylaxis hypersensitivity to rubber gloves latex. Our study confirms that rubber latex gloves reactions are frequent among dental care workers, and dentists must be aware of the latex allergy in dental practice.

  6. A latex agglutination test for the field determination of abnormal vitellogenin production in male fishes contaminated by estrogen mimics

    International Nuclear Information System (INIS)

    Magalhaes, Ilizabete; Pihan, Jean-Claude; Falla, Jairo

    2004-01-01

    Estrogen mimics are pollutants present in the aquatic environment. These compounds induce abnormalities in the reproductive system of male fishes, which lead to a total or partial male feminization, or to their demasculinization. Ultimately, these alterations could lead to a disappearance of the total contaminated fish population. Moreover, these toxic substances possess the capacity to mimic endogenous estrogens and to induce the abnormal production of vitellogenin (VTG) in male and immature fishes. The purpose of this research was to develop an easy, specific, cheap and fast method for diagnosing the contamination of male fishes by estrogen mimics, using VTG as biomarker. The selected method is based on a reverse latex agglutination test (rLAT), developed with monoclonal antibodies specific of this biomarker. The development of this VTG-rLAT has involved, firstly, the purification of carp VTG to produce monoclonal antibodies, specifics of this protein. One of these antibodies was selected to recover latex particles (diameter: 1 μm). Finally, the immunoreactivity of the VTG-rLAT was verified with different fish plasma samples from males treated with 17β-estradiol and non-treated males or females in vitellogenesis

  7. Rubber particle proteins REF1 and SRPP1 interact differently with native lipids extracted from Hevea brasiliensis latex.

    Science.gov (United States)

    Wadeesirisak, Kanthida; Castano, Sabine; Berthelot, Karine; Vaysse, Laurent; Bonfils, Frédéric; Peruch, Frédéric; Rattanaporn, Kittipong; Liengprayoon, Siriluck; Lecomte, Sophie; Bottier, Céline

    2017-02-01

    Rubber particle membranes from the Hevea latex contain predominantly two proteins, REF1 and SRPP1 involved in poly(cis-1,4-isoprene) synthesis or rubber quality. The repartition of both proteins on the small or large rubber particles seems to differ, but their role in the irreversible coagulation of the rubber particle is still unknown. In this study we highlighted the different modes of interactions of both recombinant proteins with different classes of lipids extracted from Hevea brasiliensis latex, and defined as phospholipids (PL), glycolipids (GL) and neutral lipids (NL). We combined two biophysical methods, polarization modulated-infrared reflection adsorption spectroscopy (PM-IRRAS) and ellipsometry to elucidate their interactions with monolayers of each class of lipids. REF1 and SRPP1 interactions with native lipids are clearly different; SRPP1 interacts mostly in surface with PL, GL or NL, without modification of its structure. In contrast REF1 inserts deeply in the lipid monolayers with all lipid classes. With NL, REF1 is even able to switch from α-helice conformation to β-sheet structure, as in its aggregated form (amyloid form). Interaction between REF1 and NL may therefore have a specific role in the irreversible coagulation of rubber particles. Copyright © 2016 Elsevier B.V. All rights reserved.

  8. Phytochemical characterization, antimicrobial activity and reducing potential of seed oil, latex, machine oil and presscake of Jatropha curcas.

    Science.gov (United States)

    Sharma, Amit Kumar; Gangwar, Mayank; Kumar, Dharmendra; Nath, Gopal; Kumar Sinha, Akhoury Sudhir; Tripathi, Yamini Bhushan

    2016-01-01

    This study aims to evaluate the antimicrobial activity, phytochemical studies and thin layer chromatography analysis of machine oil, hexane extract of seed oil and methanol extract of presscake & latex of Jatropha curcas Linn (family Euphorbiaceae). J. curcas extracts were subjected to preliminary qualitative phytochemical screening to detect the major phytochemicals followed by its reducing power and content of phenol and flavonoids in different fractions. Thin layer chromatography was also performed using different solvent systems for the analysis of a number of constituents in the plant extracts. Antimicrobial activity was evaluated by the disc diffusion method, while the minimum inhibitory concentration, minimum bactericidal concentration and minimum fungicidal concentration were calculated by micro dilution method. The methanolic fraction of latex and cake exhibited marked antifungal and antibacterial activities against Gram-positive and Gram-negative bacteria. Phytochemical analysis revealed the presence of alkaloids, saponins, tannins, terpenoids, steroids, glycosides, phenols and flavonoids. Reducing power showed dose dependent increase in concentration compared to standard Quercetin. Furthermore, this study recommended the isolation and separation of bioactive compounds responsible for the antibacterial activity which would be done by using different chromatographic methods such as high-performance liquid chromatography (HPLC), GC-MS etc. The results of the above study suggest that all parts of the plants possess potent antibacterial activity. Hence, it is important to isolate the active principles for further testing of antimicrobial and other biological efficacy.

  9. Prospective data collection and analysis of perforations and tears of latex surgical gloves during primary endoprosthetic surgeries

    Directory of Open Access Journals (Sweden)

    Zaatreh, Sarah

    2016-12-01

    Full Text Available Introduction: Surgical gloves are used to prevent contamination of the patient and the hospital staff with pathogens. The aim of this study was to examine the actual effectiveness of gloves by examining the damage (perforations, tears to latex gloves during surgery in the case of primary hip and knee prosthesis implantation. Materials and methods: Latex surgical gloves used by surgeons for primary hip and knee replacement surgeries were collected directly after the surgery and tested using the watertightness test according to ISO EN 455-1:2000.Results: 540 gloves were collected from 104 surgeries. In 32.7% of surgeries at least one glove was damaged. Of all the gloves collected, 10.9% were damaged, mainly on the index finger. The size of the perforations ranged from ≤1 mm to over 5 mm. The surgeon’s glove size was the only factor that significantly influenced the occurrence of glove damage. Surgeon training level, procedure duration, and the use of bone cement had no significant influence.Conclusions: Our results highlight the high failure rate of surgical gloves. This has acute implications for glove production, surgical practice, and hygiene guidelines. Further studies are needed to detect the surgical steps, surface structures, and instruments that pose an increased risk for glove damage.

  10. Identification of Minor Secondary Metabolites from the Latex of Croton lechleri (Muell-Arg and Evaluation of Their Antioxidant Activity

    Directory of Open Access Journals (Sweden)

    Maria Iorizzi

    2008-06-01

    Full Text Available Dragon’s blood (Sangre de drago, a viscous red sap derived from Croton lechleri Muell-Arg (Euphorbiaceae, is extensively used by indigenous cultures of the Amazonian basin for its wound healing properties. The aim of this study was to identify the minor secondary metabolites and test the antioxidant activity of this sustance. A bioguided fractionation of the n-hexane, chloroform, n-butanol, and aqueous extracts led to the isolation of 15 compounds: three megastigmanes, four flavan-3-ols, three phenylpropanoids, three lignans, a clerodane, and the alkaloid taspine. In addition to these known molecules, six compounds were isolated and identified for the first time in the latex: blumenol B, blumenol C, 4,5-dihydroblumenol A, erythro-guaiacyl-glyceryl-β-O-4’- dihydroconiferyl ether, 2-[4-(3-hydroxypropyl-2-methoxyphenoxy]-propane-1,3-diol and floribundic acid glucoside. Combinations of spectroscopic methods (1H-, 13C- NMR and 2D-NMR experiments, ESI-MS, and literature comparisons were used for compound identification. In vitro antioxidant activities were assessed by DPPH, total antioxidant capacity and lipid peroxidation assays. Flavan-3-ols derivatives (as major phenolic compounds in the latex exhibited the highest antioxidant activity.

  11. Latex of amapa (Parahancornia fasciculata (Poir Benoist, Apocynaceae: remedy and income in the forest and in the town

    Directory of Open Access Journals (Sweden)

    Murilo da Serra Silva

    2011-08-01

    Full Text Available The study investigated the production and trade chain as well as aspects of the consumption of the medicinal latex from amapa tree (Parahancornia fasciculata in the municipalities of Belém and Ponta de Pedras, State of Pará, Brazil. Our goal was to shed light upon several aspects related to the management and use of the product, revealing its importance to the life of producers and consumers. The approach used was the 'production to consumption chain' through qualitative and quantitative research methods, including market survey, interviews with extractivists, traders and consumers, workshops, guided visits and forest inventories. The eight thousand litters of milk sold annually in the Belém markets benefit especially the poor people, to whom the use of the 'amapa milk' is secular. The revenue from the latex represents 42% of the total income from non timber forest products for the tappers. The large number of individuals and the J-shaped diameter distribution of trees suggest the possibility of its natural regeneration. The improvement of the tapping technique reveals that the extractivists have knowledge on the tree anatomy. The tradition in the use and management of amapa milk as well as the ecological characteristics of the species indicates a good potential for programs on its sustainable production.

  12. Crystallization and preliminary X-ray analysis of a family 19 glycosyl hydrolase from Carica papaya latex

    Energy Technology Data Exchange (ETDEWEB)

    Huet, Joëlle, E-mail: jhuet@ulb.ac.be [Laboratoire de Chimie Générale (CP 206/4), Institut de Pharmacie, Université Libre de Bruxelles (ULB), Campus de la Plaine, Boulevard du Triomphe, B-1050 Bruxelles (Belgium); Azarkan, Mohamed [Laboratoire de Chimie Générale (CP 609), Faculté de Médecine, Université Libre de Bruxelles (ULB), Campus Erasme, 808 Route de Lennik, B-1070 Bruxelles (Belgium); Looze, Yvan [Laboratoire de Chimie Générale (CP 206/4), Institut de Pharmacie, Université Libre de Bruxelles (ULB), Campus de la Plaine, Boulevard du Triomphe, B-1050 Bruxelles (Belgium); Villeret, Vincent [CNRS-UMR 8161, Institut de Biologie de Lille, Université de Lille 1-Université de Lille 2-Institut Pasteur de Lille, IFR142, 1 Rue du Professeur Calmette, F-59021 Lille (France); Wintjens, René, E-mail: jhuet@ulb.ac.be [Laboratoire de Chimie Générale (CP 206/4), Institut de Pharmacie, Université Libre de Bruxelles (ULB), Campus de la Plaine, Boulevard du Triomphe, B-1050 Bruxelles (Belgium)

    2008-05-01

    A chitinase isolated from the latex of the tropical species Carica papaya has been crystallized. The addition of N-acetyl-d-glucosamine to the crystallization solution has improved the diffraction quality resolution of the crystal to 1.8 Å resolution. A chitinase isolated from the latex of the tropical species Carica papaya has been purified to homogeneity and crystallized. This enzyme belongs to glycosyl hydrolase family 19 and exhibits exceptional resistance to proteolysis. The initially observed crystals, which diffracted to a resolution of 2.0 Å, were improved through modification of the crystallization protocol. Well ordered crystals were subsequently obtained using N-acetyl-d-glucosamine, the monomer resulting from the hydrolysis of chitin, as an additive to the crystallization solution. Here, the characterization of a chitinase crystal that belongs to the monoclinic space group P2{sub 1}, with unit-cell parameters a = 69.08, b = 44.79, c = 76.73 Å, β = 95.33° and two molecules per asymmetric unit, is reported. Diffraction data were collected to a resolution of 1.8 Å. Structure refinement is currently in progress.

  13. [Changes in the peripheral blood of workers engaged in ethylbenzene-styrene and synthetic rubber and latex manufacture].

    Science.gov (United States)

    Khristeva, V

    1986-01-01

    A total of 67 workers were examined from the production of "Ethyl benzene-styrene" and 184 workers from the production of "Synthetic rubber and latex", as well as a control group of 59 employees. The workers from the first production are exposed to the effect of styrene, ethyl benzene and toluene. The concentrations of the substances surpass MAC, with several times, at the majority of the working places. The workers with a length of service over 10 years predominate. The workers from the second production are exposed to the combined effect of styrene and divinyl, their concentrations fluctuating from 2 to 8 times over MAC. The workers with a length of service over 10 years are 71.7%. The deviations, established in the hematological indices studied are compared with the results from a study on the workers from those productions of 6 years ago. Dynamics in the changes was established among the workers from the production of "Synthetic rubber and latex", associated with the duration of occupational exposure to styrene and divinyl. In case of a shorter length of service, the deviations are functional (reduction of peroxidase activity in granulocytes), increase of hemoglobin and hematocrit, associated with the adaptive reaction of organism. Pronounced anemic syndrome was established in a considerable number (24 workers) after an exposure of 10 years as well as lymphocytosis (35 subjects) and leukopenia (9 subjects).

  14. Prospective data collection and analysis of perforations and tears of latex surgical gloves during primary endoprosthetic surgeries.

    Science.gov (United States)

    Zaatreh, Sarah; Enz, Andreas; Klinder, Annett; König, Tony; Mittelmeier, Lena; Kundt, Günther; Mittelmeier, Wolfram

    2016-01-01

    Introduction: Surgical gloves are used to prevent contamination of the patient and the hospital staff with pathogens. The aim of this study was to examine the actual effectiveness of gloves by examining the damage (perforations, tears) to latex gloves during surgery in the case of primary hip and knee prosthesis implantation. Materials and methods: Latex surgical gloves used by surgeons for primary hip and knee replacement surgeries were collected directly after the surgery and tested using the watertightness test according to ISO EN 455-1:2000. Results: 540 gloves were collected from 104 surgeries. In 32.7% of surgeries at least one glove was damaged. Of all the gloves collected, 10.9% were damaged, mainly on the index finger. The size of the perforations ranged from ≤1 mm to over 5 mm. The surgeon's glove size was the only factor that significantly influenced the occurrence of glove damage. Surgeon training level, procedure duration, and the use of bone cement had no significant influence. Conclusions: Our results highlight the high failure rate of surgical gloves. This has acute implications for glove production, surgical practice, and hygiene guidelines. Further studies are needed to detect the surgical steps, surface structures, and instruments that pose an increased risk for glove damage.

  15. Prospective data collection and analysis of perforations and tears of latex surgical gloves during primary endoprosthetic surgeries

    Science.gov (United States)

    Zaatreh, Sarah; Enz, Andreas; Klinder, Annett; König, Tony; Mittelmeier, Lena; Kundt, Günther; Mittelmeier, Wolfram

    2016-01-01

    Introduction: Surgical gloves are used to prevent contamination of the patient and the hospital staff with pathogens. The aim of this study was to examine the actual effectiveness of gloves by examining the damage (perforations, tears) to latex gloves during surgery in the case of primary hip and knee prosthesis implantation. Materials and methods: Latex surgical gloves used by surgeons for primary hip and knee replacement surgeries were collected directly after the surgery and tested using the watertightness test according to ISO EN 455-1:2000. Results: 540 gloves were collected from 104 surgeries. In 32.7% of surgeries at least one glove was damaged. Of all the gloves collected, 10.9% were damaged, mainly on the index finger. The size of the perforations ranged from ≤1 mm to over 5 mm. The surgeon’s glove size was the only factor that significantly influenced the occurrence of glove damage. Surgeon training level, procedure duration, and the use of bone cement had no significant influence. Conclusions: Our results highlight the high failure rate of surgical gloves. This has acute implications for glove production, surgical practice, and hygiene guidelines. Further studies are needed to detect the surgical steps, surface structures, and instruments that pose an increased risk for glove damage. PMID:28066701

  16. Phytochemical characterization, antimicrobial activity and reducing potential of seed oil, latex, machine oil and presscake of Jatropha curcas

    Directory of Open Access Journals (Sweden)

    Amit Sharma

    2016-06-01

    Full Text Available Objective: This study aims to evaluate the antimicrobial activity, phytochemical studies and thin layer chromatography analysis of machine oil, hexane extract of seed oil and methanol extract of presscake& latex of Jatropha curcas Linn (family Euphorbiaceae. Materials and Methods: J. curcas extracts were subjected to preliminary qualitative phytochemical screening to detect the major phytochemicals followed by its reducing power and content of phenol and flavonoids in different fractions. Thin layer chromatography was also performed using different solvent systems for the analysis of a number of constituents in the plant extracts. Antimicrobial activity was evaluated by the disc diffusion method, while the minimum inhibitory concentration, minimum bactericidal concentration and minimum fungicidal concentration were calculated by micro dilution method. Results: The methanolic fraction of latex and cake exhibited marked antifungal and antibacterial activities against Gram-positive and Gram-negative bacteria. Phytochemical analysis revealed the presence of alkaloids, saponins, tannins, terpenoids, steroids, glycosides, phenols and flavonoids. Reducing power showed dose dependent increase in concentration compared to standard Quercetin. Furthermore, this study recommended the isolation and separation of bioactive compounds responsible for the antibacterial activity which would be done by using different chromatographic methods such as high-performance liquid chromatography (HPLC, GC-MS etc. Conclusion: The results of the above study suggest that all parts of the plants possess potent antibacterial activity. Hence, it is important to isolate the active principles for further testing of antimicrobial and other biological efficacy.

  17. Synergic effect of salivary pH baselines and low pH intakes on the force relaxation of orthodontic latex elastics.

    Science.gov (United States)

    Ajami, Shabnam; Farjood, Amin; Zare, Mahbubeh

    2017-01-01

    Latex elastics are still in common use due to their low cost and high flexibility to improve sagittal discrepancies or interdigitation of teeth. Mechanical properties of elastics are influenced by several environmental factors such as pH changes. This study evaluated similar latex elastics to define the influence of synergic effect of intermittent low pH and various baselines pH of saliva. Four groups of latex elastics (3-M Unitek, 3/16 inch) were tested ( n = 15 in each group). Two groups of elastics were immersed in two tanks of artificial saliva with different pH levels of 7 and 5, and two groups were immersed in two tanks of artificial saliva with intermittent drop of pH to 4. The force was measured when the elastics were stretched to 25 mm. These measurements were taken in 0, 4, 8, 12, 24, 36, and 48 h for each group. Repeated measures analysis of variance (RMANOVA) and post-hoc Tukey's test were used to assess the findings. The level of significance was 0.05%. The interaction between pH and time analyzed with RMANOVA showed no significant differences ( P > 0.05) except in 36 h ( P = 0.014). The Tukey's analysis showed that each comparison between any two groups did not indicate significant differences ( P > 0.05) except between Groups 1 and 3 and between Groups 2 and 3 ( P pH and force degradation in latex elastic band except in 36 h.

  18. Plant Growth and Water Purification of Porous Vegetation Concrete Formed of Blast Furnace Slag, Natural Jute Fiber and Styrene Butadiene Latex

    Directory of Open Access Journals (Sweden)

    Hwang-Hee Kim

    2016-04-01

    Full Text Available The purpose of this study is to investigate porous vegetation concrete formed using the industrial by-products blast furnace slag powder and blast furnace slag aggregates. We investigated the void ratio, compressive strength, freeze–thaw resistance, plant growth and water purification properties using concretes containing these by-products, natural jute fiber and latex. The target performance was a compressive strength of ≥12 MPa, a void ratio of ≥25% and a residual compressive strength of ≥80% following 100 freeze–thaw cycles. Using these target performance metrics and test results for plant growth and water purification, an optimal mixing ratio was identified. The study characterized the physical and mechanical properties of the optimal mix, and found that the compressive strength decreased compared with the default mix, but that the void ratio and the freeze–thaw resistance increased. When latex was used, the compressive strength, void ratio and freeze–thaw resistance all improved, satisfying the target performance metrics. Vegetation growth tests showed that plant growth was more active when the blast furnace slag aggregate was used. Furthermore, the use of latex was also found to promote vegetation growth, which is attributed to the latex forming a film coating that suppresses leaching of toxic components from the cement. Water purification tests showed no so significant differences between different mixing ratios; however, a comparison of mixes with and without vegetation indicated improved water purification in terms of the total phosphorus content when vegetation had been allowed to grow.

  19. Evaluation of Penicillin Binding Protein 2a Latex Agglutination Assay for Identification of Methicillin-Resistant Staphylococcus aureus Directly from Blood Cultures

    OpenAIRE

    Chapin, Kimberle C.; Musgnug, Michael C.

    2004-01-01

    The penicillin binding protein 2a (PBP2a) latex agglutination test using a blood culture pellet was compared to the oxacillin screen agar method using isolated colonies. For blood cultures positive for Staphylococcus aureus (n = 70), the direct PBP2a test was 18% sensitive and 100% specific. The PBP2a test shows poor sensitivity when used directly with positive blood cultures.

  20. Direct detection of methicillin resistance in Staphylococcus aureus in blood culture broth by use of a penicillin binding protein 2a latex agglutination test.

    Science.gov (United States)

    Qian, Qinfang; Venkataraman, Lata; Kirby, James E; Gold, Howard S; Yamazumi, Toshiaki

    2010-04-01

    We studied the utility of performing a penicillin binding protein 2a latex agglutination (PBP-LA) assay directly on Bactec blood culture broth samples containing Staphylococcus aureus to rapidly detect methicillin resistance. The sensitivity, specificity, positive predictive value, and negative predictive value of this method were 94.1%, 97.5%, 98%, and 92.9%, respectively.

  1. Direct Detection of Methicillin Resistance in Staphylococcus aureus in Blood Culture Broth by Use of a Penicillin Binding Protein 2a Latex Agglutination Test▿

    OpenAIRE

    Qian, Qinfang; Venkataraman, Lata; Kirby, James E.; Gold, Howard S.; Yamazumi, Toshiaki

    2010-01-01

    We studied the utility of performing a penicillin binding protein 2a latex agglutination (PBP-LA) assay directly on Bactec blood culture broth samples containing Staphylococcus aureus to rapidly detect methicillin resistance. The sensitivity, specificity, positive predictive value, and negative predictive value of this method were 94.1%, 97.5%, 98%, and 92.9%, respectively.

  2. Synthesis and characterization of poly (n-butyl acrylate)-poly (methyl methacrylate) latex interpenetrating polymer networks by radiation-induced seeded emulsion polymerization

    Energy Technology Data Exchange (ETDEWEB)

    Yu Haibo [Department of Applied Chemistry, College of Chemistry and Molecular Engineering, Peking University, Beijing 100871 (China); Peng Jing [Department of Applied Chemistry, College of Chemistry and Molecular Engineering, Peking University, Beijing 100871 (China)], E-mail: jpeng@pku.edu.cn; Zhai Maolin; Li Jiuqiang; Wei Genshuan [Department of Applied Chemistry, College of Chemistry and Molecular Engineering, Peking University, Beijing 100871 (China); Qiao Jinliang [Department of Applied Chemistry, College of Chemistry and Molecular Engineering, Peking University, Beijing 100871 (China); SINOPEC Beijing Research Institute of Chemical Industry, Beijing 100013 (China)

    2007-11-15

    A series of latex interpenetrating polymer networks (LIPNs) were prepared via a two-stage emulsion polymerization of methyl methacrylate (MMA) or mixture of MMA and n-butyl acrylate (n-BA) on crosslinked poly(n-butyl acrylate)(PBA) seed latex using {sup 60}Co {gamma}-ray radiation. The particles of resultant latex were produced with diameters between 150 and 250 nm. FTIR spectra identified the formation of crosslinked copolymers of PMMA or P(MMA-co-BA). Dynamic light scattering (DLS) showed that with increasing n-BA concentration in second-stage monomers, the particle size of LIPN increased. Transmission electron microscope(TEM) photographs showed that the morphology of resultant acrylate interpenetrating polymer network (IPN) latex varied from the distinct core-shell structure to homogenous particle structure with the increase of n-BA concentration, and the morphology was mainly controlled by the miscibility between crosslinked PBA seed and second-stage copolymers and polarity of P(MMA-co-BA)copolymers. In addition, differential scanning calorimeter (DSC) measurements indicated the existence of reinforced miscibility between PBA seed and P(MMA-co-BA)copolymer in prepared LIPNs.

  3. A test trial irradiation of natural rubber latex on large scale for the production of examination gloves in a production scale

    International Nuclear Information System (INIS)

    Devendra, R.; Kulatunge, S.; Chandralal, H.N.K.K.; Kalyani, N.M.V.; Seneviratne, J.; Wellage, S.

    1996-01-01

    Radiation Vulcanization of natural rubber latex has been developed extensively through various research and development programme. During these investigations many data was collected and from these data it was proved that radiation vulcanized natural rubber latex (RVNRL) can be used as a new material for industry (RVNRL symposium 1989; Makuuchi IAEA report). This material has been extensively tested in making of dipped goods and extruded products. However these investigations were confined only to laboratory experiments and these experiments mainly reflected material properties of RVNRL and only a little was observed about its behavior in actual production scale operation. The present exercise was carried out mainly to study the behavior of the material in production scale by irradiating latex on a large scale and producing gloves in a production scale plant. It was found that RVNRL can be used in conventional glove plants without making major alteration to the plant. Quality of the gloves that were produced using RVNRL is acceptable. It was also found that the small deviation of vulcanization dose will affect the crosslinking density of films. This will drastically reduce the tensile strength of the film. Crosslinking density or pre-vulcanized relax modulus (PRM) at 100% is a reliable property to control the pre vulcanization of latex by radiation

  4. Synthesis of polymer hybrid latex poly(methyl methacrylate-co-butyl acrylate) with organo montmorillonite via miniemulsion polymerization method for barrier paper

    Science.gov (United States)

    Chanra, J.; Budianto, E.; Soegijono, B.

    2018-03-01

    Hybrid polymer latex based on combination of organic-inorganic materials, poly(methyl methacrylate-co-butyl acrylate) (PMMBA) and organo-montmorillonite (OMMT) were synthesized via miniemulsion polymerization technique. Modification of montmorillonite (MMT) through the incorporation of myristyltrimethylammonium bromide (MTAB) into the clay’s interlayer spaces were investigated by Small-Angle X-ray Scattering (SAXS), Fourier Transform Infrared Spectroscopy (FTIR), Thermogravimetric Analysis (TGA) and Transmission Electron Microscopy (TEM). Barrier property and thermal stability of polymer latex film sample were investigated through its Water Vapor Transmission Rate (WVTR) and Thermogravimetric Analysis (TGA). The results indicated that addition of OMMT as filler in PMMBA increased the barrier property and thermal stability of the latex film. Addition of 8.0% (wt) OMMT increased the barrier property and thermal stability. Miniemusion polymerization process with higher addition (>8.0 wt%) of OMMT resulting in high latex viscosity, particle size, and high amount of coagulum. The utilization of this hybrid polymer could benefits paper and board industries to produce high quality barrier paper for food packaging.

  5. Deposition kinetics of quantum dots and polystyrene latex nanoparticles onto alumina: role of water chemistry and particle coating.

    Science.gov (United States)

    Quevedo, Ivan R; Olsson, Adam L J; Tufenkji, Nathalie

    2013-03-05

    A clear understanding of the factors controlling the deposition behavior of engineered nanoparticles (ENPs), such as quantum dots (QDs), is necessary for predicting their transport and fate in natural subsurface environments and in water filtration processes. A quartz crystal microbalance with dissipation monitoring (QCM-D) was used to study the effect of particle surface coatings and water chemistry on the deposition of commercial QDs onto Al2O3. Two carboxylated QDs (CdSe and CdTe) with different surface coatings were compared with two model nanoparticles: sulfate-functionalized (sPL) and carboxyl-modified (cPL) polystyrene latex. Deposition rates were assessed over a range of ionic strengths (IS) in simple electrolyte (KCl) and in electrolyte supplemented with two organic molecules found in natural waters; namely, humic acid and rhamnolipid. The Al2O3 collector used here is selected to be representative of oxide patches found on the surface of aquifer or filter grains. Deposition studies showed that ENP deposition rates on bare Al2O3 generally decreased with increasing salt concentration, with the exception of the polyacrylic-acid (PAA) coated CdTe QD which exhibited unique deposition behavior due to changes in the conformation of the PAA coating. QD deposition rates on bare Al2O3 were approximately 1 order of magnitude lower than those of the polystyrene latex nanoparticles, likely as a result of steric stabilization imparted by the QD surface coatings. Adsorption of humic acid or rhamnolipid on the Al2O3 surface resulted in charge reversal of the collector and subsequent reduction in the deposition rates of all ENPs. Moreover, the ratio of the two QCM-D output parameters, frequency and dissipation, revealed key structural information of the ENP-collector interface; namely, on bare Al2O3, the latex particles were rigidly attached as compared to the more loosely attached QDs. This study emphasizes the importance of considering the nature of ENP coatings as well

  6. Green mediated synthesis and characterization of ZnO nanoparticles using Euphorbia Jatropa latex as reducing agent

    Directory of Open Access Journals (Sweden)

    M.S. Geetha

    2016-09-01

    Full Text Available Presently the progress of green chemistry in the synthesis of nanoparticles with the use of plants has engrossed a great attention. This study reports the synthesis of ZnO using latex of Euphorbia Jatropa as reducing agent. As prepared product was characterized by powder X-ray diffractometer (PXRD, Fourier transform infra-red spectroscopy (FTIR, scanning electron microscopy–energy dispersive spectroscopy (SEM–EDS, transmission electron microscopy (TEM, X-ray photo electron spectroscopy (XPS, Rietveld refinement, UV–Visible spectroscopy and photoluminescence (PL. The concentration of plant latex plays an important role in controlling the size of the particle and its morphology. PXRD graphs showed the well crystallisation of the particles. The average particle size was calculated using Scherrer equation and advanced Williamson Hall (WH plots. The average particle size was around 15 nm. This result was also supported by SEM and TEM analyses. FTIR shows the characteristic peak of ZnO at 435 cm−1. SEM and TEM micrographs show that the particles were almost hexagonal in nature. EDS of SEM analysis confirmed that the elements are only Zn and O. EDS confirmed purity of ZnO. Atomic states were confirmed by XPS results. Crystal parameters were determined using Rietveld refinement. From UV–Visible spectra average energy gap was calculated which is ∼3.63 eV. PL studies showed UV emission peak at 392 nm and broad band visible emission centred in the range 500–600 nm. The Commission International de I'Eclairage and colour correlated temperature coordinates were estimated for ZnO prepared using 2 ml, 4 ml and 6 ml Jatropa latex. The results indicate that the phosphor may be suitable for white light emitting diode (WLED. The study fruitfully reveals simple, fast, economical and eco friendly method of synthesis of multifunctional ZnO nanoparticles (Nps.

  7. Thermal Oxidation Resistance of Rare Earth-Containing Composite Elastomer

    Institute of Scientific and Technical Information of China (English)

    邱关明; 张明; 周兰香; 中北里志; 井上真一; 冈本弘

    2001-01-01

    The rare earth-containing composite elastomer was obtained by the reaction of vinyl pyridine-SBR (PSBR) latex with rare earth alkoxides, and its thermal oxidation resistance was studied. After aging test, it is found that its retention rate of mechanical properties is far higher than that of the control sample. The results of thermogravimetric analysis show that its thermal-decomposing temperature rises largely. The analysis of oxidation mechanisms indicates that the main reasons for thermal oxidation resistance are that rare earth elements are of the utility to discontinue autoxidation chain reaction and that the formed complex structure has steric hindrance effect on oxidation.

  8. Obtaining of a rapid diagnostic test for Cholera, based on latex particles coupled with a monoclonal antibody against Vibrio cholera O1 lipopolysaccharide

    Directory of Open Access Journals (Sweden)

    Fátima Reyes-López

    2015-08-01

    Full Text Available Cholera is an acute contagious intestinal disease caused by ingestion of food or water contaminated with O1 and O139 serotypes of the bacterium Vibrio cholerae. Cholera is characterized by abundant secretory diarrhea leading to dehydration. Death occurs within hours without treatment, so early diagnosis is very important, especially at the beginning of the disease, because it is difficult to differentiate from other acute diarrheal diseases. The diagnostic golden test is the stool culture; however, it does not guarantee a rapid detection of the disease. Rapid tests have been recently developed; they are based on test strips and agglutination with latex particles, which are very effective, but difficult to acquire for their high prices. The objective of this research was to obtain a quick assay based on latex particles coupled with a monoclonal antibody (mAb against V. cholerae O1 lipopolysaccharide obtained in Finlay Institute. Latex particles of 0.8 µm were used in a 10% suspension, and they were coupled to the mAb (0.25 mg/ml for 2 hours at 37°C. The sensitivity, specificity and performance were evaluated in 84 stool samples from patients with presumptive diagnosis of cholera. The diagnostic test obtained showed no cross-reactivity against no-O1 strains and other enteropathogens. Latex diagnostic test showed values of sensitivity, specificity and efficacy of 97.87; 97.29 and 97.6% respectively, very similar to the commercial diagnostic test CTK- Biotech. The latex reagent obtained can be used in the rapid diagnosis of the disease.

  9. Toxicological evaluation of natural rubber films from vulcanized latex by the conventional process and the alternative process with ionizing radiation; Avaliacao toxicologica de filmes de borracha natural obtidos do latex vulcanizado pelo processo convencional e pelo processo alternativo com radiacao ionizante

    Energy Technology Data Exchange (ETDEWEB)

    Campos, Vania Elisabeth

    1997-07-01

    The industrial vulcanization of natural rubber latex (NRL) is made all over the world by conventional process using sulphur and heat but it can be made by an alternative process using ionizing radiation. In this research the NRL was tested by 13 physical, chemical and mechanical assays which showed its good quality. It was done a preliminary study of the toxicological properties of 4 natural rubber films obtained by casting process of NRL: one non vulcanized, other vulcanized by the conventional process and two vulcanized by the alternative process. In the alternative process the films were obtained by irradiation of NRL by gamma rays from the {sup 60} Co source at 250 kGy in the absence of sensitizer and irradiated NRL at 12 kGy in the presence of 4ph r of n-butyl acrylate / 0.2 phr of KOH. These vulcanization doses were determined from broken tensile strength. In the conventional process, sulphur vulcanized NRL was made using a classical composition. Another film was made with non vulcanized NRL. The preliminary evaluation of the toxicological properties was made from in vitro cytotoxicity and in vivo systemic toxicity assays. The LBN films vulcanized by the alternative process have less cytotoxicity than the NRL film vulcanized by the conventional process. The sensitized vulcanized films by gamma rays and non vulcanized films showed similar cytotoxicity while the vulcanized films without sensitizer showed a slight lower cytotoxicity. The non vulcanized NRL film and the NRL films vulcanized by the alternative process did not show toxic effects in the 72 hours period of the systemic toxicity assay. However the NRL film vulcanized with sulphur induced effects like allaying and motor in coordination on the animals treated with an oil extract at the fourth hour and recovering after that. The alternative process promoted lower toxic effects than conventional process because there was no toxic substances present. (author)

  10. Morphologic evaluation of the use of a latex prosthesis in videolaparoscopic inguinoplasty: an experimental study in dogs Avaliação morfológica da utilização de prótese de latex na inguinoplastia videolaparoscópica: estudo experimental em cães

    Directory of Open Access Journals (Sweden)

    Luiz Henrique de Sousa

    2011-01-01

    Full Text Available PURPOSE: To evaluate the morphological aspects of the behavior of 4 types of latex biomembranes implanted in preperitoneal videolaparoscopic inguinoplasty. METHODS: Sixteen inguinoplasties were performed in 12 dogs: group 1 received an impermeable latex biomembrane in the right inguinal region and a prolene prosthesis, as control, in the contralateral inguinal region; groups 2, 3 and 4 received latex biomembranes respectively containing impermeable polyamide, 1-mm thick porous polyamide and 0.5-mm thick porous polyamide. Macro- and microscopic evaluations of the inguinal region and of the removed implants were made on the 7th, 14th, 21st and 28th days in group 1 and on the 28th postoperative day in the other groups. RESULTS: We observed absence of hematoma, seroma and infection; presence of tortuosities; induction of vascular neoformation, inflammatory reaction and collagen deposition, and full encystment of the latex biomembranes, except that with fine porous polyamide, which was partially incorporated, with the formation of microcysts. No latex biomembrane induced fibrosis as observed in the prolene control group. CONCLUSIONS: The biomembranes maintain induction of the healing process without fibrosis, are fully encysted and, except for the one with fine porous polyamide, are not incorporated into adjacent tissues. The latex biomembrane, with or without polyamide, is not recommended as a separate material for preperitoneal inguinoplasty.OBJETIVO: Avaliar aspectos morfológicos do comportamento de 4 tipos de biomembranas de latex, colocadas pré-peritonealmente em cães, por inguinoplastia videolaparoscópica. MÉTODOS: Dezesseis inguinoplastias em 12 cães: grupo 1, com biomembrana de latex impermeável inguinal direita em quatro cães e prótese de prolene, como controle, contra-lateral; grupos 2, 3 e 4, com biomembrana de latex respectivamente de poliamida impermeável, poliamida porosa com 1mm de espessura e poliamida porosa com 0,5mm de

  11. Intercomparison of Methods for Determination of Resonant Frequency Shift of a Microstrip Patch Antenna Loaded with Hevea Rubber Latex

    Directory of Open Access Journals (Sweden)

    Nor Zakiah Yahaya

    2014-01-01

    Full Text Available This paper presents an intercomparison between the finite element method, method of moment, and the variational method to determine the effect of moisture content on the resonant frequency shift of a microstrip patch loaded with wet material. The samples selected for this study were Hevea rubber latex with different percentages of moisture content from 35% to 85%. The results were compared with the measurement data in the frequency range between 1 GHz and 4 GHz. It was found that the finite element method is the most accurate among all the three computational techniques with 0.1 mean error when compared to the measured resonant frequency shift. A calibration equation was obtained to predict moisture content from the measured frequency shift with an accuracy of 2%.

  12. Combination of Tung oil and Natural Rubber Latex in PVA as Water Based Coatings for Paperboard Application

    Directory of Open Access Journals (Sweden)

    Jianprasert Apichaya

    2015-01-01

    Full Text Available This research is focused on the preparation of the PVA/TO/NRL coatings for paperboard by using poly(vinyl alcohol (PVA as substance and blending with Tung oil (TO and/or natural rubber latex (NRL in order to enhance water resistance and dynamic mechanical properties. The effects of TO: NRL ratios on the structures were investigated by water resistance property and dynamic mechanical thermal analysis (DMA. The results showed that the water resistance property was improved by crosslinking of TO and film forming of NRL. The PVA/TO/NRL coating containing both TO and NRL gave better thermal behavior than those with only TO or NRL. For paperboard application, the PVA/TO/NRL coatings were applied on the paperboard to study water affinity and absorption rate on the coated surface. The rate of contact angle change of water on coated paperboards decreased depending on the ratios of TO and NRL.

  13. Determination of antinucleic factors and anti-DNA and antibodies with immunefluorescence, radioimmunoassay and latex-test

    Energy Technology Data Exchange (ETDEWEB)

    Lemmel, E M; Hoffmann, R; Botzenhardt, U

    1976-01-01

    The results obtained with the 3 test methods are not completely equal. This is, on the one hand, based on the fact that at least in the fluorescence test other antibodies than in the DNA-compound test are also detected. Quantitatively, however, the two tests show a good correlation to the progress of the illness; strong positive DNA-compound is practically only found in SLE. The authors were able to prove that the addition of purified C1 or C1q components of the complementary system to the test can result in a DNA binding of over 50% and, consequently, in incorrect positive values in the compound test. The Latex test is less suitable for diagnosis and course observation since it relatively often renders negative results at established cases of SLE with distinct illness activity on the one hand, while on the other hand, quantitative evidence, which is desirable for assessing the illness activity, is not possible.

  14. High speed cinematography of the initial break-point of latex condoms during the air burst test.

    Science.gov (United States)

    Stube, R; Voeller, B; Davidhazy, A

    1990-06-01

    High speed cinematography of latex condoms inflated to burst under standard (ISO) conditions reveals that rupture of the condom typically is initiated at a small focal point on the shank of the condom and then rapidly propagates throughout the condom's surface, often ending with partial or full severance of the condom at its point of attachment to the air burst instrument. This sequence of events is the reverse of that sometimes hypothesized to occur, where initiation of burst was considered to begin at the attachment point and to constitute a testing method artifact. This hypothesis of breakage at the attachment point, if true, would diminish the value of the air burst test as a standard for assessing manufacturing quality control as well as for condom strength measurements and comparisons.

  15. COMPARATIVE HAEMOSTATIC EFFICACY OF SUCCULENT LEAF EXTRACTS AND LATEX OF SOME WOUND HEALING PLANTS ON FRESH WOUND OF RABBIT

    Directory of Open Access Journals (Sweden)

    Shibabrata Pattanayak

    2015-06-01

    Full Text Available Ethnomedicinal report of haemostatic activity of six medicinal plants was validated by a study of the effect of succulent leaf extract of plant parts on the punch wound of rabbit for the first time. It was found that the succulent leave extracts of Artemisia nilagirica (Clarke, Barleria lupulina Lindl., Blumea lacera Dc., Croton bonplandianum Baill, Glinus lotoides Lin. and Mikania scandens (L Willd. can induce haemostasis in fresh wounds as compared to automatic haemostasis (120.00 ±2.91 seconds. The fresh leave extract of Mikania scandens took 25.00 ±1.87 seconds for haemostatic activity. Artemisia nilagirica (35.00 ± 1.50 seconds, Barleria lupulina (30.00 ±2.34 seconds, Blumea lacera (38.00 ±1.87 seconds, Glinus lotoides (35.00 ±2.29 seconds are having better action than Croton bonplandianum (leaf extract, which took 40.00 ±2.69 seconds time for haemostasis. The latex collected from the wounded small branches of living Croton bonplandianum plant is having highest efficacy in causing haemostasis (10.00 ±1.22 seconds, better than the positive control of Tincture Ferric per Chloride (13.00 ±2.54 seconds. The dermal toxicity study reveals that the application of the fresh plant extract on the skin of rat failed to produce any detrimental effect. The plant extracts collected from succulent plant leaves and particularly the latex collected from the living Croton bonplandianum Baill. plant can be used as haemostatic agents.

  16. Latex paint as a delivery vehicle for diethylphthalate and di-n-butylphthalate: predictable boundary layer concentrations and emission rates.

    Science.gov (United States)

    Schripp, Tobias; Salthammer, Tunga; Fauck, Christian; Bekö, Gabriel; Weschler, Charles J

    2014-10-01

    The description of emission processes of volatile and semi-volatile organic compounds (VOCs and SVOCs) from building products requires a detailed understanding of the material and the air flow conditions at the surface boundary. The mass flux between the surface of the material and air depends on the mass transfer coefficient (hm) through the boundary layer, the gas phase concentration of the target compound immediately adjacent to the material (y0), and the gas-phase concentration in bulk air (y(t)). In the present study emission experiments were performed in two chambers of quite different sizes (0.25 m(3) and 55 m(3)), and, in the larger chamber, at two different temperatures (23°C and 30°C). The emitting material was latex wall paint that had been doped with two plasticizers, diethylphthalate (DEP) and di-n-butylphthalate (DnBP). The phthalate content in the paint was varied in the small chamber experiment to evaluate the impact of the initial concentration in the bulk material (C0) on the emission rate. Boundary layer theory was applied to calculate hm for the specific phthalates from the Sherwood number (Sh) and the diffusion coefficient (Dair). Then y0 was determined based on the bulk gas-phase concentration at steady state (y¯). For both, DEP and DnBP, the y0 obtained was lower than the respective saturation vapor pressure (Ps). Furthermore, for both phthalates in latex paint, the material/air partition coefficient (C0/y0) was close in value to the octanol/air partition coefficient (KOA). This study provides a basis for designing phthalate emitting reference materials that mimic the emission behavior of common building materials. Copyright © 2014 Elsevier B.V. All rights reserved.

  17. The study of the use of a latex biomembrane and conjunctival autograft in rabbit conjunctiva wound healing.

    Science.gov (United States)

    Pinho, Erika Christina Canarim Martha de; Chahud, Fernando; Lachat, João-José; Coutinho-Netto, Joaquim José; Sousa, Sidney Julio Faria E

    2018-04-01

    RESUMO Objetivo: Estudar o uso da biomembrana de látex e o transplante conjuntival autólogo na cicatrização conjuntival em coelhos. Métodos: Em nove coelhos albinos, neo-zelandeses, machos foram removidas áreas retangulares idênticas, do quadrante supero nasal, adjacente ao limbo, de ambos os olhos. As áreas desnudas da camada esclerótica nos olhos direitos foram recobertas com biomembrana de látex e a dos olhos esquerdos com enxerto conjuntival autólogo. Os animais foram sacrificados em grupos de três, aos 7, 14 e 21 dias após a cirurgia. Os tecidos do local cirúrgico, incluindo a córnea, foram fixados em formaldeído, antes de serem processados em parafina e corados com hematoxilina e eosina. A natureza e a intensidade da resposta inflamatória e o padrão de epitelização da superfície conjuntival foram avaliados sob microscopia óptica, em seções histológicas longitudinais, passando pelo centro dos espécimes anatômicos. Resultados: Até o décimo quarto dia pós-operatório, o grupo que recebeu a biomembrana apresentou reação inflamatória mais intensa do que o grupo com auto enxerto conjuntival. Aos 14 dias, os olhos com biomembrana apresentavam-se menos inflamados e com estroma mais espesso do que aos 7 dias. Aos 21 dias, a reparação conjuntival de ambos os grupos apresentavam características semelhantes. Conclusão: Apesar de apresentar uma cicatrização mais lenta, a biomembrana de látex se mostrou tão eficaz quanto o auto enxerto conjuntival na reconstrução da superfície ocular após três semanas de cicatrização pós-operatória. Devido as suas baixas toxicidade e alergenicidade, este material parece ser uma opção terapêutica promissora na reconstrução da conjuntiva.ABSTRACT Purpose: To study a latex biomembrane and conjunctival autograft with regard to the promotion of conjunctival healing in rabbits. The study included nine male albino rabbits. In these rabbits, a rectangular area of the conjunctiva was surgically

  18. A latex-based concept for making carbon nanotube/polymer nanocomposites

    NARCIS (Netherlands)

    Grossiord, N.

    2007-01-01

    Several methods have been developed over the last few years to achieve the incorporation of carbon nanotubes (CNTs) into a polymer matrix in order to obtain electrically conductive nanocomposites. The key factors for producing such composites with low CNT loadings comprise the quality of the wetting

  19. Improving the stability of coal slurries: Quarterly progress report for the period December 15, 1986-March 15, 1987. [Adsorption of gum tragacanth on polystyrene latex spheres

    Energy Technology Data Exchange (ETDEWEB)

    Fogler, H.S.

    1987-01-01

    The previous quarterly progress report focusing on the adsorption study of the polystyrene latex spheres with gum tragacanth (GT) indicated that the conformation of GT on the surface of latex spheres plays an important role in the stabilization. To prove this, photon correlation spectroscopy was undertaken, and the steric layer thickness was measured as a function of pH. The results showed that the thickness increases as pH decreases. It is possible that at lower pH the ionization of carboxylic groups is repressed so that GT molecules no longer repel each other and become extended. In addition, the experiments in which pH was lowered showed that the particles which flocculated in the GT solution at higher pH can be deflocculated owing to the increase in the steric layer thickness. 5 refs., 5 figs., 1 tab.

  20. ''Affenhaar'' revisited - Facies context of in situ preserved latex from the Middle Eocene of Central Germany

    Energy Technology Data Exchange (ETDEWEB)

    Wilde, Volker [Senckenberg Forschungsinstitut und Naturmuseum, Sektion Palaeobotanik, Senckenberganlage 25, 60325 Frankfurt am Main (Germany); Riegel, Walter [Senckenberg Forschungsinstitut und Naturmuseum, Sektion Palaeobotanik, Senckenberganlage 25, 60325 Frankfurt am Main (Germany); Geowissenschaftliches Zentrum der Universitaet Goettingen, Geobiologie, Goldschmidtstr. 3, 37077 Goettingen (Germany)

    2010-08-01

    In situ preserved latex (''Affenhaar'') has long been known from some of the Middle Eocene lignites of Central Germany. Now, for the first time, the occurrence of bark with latex canals still in situ has been studied in detail in the former mining area of the Geiseltal. Affenhaar is found in both massive matrix-dominated lignites and interbedded clastics, representing sub-autochthonous and reworked material, respectively. Palynological studies of Affenhaar-bearing sections reveal a highly diverse assemblage of spores and pollen, but none of the pollen taxa is obviously correlated to the occurrence of Affenhaar. A significant herbaceous component has been recognized in the pollen record in addition to those taxa mainly derived from trees. (author)

  1. Rapid detection of methicillin resistance in coagulase-negative staphylococci by a penicillin-binding protein 2a-specific latex agglutination test.

    Science.gov (United States)

    Horstkotte, M A; Knobloch, J K; Rohde, H; Mack, D

    2001-10-01

    The detection of PBP 2a by the MRSA-Screen latex agglutination test with 201 clinical coagulase-negative staphylococci had an initial sensitivity of 98% and a high degree of specificity for Staphylococcus epidermidis strains compared to PCR for mecA. Determination of oxacillin MICs evaluated according to the new breakpoint (0.5 microg/ml) of the National Committee for Clinical Laboratory Standards exhibited an extremely low specificity for this population.

  2. Rapid Detection of Methicillin Resistance in Coagulase-Negative Staphylococci by a Penicillin-Binding Protein 2a-Specific Latex Agglutination Test

    OpenAIRE

    Horstkotte, Matthias A.; Knobloch, Johannes K.-M.; Rohde, Holger; Mack, Dietrich

    2001-01-01

    The detection of PBP 2a by the MRSA-Screen latex agglutination test with 201 clinical coagulase-negative staphylococci had an initial sensitivity of 98% and a high degree of specificity for Staphylococcus epidermidis strains compared to PCR for mecA. Determination of oxacillin MICs evaluated according to the new breakpoint (0.5 μg/ml) of the National Committee for Clinical Laboratory Standards exhibited an extremely low specificity for this population.

  3. Comparative Proteomics of Rubber Latex Revealed Multiple Protein Species of REF/SRPP Family Respond Diversely to Ethylene Stimulation among Different Rubber Tree Clones

    Directory of Open Access Journals (Sweden)

    Zheng Tong

    2017-05-01

    Full Text Available Rubber elongation factor (REF and small rubber particle protein (SRPP are two key factors for natural rubber biosynthesis. To further understand the roles of these proteins in rubber formation, six different genes for latex abundant REF or SRPP proteins, including REF138,175,258 and SRPP117,204,243, were characterized from Hevea brasiliensis Reyan (RY 7-33-97. Sequence analysis showed that REFs have a variable and long N-terminal, whereas SRPPs have a variable and long C-terminal beyond the REF domain, and REF258 has a β subunit of ATPase in its N-terminal. Through two-dimensional electrophoresis (2-DE, each REF/SRPP protein was separated into multiple protein spots on 2-DE gels, indicating they have multiple protein species. The abundance of REF/SRPP proteins was compared between ethylene and control treatments or among rubber tree clones with different levels of latex productivity by analyzing 2-DE gels. The total abundance of each REF/SRPP protein decreased or changed a little upon ethylene stimulation, whereas the abundance of multiple protein species of the same REF/SRPP changed diversely. Among the three rubber tree clones, the abundance of the protein species also differed significantly. Especially, two protein species of REF175 or REF258 were ethylene-responsive only in the high latex productivity clone RY 8-79 instead of in RY 7-33-97 and PR 107. Some individual protein species were positively related to ethylene stimulation and latex productivity. These results suggested that the specific protein species could be more important than others for rubber production and post-translational modifications might play important roles in rubber biosynthesis.

  4. Effect of multiple alcohol-based hand rub applications on the tensile properties of thirteen brands of medical exam nitrile and latex gloves.

    Science.gov (United States)

    Gao, Pengfei; Horvatin, Matthew; Niezgoda, George; Weible, Robyn; Shaffer, Ronald

    2016-12-01

    Current CDC guidance for the disinfection of gloved hands during the doffing of personal protective equipment (PPE) following the care of a patient with Ebola recommends for multiple applications of alcohol-based hand rub (ABHR) on medical exam gloves. To evaluate possible effects of ABHR applications on glove integrity, thirteen brands of nitrile and latex medical exam gloves from five manufacturers and two different ABHRs were included in this study. A pair of gloves were worn by a test operator and the outside surfaces of the gloves were separately treated with an ABHR for 1-6 applications. Tensile strength and ultimate elongation of the gloves without any ABHR treatments (control gloves) and gloves after 1-6 ABHR applications were measured based on the ASTM D412 standard method. In general, tensile strength decreased with each ABHR application. ABHRs had more effect on the tensile strength of the tested nitrile than latex gloves, while ethanol-based ABHR (EBHR) resulted in lesser changes in tensile strength compared to isopropanol-based ABHR (IBHR). The results show that multiple EBHR applications on the latex gloves and some of the nitrile gloves tested should be safe for Ebola PPE doffing based on the CDC guidance. Appropriate hospital staff practice using ABHR treatment and doffing gloves is recommended to become more familiar with changes in glove properties.

  5. Effects of sulfur-based hemostatic agents and gingival retraction cords handled with latex gloves on the polymerization of polyvinyl siloxane impression materials

    Directory of Open Access Journals (Sweden)

    Carlos Eduardo Palhares Machado

    2011-12-01

    Full Text Available OBJECTIVES: This study investigated the possible interactions between three addition silicone materials (Express®, Aquasil Ultra® and Adsil®, three hemostatic agents (ferric sulfate, StatGel FS®; aluminum sulfate, GelCord®; and aluminum chloride, Hemostop® and gingival retraction cords previously handled with latex gloves to determine whether direct contact with medicaments or indirect contamination by latex in conditions similar to those found in clinical practice inhibit or affect the setting of the impression materials. MATERIAL AND METHODS: A portable device for the simultaneous test of several specimens was specifically developed for this study. Polymerization inhibition was analyzed by examination of the impressions and the molded surface. Ten trials were performed for each addition silicone material used in the study, at a total of 240 study samples. RESULTS: All the samples tested (N=240 were nonreactive regardless of the type of combination used. CONCLUSIONS: Aluminum sulfate, ferric sulfate and aluminum chloride hemostatic solutions did not show any inhibitory potential on the addition silicone samples under study, and there were no changes in polymerization as a result of contact between addition silicone and retraction cords handled with latex gloves.

  6. Effects of sulfur-based hemostatic agents and gingival retraction cords handled with latex gloves on the polymerization of polyvinyl siloxane impression materials.

    Science.gov (United States)

    Machado, Carlos Eduardo Palhares; Guedes, Carlos Gramani

    2011-01-01

    This study investigated the possible interactions between three addition silicone materials (Express®, Aquasil Ultra® and Adsil®), three hemostatic agents (ferric sulfate, StatGel FS®; aluminum sulfate, GelCord®; and aluminum chloride, Hemostop®) and gingival retraction cords previously handled with latex gloves to determine whether direct contact with medicaments or indirect contamination by latex in conditions similar to those found in clinical practice inhibit or affect the setting of the impression materials. A portable device for the simultaneous test of several specimens was specifically developed for this study. Polymerization inhibition was analyzed by examination of the impressions and the molded surface. Ten trials were performed for each addition silicone material used in the study, at a total of 240 study samples. All the samples tested (N=240) were nonreactive regardless of the type of combination used. Aluminum sulfate, ferric sulfate and aluminum chloride hemostatic solutions did not show any inhibitory potential on the addition silicone samples under study, and there were no changes in polymerization as a result of contact between addition silicone and retraction cords handled with latex gloves.

  7. Mixtures of latex particles and the surfactant of opposite charge used as interface stabilizers--influence of particle contact angle, zeta potential, flocculation and shear energy.

    Science.gov (United States)

    Deleurence, Rémi; Parneix, Caroline; Monteux, Cécile

    2014-09-28

    We investigate the stabilization of air-water interfaces by mixtures of negatively charged latex particles (sulfate polystyrene) and cationic surfactants (alkyl trimethylammonium bromides). First we report results concerning the binding of surfactant molecules to the latex particles. As the surfactant concentration increases, the charge of the particles reverses, from negative to positive, because CnTAB first binds electrostatically to the latex particles and then through hydrophobic interaction with the monolayer already adsorbed on the particles as well as directly with the hydrophobic surface of the latex. Over a large range of surfactant concentrations around the charge inversion, a strong flocculation is observed and 100 μm large aggregates form in the suspension. Unlike previous studies published on mixtures of inorganic particles with oppositely charged surfactants, we show that we can vary the sign of the zeta potential of the particles without changing the contact angle of the particles over a large range of surfactant concentrations. Indeed, the latex particles that we study are more hydrophobic than inorganic particles, hence adding moderate concentrations of the surfactant results in a weak variation of the contact angle while the charge of the particles can be reversed. This enables decoupling of the effect of zeta potential and contact angle on the interfacial properties of the mixtures. Our study shows that the contact angle and the charge of the particles are not sufficient parameters to control the foam properties, and the key-parameters are the flocculation state and the shear energy applied to produce the foam. Indeed, flocculated samples, whatever the sign of the zeta potential, enable production of a stable armour at the interface. The large aggregates do not adsorb spontaneously at the interface because of their large size, however when a large shear energy is used to produce the foam very stable foam is obtained, where particles are trapped

  8. Immunodiagnosis of paracoccidioidomycosis due to Paracoccidioides brasiliensis using a latex test: detection of specific antibody anti-gp43 and specific antigen gp43.

    Directory of Open Access Journals (Sweden)

    Priscila Oliveira Dos Santos

    2015-02-01

    Full Text Available Paracoccidioidomycosis (PCM is a life-threatening systemic disease and is a neglected public health problem in many endemic regions of Latin America. Though several diagnostic methods are available, almost all of them present with some limitations.A latex immunoassay using sensitized latex particles (SLPs with gp43 antigen, the immunodominant antigen of Paracoccidioides brasiliensis, or the monoclonal antibody mAb17c (anti-gp43 was evaluated for antibody or antigen detection in sera, cerebrospinal fluid (CSF, and bronchoalveolar lavage (BAL from patients with PCM due to P. brasiliensis. The gp43-SLPs performed optimally to detect specific antibodies with high levels of sensitivity (98.46%, 95% CI 91.7-100.0, specificity (93.94%, 95% CI 87.3-97.7, and positive (91.4% and negative (98.9% predictive values. In addition, we propose the use of mAb17c-SLPs to detect circulating gp43, which would be particularly important in patients with immune deficiencies who fail to produce normal levels of immunoglobulins, achieving good levels of sensitivity (96.92%, 95% CI 89.3-99.6, specificity (88.89%, 95% CI 81.0-94.3, and positive (85.1% and negative (97.8% predictive values. Very good agreement between latex tests and double immune diffusion was observed for gp43-SLPs (k = 0.924 and mAb17c-SLPs (k = 0.850, which reinforces the usefulness of our tests for the rapid diagnosis of PCM in less than 10 minutes. Minor cross-reactivity occurred with sera from patients with other fungal infections. We successfully detected antigens and antibodies from CSF and BAL samples. In addition, the latex test was useful for monitoring PCM patients receiving therapy.The high diagnostic accuracy, low cost, reduced assay time, and simplicity of this new latex test offer the potential to be commercialized and makes it an attractive diagnostic assay for use not only in clinics and medical mycology laboratories, but mainly in remote locations with limited laboratory infrastructure

  9. Preparation of PBA-P(MMA-DMA) core-shell latex particles%PBA-P(MMA-DMA)核壳乳胶粒子的制备

    Institute of Scientific and Technical Information of China (English)

    辛丹丹; 刘喜军; 娄春华

    2016-01-01

    A novel poly-butyl methacry1ate(PBA)-poly(methyl methacrylate-dimethylaminoethyl methacrylate)[P(MMA-DMA)]core-shell latex particle containing amino groups in surface layer was prepared by a pre-emulsion semi-continuous seeded emulsion polymerization method. It was characterized through element analyzer, laser particle size analyzer, transmission electron microscope (TEM), and X-ray Photoelectron Spectroscopy(XPS). The results indicate that PBA-P(MMA-DMA)latex particles are well-defined core-shell structure, and the mean grain size of PBA core and PBA-P(MMA-DMA) core-shell latex particles are 270 nm and 340 nm respectively. There exists DMA in shell layer of PBA-P (MMA-DMA) core-shell latex particles. When DMA content in shell layer is 10.0% of MMA, the mass fraction of nitrogen in PBA- P(MMA-DMA) core-shell latex particles reaches 0.29%, equivalent of 0.78% amino in shell layer.%采用预乳化半连续种子乳液聚合方法制备了一种新型的表层含氨基的聚甲基丙烯酸丁酯(PBA)-聚(甲基丙烯酸甲酯-甲基丙烯酸二甲氨基乙酯)[P(MMA-DMA)]核壳乳胶粒子,并通过激光粒径分析仪、透射电子显微镜、X射线光电子能谱仪和元素分析仪等对其进行表征。结果表明:PBA-P(MMA-DMA)乳胶粒子为核壳结构,PBA核芯和PBA-P(MMA-DMA)核壳乳胶粒子的平均粒径分别为270,340nm;PBA-P(MMA-DMA)核壳乳胶粒子的壳层确实含有甲基丙烯酸二甲氨基乙酯(DMA),当DMA用量为甲基丙烯酸甲酯质量的10.0%时,PBA-P(MMA-DMA)核壳乳胶粒子氮元素质量分数达0.29%,折合壳层氨基质量分数达0.78%。

  10. Molecular identification and characterization of the pyruvate decarboxylase gene family associated with latex regeneration and stress response in rubber tree.

    Science.gov (United States)

    Long, Xiangyu; He, Bin; Wang, Chuang; Fang, Yongjun; Qi, Jiyan; Tang, Chaorong

    2015-02-01

    In plants, ethanolic fermentation occurs not only under anaerobic conditions but also under aerobic conditions, and involves carbohydrate and energy metabolism. Pyruvate decarboxylase (PDC) is the first and the key enzyme of ethanolic fermentation, which branches off the main glycolytic pathway at pyruvate. Here, four PDC genes were isolated and identified in a rubber tree, and the protein sequences they encode are very similar. The expression patterns of HbPDC4 correlated well with tapping-simulated rubber productivity in virgin rubber trees, indicating it plays an important role in regulating glycometabolism during latex regeneration. HbPDC1, HbPDC2 and HbPDC3 had striking expressional responses in leaves and bark to drought, low temperature and high temperature stresses, indicating that the HbPDC genes are involve in self-protection and defense in response to various abiotic and biotic stresses during rubber tree growth and development. To understand ethanolic fermentation in rubber trees, it will be necessary to perform an in-depth study of the regulatory pathways controlling the HbPDCs in the future. Copyright © 2014 Elsevier Masson SAS. All rights reserved.

  11. Overexpression of the mulberry latex gene MaMLX-Q1 enhances defense against Plutella xylostella in Arabidopsis thaliana

    Directory of Open Access Journals (Sweden)

    Liu Yan

    2017-01-01

    Full Text Available Purified mulberry latex chitinase (MLX has a role in defense against some lepidopteran insects. In this study, a full length chitinase gene, MaMLX-Q1, of 1405 bp with a 1140 bp open reading frame, was obtained from mulberry leaves by the degenerate primers and rapid amplification of cDNA ends polymerase chain reaction (RACE-PCR procedure. The gene encoded a mature protein with the predicted molecular mass of 39.38 kDa and an isoelectric point (pI of 6.43; it contained two chitin-binding domains and a hydrolase family 19 chitinase domain. Sequence alignment and phylogenetic analysis grouped it in the class I chitinase protein group. Heterogeneous expression of this MaMLX-Q1 in Arabidopsis showed non-visible alterations in growth phenotype, except for the higher transcriptional expression of MaMLX-Q1 when compared to that of wild-type Arabidopsis. This ectopic MaMLX-Q1 exhibited toxicity to the growth and development of Plutella xylostella larvae, causing significantly lower weight gain and higher mortality. These results indicate an application of MaMLX-Q1 as an insecticide for plant protection.

  12. Deproteinised natural rubber latex grafted poly(dimethylaminoethyl methacrylate) - poly(vinyl alcohol) blend membranes: Synthesis, properties and application.

    Science.gov (United States)

    Jayadevan, Janisha; Alex, Rosamma; Gopalakrishnapanicker, Unnikrishnan

    2018-02-01

    Natural rubber latex was initially deproteinised (DNRL) and then subjected to physicochemical modifications to make high functional membranes for drug delivery applications. Initially, DNRL was prepared by incubating with urea, sodiumdodecylsulphate and acetone followed by centrifugation. The deproteinisation was confirmed by CHN analysis. The DNRL was then chemically modified by grafting (dimethylaminoethyl methacrylate) onto NR particles by using a redox initiator system viz; cumene hydroperoxide/tetraethylenepentamine, followed by dialysis for purification. The grafting was confirmed by dynamic light scattering, Fourier transform infrared spectroscopy and nuclear magnetic resonance spectroscopy. The grafted system was blended with a hydrophilic adhesive polymer PVA and casted into membranes. The membranes after blending showed enhanced mechanical properties with a threshold concentration of PVA. The moisture uptake, swelling and water contact angle experiments indicated an increased hydrophilicity with an increased PVA content in the blend membranes. The grafted DNRL possessed significant antibacterial property which has been found to be retained in the blended form. A notable decrease in cytotoxicity was observed for the modified DNRL membranes than the bare DNRL membranes. The in-vitro drug release studies using rhodamine B as a model drug, confirmed the utility of the prepared membranes to function as a drug delivery matrix. Copyright © 2017 Elsevier B.V. All rights reserved.

  13. Measurements of dispersion forces between colloidal latex particles with the atomic force microscope and comparison with Lifshitz theory

    Energy Technology Data Exchange (ETDEWEB)

    Elzbieciak-Wodka, Magdalena; Ruiz-Cabello, F. Javier Montes; Trefalt, Gregor; Maroni, Plinio; Borkovec, Michal, E-mail: michal.borkovec@unige.ch [Department of Inorganic and Analytical Chemistry, University of Geneva, Sciences II, 30, Quai Ernest-Ansermet, 1205 Geneva (Switzerland); Popescu, Mihail N. [Ian Wark Research Institute, University of South Australia, Mawson Lakes, SA 5095 (Australia)

    2014-03-14

    Interaction forces between carboxylate colloidal latex particles of about 2 μm in diameter immersed in aqueous solutions of monovalent salts were measured with the colloidal probe technique, which is based on the atomic force microscope. We have systematically varied the ionic strength, the type of salt, and also the surface charge densities of the particles through changes in the solution pH. Based on these measurements, we have accurately measured the dispersion forces acting between the particles and estimated the apparent Hamaker constant to be (2.0 ± 0.5) × 10{sup −21} J at a separation distance of about 10 nm. This value is basically independent of the salt concentration and the type of salt. Good agreement with Lifshitz theory is found when roughness effects are taken into account. The combination of retardation and roughness effects reduces the value of the apparent Hamaker constant and its ionic strength dependence with respect to the case of ideally smooth surfaces.

  14. Novel Polyvinyl Alcohol/Styrene Butadiene Rubber Latex/Carboxymethyl Cellulose Nanocomposites Reinforced with Modified Halloysite Nanotubes

    Directory of Open Access Journals (Sweden)

    Yanjun Tang

    2013-01-01

    Full Text Available Novel polyvinyl alcohol (PVA/styrene butadiene rubber (SBR latex/carboxymethyl cellulose (CMC/halloysite nanotubes (HNTs nanocomposites were successfully prepared through physical blending. The as-obtained PVA/SBR/CMC/HNTs nanocomposites were coated on the surface of old corrugated container (OCC-based paper in an effort to improve the mechanical properties of paper. To improve the dispersion of HNTs and enhance the compatibility between HNTs and polymer matrix, HNTs were modified with titanate coupling agent (TCA. FT-IR, together with TGA, confirmed that TCA was grafted onto the surface of HNTs successfully. XRD demonstrated that the crystal structures of HNTs remained almost unchanged. TEM showed that modified HNTs exhibited good dispersion and possessed nanotubular structures with an outer diameter of around 50 nm and an inner diameter of about 20 nm. SEM gave an indication that modified HNTs were dispersed more uniformly than unmodified HNTs within PVA/SBR/CMC matrix. Rheological measurement exhibited that surface modification process enhanced the compatibility between HNTs and polymer matrix, thus resulting in the decreased viscosity of nanocomposites. In comparison with unmodified HNTs, modified HNTs were found to contribute more to the enhancement in mechanical properties, which might be attributed to the better dispersion and compatibility of modified HNTs evidenced by TEM, SEM, and rheological measurement.

  15. PHYSICOCHEMICAL PROPERTIES OF THE PROTEOLYTIC ENZYME FROM THE LATEX OF THE MILKWEED, ASCLEPIAS SPECIOSA TORR. SOME COMPARISONS WITH OTHER PROTEASES

    Science.gov (United States)

    Winnick, Theodore; Davis, Alva R.; Greenberg, David M.

    1940-01-01

    1. A study has been made of the properties of a hitherto unreported proteolytic enzyme from the latex of the milkweed, Asclepias speciosa. The new protease has been named asclepain by the authors. 2. The results of chemical, diffusion, and denaturation tests indicate that asclepain is a protein. 3. Like papain, asclepain dots milk and digests most proteins, particularly if they are dissolved in concentrated urea solution. Unlike papain, asclepain did not clot blood. 4. The activation and inhibition phenomena of asclepain resemble those of papain, and seem best explained on the assumption that free sulfhydryl in the enzyme is necessary for proteolytic activity. The sulfhydryl of asclepain appears more labile than that of papain. 5. The measurement of pH-activity curves of asclepain on casein, ovalbumin, hemoglobin, edestin, and ovovitellin showed no definite digestion maxima for most of the undenatured proteins, while in urea solution there were well defined maxima near pH 7.0. Native hemoglobin and ovovitellin were especially undigestible, while native casein was rapidly attacked. 6. Temperature-activity curves were determined for asclepain on hemoglobin, casein, and milk solutions. The optimum temperature was shown to increase with decreasing time of digestion. PMID:19873154

  16. Genome-wide evolutionary characterization and expression analyses of major latex protein (MLP) family genes in Vitis vinifera.

    Science.gov (United States)

    Zhang, Ningbo; Li, Ruimin; Shen, Wei; Jiao, Shuzhen; Zhang, Junxiang; Xu, Weirong

    2018-04-27

    The major latex protein/ripening-related protein (MLP/RRP) subfamily is known to be involved in a wide range of biological processes of plant development and various stress responses. However, the biological function of MLP/RRP proteins is still far from being clear and identification of them may provide important clues for understanding their roles. Here, we report a genome-wide evolutionary characterization and gene expression analysis of the MLP family in European Vitis species. A total of 14 members, was found in the grape genome, all of which are located on chromosome 1, where are predominantly arranged in tandem clusters. We have noticed, most surprisingly, promoter-sharing by several non-identical but highly similar gene members to a greater extent than expected by chance. Synteny analysis between the grape and Arabidopsis thaliana genomes suggested that 3 grape MLP genes arose before the divergence of the two species. Phylogenetic analysis provided further insights into the evolutionary relationship between the genes, as well as their putative functions, and tissue-specific expression analysis suggested distinct biological roles for different members. Our expression data suggested a couple of candidate genes involved in abiotic stresses and phytohormone responses. The present work provides new insight into the evolution and regulation of Vitis MLP genes, which represent targets for future studies and inclusion in tolerance-related molecular breeding programs.

  17. Comparative study of the conformational lock, dissociative thermal inactivation and stability of euphorbia latex and lentil seedling amine oxidases.

    Science.gov (United States)

    Amani, M; Moosavi-Movahedi, A A; Floris, G; Longu, S; Mura, A; Moosavi-Nejad, S Z; Saboury, A A; Ahmad, F

    2005-04-01

    The thermal stability of copper/quinone containing amine oxidases from Euphorbia characias latex (ELAO) and lentil seedlings (LSAO) was measured in 100 mM potassium phosphate buffer (pH 7.0) following changes in absorbance at 292 nm. ELAO was shown to be about 10 degrees C more stable than LSAO. The dissociative thermal inactivation of ELAO was studied using putrescine as substrate at different temperatures in the range 47-70 degrees C, and a "conformational lock" was developed using the theory pertaining to oligomeric enzyme. Moreover ELAO was shown to be more stable towards denaturants than LSAO, as confirmed by dodecyl trimethylammonium bromide denaturation curves. A comparison of the numbers of contact sites in inter-subunits of ELAO relative to LSAO led us to conclude that the higher stability of ELAO to temperature and towards denaturants was due to the presence of larger number of contact sites in the conformational lock of the enzyme. This study also gives a putative common mechanism for thermal inactivation of amine oxidases and explains the importance of C-terminal conserved amino acids residues in this class of enzymes.

  18. Structural Changes in Stx1 Engineering Monoclonal Antibody Improves Its Functionality as Diagnostic Tool for a Rapid Latex Agglutination Test

    Directory of Open Access Journals (Sweden)

    Daniela Luz

    2018-02-01

    Full Text Available Stx1 toxin is one of the AB5 toxins of Shiga toxin-producing Escherichia coli (STEC responsible for foodborne intoxication during outbreaks. The single-chain variable fragment (scFv is the most common recombinant antibody format; it consists of both variable chains connected by a peptide linker with conserved specificity and affinity for antigen. The drawbacks of scFv production in bacteria are the heterologous expression, conformation and stability of the molecule, which could change the affinity for the antigen. In this work, we obtained a stable and functional scFv-Stx1 in bacteria, starting from IgG produced by hybridoma cells. After structural modifications, i.e., change in protein orientation, vector and linker, its solubility for expression in bacteria was increased as well as the affinity for its antigen, demonstrated by a scFv dissociation constant (KD of 2.26 × 10−7 M. Also, it was able to recognize purified Stx1 and cross-reacted with Stx2 toxin by ELISA (Enzyme-Linked Immunosorbent Assay, and detected 88% of Stx1-producing strains using a rapid latex agglutination test. Thus, the scFv fragment obtained in the present work is a bacteria-produced tool for use in a rapid diagnosis test, providing an alternative for STEC diagnosis.

  19. Autologous albumin enhances the humoral immune response to capsular polysaccharide covalently co-attached to bacteria-sized latex beads

    Science.gov (United States)

    Colino, Jesus; Duke, Leah; Snapper, Clifford M.

    2014-01-01

    Abundant autologous proteins, like serum albumin, should be immunologically inert. However, individuals with no apparent predisposition to autoimmune disease can develop immune responses to autologous therapeutic proteins. Protein aggregation is a potential major trigger of these responses. Adsorption of proteins to particles provides macromolecular size and may generate structural changes in the protein, resembling aggregation. Using aldehyde/sulfate latex beads coated with murine serum albumin (MSA), we found that mice mounted MSA-specific IgG responses that were dependent on CD4+ T cells. IgG were specific for MSA adsorbed to solid surfaces and non-cross-reactive with human, bovine or pig albumins. T cells induced in response to MSA, augmented the primary and induced boosted secondary IgG and IgM responses specific for the T cell-independent antigen, capsular polysaccharide of Streptococcus pneumoniae type 14 (PPS14), when the latter was attached to the same bead. Similar to the anti-MSA IgG response, the boosted PPS14-specific IgG secondary response was CD4+ T cell-dependent, displayed a typical carrier effect, and was enhanced by, but did not require, Toll-like receptor stimulation. These results provide a potential mechanism for the induction of responses to autoantigens unable to induce specific T cell responses, and provide new insights into polysaccharide-specific immunity. PMID:24481921

  20. Legionella species and serogroups in Malaysian water cooling towers: identification by latex agglutination and PCR-DNA sequencing of isolates.

    Science.gov (United States)

    Yong, Stacey Foong Yee; Goh, Fen-Ning; Ngeow, Yun Fong

    2010-03-01

    In this study, we investigated the distribution of Legionella species in water cooling towers located in different parts of Malaysia to obtain information that may inform public health policies for the prevention of legionellosis. A total of 20 water samples were collected from 11 cooling towers located in three different states in east, west and south Malaysia. The samples were concentrated by filtration and treated with an acid buffer before plating on to BCYE agar. Legionella viable counts in these samples ranged from 100 to 2,000 CFU ml(-1); 28 isolates from the 24 samples were examined by latex agglutination as well as 16S rRNA and rpoB PCR-DNA sequencing. These isolates were identified as Legionella pneumophila serogroup 1 (35.7%), L. pneumophila serogroup 2-14 (39%), L. pneumophila non-groupable (10.7%), L. busanensis, L. gormanii, L. anisa and L. gresilensis. L. pneumophila was clearly the predominant species at all sampling sites. Repeat sampling from the same cooling tower and testing different colonies from the same water sample showed concurrent colonization by different serogroups and different species of Legionella in some of the cooling towers.