WorldWideScience

Sample records for c-2260 resonances

  1. 21 CFR 74.2260 - D&C Orange No. 10.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false D&C Orange No. 10. 74.2260 Section 74.2260 Food... COLOR ADDITIVES SUBJECT TO CERTIFICATION Cosmetics § 74.2260 D&C Orange No. 10. (a) Identity and specifications. The color additive D&C Orange No. 10 shall conform in identity and specifications to the...

  2. 21 CFR 864.2260 - Chromosome culture kit.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Chromosome culture kit. 864.2260 Section 864.2260...) MEDICAL DEVICES HEMATOLOGY AND PATHOLOGY DEVICES Cell And Tissue Culture Products § 864.2260 Chromosome culture kit. (a) Identification. A chromosome culture kit is a device containing the necessary ingredients...

  3. 7 CFR 29.2260 - Condition.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Condition. 29.2260 Section 29.2260 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing... Condition. The state of tobacco which results from the method of preparation or from the degree of...

  4. 42 CFR 423.2260 - Definitions concerning marketing materials.

    Science.gov (United States)

    2010-10-01

    ..., yellow pages, or the Internet. (ii) Marketing representative materials such as scripts or outlines for... 42 Public Health 3 2010-10-01 2010-10-01 false Definitions concerning marketing materials. 423... Marketing Requirements § 423.2260 Definitions concerning marketing materials. As used in this subpart...

  5. 21 CFR 862.2260 - High pressure liquid chromatography system for clinical use.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false High pressure liquid chromatography system for... Clinical Laboratory Instruments § 862.2260 High pressure liquid chromatography system for clinical use. (a) Identification. A high pressure liquid chromatography system for clinical use is a device intended to separate...

  6. 3C-SiC microdisk mechanical resonators with multimode resonances at radio frequencies

    Science.gov (United States)

    Lee, Jaesung; Zamani, Hamidrera; Rajgopal, Srihari; Zorman, Christian A.; X-L Feng, Philip

    2017-07-01

    We report on the design, modeling, fabrication and measurement of single-crystal 3C-silicon carbide (SiC) microdisk mechanical resonators with multimode resonances operating at radio frequencies (RF). These microdisk resonators (center-clamped on a vertical stem pedestal) offer multiple flexural-mode resonances with frequencies dependent on both disk and anchor dimensions. The resonators are made using a novel fabrication method comprised of focused ion beam nanomachining and hydroflouic : nitric : acetic (HNA) acid etching. Resonance peaks (in the frequency spectrum) are detected through laser-interferometry measurements. Resonators with different dimensions are tested, and multimode resonances, mode splitting, energy dissipation (in the form of quality factor measurement) are investigated. Further, we demonstrate a feedback oscillator based on a passive 3C-SiC resonator. This investigation provides important guidelines for microdisk resonator development, ranging from an analytical prediction of frequency scaling law to fabrication, suggesting RF microdisk resonators can be good candidates for future sensing applications in harsh environments.

  7. Performance of 2000CA/LL and 2260XL liquid scintillation spectrometers for low-level tritium and carbon-14 analyses

    International Nuclear Information System (INIS)

    Rozanski, K.; Stichler, W.; Schwarz, P.

    1991-01-01

    The performance of two commercially available liquid scintillation spectrometers for low-level counting of 3 H and 14 C has been investigated. Two models of new technology Tri-Carb spectrometers from the Packard Instrument Company were tested: the 2000CA/LL and 2260XL. The measurements revealed a superior 3 H performance of the 2000CA/LL equipment owing to its substantially higher counting efficiency. Results for 14 C are less conclusive and depend on the configuration of the counting parameters selected. A comparison of three commercially available scintillation cocktails for tritium assay in water samples revealed a superior performance for PicoFluor LLT. (Author)

  8. Resonance Raman Optical Activity and Surface Enhanced Resonance Raman Optical Activity analysis of Cytochrome C

    DEFF Research Database (Denmark)

    Johannessen, Christian; Abdali, Salim; White, Peter C.

    2007-01-01

    High quality Resonance Raman (RR) and resonance Raman Optical Activity (ROA) spectra of cytochrome c were obtained in order to perform full assignment of spectral features of the resonance ROA spectrum. The resonance ROA spectrum of cytochrome c revealed a distinct spectral signature pattern due...... to resonance enhanced skeletal porphyrin vibrations, more pronounced than any contribution from the protein back-bone. Combining the intrinsic resonance enhancement of cytochrome c with surface plasmon enhancement by colloidal silver particles, the Surface Enhanced Resonance Raman Scattering (SERRS) and Chiral...... Enhanced Raman Spectroscopy (ChERS) spectra of the protein were successfully obtained at very low concentration (as low as 1 µM). The assignment of spectral features was based on the information obtained from the RR and resonance ROA spectra. Excellent agreement between RR and SERRS spectra is reported...

  9. Control of a resonant d.c.-link converter for a.c. motor drives

    Directory of Open Access Journals (Sweden)

    Astrid Petterteig

    1992-10-01

    Full Text Available This paper presents the control of the resonant d.c.-link converter for a.c. motor drives. This is a low loss converter with higher efficiency than a conventional PWM converter, but it requires complex control. It needs a special control of the resonant d.c.-link voltage in addition to the discrete control of the a.c. side currents. Simulations show how the control of the a.c. currents, the modulation principle, influences the overall performance of the converter.

  10. Molecular resonances in sub-Coulomb energy region (12C-12C, 12C-24Mg, 12C-9Be systems)

    International Nuclear Information System (INIS)

    Takimoto, Kiyohiko; Shimomura, Susumu; Tanaka, Makoto; Murakami, Tetsuya; Fukada, Mamoru; Sakaguchi, Atsushi

    1982-01-01

    Molecular resonance in sub-Coulomb energy region was studied on 12 C- 12 C, 12 C- 24 Mg and 12 C- 9 Be systems. The excitation functions and the angular distributions were measured on the reactions 12 C( 12 C, 8 Besub(g,s,)) 16 Osub(g,s,), 24 Mg( 12 C, α) 32 S and 9 Be ( 12 C, 8 Besub(g,s,)) 13 Csub(g,s,). Sub-Coulomb resonances were observed in all systems and the contribution of the 12 Csub(2nd)*(0 + , 7.65 MeV) state is proposed. (author)

  11. Investigation of low spin resonances in the 12C+12C and 16O+12C systems

    International Nuclear Information System (INIS)

    Uzureau, J.L.; Fieni, J.M.; Cocu, F.; Michaudon, A.

    1979-01-01

    The excitation functions of the 12 C( 12 C,α) 20 Ne and 12 C( 16 O,α) 24 Mg reactions were measured at different angles below the Coulomb barrier. Resonant structures were found at Esub(cm)=5.80 MeV in the 12 C+ 12 C system and at Esub(cm)=6.10 MeV in the 16 O+ 12 C system. From the analysis of angular distributions measured at the previous resonant energies, values of respectively Jsup(π)=0 + and 2 + have been deduced [fr

  12. Two convergent approaches toward novel carbocyclic C-nucleosides

    Czech Academy of Sciences Publication Activity Database

    Nencka, Radim; Šála, Michal; Dejmek, Milan; Dračínský, Martin; Holý, Antonín; Hřebabecký, Hubert

    -, č. 23 (2010), s. 4119-4130 ISSN 0039-7881 R&D Projects: GA MŠk 1M0508 Institutional research plan: CEZ:AV0Z40550506 Keywords : carbocyclic C-nucleosides * convergent approach * uracil * pyrimidines Subject RIV: CC - Organic Chemistry Impact factor: 2.260, year: 2010

  13. Alpha Resonant States in 13C

    International Nuclear Information System (INIS)

    Rodrigues, M. R. D.; Borello-Lewin, T.; Horodynski-Matsushigue, L. B.; Duarte, J. L. M.; Rodrigues, C. L.; Souza, M. A.; Miyake, H.; Cunsolo, A.; Cappuzzello, F.; Ukita, G. M.

    2011-01-01

    The 9 Be( 6 Li,d) 13 C reaction was used to investigate alpha resonant states in 13 C up to 15 MeV of excitation. The reaction was measured at a bombarding energy of 25.5 MeV employing the Sao Paulo Pelletron-Enge-Spectrograph facility and the nuclear emulsion detection technique. An energy resolution of 50 keV was obtained. Several narrow alpha resonant states not previously measured were detected, in particular the one at the (3α+n) threshold populated by an L = 2 transfer, revealing a 9 Be+α component for the 1/2 - cluster state candidate at this threshold. Experimental angular distributions are presented in comparison with DWBA predictions.

  14. Shape resonance in K-shell photodetachment from C-

    International Nuclear Information System (INIS)

    Walter, C. W.; Gibson, N. D.; Bilodeau, R. C.; Berrah, N.; Bozek, J. D.; Ackerman, G. D.; Aguilar, A.

    2006-01-01

    The core-excited (1s2s 2 2p 4 4 P) negative ion shape resonance of C - near 281.7 eV has been investigated using the merged ion beam--photon beam photodetachment technique on the Advanced Light Source beamline 10.0.1. C + ions formed by double detachment were detected as a function of photon energy. Higher resolution spectra yield more precise values for the energy and width of the resonance than our previous measurements [N. D. Gibson et al., Phys. Rev. A 67, 030703(R) (2003)]. The absolute cross section for double detachment from C - following 1s photoexcitation is measured for the first time and the spectrum is compared to previous theoretical calculations. These measurements also provide information on the lowest core-excited state of neutral carbon (1s2s 2 2p 3 5 S)

  15. Tilted c-Axis Thin-Film Bulk Wave Resonant Pressure Sensors With Improved Sensitivity

    OpenAIRE

    Anderås, Emil; Katardjiev, Ilia; Yantchev, Ventsislav

    2012-01-01

    Aluminum nitride thin film bulk wave resonant pressure sensors employing c- and tilted c-axis texture, have been fabricated and tested for their pressure sensitivities. The c-axis tilted FBAR pressure sensors demonstrate substantially higher pressure sensitivity compared to its c-axis oriented counterpart. More specifically the thickness plate quasi-shear resonance has demonstrated the highest pressure sensitivity while further being able to preserve its performance in liquid environment.

  16. Bonding wood-saxon potential and the mechanism of resonance states in the ''1''2C+''1''2C system

    International Nuclear Information System (INIS)

    Kim, G.; Khaydarov, R.R.

    2001-01-01

    In present work the ''1''2C+''1''2C system are investigated in the realistic Woods--Saxon potential with Coulomb interaction. The comparison of the calculated states with the experimental data has shown, that the observed (identified) resonances may be explained by the single-channel description, i.e., as potential resonances. The quadrupole moments and transition probabilities for low-laying states have been calculated

  17. Angular correlation, spin alignment, and systematics of mis-matched {sup 12}C+{sup 12}C inelastic scattering resonances

    Energy Technology Data Exchange (ETDEWEB)

    Wuosmaa, A.H.; Wiedenhoever, I.; Caggiano, J.; Carpenter, M.P.; Devlin, M.; Heinz, A.; Janssens, R.V.F.; Kondev, F.; Lauritsen, T.; Sarantites, D.G.; Sobotka, L.G.; Battacharyya, P

    2003-10-09

    Particle gamma-ray angular correlation measurements have been used to study the spin alignment and magnetic-substate population parameters for the 2{sup +}{sub 1} (4.443 MeV) state in {sup 12}C, populated in the {sup 12}C({sup 12}C,{sup 12}C[0{sup +}{sub 2}]){sup 12}C(2{sup +}{sub 1}) inelastic scattering reaction in the vicinity of a prominent, narrow peak in the scattering excitation function. The data show a strong alignment of the spin with the orbital angular momentum, and suggest that the cross section peak corresponds to a spin 14{sup +} resonance at E{sub c.m.}=28.0 MeV. This energy is close to that where a strong peak is also observed in the 0{sup +}{sub 1}+0{sup +}{sub 2} excitation function. A comparison between the data for these two channels lends some support to recent theoretical calculations of resonance behavior for angular-momentum-mismatched channels in {sup 12}C+{sup 12}C inelastic scattering.

  18. Giant quadrupole resonance in 12C, 24Mg, and 27Al observed via deuteron inelastic scattering

    International Nuclear Information System (INIS)

    Chang, C.C.; Didelez, J.P.; Kwiatowski, K.; Wo, J.R.

    1977-06-01

    Giant quadrupole resonance in 12 C, 24 Mg, and 27 Al was studied using 70 MeV deuteron beam. The results clearly show, in all three targets, resonance-like structures peaked at E/sub x/ approximately 63A/sup -1/3/ MeV, with a width of about 10 MeV. The experimental angular distributions for these resonances agree well with the l = 2 DWBA prediction. For 12 C, a binary splitting was observed, and for 24 Mg, there are indications of finer structure in the main giant quadrupole resonance region

  19. The differential cross section of the 12C(p,p)12C reaction near the resonance at energy 1.726 MeV

    International Nuclear Information System (INIS)

    Duvanov, S.M.; Kobzev, A.P.

    1996-01-01

    New experimental results on the differential cross section of the 12 C(p,p) 12 C reaction near the separate resonance at 1726 keV were obtained for the 170 deg scattering angle. The cross section measured with a thin target has been used for computer simulation of the spectra measured for a defined initial proton energy for two thick targets. The precision measurements of the proton energies have been carried out using the resonance of 27 Al(p,γ) 28 Si reaction at 1726.0 keV. The energy scale of the excitation function of the 12 C(p,p) 12 C reaction near the resonance at 1726 keV has been defined more exactly. It will improve the precision of depth profiling of carbon in solids. 11 refs., 5 figs., 1 tab

  20. A small parameter in the 1/Nsub(c) expansion and narrowness of hadronic resonances

    International Nuclear Information System (INIS)

    Bishari, M.

    1980-01-01

    The dynamical basis for the validity of the 1/Nsub(c) expansion is investigated in the context of QCD in 1+1 dimensions. This is carried out by studying the first non-leading corrections in 1/Nsub(c) to the mass operator in the space of physical states. The correction to the real part of the mass operator has a direct implication for the convergence of the 1/Nsub(c) expansion, since a small effective parameter is identified, where its smallness depends on the dynamical circumstances in a known way. The generated imaginary part of the mass operator provides us with an insight concerning the question of the narrowness of hadronic resonances. In order to have a more realistic contact with our world, we include also effects due to the flavor symmetry group SU(Nsub(f)). This allows us to understand better the validity and usefulness of the notions of resonance dominance and (smooth) Regge behavior. We also discuss the expansion with Nsub(f)/Nsub(c) fixed and compare the results with those obtained from Dual Resonance Model. It is remarked that a non-uniformity exists between the limits Nsub(c) → infinity, Nsub(f) = fixed and Nsub(c) → infinity Nsub(f)/Nsub(c) = fixed, which may affect physical quantities. (author)

  1. Resonance states in 16O+16O, 12C+16O, α+ 16O and α+ 12C with ...

    Indian Academy of Sciences (India)

    The resonance states in 16O + 16O, 12C + 16O, + 16O and + 12C are described using modified Morse potential proposed earlier whose success has already been demon-strated in the case of 12C + 12C system. The general validity of such a potential with long range, shallow depth and repulsive soft core determined ...

  2. Resonant states in 13C and 16,17O at high excitation energy

    Science.gov (United States)

    Rodrigues, M. R. D.; Borello-Lewin, T.; Miyake, H.; Duarte, J. L. M.; Rodrigues, C. L.; Horodynski-Matsushigue, L. B.; Ukita, G. M.; Cappuzzello, F.; Cavallaro, M.; Foti, A.; Agodi, C.; Cunsolo, A.; Carbone, D.; Bondi, M.; De Napoli, M.; Roeder, B. T.; Linares, R.; Lombardo, I.

    2014-12-01

    The 9Be(6Li,d)13C and 12,13C(6Li,d)16,17O reactions were measured at the São Paulo Pelletron-Enge-Spectrograph facility at 25.5 MeV incident energy. The nuclear emulsion detection technique was applied. Several narrow resonances were populated up to approximately 17 MeV of excitation energy. An excellent energy resolution was obtained: 40 keV for 13C and 15-30 keV for 16O. The upper limit for the resonance widths were determined. Recently, d-a angular correlations were measured at θd = 0° with incident energy of 25 MeV using the LNS Tandem-MAGNEX Spectrometer facility.

  3. Resonant states in 13C and 16,17O at high excitation energy

    International Nuclear Information System (INIS)

    Rodrigues, M R D; Borello-Lewin, T; Miyake, H; Duarte, J L M; Rodrigues, C L; Horodynski-Matsushigue, L B; Ukita, G M; Cappuzzello, F; Foti, A; Cavallaro, M; Agodi, C; Cunsolo, A; Carbone, D; Bondi, M; Napoli, M De; Roeder, B T; Linares, R; Lombardo, I

    2014-01-01

    The 9 Be( 6 Li,d) 13 C and 12,13 C( 6 Li,d) 16,17 O reactions were measured at the São Paulo Pelletron-Enge-Spectrograph facility at 25.5 MeV incident energy. The nuclear emulsion detection technique was applied. Several narrow resonances were populated up to approximately 17 MeV of excitation energy. An excellent energy resolution was obtained: 40 keV for 13 C and 15-30 keV for 16 O. The upper limit for the resonance widths were determined. Recently, d-a angular correlations were measured at θ d = 0° with incident energy of 25 MeV using the LNS Tandem-MAGNEX Spectrometer facility

  4. Modification of the Xe 4d giant resonance by the C60 shell in molecular Xe at C60

    International Nuclear Information System (INIS)

    Amusia, M. Ya.; Baltenkov, A. S.; Chernysheva, L. V.; Felfli, Z.; Msezane, A. Z.

    2006-01-01

    It is demonstrated that in photoabsorption of the 4d 10 subshell of a Xe atom in molecular Xe at C 60 , the 4d giant resonance that characterizes the isolated Xe atom is distorted significantly. The reflection of photoelectron waves by the C 60 shell leads to profound oscillations in the photoionization cross section such that the Xe giant resonance is transformed into four strong peaks. Similarly, the angular anisotropy parameters, both dipole and nondipole, are also modified. The method of calculation is based on the approximation of the C 60 shell by an infinitely thin bubble potential that leaves the sum rule for the 4d-electrons almost unaffected, but noticeably modifies the dipole polarizability of the 4d-shell

  5. Methods for sequential resonance assignment in solid, uniformly 13C, 15N labelled peptides: Quantification and application to antamanide

    International Nuclear Information System (INIS)

    Detken, Andreas; Hardy, Edme H.; Ernst, Matthias; Kainosho, Masatsune; Kawakami, Toru; Aimoto, Saburo; Meier, Beat H.

    2001-01-01

    The application of adiabatic polarization-transfer experiments to resonance assignment in solid, uniformly 13 C- 15 N-labelled polypeptides is demonstrated for the cyclic decapeptide antamanide. A homonuclear correlation experiment employing the DREAM sequence for adiabatic dipolar transfer yields a complete assignment of the C α and aliphatic side-chain 13 C resonances to amino acid types. The same information can be obtained from a TOBSY experiment using the recently introduced P9 1 12 TOBSY sequence, which employs the J couplings as a transfer mechanism. A comparison of the two methods is presented. Except for some aromatic phenylalanine resonances, a complete sequence-specific assignment of the 13 C and 15 N resonances in antamanide is achieved by a series of selective or broadband adiabatic triple-resonance experiments. Heteronuclear transfer by adiabatic-passage Hartmann-Hahn cross polarization is combined with adiabatic homonuclear transfer by the DREAM and rotational-resonance tickling sequences into two- and three-dimensional experiments. The performance of these experiments is evaluated quantitatively

  6. Reaction 12C(16O,α)24Mg leading to nuclear molecular resonances

    International Nuclear Information System (INIS)

    Nagatani, K.; Shimoda, T.; Tanner, D.; Tribble, R.; Yamaya, T.

    1979-01-01

    The reactions 12 C( 16 O,α) 24 Mg and 13 C( 16 O,α) 25 Mg were investigated at an incident energy of 145 MeV. In the reaction with the 12 C target, broad peaks are observed at forward angles which correspond to the molecular resonance states of the 12 C+ 12 C system, while the spectra with 13 C target show only a smooth continuum

  7. 13C, 15N Resonance Assignment of Parts of the HET-s Prion Protein in its Amyloid Form

    International Nuclear Information System (INIS)

    Siemer, Ansgar B.; Ritter, Christiane; Steinmetz, Michel O.; Ernst, Matthias; Riek, Roland; Meier, Beat H.

    2006-01-01

    The partial 15 N and 13 C solid-state NMR resonance assignment of the HET-s prion protein fragment 218-289 in its amyloid form is presented. It is based on experiments measured at MAS frequencies in the range of 20-40 kHz using exclusively adiabatic polarization-transfer schemes. The resonance assignment within each residue is based on two-dimensional 13 C-- 13 C correlation spectra utilizing the DREAM mixing scheme. The sequential linking of the assigned residues used a set of two- and three-dimensional 15 N-- 13 C correlation experiments. Almost all cross peaks visible in the spectra are assigned, but only resonances from 43 of the 78 amino-acid residues could be detected. The missing residues are thought to be highly disordered and/or highly dynamic giving rise to broad resonance lines that escaped detection in the experiments applied. The line widths of the observed resonances are narrow and comparable to line widths observed in micro-crystalline samples. The 43 assigned residues are located in two fragments of about 20 residues

  8. Synthesis of 24-methyl sterols sterospecifically labelled with 2H in the isopropyl methyl groups. 13C NMR spectral assignment of C-26 and C-27 resonances

    International Nuclear Information System (INIS)

    Colombo, D.; Ronchetti, F.; Toma, L.

    1990-01-01

    Through analysis of the 13 C NMR spectra of (25S)-[27- 2 H]campesterol (1) and (25R)-[26- 2 H]dihydrobrassicasterol (2), the C-26 and C-27 resonances have been unambiguously assigned; the biosynthetic applications are discussed. (author)

  9. Dramatic distortion of the 4d giant resonance by the C{sub 60} fullerene shell

    Energy Technology Data Exchange (ETDEWEB)

    Amusia, M Ya [Racah Institute of Physics, The Hebrew University, Jerusalem 91904 (Israel); Baltenkov, A S [Arifov Institute of Electronics, Akademgorodok, 700125 Tashkent (Uzbekistan); Chernysheva, L V [A F Ioffe Physical-Technical Institute, St Petersburg 194021 (Russian Federation); Felfli, Z [Department of Physics and Center for Theoretical Studies of Physical Systems, Clark Atlanta University, Atlanta, GA 30314 (United States); Msezane, A Z [Department of Physics and Center for Theoretical Studies of Physical Systems, Clark Atlanta University, Atlanta, GA 30314 (United States)

    2005-05-28

    The photoionization cross section for the endohedral Xe at C{sub 60} atom is investigated within the framework of representing the C{sub 60} by a delta-type potential. Results demonstrate that in Xe at C{sub 60}, the 4d giant resonance is distorted significantly when compared with that of the isolated Xe atom. The reflection of the photoelectron waves by the C{sub 60} causes strong oscillations in the photoionization cross section resulting in the replacement of the Xe 4d giant resonance by four prominent peaks. The approximation of C{sub 60} by an infinitely thin real potential preserves reasonably well the sum rule for the 4d electrons but modifies the dipole polarizability of the 4d shell. (letter to the editor)

  10. Search for resonant states in 10C and 11C and their impact on the primordial 7Li abundance

    Science.gov (United States)

    Hammache, F.; Coc, A.; de Séréville, N.; Stefan, I.; Roussel, P.; Assié, M.; Audouin, L.; Beaumel, D.; Franchoo, S.; Fernandez-Dominguez, B.; Fox, S.; Hamadache, C.; Kiener, J.; Laird, A.; Le Crom, B.; Lefebvre-Schuhl, A.; Lefebvre, L.; Matea, I.; Matta, A.; Mavilla, G.; Mrazek, J.; Morfouace, P.; de Oliveira Santos, F.; Parikh, A.; Perrot, L.; Sanchez-Benitez, A. M.; Suzuki, D.; Tatischeff, V.; Ujic, P.; Vandebrouck, Marine

    2018-01-01

    The cosmological 7Li problem arises from the significant discrepancy of about a factor 3 between the predicted primordial 7Li abundance and the observed one. The main process for the production of 7Li during Big-Bang nucleosynthesis is the decay of 7Be. Many key nuclear reactions involved in the production and destruction of 7Be were investigated in attempt to explain the 7Li deficit but none of them led to successful conclusions. However, some authors suggested recently the possibility that the destruction of 7Be by 3He and 4He may reconcile the predictions and observations if missing resonant states in the compound nuclei 10C and 11C exist. Hence, a search of these missing resonant states in 10C and 11C was investigated at the Orsay Tandem-Alto facility through 10B(3He,t)10C and 11B(3He,t)11C charge-exchange reactions respectively. After a short overview of the cosmological 7Li problem from a nuclear physics point of view, a description of the Orsay experiment will be given as well as the obtained results and their impact on the 7Li problem.

  11. χ_{c1} and χ_{c2} Resonance Parameters with the Decays χ_{c1,c2}→J/ψμ^{+}μ^{-}.

    Science.gov (United States)

    Aaij, R; Adeva, B; Adinolfi, M; Ajaltouni, Z; Akar, S; Albrecht, J; Alessio, F; Alexander, M; Alfonso Albero, A; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves, A A; Amato, S; Amerio, S; Amhis, Y; An, L; Anderlini, L; Andreassi, G; Andreotti, M; Andrews, J E; Appleby, R B; Archilli, F; d'Argent, P; Arnau Romeu, J; Artamonov, A; Artuso, M; Aslanides, E; Atzeni, M; Auriemma, G; Baalouch, M; Babuschkin, I; Bachmann, S; Back, J J; Badalov, A; Baesso, C; Baker, S; Balagura, V; Baldini, W; Baranov, A; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Baryshnikov, F; Batozskaya, V; Battista, V; Bay, A; Beaucourt, L; Beddow, J; Bedeschi, F; Bediaga, I; Beiter, A; Bel, L J; Beliy, N; Bellee, V; Belloli, N; Belous, K; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Beranek, S; Berezhnoy, A; Bernet, R; Berninghoff, D; Bertholet, E; Bertolin, A; Betancourt, C; Betti, F; Bettler, M-O; van Beuzekom, M; Bezshyiko, Ia; Bifani, S; Billoir, P; Birnkraut, A; Bizzeti, A; Bjørn, M; Blake, T; Blanc, F; Blusk, S; Bocci, V; Boettcher, T; Bondar, A; Bondar, N; Bordyuzhin, I; Borghi, S; Borisyak, M; Borsato, M; Bossu, F; Boubdir, M; Bowcock, T J V; Bowen, E; Bozzi, C; Braun, S; Britton, T; Brodzicka, J; Brundu, D; Buchanan, E; Burr, C; Bursche, A; Buytaert, J; Byczynski, W; Cadeddu, S; Cai, H; Calabrese, R; Calladine, R; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D H; Capriotti, L; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carniti, P; Carson, L; Carvalho Akiba, K; Casse, G; Cassina, L; Cattaneo, M; Cavallero, G; Cenci, R; Chamont, D; Chapman, M G; Charles, M; Charpentier, Ph; Chatzikonstantinidis, G; Chefdeville, M; Chen, S; Cheung, S F; Chitic, S-G; Chobanova, V; Chrzaszcz, M; Chubykin, A; Ciambrone, P; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Cogan, J; Cogneras, E; Cogoni, V; Cojocariu, L; Collins, P; Colombo, T; Comerma-Montells, A; Contu, A; Cook, A; Coombs, G; Coquereau, S; Corti, G; Corvo, M; Costa Sobral, C M; Couturier, B; Cowan, G A; Craik, D C; Crocombe, A; Cruz Torres, M; Currie, R; D'Ambrosio, C; Da Cunha Marinho, F; Dall'Occo, E; Dalseno, J; Davis, A; De Aguiar Francisco, O; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Serio, M; De Simone, P; Dean, C T; Decamp, D; Del Buono, L; Dembinski, H-P; Demmer, M; Dendek, A; Derkach, D; Deschamps, O; Dettori, F; Dey, B; Di Canto, A; Di Nezza, P; Dijkstra, H; Dordei, F; Dorigo, M; Dosil Suárez, A; Douglas, L; Dovbnya, A; Dreimanis, K; Dufour, L; Dujany, G; Durante, P; Dzhelyadin, R; Dziewiecki, M; Dziurda, A; Dzyuba, A; Easo, S; Ebert, M; Egede, U; Egorychev, V; Eidelman, S; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; Ely, S; Esen, S; Evans, H M; Evans, T; Falabella, A; Farley, N; Farry, S; Fazzini, D; Federici, L; Ferguson, D; Fernandez, G; Fernandez Declara, P; Fernandez Prieto, A; Ferrari, F; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fini, R A; Fiorini, M; Firlej, M; Fitzpatrick, C; Fiutowski, T; Fleuret, F; Fohl, K; Fontana, M; Fontanelli, F; Forshaw, D C; Forty, R; Franco Lima, V; Frank, M; Frei, C; Fu, J; Funk, W; Furfaro, E; Färber, C; Gabriel, E; Gallas Torreira, A; Galli, D; Gallorini, S; Gambetta, S; Gandelman, M; Gandini, P; Gao, Y; Garcia Martin, L M; García Pardiñas, J; Garra Tico, J; Garrido, L; Garsed, P J; Gascon, D; Gaspar, C; Gavardi, L; Gazzoni, G; Gerick, D; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gianì, S; Gibson, V; Girard, O G; Giubega, L; Gizdov, K; Gligorov, V V; Golubkov, D; Golutvin, A; Gomes, A; Gorelov, I V; Gotti, C; Govorkova, E; Grabowski, J P; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graverini, E; Graziani, G; Grecu, A; Greim, R; Griffith, P; Grillo, L; Gruber, L; Gruberg Cazon, B R; Grünberg, O; Gushchin, E; Guz, Yu; Gys, T; Göbel, C; Hadavizadeh, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hamilton, B; Han, X; Hancock, T H; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Hasse, C; Hatch, M; He, J; Hecker, M; Heinicke, K; Heister, A; Hennessy, K; Henrard, P; Henry, L; van Herwijnen, E; Heß, M; Hicheur, A; Hill, D; Hombach, C; Hopchev, P H; Hu, W; Huard, Z C; Hulsbergen, W; Humair, T; Hushchyn, M; Hutchcroft, D; Ibis, P; Idzik, M; Ilten, P; Jacobsson, R; Jalocha, J; Jans, E; Jawahery, A; Jiang, F; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Jurik, N; Kandybei, S; Karacson, M; Kariuki, J M; Karodia, S; Kazeev, N; Kecke, M; Keizer, F; Kelsey, M; Kenzie, M; Ketel, T; Khairullin, E; Khanji, B; Khurewathanakul, C; Kirn, T; Klaver, S; Klimaszewski, K; Klimkovich, T; Koliiev, S; Kolpin, M; Kopecna, R; Koppenburg, P; Kosmyntseva, A; Kotriakhova, S; Kozeiha, M; Kravchuk, L; Kreps, M; Kress, F; Krokovny, P; Kruse, F; Krzemien, W; Kucewicz, W; Kucharczyk, M; Kudryavtsev, V; Kuonen, A K; Kvaratskheliya, T; Lacarrere, D; Lafferty, G; Lai, A; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; Leflat, A; Lefrançois, J; Lefèvre, R; Lemaitre, F; Lemos Cid, E; Leroy, O; Lesiak, T; Leverington, B; Li, P-R; Li, T; Li, Y; Li, Z; Likhomanenko, T; Lindner, R; Lionetto, F; Lisovskyi, V; Liu, X; Loh, D; Loi, A; Longstaff, I; Lopes, J H; Lucchesi, D; Luchinsky, A; Lucio Martinez, M; Luo, H; Lupato, A; Luppi, E; Lupton, O; Lusiani, A; Lyu, X; Machefert, F; Maciuc, F; Macko, V; Mackowiak, P; Maddrell-Mander, S; Maev, O; Maguire, K; Maisuzenko, D; Majewski, M W; Malde, S; Malecki, B; Malinin, A; Maltsev, T; Manca, G; Mancinelli, G; Marangotto, D; Maratas, J; Marchand, J F; Marconi, U; Marin Benito, C; Marinangeli, M; Marino, P; Marks, J; Martellotti, G; Martin, M; Martinelli, M; Martinez Santos, D; Martinez Vidal, F; Massacrier, L M; Massafferri, A; Matev, R; Mathad, A; Mathe, Z; Matteuzzi, C; Mauri, A; Maurice, E; Maurin, B; Mazurov, A; McCann, M; McNab, A; McNulty, R; Mead, J V; Meadows, B; Meaux, C; Meier, F; Meinert, N; Melnychuk, D; Merk, M; Merli, A; Michielin, E; Milanes, D A; Millard, E; Minard, M-N; Minzoni, L; Mitzel, D S; Mogini, A; Molina Rodriguez, J; Mombächer, T; Monroy, I A; Monteil, S; Morandin, M; Morello, M J; Morgunova, O; Moron, J; Morris, A B; Mountain, R; Muheim, F; Mulder, M; Müller, D; Müller, J; Müller, K; Müller, V; Naik, P; Nakada, T; Nandakumar, R; Nandi, A; Nasteva, I; Needham, M; Neri, N; Neubert, S; Neufeld, N; Neuner, M; Nguyen, T D; Nguyen-Mau, C; Nieswand, S; Niet, R; Nikitin, N; Nikodem, T; Nogay, A; O'Hanlon, D P; Oblakowska-Mucha, A; Obraztsov, V; Ogilvy, S; Oldeman, R; Onderwater, C J G; Ossowska, A; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pais, P R; Palano, A; Palutan, M; Papanestis, A; Pappagallo, M; Pappalardo, L L; Parker, W; Parkes, C; Passaleva, G; Pastore, A; Patel, M; Patrignani, C; Pearce, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perret, P; Pescatore, L; Petridis, K; Petrolini, A; Petrov, A; Petruzzo, M; Picatoste Olloqui, E; Pietrzyk, B; Pikies, M; Pinci, D; Pisani, F; Pistone, A; Piucci, A; Placinta, V; Playfer, S; Plo Casasus, M; Polci, F; Poli Lener, M; Poluektov, A; Polyakov, I; Polycarpo, E; Pomery, G J; Ponce, S; Popov, A; Popov, D; Poslavskii, S; Potterat, C; Price, E; Prisciandaro, J; Prouve, C; Pugatch, V; Puig Navarro, A; Pullen, H; Punzi, G; Qian, W; Quagliani, R; Quintana, B; Rachwal, B; Rademacker, J H; Rama, M; Ramos Pernas, M; Rangel, M S; Raniuk, I; Ratnikov, F; Raven, G; Ravonel Salzgeber, M; Reboud, M; Redi, F; Reichert, S; Dos Reis, A C; Remon Alepuz, C; Renaudin, V; Ricciardi, S; Richards, S; Rihl, M; Rinnert, K; Rives Molina, V; Robbe, P; Robert, A; Rodrigues, A B; Rodrigues, E; Rodriguez Lopez, J A; Rogozhnikov, A; Roiser, S; Rollings, A; Romanovskiy, V; Romero Vidal, A; Ronayne, J W; Rotondo, M; Rudolph, M S; Ruf, T; Ruiz Valls, P; Ruiz Vidal, J; Saborido Silva, J J; Sadykhov, E; Sagidova, N; Saitta, B; Salustino Guimaraes, V; Sanchez Mayordomo, C; Sanmartin Sedes, B; Santacesaria, R; Santamarina Rios, C; Santimaria, M; Santovetti, E; Sarpis, G; Sarti, A; Satriano, C; Satta, A; Saunders, D M; Savrina, D; Schael, S; Schellenberg, M; Schiller, M; Schindler, H; Schmelling, M; Schmelzer, T; Schmidt, B; Schneider, O; Schopper, A; Schreiner, H F; Schubiger, M; Schune, M-H; Schwemmer, R; Sciascia, B; Sciubba, A; Semennikov, A; Sepulveda, E S; Sergi, A; Serra, N; Serrano, J; Sestini, L; Seyfert, P; Shapkin, M; Shapoval, I; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, V; Siddi, B G; Silva Coutinho, R; Silva de Oliveira, L; Simi, G; Simone, S; Sirendi, M; Skidmore, N; Skwarnicki, T; Smith, E; Smith, I T; Smith, J; Smith, M; Soares Lavra, L; Sokoloff, M D; Soler, F J P; Souza De Paula, B; Spaan, B; Spradlin, P; Sridharan, S; Stagni, F; Stahl, M; Stahl, S; Stefko, P; Stefkova, S; Steinkamp, O; Stemmle, S; Stenyakin, O; Stepanova, M; Stevens, H; Stone, S; Storaci, B; Stracka, S; Stramaglia, M E; Straticiuc, M; Straumann, U; Sun, J; Sun, L; Sutcliffe, W; Swientek, K; Syropoulos, V; Szumlak, T; Szymanski, M; T'Jampens, S; Tayduganov, A; Tekampe, T; Tellarini, G; Teubert, F; Thomas, E; van Tilburg, J; Tilley, M J; Tisserand, V; Tobin, M; Tolk, S; Tomassetti, L; Tonelli, D; Toriello, F; Tourinho Jadallah Aoude, R; Tournefier, E; Traill, M; Tran, M T; Tresch, M; Trisovic, A; Tsaregorodtsev, A; Tsopelas, P; Tully, A; Tuning, N; Ukleja, A; Usachov, A; Ustyuzhanin, A; Uwer, U; Vacca, C; Vagner, A; Vagnoni, V; Valassi, A; Valat, S; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; van Veghel, M; Velthuis, J J; Veltri, M; Veneziano, G; Venkateswaran, A; Verlage, T A; Vernet, M; Vesterinen, M; Viana Barbosa, J V; Viaud, B; Vieira, D; Vieites Diaz, M; Viemann, H; Vilasis-Cardona, X; Vitti, M; Volkov, V; Vollhardt, A; Voneki, B; Vorobyev, A; Vorobyev, V; Voß, C; de Vries, J A; Vázquez Sierra, C; Waldi, R; Wallace, C; Wallace, R; Walsh, J; Wang, J; Ward, D R; Wark, H M; Watson, N K; Websdale, D; Weiden, A; Weisser, C; Whitehead, M; Wicht, J; Wilkinson, G; Wilkinson, M; Williams, M; Williams, M P; Williams, M; Williams, T; Wilson, F F; Wimberley, J; Winn, M; Wishahi, J; Wislicki, W; Witek, M; Wormser, G; Wotton, S A; Wraight, K; Wyllie, K; Xie, Y; Xu, M; Xu, Z; Yang, Z; Yang, Z; Yao, Y; Yin, H; Yu, J; Yuan, X; Yushchenko, O; Zarebski, K A; Zavertyaev, M; Zhang, L; Zhang, Y; Zhelezov, A; Zheng, Y; Zhu, X; Zhukov, V; Zonneveld, J B; Zucchelli, S

    2017-12-01

    The decays χ_{c1}→J/ψμ^{+}μ^{-} and χ_{c2}→J/ψμ^{+}μ^{-} are observed and used to study the resonance parameters of the χ_{c1} and χ_{c2} mesons. The masses of these states are measured to be m(χ_{c1})=3510.71±0.04(stat)±0.09(syst)  MeV and m(χ_{c2})=3556.10±0.06(stat)±0.11(syst)  MeV, where the knowledge of the momentum scale for charged particles dominates the systematic uncertainty. The momentum-scale uncertainties largely cancel in the mass difference m(χ_{c2})-m(χ_{c1})=45.39±0.07(stat)±0.03(syst)  MeV. The natural width of the χ_{c2} meson is measured to be Γ(χ_{c2})=2.10±0.20(stat)±0.02(syst)  MeV. These results are in good agreement with and have comparable precision to the current world averages.

  12. Quantitative determination of Quarternary alicyclic carbon atoms in coal and oil using nuclear magnetic resonance /sup 13/C method

    Energy Technology Data Exchange (ETDEWEB)

    Afonina, T.V.; Kushnarev, D.F.; Randin, O.I.; Shishkov, V.F.; Kalabin, G.A.

    1986-09-01

    Possibility is indicated for utilizing nuclear magnetic resonance spectroscopy for quantitative determination of Quarternary aliphatic carbon atoms in heavy hydrocarbon fractions of oil and coal extracts. C/sub n/, CH, CH/sub 2/ and CH/sub 3/ content in coal and oil samples are determined and corresponding resonance lines are referred to individual structural fragments (on the basis of nuclear magnetic resonance /sup 13/C spectra) of known saturated hydrocarbons. Tests were carried out on chloroform extracts of Irsha-Borodinsk coal, Mungunsk coal and paraffin and cycloparaffin of Sivinsk oil (b.p. over 550 C) fractions. Nuclear magnetic resonance spectra were obtained using Burker WP 200 spectrometer (50.13 MHz frequency). Results of the tests are given. 11 references.

  13. Resonance analysis of the {sup 12}C,{sup 13}C({alpha},n) reactions and evaluation of neutron yield data of the reaction

    Energy Technology Data Exchange (ETDEWEB)

    Murata, Toru [AITEL Corp., Tokyo (Japan)

    1998-03-01

    The {sup 12}C({alpha},n){sup 15}O reaction and the {sup 13}C({alpha},n){sup 16}O reaction were analyzed with a resonance formula in the incident {alpha}-particle energy range of 1.0 to 16.0 MeV. With the obtained resonance parameters, branching ratios of the emitted neutrons to the several levels of the residual nucleus and their angular distributions were calculated to obtain the energy spectrum of emitted neutrons. Thick target neutron yield of carbon were also calculated and compared with the experimental data. (author)

  14. Experimental study of isospin mixing in 12C + n → 13C(T = 3/2) and 16O + n → 17O(T = 3/2) resonances

    International Nuclear Information System (INIS)

    Cierjacks, S.; Schmalz, G.; Hinterberger, F.; Rossen, P. v.

    1981-12-01

    Narrow resonances of 13 C and 17 O have been studied by a measurement of the total neutron cross sections of carbon and oxygen between 3 and 30 MeV. Employing the improved time-of-flight spectrometer at the Karlsruhe Isochronous Cyclotron and precise calibration methods, resonance cross sections were measured with an energy resolution of 1:2100 at 10 MeV and energy accuracies between 10 -4 and 10 -5 . Resonance analysis of the measured data provided parameters for numerous narrow states of both isospins, T = 1/2 and T = 3/2. These data in conjunction with information from broad T = 1/2 resonances provided a good means to experimentally determine isospin mixing matrix elements. Results were obtained for the first five T = 3/2 resonances in 17 O and the first T = 3/2 resonance in 13 C. The obtained mixing matrix elements are compared with previous experimental results and shell-modell predictions of this quantity. (orig.) [de

  15. Positron annihilation and electron spin resonance studies of defects in electron-irradiated 3C-SiC

    International Nuclear Information System (INIS)

    Itoh, Hisayoshi; Yoshikawa, Masahito; Tanigawa, Shoichiro; Nashiyama, Isamu; Misawa, Shunji; Okumura, Hajime; Yoshida, Sadafumi.

    1992-01-01

    Defects induced by 1 MeV electron-irradiation in cubic silicon carbide (3C-SiC) epitaxially grown by chemical vapor deposition have been studied with positron annihilation and electron spin resonance (ESR). Doppler broadened energy spectra of annihilation γ-rays obtained by using variable-energy positron beams showed the formation of vacancy-type defects in 3C-SiC by the electron-irradiation. An ESR spectrum labeled Tl, which has an isotropic g-value of 2.0029 ± 0.001, was observed in electron-irradiated 3C-SiC. The Tl spectrum is interpreted by hyperfine interactions of paramagnetic electrons with 13 C at four carbon sites and 29 Si at twelve silicon sites, indicating that the Tl center arises from a point defect at a silicon site. Both the results can be accounted for by the introduction of isolated Si vacancies by the irradiation. (author)

  16. Electrically-detected electron paramagnetic resonance of point centers in 6H-SiC nanostructures

    Czech Academy of Sciences Publication Activity Database

    Bagraev, N.T.; Gets, D.S.; Kalabukhova, E.N.; Klyachkin, L.E.; Malyarenko, A.M.; Mashkov, V.A.; Savchenko, Dariia; Shanina, B.D.

    2014-01-01

    Roč. 48, č. 11 (2014), s. 1467-1480 ISSN 1063-7826 R&D Projects: GA MŠk(CZ) LM2011029 Grant - others:SAFMAT(XE) CZ.2.16/3.1.00/22132 Institutional support: RVO:68378271 Keywords : electron paramagnetic resonance * electrically- detected electron paramagnetic resonance * 6H -SiC nanostructures * nitrogen-vacancy defect * point defect Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.739, year: 2014

  17. Ultrasonic series resonant converter with integrated L-C-T

    CSIR Research Space (South Africa)

    Smit, MC

    1995-01-01

    Full Text Available primary plate separation, w G bifilar primary 2EOE,NpW(h + To - T;) d C= where d plate width. Fig. 8. SPICE model of discrete component converter ~ 21 B. Spice Simulation The objective of the simulation is to show that the integrated structure... reacts in the same way as a discrete series inductor capacitor and transformer would do, and in turn agrees with the experimental results. Fig. 8 shows the SPICE circuit model of the discrete component series resonant converter. Inductance L...

  18. Photoionization of Xe inside C60: Atom-fullerene hybridization, giant cross-section enhancement, and correlation confinement resonances

    International Nuclear Information System (INIS)

    Madjet, Mohamed E.; Renger, Thomas; Hopper, Dale E.; McCune, Matthew A.; Chakraborty, Himadri S.; Rost, Jan-M.; Manson, Steven T.

    2010-01-01

    A theoretical study of the subshell photoionization of the Xe atom endohedrally confined in C 60 is presented. Powerful hybridization of the Xe 5s state with the bottom edge of C 60 π band is found that induces strong structures in the 5s ionization, causing the cross section to differ significantly from earlier results that omit this hybridization. The hybridization also affects the angular distribution asymmetry parameter of Xe 5p ionization near the Cooper minimum. The 5p cross section, on the other hand, is greatly enhanced by borrowing considerable oscillator strength from the C 60 giant plasmon resonance via the atom-fullerene dynamical interchannel coupling. Beyond the C 60 plasmon energy range the atomic subshell cross sections display confinement-induced oscillations in which, over the large 4d shape resonance region, the dominant 4d oscillations induce their ''clones'' in all degenerate weaker channels known as correlation confinement resonances.

  19. Spin-flip measurements in the proton inelastic scattering on 12C and giant resonance effects

    International Nuclear Information System (INIS)

    De Leo, R.; D'Erasmo, G.; Ferrero, F.; Pantaleo, A.; Pignanelli, M.

    1975-01-01

    Differential cross sections and spin-flip probabilities (SFP) for the inelastic scattering of protons, exciting the 2 + state at 4.43 MeV in 12 C, have been measured at several incident energies between 15.9 and 37.6 MeV. The changes in the shape of the SFP angular distributions are rather limited, while the absolute values show a pronounced increase, resonant like, in two energy regions centered at about 20 and 29 MeV. The second resonance reproduces very closely the energy dependence of the E2 giant quadrupole strength found in a previous experiment. The resonance at 20 MeV should correspond to a substructure of the E1 giant dipole resonance. (Auth.)

  20. Electron paramagnetic resonance study on n-type electron-irradiated 3C-SiC

    Energy Technology Data Exchange (ETDEWEB)

    Carlsson, P; Rabia, K; Son, N T; Janzen, E [Department of Physics, Chemistry and Biology, Linkoeping University, SE-581 83 Linkoeping (Sweden); Ohshima, T; Morishita, N; Itoh, H [Japan Atomic Energy Research Institute, Takasaki 370-1292 (Japan); Isoya, J [University of Tsukuba, Tsukuba 305-8550 (Japan)], E-mail: paca@ifm.liu.se

    2008-03-15

    Electron Paramagnetic Resonance (EPR) was used to study defects in n-type 3C-SiC films irradiated by 3-MeV electrons at room temperature with a dose of 2x10{sup 18} cm{sup -2}. After electron irradiation, two new EPR spectra with an effective spin S = 1, labeled L5 and L6, were observed. The L5 center has C{sub 3v} symmetry with g = 2.004 and a fine-structure parameter D = 436.5x10{sup -4} cm{sup -1}. The L5 spectrum was only detected under light illumination and it could not be detected after annealing at {approx}550{sup 0}C. The principal z-axis of the D tensor is parallel to the <111>-directions, indicating the location of spins along the Si-C bonds. Judging from the symmetry and the fact that the signal was detected under illumination in n-type material, the L5 center may be related to the divacancy in the neutral charge state. The L6 center has a C{sub 2v}-symmetry with an isotropic g-value of g = 2.003 and the fine structure parameters D = 547.7x10{sup -4} cm{sup -1} and E = 56.2x10{sup -4} cm{sup -1}. The L6 center disappeared after annealing at a rather low temperature ({approx}200 deg. C), which is substantially lower than the known annealing temperatures for vacancy-related defects in 3C-SiC. This highly mobile defect may be related to carbon interstitials.

  1. Spectroscopy of transmission resonances through a C60 junction

    DEFF Research Database (Denmark)

    Schneider, N. L.; Néel, N.; Andersen, Nick Papior

    2015-01-01

    Electron transport through a single C60 molecule on Cu(1 1 1) has been investigated with a scanning tunnelling microscope in tunnelling and contact ranges. Single-C60 junctions have been fabricated by establishing a contact between the molecule and the tip, which is reflected by a down......-shift in the lowest unoccupied molecular orbital resonance. These junctions are stable even at elevated bias voltages enabling conductance measurements at high voltages and nonlinear conductance spectroscopy in tunnelling and contact ranges. Spectroscopy and first principles transport calculations clarify...

  2. Analysis of Resonance Response Performance of C-Band Antenna Using Parasitic Element

    Science.gov (United States)

    Islam, M. T.; Misran, N.; Mandeep, J. S.

    2014-01-01

    Analysis of the resonance response improvement of a planar C-band (4–8 GHz) antenna is proposed using parasitic element method. This parasitic element based method is validated for change in the active and parasitic antenna elements. A novel dual-band antenna for C-band application covering 5.7 GHz and 7.6 GHz is designed and fabricated. The antenna is composed of circular parasitic element with unequal microstrip lines at both sides and a rectangular partial ground plane. A fractional bandwidth of 13.5% has been achieved from 5.5 GHz to 6.3 GHz (WLAN band) for the lower band. The upper band covers from 7.1 GHz to 8 GHz with a fractional bandwidth of 12%. A gain of 6.4 dBi is achieved at the lower frequency and 4 dBi is achieved at the upper frequency. The VSWR of the antenna is less than 2 at the resonance frequency. PMID:24895643

  3. {sup 13}C, {sup 15}N Resonance Assignment of Parts of the HET-s Prion Protein in its Amyloid Form

    Energy Technology Data Exchange (ETDEWEB)

    Siemer, Ansgar B. [Physical Chemistry (Switzerland); Ritter, Christiane [Salk Institute, Structural Biology Laboratory (United States); Steinmetz, Michel O. [Paul Scherrer Institut, Biomolecular Research, Structural Biology (Switzerland); Ernst, Matthias [Physical Chemistry (Switzerland); Riek, Roland [Salk Institute, Structural Biology Laboratory (United States); Meier, Beat H. [Physical Chemistry (Switzerland)

    2006-02-15

    The partial {sup 15}N and {sup 13}C solid-state NMR resonance assignment of the HET-s prion protein fragment 218-289 in its amyloid form is presented. It is based on experiments measured at MAS frequencies in the range of 20-40 kHz using exclusively adiabatic polarization-transfer schemes. The resonance assignment within each residue is based on two-dimensional {sup 13}C--{sup 13}C correlation spectra utilizing the DREAM mixing scheme. The sequential linking of the assigned residues used a set of two- and three-dimensional {sup 15}N--{sup 13}C correlation experiments. Almost all cross peaks visible in the spectra are assigned, but only resonances from 43 of the 78 amino-acid residues could be detected. The missing residues are thought to be highly disordered and/or highly dynamic giving rise to broad resonance lines that escaped detection in the experiments applied. The line widths of the observed resonances are narrow and comparable to line widths observed in micro-crystalline samples. The 43 assigned residues are located in two fragments of about 20 residues.

  4. Proportional Counter Calibration and Analysis for 12C + p Resonance Scattering

    Science.gov (United States)

    Nelson, Austin; Rogachev, Grigory; Uberseder, Ethan; Hooker, Josh; Koshchiy, Yevgen

    2014-09-01

    Light exotic nuclei provide a unique opportunity to test the predictions of modern ab initio theoretical calculations near the drip line. In ab initio approaches, nuclear structure is described starting from bare nucleon-nucleon and three-nucleon interactions. Calculations are very heavy and can only be performed for the lightest nuclei (A objective of this project was to test the performance and perform position calibration of this proportional counter array. The test was done using 12C beam. The excitation function for 12C + p elastic scattering was measured and calibration of the proportional counter was performed using known resonances in 13N. The method of calibration, including solid angle calculations, normalization corrections, and position calibration will be presented. Light exotic nuclei provide a unique opportunity to test the predictions of modern ab initio theoretical calculations near the drip line. In ab initio approaches, nuclear structure is described starting from bare nucleon-nucleon and three-nucleon interactions. Calculations are very heavy and can only be performed for the lightest nuclei (A objective of this project was to test the performance and perform position calibration of this proportional counter array. The test was done using 12C beam. The excitation function for 12C + p elastic scattering was measured and calibration of the proportional counter was performed using known resonances in 13N. The method of calibration, including solid angle calculations, normalization corrections, and position calibration will be presented. Funded by DOE and NSF-REU Program; Grant No. PHY-1263281.

  5. Multinuclear solid-state high-resolution and C-13 -{Al-27} double-resonance magic-angle spinning NMR studies on aluminum alkoxides

    NARCIS (Netherlands)

    Abraham, A.; Prins, R.; Bokhoven, J.A. van; Eck, E.R.H. van; Kentgens, A.P.M.

    2006-01-01

    A combination of Al-27 magic-angle spinning (MAS)/multiple quantum (MQ)-MAS, C-13-H-1 CPMAS, and C-13-{Al-27} transfer of population in double-resonance (TRAPDOR) nuclear magnetic resonance (NMR) were used for the structural elucidation of the aluminum alkoxides aluminum ethoxide, aluminum

  6. Magnetic resonance butterfly coils: Design and application for hyperpolarized 13C studies

    DEFF Research Database (Denmark)

    Giovannetti, Giulio; Frijia, Francesca; Attanasio, Simona

    2013-01-01

    Hyperpolarized 13C magnetic resonance spectroscopy in pig models enables cardiac metabolism assessment and provides a powerful tool for heart physiology studies, although the low molar concentration of derivate metabolites gives rise to technological limitations in terms of data quality. The desi...... throughout the volume of interest for cardiac imaging in pig. Experimental SNR-vs-depth profiles, extracted from the [1-13C]acetate phantom chemical shift image (CSI), permitted to highlight the performance of the proposed coils configuration. © 2013 Elsevier Ltd. All rights reserved....

  7. Observation of a $J^{PC} = 1^{-+}$ exotic resonance in diffractive dissociation of 190 GeV/c $\\pi^{-}$ into $\\pi^- \\pi^- \\pi^+$

    CERN Document Server

    Alekseev, M.; Alexandrov, Yu.; Alexeev, G.D.; Amoroso, A.; Austregisilio, A.; Badelek, B.; Balestra, F.; Ball, J.; Barth, J.; Baum, G.; Bedfer, Y.; Bernhard, J.; Bertini, R.; Bettinelli, M.; Birsa, R.; Bisplinghoff, J.; Bordalo, P.; Bradamante, F.; Bravar, A.; Bressan, A.; Brona, G.; Burtin, E.; Bussa, M.P.; Chapiro, A.; Chiosso, M.; Chung, S.U.; Cicuttin, A.; Colantoni, M.; Crespo, M.L.; Dalla Torre, S.; Dafni, T.; Das, S.; Dasgupta, S.S.; Denisov, O.Yu.; Dhara, L.; Diaz, V.; Dinkelbach, A.M.; Donskov, S.V.; Doshita, N.; Duic, V.; Dunnweber, W.; Efremov, A.; Eversheim, P.D.; Eyrich, W.; Faessler, M.; Ferrero, A.; Finger, M.; Finger, M., jr.; Fischer, H.; Franco, C.; Friedrich, J.M.; Garfagnini, R.; Gautheron, F.; Gavrichtchouk, O.P.; Gazda, R.; Gerassimov, S.; Geyer, R.; Giorgi, M.; Gobbo, B.; Goertz, S.; Grabmuller, S.; Grajek, O.A.; Grasso, A.; Grube, B.; Gushterski, R.; Guskov, A.; Haas, F.; von Harrach, D.; Hasegawa, T.; Heckmann, J.; Heinsius, F.H.; Hermann, R.; Herrmann, F.; Hess, C.; Hinterberger, F.; Horikawa, N.; Hoppner, Ch.; d'Hose, N.; Ilgner, C.; Ishimoto, S.; Ivanov, O.; Ivanshin, Yu.; Iwata, T.; Jahn, R.; Jasinski, P.; Jegou, G.; Joosten, R.; Kabuss, E.; Kang, D.; Ketzer, B.; Khaustov, G.V.; Khokhlov, Yu.A.; Kisselev, Yu.; Klein, F.; Klimaszewski, K.; Koblitz, S.; Koivuniemi, J.H.; Kolosov, V.N.; Komissarov, E.V.; Kondo, K.; Konigsmann, Kay; Konopka, R.; Konorov, I.; Konstantinov, V.F.; Korzenev, A.; Kotzinian, A.M.; Kouznetsov, O.; Kowalik, K.; Kramer, M.; Kral, A.; Kroumchtein, Z.V.; Kuhn, R.; Kunne, F.; Kurek, K.; Lauser, L.; Le Goff, J.M.; Lednev, A.A.; Lehmann, A.; Levorato, S.; Lichtenstadt, J.; Liska, T.; Maggiora, A.; Maggiora, M.; Magnon, A.; Mallot, G.K.; Mann, A.; Marchand, C.; Marroncle, J.; Martin, A.; Marzec, J.; Massmann, F.; Matsuda, T.; Meyer, W.; Michigami, T.; Mikhailov, Yu.V.; Moinester, M.A.; Mutter, A.; Nagaytsev, A.; Nagel, T.; Nassalski, J.; Negrini, S.; Nerling, F.; Neubert, S.; Neyret, D.; Nikolaenko, V.I.; Olshevsky, A.G.; Ostrick, M.; Padee, A.; Panknin, R.; Panzieri, D.; Parsamyan, B.; Paul, S.; Pawlukiewicz-Kaminska, B.; Perevalova, E.; Pesaro, G.; Peshekhonov, D.V.; Piragino, G.; Platchkov, S.; Pochodzalla, J.; Polak, J.; Polyakov, V.A.; Pontecorvo, G.; Pretz, J.; Quintans, C.; Rajotte, J.-F.; Ramos, S.; Rapatsky, V.; Reicherz, G.; Reggiani, D.; Richter, A.; Robinet, F.; Rocco, E.; Rondio, E.; Ryabchikov, D.I.; Samoylenko, V.D.; Sandacz, A.; Santos, H.; Sapozhnikov, M.G.; Sarkar, S.; Savin, Igor A.; Sbrizza, G.; Schiavon, P.; Schill, C.; Schlüter, Tobias; Schmitt, L.; Schopferer, S.; Schroder, W.; Shevchenko, O.Yu.; Siebert, H.-W.; Silva, L.; Sinha, L.; Sissakian, A.N.; Slunecka, M.; Smirnov, G.I.; Sosio, S.; Sozzi, F.; Srnka, A.; Stolarski, M.; Sulc, M.; Sulej, R.; Takekawa, S.; Tessaro, S.; Tessarotto, F.; Teufel, A.; Tkatchev, L.G.; Uman, I.; Venugopal, G.; Virius, M.; Vlassov, N.V.; Vossen, A.; Weitzel, Q.; Windmolders, R.; Wislicki, W.; Wollny, H.; Zaremba, K.; Zavertyaev, M.; Zemlyanichkina, E.; Ziembicki, M.; Zhao, J.; Zhuravlev, N.; Zvyagin, A.

    2010-01-01

    The COMPASS experiment at the CERN SPS has studied the diffractive dissociation of negative pions into the pi- pi- pi+ final state using a 190 GeV/c pion beam hitting a lead target. A partial wave analysis has been performed on a sample of 420000 events taken at values of the squared 4-momentum transfer t' between 0.1 and 1 GeV^2/c^2. The well-known resonances a1(1260), a2(1320), and pi2(1670) are clearly observed. In addition, the data show a significant natural parity exchange production of a resonance with spin-exotic quantum numbers J^PC = 1-+ at 1.66 GeV/c^2 decaying to rho pi. The resonant nature of this wave is evident from the mass-dependent phase differences to the J^PC = 2-+ and 1++ waves. From a mass-dependent fit a resonance mass of 1660 +- 10+0-64 MeV/c^2 and a width of 269+-21+42-64 MeV/c^2 is deduced.

  8. Substitution effect in nuclear magnetic resonance of C-13: α methoxicyclohexanones

    International Nuclear Information System (INIS)

    Lopez Holland, M.A.G.

    1984-01-01

    Eletronic and steric interactions between the carbonyl and methoxyl groups in α-methoxicyclohexanones by H-1 and C-13 nuclear magnetic resonance spectroscopy (n.m.r) is studied. Interpretation of H-1 n.m.r measurements based on the carbonyl group anisotropy is made. The asigment of spectral lines to specific nuclear by Lanthanide Shift Reagent Experiments is confirmed. Interpretation of C-13 n.m.r. spectra with respect to molecular effects and emphirical relationships associated with the substituent was analysed. The C-13 chemical shift asignment by comparison with results of partially (SFORD) and fully decompled spectra and also by relating the measured chemical shift with values cited in the literature for similar compounds are made. A qualitative study using I.R. spectroscopy in attempt to evaluate the predominance of one the conformers of the studied compounds in solutions of n-hexan and chloroform is made. (M.J.C.) [pt

  9. Identifying inter-residue resonances in crowded 2D {sup 13}C-{sup 13}C chemical shift correlation spectra of membrane proteins by solid-state MAS NMR difference spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Miao Yimin; Cross, Timothy A. [Florida State University, Department of Chemistry and Biochemistry (United States); Fu Riqiang, E-mail: rfu@magnet.fsu.edu [National High Magnet Field Lab (United States)

    2013-07-15

    The feasibility of using difference spectroscopy, i.e. subtraction of two correlation spectra at different mixing times, for substantially enhanced resolution in crowded two-dimensional {sup 13}C-{sup 13}C chemical shift correlation spectra is presented. With the analyses of {sup 13}C-{sup 13}C spin diffusion in simple spin systems, difference spectroscopy is proposed to partially separate the spin diffusion resonances of relatively short intra-residue distances from the longer inter-residue distances, leading to a better identification of the inter-residue resonances. Here solid-state magic-angle-spinning NMR spectra of the full length M2 protein embedded in synthetic lipid bilayers have been used to illustrate the resolution enhancement in the difference spectra. The integral membrane M2 protein of Influenza A virus assembles as a tetrameric bundle to form a proton-conducting channel that is activated by low pH and is essential for the viral lifecycle. Based on known amino acid resonance assignments from amino acid specific labeled samples of truncated M2 sequences or from time-consuming 3D experiments of uniformly labeled samples, some inter-residue resonances of the full length M2 protein can be identified in the difference spectra of uniformly {sup 13}C labeled protein that are consistent with the high resolution structure of the M2 (22-62) protein (Sharma et al., Science 330(6003):509-512, 2010)

  10. Light isovector resonances in $\\pi^- p \\to \\pi^-\\pi^-\\pi^+ p$ at 190 GeV/${\\it c}$

    CERN Document Server

    Akhunzyanov, R.; The COMPASS collaboration; Alexeev, G.D.; Amoroso, A.; Andrieux, V.; Anfimov, N.V.; Anosov, V.; Antoshkin, A.; Augsten, K.; Augustyniak, W.; Austregesilo, A.; Azevedo, C.D.R.; Badełek, B.; Balestra, F.; Ball, M.; Barth, J.; Beck, R.; Bedfer, Y.; Bernhard, J.; Bicker, K.; Bielert, E.R.; Birsa, R.; Bodlak, M.; Bordalo, P.; Bradamante, F.; Bressan, A.; Büchele, M.; Burtsev, V.E.; Chang, W.-C.; Chatterjee, C.; Chiosso, M.; Chumakov, A.G.; Chung, S.-U.; Cicuttin, A.; Crespo, M.L.; Dalla Torre, S.; Dasgupta, S.S.; Dasgupta, S.; Denisov, O.Yu.; Dhara, L.; Donskov, S.V.; Doshita, N.; Dreisbach, Ch.; Dünnweber, W.; Dusaev, R.R.; Dziewiecki, M.; Efremov, A.; Eversheim, P.D.; Faessler, M.; Ferrero, A.; Finger, M.; Finger, M., jr.; Fischer, H.; Franco, C.; du Fresne von Hohenesche, N.; Friedrich, J.M.; Frolov, V.; Gautheron, F.; Gavrichtchouk, O.P.; Gerassimov, S.; Giarra, J.; Gnesi, I.; Gorzellik, M.; Grasso, A.; Gridin, A.; Grosse Perdekamp, M.; Grube, B.; Guskov, A.; Hahne, D.; Hamar, G.; von Harrach, D.; Heitz, R.; Herrmann, F.; Horikawa, N.; d'Hose, N.; Hsieh, C.-Y.; Huber, S.; Ishimoto, S.; Ivanov, A.; Ivanshin, Yu.; Iwata, T.; Jary, V.; Joosten, R.; Jörg, P.; Kabuß, E.; Kerbizi, A.; Ketzer, B.; Khaustov, G.V.; Khokhlov, Yu.A.; Kisselev, Yu.; Klein, F.; Koivuniemi, J.H.; Kolosov, V.N.; Kondo, K.; Konorov, I.; Konstantinov, V.F.; Kotzinian, A.M.; Kouznetsov, O.M.; Kral, Z.; Krämer, M.; Krinner, F.; Kroumchtein, Z.V.; Kulinich, Y.; Kunne, F.; Kurek, K.; Kurjata, R.P.; Kuznetsov, I.I.; Kveton, A.; Lednev, A.A.; Levchenko, E.A.; Levorato, S.; Lian, Y.-S.; Lichtenstadt, J.; Longo, R.; Lyubovitskij, V.E.; Maggiora, A.; Magnon, A.; Makins, N.; Makke, N.; Mallot, G.K.; Mamon, S.A.; Marianski, B.; Martin, A.; Marzec, J.; Matoušek, J.; Matsuda, H.; Matsuda, T.; Meshcheryakov, G.V.; Meyer, M.; Meyer, W.; Mikhailov, Yu.V.; Mikhasenko, M.; Mitrofanov, E.; Mitrofanov, N.; Miyachi, Y.; Moretti, A.; Nagaytsev, A.; Nerling, F.; Neyret, D.; Nový, J.; Nowak, W.-D.; Nukazuka, G.; Nunes, A.S.; Olshevsky, A.G.; Orlov, I.; Ostrick, M.; Panzieri, D.; Parsamyan, B.; Paul, S.; Peng, J.-C.; Pereira, F.; Pešek, M.; Pešková, M.; Peshekhonov, D.V.; Pierre, N.; Platchkov, S.; Pochodzalla, J.; Polyakov, V.A.; Pretz, J.; Quaresma, M.; Quintans, C.; Ramos, S.; Regali, C.; Reicherz, G.; Riedl, C.; Ryabchikov, D.I.; Rybnikov, A.; Rychter, A.; Salac, R.; Samoylenko, V.D.; Sandacz, A.; Sarkar, S.; Savin, I.A.; Sawada, T.; Sbrizzai, G.; Schmieden, H.; Seder, E.; Selyunin, A.; Silva, L.; Sinha, L.; Sirtl, S.; Slunecka, M.; Smolik, J.; Srnka, A.; Steffen, D.; Stolarski, M.; Subrt, O.; Sulc, M.; Suzuki, H.; Szabelski, A.; Szameitat, T.; Sznajder, P.; Tasevsky, M.; Tessaro, S.; Tessarotto, F.; Thiel, A.; Tomsa, J.; Tosello, F.; Tskhay, V.; Uhl, S.; Vasilishin, B.I.; Vauth, A.; Veit, B.M.; Veloso, J.; Vidon, A.; Virius, M.; Wallner, S.; Wilfert, M.; Zaremba, K.; Zavada, P.; Zavertyaev, M.; Zemlyanichkina, E.; Zhuravlev, N.; Ziembicki, M.

    2018-01-01

    We have performed the most comprehensive resonance-model fit of $ \\pi^-\\pi^-\\pi^+$ states using the results of our previously published partial-wave analysis (PWA) of a large data set of diffractive-dissociation events from the reaction $\\pi^- +p \\to \\pi^-\\pi^-\\pi^+ +p_{recoil}$ with a 190 GeV/${\\it c}$ pion beam. The PWA results, which were obtained in 100~bins of three-pion mass, 0.5 < ~$m_{3\\pi}$ < 2.5 GeV/${\\it c}$$^2$, and simultaneously in 11~bins of the reduced four-momentum transfer squared, 0.1 < $t'$ < 1.0 (GeV/${\\it c}$)$^2$, are subjected to a resonance-model fit using Breit-Wigner amplitudes to simultaneously describe a subset of 14~selected waves using 11~isovector light-meson states with $J^{PC} = 0^{-+}$, $1^{++}$, $2^{++}$, $2^{-+}$, $4^{++}$, and spin-exotic $1^{-+}$ quantum numbers. The model contains the well-known resonances $\\pi$(1800), $a_1$(1260), $a_2$(1320), $\\pi_2$(1670), $\\pi_2$(1880), and $a_4$(2040). In addition, it includes the dispute...

  11. 16O resonances near 4α threshold through 12C (6Li,d ) reaction

    Science.gov (United States)

    Rodrigues, M. R. D.; Borello-Lewin, T.; Miyake, H.; Horodynski-Matsushigue, L. B.; Duarte, J. L. M.; Rodrigues, C. L.; de Faria, P. Neto; Cunsolo, A.; Cappuzzello, F.; Foti, A.; Agodi, C.; Cavallaro, M.; di Napoli, M.; Ukita, G. M.

    2014-11-01

    Several narrow alpha resonant 16O states were detected through the 12C (6Li,d ) reaction, in the range of 13.5 to 17.5 MeV of excitation energy. The reaction was measured at a bombarding energy of 25.5 MeV employing the São Paulo Pelletron-Enge-Spectrograph facility and the nuclear emulsion technique. Experimental angular distributions associated with natural parity quasi-bound states around the 4α threshold are presented and compared to DWBA predictions. The upper limit for the resonance widths obtained is near the energy resolution (15 keV).

  12. 16O resonances near 4α threshold through 12C(6Li,d) reaction

    International Nuclear Information System (INIS)

    Rodrigues, M. R. D.; Borello-Lewin, T.; Miyake, H.; Horodynski-Matsushigue, L. B.; Duarte, J. L. M.; Rodrigues, C. L.; Faria, P. Neto de; Cunsolo, A.; Cappuzzello, F.; Foti, A.; Agodi, C.; Cavallaro, M.; Napoli, M. di; Ukita, G. M.

    2014-01-01

    Several narrow alpha resonant 16 O states were detected through the 12 C( 6 Li,d) reaction, in the range of 13.5 to 17.5 MeV of excitation energy. The reaction was measured at a bombarding energy of 25.5 MeV employing the São Paulo Pelletron-Enge-Spectrograph facility and the nuclear emulsion technique. Experimental angular distributions associated with natural parity quasi-bound states around the 4α threshold are presented and compared to DWBA predictions. The upper limit for the resonance widths obtained is near the energy resolution (15 keV)

  13. Measurement of resonances in 12 C + 4 He through inverse kinematics with thick targets

    International Nuclear Information System (INIS)

    Aguilera, E.F.; Lizcano, D.; Martinez Q, E.; Fernandez, M.C.; Murillo, G.; Goldberg, V.; Skorodumov, B.B.; Rogachev, G.

    2003-01-01

    The excitation function of elastic scattering for the system 12 C + 4 He to energy from 0.5 to 3.5 MeV in the center of mass system (c.m.) was measured. We use a gassy thick target and the technique of inverse kinematics which allows to make measurements at 180 degrees in c.m. Using the R matrix theory those was deduced parameters of the resonances and the results were compared with measurements reported in the literature made with other techniques. (Author)

  14. 13C nuclear magnetic resonance study of the complexation of calcium by taurine

    International Nuclear Information System (INIS)

    Irving, C.S.; Hammer, B.E.; Danyluk, S.S.; Klein, P.D.

    1980-01-01

    13 C Nuclear magnetic resonance chemical shifts, 1 J/sub c-c/ scalar coupling constants, spin-lattice relaxation times, and nuclear Overhauser effects were determined for taurine-[1, 2 13 C] and a taurine-[1 13 C] and taurine-[2 13 C] mixture in the presence and absence of calcium. Comparison of taurine titration shifts to values for related compounds reveals some unusual electronic properties of the taurine molecule. Stability constants of 1:1 calcium complexes with taurine zwitterions and anions, as well as their 13 C chemical shifts, were obtained by least squares analysis of titration curves measured in the presence of calcium. The stability constants of calcium-taurine complexes were significantly lower than previous values and led to estimates that only approximately one percent of intracellular calcium of mammalian myocardial cells would exist in a taurine complex

  15. Metabolic profiling of heat or anoxic stress in mouse C2C12 myotubes using multinuclear magnetic resonance spectroscopy

    DEFF Research Database (Denmark)

    Straadt, Ida K; Young, Jette F; Petersen, Bent O

    2010-01-01

    to anaerobic metabolism due to inhibition of the aerobic pathway in the mitochondria. Conversely, lower levels of unlabeled ((12)C) lactate were apparent at increasing severity of stress, which indicate that lactate is released from the myotubes to the medium. In conclusion, the metabolites identified......In the present study, the metabolic effects of heat and anoxic stress in myotubes from the mouse cell line C2C12 were investigated by using a combination of (13)C, (1)H, and (31)P nuclear magnetic resonance (NMR) spectroscopy and enrichment with [(13)C]-glucose. Both the (13)C and the (1)H NMR...... spectra showed reduced levels of the amino acids alanine, glutamate, and aspartate after heat or anoxic stress. The decreases were smallest at 42 degrees C, larger at 45 degrees C, and most pronounced after anoxic conditions. In addition, in both the (1)H and the (31)P NMR spectra, decreases in the high...

  16. Resonance scattering of 12C nuclei on protons in the Maya active target

    CERN Document Server

    Khodery, Mohammad

    This work is related to the realm of exotic nuclei. These are nuclei that exist far from the valley of stability. Study of these nuclei introduced many interesting phenomena and changed our understanding about the nuclear structure. As exotic nuclei are very short lived, their study has to be at the time of their production using radioactive beams of the exotic nuclei. The goal of the experiment was to study the $^{13}$Be low-lying energy levels. The experiment was performed at ISOLDE at CERN as $^{12}$Be beams are produced at this facility with suitable intensity and energy. The method used to study $^{13}$Be was elastic resonance reactions. This is a powerful tool to study unbound states. This thesis concentrates on the $^{12}$C nuclei that are present in the beam as isobaric contamination. $^{12}$C in the beam is scattered on the protons which is the target. The protons are introduced in the form of isobutene gas. The aim of this work is to prove the principle of the technique of elastic resonance scatteri...

  17. Charmonium resonances in the 3.9 GeV/c2 energy region and the X(3915)/X(3930) puzzle

    Science.gov (United States)

    Ortega, Pablo G.; Segovia, Jorge; Entem, David R.; Fernández, Francisco

    2018-03-01

    An interesting controversy has emerged challenging the widely accepted nature of the X (3915) and the X (3930) resonances, which had initially been assigned to the χc0 (2 P) and χc2 (2 P) c c bar states, respectively. To unveil their inner structure, the properties of the JPC =0++ and JPC =2++ charmonium states in the energy region of these resonances are analyzed in the framework of a constituent quark model. Together with the bare q q bar states, threshold effects due to the opening of nearby meson-meson channels are included in a coupled-channels scheme calculation. We find that the structure of both states is dominantly molecular with a probability of bare q q bar states lower than 45%. Our results favor the hypothesis that X (3915) and X (3930) resonances arise as different decay mechanisms of the same JPC =2++ state. Moreover we find an explanation for the recently discovered M = 3860MeV /c2 as a JPC =0++ 2P state and rediscover the lost Y (3940) as an additional state in the JPC =0++ family.

  18. Study of the decay $B^0 \\to \\chi_{c1} K^+ \\pi^-$ and search of exotic resonances at LHCb

    CERN Document Server

    Sbordone, Francesco; Alves Junior, Antonio Augusto

    In 2008 the Belle Collaboration reported the observation of two charged resonance-like structures in the ${\\chi_c}_1 \\pi^-$ mass spectrum produced in the decay $B^0 \\to {\\chi_c}_1 K^+ \\pi^-$. These were labelled as $Z_1(4050)^-$ and $Z_2(4250)^-$. Alternatively, a single wider resonance hypothesis was also pursued by Belle, and labelled as $Z(4150)^-$. The fact that these are charged states would be a clear sample, if they really exist, of four quark bound systems; for this reason this observation has given rise to a great deal of interest. In 2012 the BABAR Collaboration has searched for these resonances in the channels $B^{0,+} \\to {\\chi_c}_1 K^{+,0} \\pi^-$ and did not find any evidence of them. In this thesis a search for these claimed exotic charmonium-like states $Z_1(4050)^-$ and $Z_2(4250)^-$ is presented, in the decay $B^0 \\to {\\chi_c}_1 K^+ \\pi^-$, where ${\\chi_c}_1 \\to J/\\psi \\gamma$ and $J/\\psi \\to \\mu^+ \\mu^-$. Charged conjugate are implied throughout the whole thesis. The analysis is performed us...

  19. 16O resonances near the 4α threshold through the 12C(6Li,d) reaction

    Science.gov (United States)

    Rodrigues, M. R. D.; Borello-Lewin, T.; Miyake, H.; Duarte, J. L. M.; Rodrigues, C. L.; Souza, M. A.; Horodynski-Matsushigue, L. B.; Ukita, G. M.; Cappuzzello, F.; Cunsolo, A.; Cavallaro, M.; Agodi, C.; Foti, A.

    2014-02-01

    Background: Resonances around xα thresholds in light nuclei are recognized to be important in basic aspects of nuclear structure. However, there is scarce experimental information associated with them. Purpose: We study the α-clustering phenomenon in resonant states around the 4α threshold (14.44 MeV) in the 16O nucleus. Method: The 12C(6Li,d )16O reaction was investigated with an unprecedented resolution at a bombarding energy of 25.5 MeV by employing the São Paulo Pelletron-Enge-Spectrograph facility and the nuclear emulsion technique. Results: Several narrow resonances were populated and the energy resolution of 15 keV allows for the separation of doublet states that were not resolved previously. The upper limits for the resonance widths in this region were extracted. The angular distributions of the absolute differential cross section associated with four natural parity quasibound states are presented and compared to distorted wave Born approximation predictions. Conclusions: Narrow resonances not previously reported in the literature were observed. This indicates that the α-cluster structure information in this region should be revised.

  20. Nuclear magnetic resonance study of interaction of ligands with Streptococcus faecium dihydrofolate reductase labeled with [#betta#-13C]tryptophan

    International Nuclear Information System (INIS)

    London, R.E.; Groff, J.P.; Cocco, L.; Blakley, R.L.

    1982-01-01

    Dihydrofolate reductase from Streptococcus faecium has been labeled with [#betta#- 13 C]tryptophan. We have determined changes occurring in the chemical shifts and line widths of the four resonances of the 13 C NMR spectrum of the labeled enzyme, due to its interaction with various ligands. These include the coenzyme, NPDPH and related nucleotides, folate and its polyglutamate derivatives, and many inhibitors including methotrexate and trimethoprim. In addition, paramagnetic relaxation effects produced by a bound spin-labeled analogue of 2'-phosphoadenosine-5'-diphosphoribose on the tryptophan C/sup #betta#/ carbons have been measured. Distances calculated from the relaxation data have been compared with corresponding distances in the crystallographic model of the NADPH-methotrexate ternary complex of Lactobacillus casei reductase. The paramagnetic relaxation data indicate that the two downfield resonances (1 and 2) correspond to tryptophans (W/sub A/ and W/sub B/) that are more remote from the catalytic site, and from the crystallographic model these are seen to be Trp-115 and Trp-160. The upfield resonances (3 and 4) that show broadening due to chemical exchange correspond to closer residues (W/sub C/ and W/sub D/), and these are identified with Trp-6 and Trp-22. However, the relaxation data do not permit specific assignments within the nearer and farther pairs. Although resonance 3, which is split due to chemical exchange, was formerly assigned to Trp-6, data obtained for the enzyme in the presence of various ligands are better interpreted if resonance 3 is assigned to Trp-22, which is located on a loop that joins elements of secondary structure and forms one side of the ligand-binding cavity

  1. Properties of K,Rb-intercalated C60 encapsulated inside carbon nanotubes called peapods derived from nuclear magnetic resonance

    KAUST Repository

    Mahfouz, Remi; Bouhrara, M.; Kim, Y.; Wå gberg, T.; Goze-Bac, C.; Abou-Hamad, Edy

    2015-01-01

    We present a detailed experimental study on how magnetic and electronic properties of Rb,K-intercalated C60 encapsulated inside carbon nanotubes called peapods can be derived from 13C nuclear magnetic resonance investigations. Ring currents do play

  2. Computing resonant frequency of C-shaped compact microstrip antennas by using ANFIS

    Science.gov (United States)

    Akdagli, Ali; Kayabasi, Ahmet; Develi, Ibrahim

    2015-03-01

    In this work, the resonant frequency of C-shaped compact microstrip antennas (CCMAs) operating at UHF band is computed by using the adaptive neuro-fuzzy inference system (ANFIS). For this purpose, 144 CCMAs with various relative dielectric constants and different physical dimensions were simulated by the XFDTD software package based on the finite-difference time domain (FDTD) method. One hundred and twenty-nine CCMAs were employed for training, while the remaining 15 CCMAs were used for testing of the ANFIS model. Average percentage error (APE) values were obtained as 0.8413% and 1.259% for training and testing, respectively. In order to demonstrate its validity and accuracy, the proposed ANFIS model was also tested over the simulation data given in the literature, and APE was obtained as 0.916%. These results show that ANFIS can be successfully used to compute the resonant frequency of CCMAs.

  3. A polymer-based magnetic resonance tracer for visualization of solid tumors by 13C spectroscopic imaging.

    Directory of Open Access Journals (Sweden)

    Yoshikazu Suzuki

    Full Text Available Morphological imaging precedes lesion-specific visualization in magnetic resonance imaging (MRI because of the superior ability of this technique to depict tissue morphology with excellent spatial and temporal resolutions. To achieve lesion-specific visualization of tumors by MRI, we investigated the availability of a novel polymer-based tracer. Although the 13C nucleus is a candidate for a detection nucleus because of its low background signal in the body, the low magnetic resonance sensitivity of the nucleus needs to be resolved before developing a 13C-based tracer. In order to overcome this problem, we enriched polyethylene glycol (PEG, a biocompatible polymer, with 13C atoms. 13C-PEG40,000 (13C-PEG with an average molecular weight of 40 kDa emitted a single 13C signal with a high signal-to-noise ratio due to its ability to maintain signal sharpness, as was confirmed by in vivo investigation, and displayed a chemical shift sufficiently distinct from that of endogenous fat. 13C-PEG40,000 intravenously injected into mice showed long retention in circulation, leading to its effective accumulation in tumors reflecting the well-known phenomenon that macromolecules accumulate in tumors because of leaky tumor capillaries. These properties of 13C-PEG40,000 allowed visualization of tumors in mice by 13C spectroscopic imaging. These findings suggest that a technique based on 13C-PEG is a promising strategy for tumor detection.

  4. The discovery of resonances in multibaryon systems. Pt. 3. Λ p-resonances

    International Nuclear Information System (INIS)

    Shahbazian, B.A.; Temnikov, P.P.; Timonina, A.A.; Rozhdestvenskij, A.M.

    1978-01-01

    Dibaryon Λ p resonance of 2256 MeV/c 2 mass, GITA 2 (depending on the spin Jsub(Λp)) width, and Jsup(p) > O + spin-parity assignments is discovered. The statistical significance of the corresponding peak in Λ p effective mass spectra is defined by more than five standard deviations. Its production effective cross section in n 12 C collisions at =7.0 GeV/c is estimated to be sigmasub(pr) (2256)=(85.3+-20.0)μb, whereas the formation effective cross section in Λ p → Λ p interactions is sigmasub(f) (2256) = 5.3(2Jsub(Λp)+1) mb. The Λp effective mass spectra which have been investigated in this experiment reveal, apart the well known approximately(Msub(Λ+Msub(p)) MeV/c 2 and 2128 MeV/c 2 peaks, enhancements including 2256 MeV/c 2 peak near the most of the resonance mass values predicted by MIT Bag Model. Possible mechanisms of multibaryon resonance formation are discussed. According to the hypercharge selection rule Y <= 1 multibaryon resonances are shown to be ultra-high density superstrange objects

  5. Electrochemistry and electron paramagnetic resonance spectroscopy of cytochrome c and its heme-disrupted analogs.

    Science.gov (United States)

    Novak, David; Mojovic, Milos; Pavicevic, Aleksandra; Zatloukalova, Martina; Hernychova, Lenka; Bartosik, Martin; Vacek, Jan

    2018-02-01

    Cytochrome c (cyt c) is one of the most studied conjugated proteins due to its electron-transfer properties and ability to regulate the processes involved in homeostasis or apoptosis. Here we report an electrochemical strategy for investigating the electroactivity of cyt c and its analogs with a disrupted heme moiety, i.e. apocytochrome c (acyt c) and porphyrin cytochrome c (pcyt c). The electrochemical data are supplemented with low-temperature and spin-probe electron paramagnetic resonance (EPR) spectroscopy. The main contribution of this report is a complex evaluation of cyt c reduction and oxidation at the level of surface-localized amino acid residues and the heme moiety in a single electrochemical scan. The electrochemical pattern of cyt c is substantially different to both analogs acyt c and pcyt c, which could be applicable in further studies on the redox properties and structural stability of cytochromes and other hemeproteins. Copyright © 2017 Elsevier B.V. All rights reserved.

  6. Electrical Characterization of Microelectromechanical Silicon Carbide Resonators

    Directory of Open Access Journals (Sweden)

    Christian Zorman

    2008-09-01

    Full Text Available This manuscript describes the findings of a study to investigate the performance of SiC MEMS resonators with respect to resonant frequency and quality factor under a variety of testing conditions, including various ambient pressures, AC drive voltages, bias potentials and temperatures. The sample set included both single-crystal and polycrystalline 3C-SiC lateral resonators. The experimental results show that operation at reduced pressures increases the resonant frequency as damping due to the gas-rarefaction effect becomes significant. Both DC bias and AC drive voltages result in nonlinearities, but the AC drive voltage is more sensitive to noise. The AC voltage has a voltage coefficient of 1~4ppm/V at a DC bias of 40V. The coefficient of DC bias is about -11ppm/V to - 21ppm/V for poly-SiC, which is more than a factor of two better than a similarly designed polysilicon resonator (-54 ppm/V. The effective stiffness of the resonator decreases (softens as the bias potential is increased, but increases (hardens as drive voltage increase when scan is from low to high frequency. The resonant frequency decreases slightly with increasing temperature, exhibiting a temperature coefficient of -22 ppm/oC, between 22oC and 60oC. The thermal expansion mismatch between the SiC device and the Si substrate could be a reason that thermal coefficient for these SiC resonators is about twofold higher than similar polysilicon resonators. However, the Qs appear to exhibit no temperature dependence in this range.

  7. The C-N-cycle additional channels through the combinative resonances phenomenon (CIRs)

    International Nuclear Information System (INIS)

    Gafarov, A.A.; Khugaev, A.V.; Koblik, Yu.N.

    2000-01-01

    The Combinative Isobar Resonances are shown as new channels of the C-N-cycle. In 1994 we had firstly used our new developed approach - the M ethod of Spectra Superposition p roviding measurement of d σ (E) /d ω at every accelerator (including colliders ) with highest energy-resolution depending (for thin targets) only on energy-resolution of detectors [1-5]. Rarely one can read about this[6].That time the Excitation Function (EF) of the l2 C(p,p o ) elastic scattering with energy-resolution ∼10 keV for E p =16 ∼ 19.5 MeV of cyclotron protons by using the multi angular magnetic spectrograph as detector was measured.It was wonderful when after data processing so surprised curve with a saturated structure of overlapped resonances - fluctuations of cross-section (Fig.1) was obtained (in contrary to EF obtained by M.J. LeVine and P.D.Parker in 60 Th at the tandem generator [7]). The precise agreement between well known thresholds and nuclear levels with the brightest anomalies in our curve and not disappearing fine structures in full-events curve (stat.err. 3%) - all this, only, had satisfied me that these structures are not just a joke of statistics. Fig.l shows a comparison of our obtained EF with thresholds and levels of well known product-nuclei

  8. Measuring glucose cerebral metabolism in the healthy mouse using hyperpolarized C-13 magnetic resonance

    DEFF Research Database (Denmark)

    Mishkovsky, Mor; Anderson, Brian; Karlsson, Magnus

    2017-01-01

    The mammalian brain relies primarily on glucose as a fuel to meet its high metabolic demand. Among the various techniques used to study cerebral metabolism, C-13 magnetic resonance spectroscopy (MRS) allows following the fate of C-13-enriched substrates through metabolic pathways. We herein...... glucose is split into 3-carbon intermediates by aldolase. This unique method allows direct detection of glycolysis in vivo in the healthy brain in a noninvasive manner....... demonstrate that it is possible to measure cerebral glucose metabolism in vivo with sub-second time resolution using hyperpolarized C-13 MRS. In particular, the dynamic C-13-labeling of pyruvate and lactate formed from C-13-glucose was observed in real time. An ad-hoc synthesis to produce [2,3,4,6,6-H-2(5), 3...

  9. Revised rates for the stellar triple-α process from measurement of ¹²C nuclear resonances

    CERN Multimedia

    2005-01-01

    In the centres of stars where the temperature is high enough, three α-particles (helium nuclei) are able to combine to form ¹²C because of a resonant reaction leading to a nuclear excited state (2 pages)

  10. Multiquark resonant states

    International Nuclear Information System (INIS)

    Shahbazian, B.A.

    1982-01-01

    The invariant mass spectra of forty nine hadronic systems with hypercharge, strangeness and baryon number, varied in wide limits have been studied. Resonance peaks have been found in the invariant mass spectra of Y 2 and #betta#pπ 2495 MeV/c 2 resonant states. Three more candidates for anti qq 4 states were found #bettaπ# + π + : 1705, 2072, 2605 MeV/c 2 . The masses of all these candidates are in good agreement with Bag Model predictions. A hypercharge selection rule is suggested: ''The hypercharge of hadronic resonances in weak gravitational fields cannot exceed one Y <= 1

  11. 21 CFR 520.2260c - Sulfamethazine sustained-release tablets.

    Science.gov (United States)

    2010-04-01

    ... response within 2 to 3 days, reevaluate therapy. Do not crush tablets. Treated animals must not be... SERVICES (CONTINUED) ANIMAL DRUGS, FEEDS, AND RELATED PRODUCTS ORAL DOSAGE FORM NEW ANIMAL DRUGS § 520...

  12. Noninvasive brain metabolism measurement using carbon-13 magnetic resonance spectroscopy ({sup 13}C-MRS); Tanso 13 jiki kyomei spectroscopy ({sup 13}C-MRS) ni yoru mushinshuteki notaisha keisoku

    Energy Technology Data Exchange (ETDEWEB)

    Okamoto, K.; Tsukada, Y. [Toshiba Corp., Tokyo (Japan)

    1998-10-10

    Carbon-13 magnetic resonance spectroscopy ({sup 13}C-MRS) and research and development efforts for brain metabolism measurement are described. Brain metabolism is a process characterized in that it not only extracts energy by disintegrating grape sugar that is the practically sole source of energy into H2O, CO2, etc., but also vigorously synthesizes amino acids that perform important functions in neural transmission, such as glutamic acid, glutamine, and {gamma}-amino acid. MRS is a technique that utilizes the magnetic resonance, which is generated when an atomic nucleus with a spin is placed in a magnetic field, for the isolation and identification of chemicals in a living body through examining the delicate difference in the magnetic resonance frequencies of the nuclei under observation. Since the signals from {sup 13}C are low in intensity as compared with those from other nuclides, a method was contrived around 1980, which observes {sup 1}H combined with {sup 13}C in grape sugar and amino acids, named the HSQC (heteronuclear single quantum coherence) method. The author et al., combining gradient magnetic pulses with HSQC, actually measure Homo sapiens brain metabolism using {sup 13}C-MRS, and now believe that the technology will be put to practical application. 7 refs., 10 figs., 1 tab.

  13. Prevalence of C. botulinum and C. perfringens spores in food products available on Polish market

    Directory of Open Access Journals (Sweden)

    Grenda Tomasz

    2017-09-01

    Full Text Available Introduction: The aim of this study was to evaluate the prevalence of Clostridium botulinum and Clostridium perfringens in food samples purchased from Polish producers. Material and Methods: The analyses were performed on 260 food samples collected in Lublin and Subcarpathian regions: 56 of smoked meat, 21 of pork meat, 20 of dairy products, 26 of vegetable and fruit preserves, 40 of ready-to-eat meals, 27 of fish preserves, and 70 of honey collected directly from apiaries. Results: C. botulinum strains were isolated from 2.3% (6/260 of samples and the isolates were classified as toxin types A (4/260 and B (2/260. C. perfringens strains were isolated from 14% (37/260 of samples. All the isolates were classified as toxin type A, 28 of them were able also to produce α toxin and 9 - β2 toxin. Conclusion: On the basis of the obtained results it could be suggested that risk assessment, especially regarding the entire honey harvesting process, should be provided in order to ensure the microbiological safety of the products to be consumed by infants and people with a weakened immune system.

  14. Multipole giant resonances of 12C nucleus electro excitation in intermediate coupling model

    International Nuclear Information System (INIS)

    Goncharova, N.G.; Zhivopistsev, F.A.

    1977-01-01

    Multipole giant resonances in 12 C electroexcitation are considered using the shell model with coupling. Cross sections are calculated for the states of 1 - , 2 - , 3 - , 4 - , at T=1. The distributions of the transverse form factor at transferred momenta equal to q approximately 0.75, 1.04, 1.22 and 1.56 Fm -1 and the longitudinal form factor for q = 0.75, 1.04, 1.56 Fm -1 are presented. For the excitation energies in the range from 18 to 28 MeV positive-parity states have a small contribution in the cross section. The distribution of the total form factor in the excitation energies is given. It is concluded that the multipole giant resonances of anomalous parity levels calculated within the interatomic-coupling shell model show a satisfactorily close agreement with the behavior of experimental form factors in the excitation energy range from 18 to 28 MeV

  15. Observation of a J(PC)=1-+ exotic resonance in diffractive dissociation of 190   GeV/c π- into π- π- π+.

    Science.gov (United States)

    Alekseev, M G; Alexakhin, V Yu; Alexandrov, Yu; Alexeev, G D; Amoroso, A; Austregesilo, A; Badełek, B; Balestra, F; Ball, J; Barth, J; Baum, G; Bedfer, Y; Bernhard, J; Bertini, R; Bettinelli, M; Birsa, R; Bisplinghoff, J; Bordalo, P; Bradamante, F; Bravar, A; Bressan, A; Brona, G; Burtin, E; Bussa, M P; Chapiro, A; Chiosso, M; Chung, S U; Cicuttin, A; Colantoni, M; Crespo, M L; Dalla Torre, S; Dafni, T; Das, S; Dasgupta, S S; Denisov, O Yu; Dhara, L; Diaz, V; Dinkelbach, A M; Donskov, S V; Doshita, N; Duic, V; Dünnweber, W; Efremov, A; El Alaoui, A; Eversheim, P D; Eyrich, W; Faessler, M; Ferrero, A; Finger, M; Finger, M; Fischer, H; Franco, C; Friedrich, J M; Garfagnini, R; Gautheron, F; Gavrichtchouk, O P; Gazda, R; Gerassimov, S; Geyer, R; Giorgi, M; Gobbo, B; Goertz, S; Grabmüller, S; Grajek, O A; Grasso, A; Grube, B; Gushterski, R; Guskov, A; Haas, F; von Harrach, D; Hasegawa, T; Heckmann, J; Heinsius, F H; Hermann, R; Herrmann, F; Hess, C; Hinterberger, F; Horikawa, N; Höppner, Ch; d'Hose, N; Ilgner, C; Ishimoto, S; Ivanov, O; Ivanshin, Yu; Iwata, T; Jahn, R; Jasinski, P; Jegou, G; Joosten, R; Kabuss, E; Kang, D; Ketzer, B; Khaustov, G V; Khokhlov, Yu A; Kisselev, Yu; Klein, F; Klimaszewski, K; Koblitz, S; Koivuniemi, J H; Kolosov, V N; Komissarov, E V; Kondo, K; Königsmann, K; Konopka, R; Konorov, I; Konstantinov, V F; Korzenev, A; Kotzinian, A M; Kouznetsov, O; Kowalik, K; Krämer, M; Kral, A; Kroumchtein, Z V; Kuhn, R; Kunne, F; Kurek, K; Lauser, L; Le Goff, J M; Lednev, A A; Lehmann, A; Levorato, S; Lichtenstadt, J; Liska, T; Maggiora, A; Maggiora, M; Magnon, A; Mallot, G K; Mann, A; Marchand, C; Marroncle, J; Martin, A; Marzec, J; Massmann, F; Matsuda, T; Maximov, A N; Meyer, W; Michigami, T; Mikhailov, Yu V; Moinester, M A; Mutter, A; Nagaytsev, A; Nagel, T; Nassalski, J; Negrini, T; Nerling, F; Neubert, S; Neyret, D; Nikolaenko, V I; Olshevsky, A G; Ostrick, M; Padee, A; Panknin, R; Panzieri, D; Parsamyan, B; Paul, S; Pawlukiewicz-Kaminska, B; Perevalova, E; Pesaro, G; Peshekhonov, D V; Piragino, G; Platchkov, S; Pochodzalla, J; Polak, J; Polyakov, V A; Pontecorvo, G; Pretz, J; Quintans, C; Rajotte, J-F; Ramos, S; Rapatsky, V; Reicherz, G; Reggiani, D; Richter, A; Robinet, F; Rocco, E; Rondio, E; Ryabchikov, D I; Samoylenko, V D; Sandacz, A; Santos, H; Sapozhnikov, M G; Sarkar, S; Savin, I A; Sbrizzai, G; Schiavon, P; Schill, C; Schlüter, T; Schmitt, L; Schopferer, S; Schröder, W; Shevchenko, O Yu; Siebert, H-W; Silva, L; Sinha, L; Sissakian, A N; Slunecka, M; Smirnov, G I; Sosio, S; Sozzi, F; Srnka, A; Stolarski, M; Sulc, M; Sulej, R; Takekawa, S; Tessaro, S; Tessarotto, F; Teufel, A; Tkatchev, L G; Uhl, S; Uman, I; Venugopal, G; Virius, M; Vlassov, N V; Vossen, A; Weitzel, Q; Windmolders, R; Wiślicki, W; Wollny, H; Zaremba, K; Zavertyaev, M; Zemlyanichkina, E; Ziembicki, M; Zhao, J; Zhuravlev, N; Zvyagin, A

    2010-06-18

    The COMPASS experiment at the CERN SPS has studied the diffractive dissociation of negative pions into the π- π- π+ final state using a 190  GeV/c pion beam hitting a lead target. A partial wave analysis has been performed on a sample of 420,000 events taken at values of the squared 4-momentum transfer t' between 0.1 and 1  GeV2/c2. The well-known resonances a1(1260), a2(1320), and π2(1670) are clearly observed. In addition, the data show a significant natural-parity exchange production of a resonance with spin-exotic quantum numbers J(PC)=1-+ at 1.66  GeV/c2 decaying to ρπ. The resonant nature of this wave is evident from the mass-dependent phase differences to the J(PC)=2-+ and 1++ waves. From a mass-dependent fit a resonance mass of (1660±10(-64)(+0))  MeV/c2 and a width of (269±21(-64)(+42))  MeV/c2 are deduced, with an intensity of (1.7±0.2)% of the total intensity.

  16. Evaluation of heterogeneous metabolic profile in an orthotopic human glioblastoma xenograft model using compressed sensing hyperpolarized 3D 13C magnetic resonance spectroscopic imaging.

    Science.gov (United States)

    Park, Ilwoo; Hu, Simon; Bok, Robert; Ozawa, Tomoko; Ito, Motokazu; Mukherjee, Joydeep; Phillips, Joanna J; James, C David; Pieper, Russell O; Ronen, Sabrina M; Vigneron, Daniel B; Nelson, Sarah J

    2013-07-01

    High resolution compressed sensing hyperpolarized (13)C magnetic resonance spectroscopic imaging was applied in orthotopic human glioblastoma xenografts for quantitative assessment of spatial variations in (13)C metabolic profiles and comparison with histopathology. A new compressed sensing sampling design with a factor of 3.72 acceleration was implemented to enable a factor of 4 increase in spatial resolution. Compressed sensing 3D (13)C magnetic resonance spectroscopic imaging data were acquired from a phantom and 10 tumor-bearing rats following injection of hyperpolarized [1-(13)C]-pyruvate using a 3T scanner. The (13)C metabolic profiles were compared with hematoxylin and eosin staining and carbonic anhydrase 9 staining. The high-resolution compressed sensing (13)C magnetic resonance spectroscopic imaging data enabled the differentiation of distinct (13)C metabolite patterns within abnormal tissues with high specificity in similar scan times compared to the fully sampled method. The results from pathology confirmed the different characteristics of (13)C metabolic profiles between viable, non-necrotic, nonhypoxic tumor, and necrotic, hypoxic tissue. Copyright © 2012 Wiley Periodicals, Inc.

  17. Electrically detected magnetic resonance of carbon dangling bonds at the Si-face 4H-SiC/SiO2 interface

    Science.gov (United States)

    Gruber, G.; Cottom, J.; Meszaros, R.; Koch, M.; Pobegen, G.; Aichinger, T.; Peters, D.; Hadley, P.

    2018-04-01

    SiC based metal-oxide-semiconductor field-effect transistors (MOSFETs) have gained a significant importance in power electronics applications. However, electrically active defects at the SiC/SiO2 interface degrade the ideal behavior of the devices. The relevant microscopic defects can be identified by electron paramagnetic resonance (EPR) or electrically detected magnetic resonance (EDMR). This helps to decide which changes to the fabrication process will likely lead to further increases of device performance and reliability. EDMR measurements have shown very similar dominant hyperfine (HF) spectra in differently processed MOSFETs although some discrepancies were observed in the measured g-factors. Here, the HF spectra measured of different SiC MOSFETs are compared, and it is argued that the same dominant defect is present in all devices. A comparison of the data with simulated spectra of the C dangling bond (PbC) center and the silicon vacancy (VSi) demonstrates that the PbC center is a more suitable candidate to explain the observed HF spectra.

  18. Further evidence for resonance anomalies in the 12C + 16O system

    International Nuclear Information System (INIS)

    Branford, D.; Nagorcka, B.N.; Newton, J.O.

    1977-09-01

    Excitation functions for six nuclides resulting from the 16 O + 12 C reaction, as well as for inelastic scattering to the 3 - state of 16 O, have been measured by γ-ray techniques in the range Esub(cm) = 12.8 - 18.2 MeV and a complete fusion excitation function deduced. Resonance anomalies, which may be due to the excitation of quasimolecular states, are observed at 14.7, 16.7, 17.6 and 18.6 MeV. These and other results are considered in terms of theoretical models for quasimolecular states. (Author)

  19. Quasi-bound alpha resonant states populated by the 12C(6Li, d) reaction

    International Nuclear Information System (INIS)

    Rodrigues, M.R.D.; Borello-Lewin, T.; Miyake, H.; Horodynski-Matsushigue, L.B.; Duarte, J.L.M.; Rodrigues, C.L.; Souza, M.A.; Cunsolo, A.; Cappuzzello, F.; Foti, A.; Agodi, C.; Cavallaro, M.; Ukita, G.M.

    2012-01-01

    Full text: The alpha cluster phenomenon in the light nuclei structure has been the subject of a long time investigation since the proposal of the Ikeda diagrams [1]. The main purpose of the research program in progress is the investigation of this phenomenon in (xα) and (xα+n) nuclei through the ( 6 Li, d) alpha transfer reaction [2-4]. Alpha resonant states around the (4α) threshold in the nucleus 16 O are the focus of the present contribution. In fact, the importance of these resonances at the elements production in stars is recognized, as primarily pointed out by Hoyle in 12 C [6]. The existence of a rotational band with the α + 12 C (Hoyle) cluster state structure was recently demonstrated by Ohkubo and Hirabayashi [6]. In order to explore this region of interest, measurements of the 12 C( 6 Li, d) 16 O reaction up to 17 MeV of excitation at an incident energy of 25.5 MeV, have been performed employing the Sao Paulo Pelletron-Enge Split-Pole facility and the nuclear emulsion detection technique (plates Fuji G6B, 50 μm thick). Spectra associated with six scattering angles, from 5 deg to 29 deg in the laboratory frame, each one 50 cm along the focal surface, were measured. Several narrow resonances with a quasi-bound behavior embedded in the continuum were detected and the resolution of 25 keV allowed for the separation of doublets not resolved before [7,8]. The absolute cross sections and the respective deuteron angular distributions were determined and the analysis is in progress. [1] K. Ikeda et al., Prog. Theor. Phys. Suppl. E 68, 464 (1968); H. Horiuchi, K. Ikeda, and Y. Suzuki, ibid. 44, 225 (1978). [2] M.R.D.Rodrigues et al., in12th International Conference on Nuclear Reaction Mechanism, Varenna, Italy, edited by F. Cerutti and A. Ferrari , CERN Proceedings, 2010-2, pp. 331- 335. [3] T. Borello-Lewin et al., Proceedings of SOTANCP2, Brussels, Belgium 2010, edited by P. Descouvemount et al., Int. J. Mod. Mod. Phys E 20, 1018-1021 (2011). [4] T. Borello

  20. Resonances in the nuclear reactions 15N + 12C and 15N + 16O

    International Nuclear Information System (INIS)

    Monnehan, G.A.

    1987-06-01

    The reaction 12 C + 15 N have been studied at 15 N beam energies between 30 and 70 MeV. For each reaction, about twelve residual nuclei have been identified through the γ-ray detection method. Excitation functions were obtained for the fusion and peripheral channels. Resonances are seen in the channels containing at least one α particle at energies below 50 MeV. At higher energies, strong structures are observed in the direct reaction channels. The evolution of the fusion cross section is well reproduced by a model based on the statistical desexcitation of the compound nucleus if the discrete states of the residual nuclei are taken into account. The favourable observation of resonant phenomena in 15 N induced reactions can be understood in terms of a small number of channels open to the grazing wave. In the range 50 to 60 MeV, there is a strong coupling between the fusion and the direct reaction channels. The occurrence of resonances above E lab = 50 MeV in the peripheral channels is explained with the band crossing and effective barrier models. In the 15 N induced reactions, the absorption of the surface waves is weak [fr

  1. A novel C-shaped, gold nanoparticle coated, embedded polymer waveguide for localized surface plasmon resonance based detection.

    Science.gov (United States)

    Prabhakar, Amit; Mukherji, Soumyo

    2010-12-21

    In this study, a novel embedded optical waveguide based sensor which utilizes localized surface plasmon resonance of gold nanoparticles coated on a C-shaped polymer waveguide is being reported. The sensor, as designed, can be used as an analysis chip for detection of minor variations in the refractive index of its microenvironment, which makes it suitable for wide scale use as an affinity biosensor. The C-shaped waveguide coupled with microfluidic channel was fabricated by single step patterning of SU8 on an oxidized silicon wafer. The absorbance due to the localized surface plasmon resonance (LSPR) of SU8 waveguide bound gold nano particle (GNP) was found to be linear with refractive index changes between 1.33 and 1.37. A GNP coated C-bent waveguide of 200 μ width with a bend radius of 1 mm gave rise to a sensitivity of ~5 ΔA/RIU at 530 nm as compared to the ~2.5 ΔA/RIU (refractive index units) of the same dimension bare C-bend SU8 waveguide. The resolution of the sensor probe was ~2 × 10(-4) RIU.

  2. Calculation of astrophysical S-factor in reaction ^{13}C(p,γ )^{14}N for first resonance levels

    Science.gov (United States)

    Moghadasi, A.; Sadeghi, H.; Pourimani, R.

    2018-01-01

    The ^{13}C(p,γ )^{14}N reaction is one of the important reactions in the CNO cycle, which is a key process in nucleosynthesis. We first calculated wave functions for the bound state of ^{14}N with Faddeev's method. In this method, the considered reaction components are ^{12}C+n+p. Then, by using direct capture cross section and Breit-Wigner formulae, the non-resonant and resonant cross sections were calculated, respectively. In the next step, we calculated the total S-factor and compared it with experimental data, which showed good agreement between them. Next, we extrapolated the S-factor for the transition to the ground state at zero energy and obtained S(0)=5.8 ± 0.7 (keV b) and then calculate reaction rate. These ones are in agreement with previous reported results.

  3. Investigation of meson resonances in the reaction pp→ppπ+π+π-π- at 19 GeV/c

    International Nuclear Information System (INIS)

    Allan, J.; Blomqvist, G.

    1975-07-01

    In the reaction pp→ppπ + π + π - π - at 19 GeV/c, enchancements around 1100 and 1300 MeV/c in the (π + π + π - ) and (π + π - π - ) systems are analysed. The peak at A 2 - is mainly visible in association with the Δ ++ (1236) resonance, a phenomenon analogous to the previous observed reaction type pp → ΔrhoN. In contrast, a weak enchancement at A 1 + is not visible together with the Δ 0 (1236) resonance. The peak at A 1 + is predominantly seen in a subsample of single diffraction like events, whereas the peak at A 2 - is only visible in the corresponding nondiffractive subsample. Further, there is an indication of the process pp → prho 0 rho 0 p and finally, an observed enchancement around 1680 MeV/c 2 in the (π + π + π - π - ) system can be explained as a reflection of the peak at A 2 - . (Auth.)

  4. Enhanced absorption in Au nanoparticles/a-Si:H/c-Si heterojunction solar cells exploiting Au surface plasmon resonance

    Energy Technology Data Exchange (ETDEWEB)

    Losurdo, Maria; Giangregorio, Maria M.; Bianco, Giuseppe V.; Sacchetti, Alberto; Capezzuto, Pio; Bruno, Giovanni [Institute of Inorganic Methodologies and of Plasmas, IMIP-CNR, via Orabona 4, 70126 Bari (Italy)

    2009-10-15

    Au nanoparticles (NPs)/(n-type)a-Si:H/(p-type)c-Si heterojunctions have been deposited combining plasma-enhanced chemical-vapour deposition (PECVD) with Au sputtering. We demonstrate that a density of {proportional_to}1.3 x 10{sup 11} cm{sup -2} of Au nanoparticles with an approximately 20 nm diameter deposited onto (n-type)a-Si:H/(p-type)c-Si heterojunctions enhance performance exploiting the improved absorption of light by the surface plasmon resonance of Au NPs. In particular, Au NPs/(n-type)a-Si:H/(p-type)c-Si show an enhancement of 20% in the short-circuit current, J{sub SC}, 25% in the power output, P{sub max} and 3% in the fill factor, FF, compared to heterojunctions without Au NPs. Structures have been characterized by spectroscopic ellipsometry, atomic force microscopy and current-voltage (I-V) measurements to correlate the plasmon resonance-induced enhanced absorption of light with photovoltaic performance. (author)

  5. Computation of the Coupling Resonance Driving term f1001 and the coupling coefficient C from turn-by-turn single-BPM data.

    CERN Document Server

    Franchi, A; Vanbavinkhove, G; CERN. Geneva. BE Department

    2010-01-01

    In this note we show how to compute the Resonance Driving Term (RDT) f1001, the local resonance term chi 1010 and the coupling coefficient C from the spectrum of turn-by-turn single-BPM data. The harmonic analysis of real coordinate x(y) is model independent, conversely to the the analysis of the complex Courant-Snyder coordinate hx,- = x-ipx. From the computation of f1001 along the ring is closely related to the global coupling coefficient C, but it is affected by an intrinsic error, discussed in this note.

  6. 21 CFR 177.2260 - Filters, resin-bonded.

    Science.gov (United States)

    2010-04-01

    .... Potassium. Sodium. Triethanolamine. Fatty acid (C10-C18) mono- and diesters of polyoxyethylene glycol.... (3) Resins: Acrylic polymers produced by polymerizing ethyl acrylate alone or with one or more of the... contain at least 70 weight percent of polymer units derived from ethyl acrylate, no more than 2 weight...

  7. The electron spin resonance study of heavily nitrogen doped 6H SiC crystals

    Czech Academy of Sciences Publication Activity Database

    Savchenko, Dariia

    2015-01-01

    Roč. 117, č. 4 (2015), "045708-1"-"045708-6" ISSN 0021-8979 R&D Projects: GA ČR GP13-06697P; GA MŠk(CZ) LM2011029 Grant - others:SAFMAT(XE) CZ.2.16/3.1.00/22132 Institutional support: RVO:68378271 Keywords : electron spin resonance * conduction electrons * 6H SiC * insulator-metal transition Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.101, year: 2015

  8. Study of spin resonances in the accelerators with snakes

    International Nuclear Information System (INIS)

    Lee, S.Y.

    1989-01-01

    Spin resonances in the circular accelerators with snakes are studied to understand the nature of snake resonances. We analyze the effect of snake configuration, and the snake superperiod on the resonance. Defining the critical resonance strength ε c as the maximum tolerable resonance strength without losing the beam polarization after passing through the resonance, we found that ε c is a sensitive function of the snake configuration, the snake superperiod at the first order snake resonance, the higher order snake resonance conditions and the spin matching condition. Under properly designed snake configuration, the critical resonance strength ε c is found to vary linearly with N S as left-angle ε c right-angle=(1/π)sin -1 (cos πν z | 1/2 )N S , where ν| z and N S are the betatron tune and the number of snakes respectively. We also study the effect of overlapping intrinsic and imperfection resonances. The imperfection resonance should be corrected to a magnitude of insignificance (e.g., ε≤0.1 for two snakes case) to maintain proper polarization

  9. Chiral effects on the 13C resonances of α-tocopherol and related compounds. A novel illustration of Newman's rule of six

    International Nuclear Information System (INIS)

    Brownstein, S.; Burton, G.W.; Hughes, L.; Ingold, K.U.

    1989-01-01

    The 100-MHz 13 C NMR spectrum of (2R,4'R,8'R)-α-tocopherol (natural vitamin E) has been completely assigned with the aid of a number of selectively deuteriated (2R,4'R,8'R)-α-tocopherols. The 13 C NMR spectrum of (2RS,4'RS,8'RS)-α-tocopherol (all-racemic, synthetic vitamin E) has also been measured. Many of the individual carbons in this all-racemic mixture of eight α-tocopherol stereoisomers give more than one resonance with eight of the carbons (2-CH 3 , 2',3',4',4'-CH 3 , 5', 8', and 9') giving the maximum number of four resonances from each of the four enantiomeric pairs; these resonances have also been assigned. The structurally related 5'-hydroxy-2-(4',8',12'-trimethyltridecyl)-2,4,6,7-tetramethyl-2,3,-dihydrobenzofuran (HTDBF) has been synthesized for the first time in the 2R,4'R,8'R and 2S,4'R,8'R configurations and their 13 C resonances have been assigned. In its all-racemic form this compound also shows up to four resonances from a single carbon. Related observations have been made with phytol and isophytol. A careful examination of these chirally induced chemical shift differences for the individual carbon atoms, Δ, reveals a bond-alternation effect with maxima at a separation of one, three, and five bonds from the closest chiral center and with the maximum at a five-bond separation being greater than that at a three-bond separation. 32 references, 2 figures, 4 tables

  10. {sup 16}O resonances near 4α threshold through {sup 12}C({sup 6}Li,d) reaction

    Energy Technology Data Exchange (ETDEWEB)

    Rodrigues, M. R. D.; Borello-Lewin, T.; Miyake, H.; Horodynski-Matsushigue, L. B.; Duarte, J. L. M.; Rodrigues, C. L.; Faria, P. Neto de [Instituto de Física, Universidade de São Paulo, Caixa Postal 66318, CEP 05314-970, São Paulo, SP (Brazil); Cunsolo, A.; Cappuzzello, F.; Foti, A.; Agodi, C.; Cavallaro, M. [INFN - Laboratori Nazionali del Sud, Via S. Sofia 62, 95125 Catania (Italy); Napoli, M. di; Ukita, G. M. [Faculdade de Psicologia, Universidade de Santo Amaro, R. Prof. Eneas da Siqueira Neto, 340, CEP 04829-300, São Paulo, SP (Brazil)

    2014-11-11

    Several narrow alpha resonant {sup 16}O states were detected through the {sup 12}C({sup 6}Li,d) reaction, in the range of 13.5 to 17.5 MeV of excitation energy. The reaction was measured at a bombarding energy of 25.5 MeV employing the São Paulo Pelletron-Enge-Spectrograph facility and the nuclear emulsion technique. Experimental angular distributions associated with natural parity quasi-bound states around the 4α threshold are presented and compared to DWBA predictions. The upper limit for the resonance widths obtained is near the energy resolution (15 keV)

  11. Fusion, resonances and scattering in C reaction

    Indian Academy of Sciences (India)

    respectively. In each of these regions, we find some important features in the results ofσfus. ... draws attention in the astrophysical studies [2,7]. Here, Ecm and η .... We outline the concept of selective resonance tunneling for fusion in Ü3. In Ü4 ...

  12. The structure of teichoic acid from Bacillus subtilis var. niger WM as determined by 13C nuclear-magnetic-resonance spectroscopy

    International Nuclear Information System (INIS)

    De Boer, W.R.; Kruyssen, F.J.; Wouters, J.T.M.; Kruk, C.

    1976-01-01

    The walls of Bacillus subtilis var. niger WM, grown in a Mg 2+ -limited chemostat culture (carbon source glucose, dilution rate = 0.2 h -1 , 37 0 C, pH 7) contained 45% (w/w) teichoic acid, a polymer composed of glycerol, phosphate and glucose in the molar ratio 1.00 : 1.00 : 0.88. Alkaline hydrolysis of this teichoic acid yielded 1-O-β-glucosylglycerol phosphate (together with small amounts of glycerol phosphate), and 13 C nuclear magnetic resonance spectra of this hydrolysis product, and its derivative after alkaline phosphatase treatment, confirmed that the monomeric unit was 1-O-β-glucosylglycerol-3-phosphate. Assignment of the resonances in the spectrum of undegraded teichoic acid revealed that the polymer was a poly[(2,3)glycerol phosphate], glucosidically substituted on C-1 of glycerol with β-glucose. (orig.) [de

  13. Whistler mode resonance-cone transmissions at 100 kHz in the OEDIPUS-C experiment

    Czech Academy of Sciences Publication Activity Database

    Chugunov, Y. V.; Fiala, Vladimír; Hayosh, Mykhaylo; James, H. G.

    2012-01-01

    Roč. 47, č. 6 (2012), RS6002/1-RS6002/11 ISSN 0048-6604 Grant - others:Rada Programu interní podpory projektů mezinárodní spolupráce AV ČR(CZ) M100420904 Program:M Institutional support: RVO:68378289 Keywords : OEDIPUS-C * dipole * pulse distortion * resonance cone * whistler mode Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.000, year: 2012 http://onlinelibrary.wiley.com/doi/10.1029/2012RS005054/abstract

  14. DESIGN OPTIMIZATION OF RESONANT DC-DC CONVERTERS

    OpenAIRE

    Belqasem Aljafari

    2016-01-01

    Resonant DC/DC converters are the class of converters, which have L-C resonant tank serving as a major part of the power conversion process. The fundamental concept of the resonant converter is that the circulating energy in an L-C resonant circuit is manageable by changing the operating frequency, and therefore the converter can condition the input power to the desired output voltage. The development in power conversion technology is steady demand for high power efficiency and high power den...

  15. Efficient primary and parametric resonance excitation of bistable resonators

    KAUST Repository

    Ramini, Abdallah

    2016-09-12

    We experimentally demonstrate an efficient approach to excite primary and parametric (up to the 4th) resonance of Microelectromechanical system MEMS arch resonators with large vibrational amplitudes. A single crystal silicon in-plane arch microbeam is fabricated such that it can be excited axially from one of its ends by a parallel-plate electrode. Its micro/nano scale vibrations are transduced using a high speed camera. Through the parallel-plate electrode, a time varying electrostatic force is applied, which is converted into a time varying axial force that modulates dynamically the stiffness of the arch resonator. Due to the initial curvature of the structure, not only parametric excitation is induced, but also primary resonance. Experimental investigation is conducted comparing the response of the arch near primary resonance using the axial excitation to that of a classical parallel-plate actuation where the arch itself forms an electrode. The results show that the axial excitation can be more efficient and requires less power for primary resonance excitation. Moreover, unlike the classical method where the structure is vulnerable to the dynamic pull-in instability, the axial excitation technique can provide large amplitude motion while protecting the structure from pull-in. In addition to primary resonance, parametrical resonances are demonstrated at twice, one-half, and two-thirds the primary resonance frequency. The ability to actuate primary and/or parametric resonances can serve various applications, such as for resonator based logic and memory devices. (C) 2016 Author(s). All article content, except where otherwise noted, is licensed under a Creative Commons Attribution (CC BY) license

  16. CACA-TOCSY with alternate {sup 13}C-{sup 12}C labeling: a {sup 13}C{sup {alpha}} direct detection experiment for mainchain resonance assignment, dihedral angle information, and amino acid type identification

    Energy Technology Data Exchange (ETDEWEB)

    Takeuchi, Koh [National Institute of Advanced Industrial Science and Technology (AIST), Biomedicinal Information Research Center (BIRC) (Japan); Frueh, Dominique P.; Sun, Zhen-Yu J.; Hiller, Sebastian; Wagner, Gerhard, E-mail: gerhard_wagner@hms.harvard.ed [Harvard Medical School, Department of Biological Chemistry and Molecular Pharmacology (United States)

    2010-05-15

    We present a {sup 13}C direct detection CACA-TOCSY experiment for samples with alternate {sup 13}C-{sup 12}C labeling. It provides inter-residue correlations between {sup 13}C{sup {alpha}} resonances of residue i and adjacent C{sup {alpha}s} at positions i - 1 and i + 1. Furthermore, longer mixing times yield correlations to C{sup {alpha}} nuclei separated by more than one residue. The experiment also provides C{sup {alpha}}-to-side chain correlations, some amino acid type identifications and estimates for {psi} dihedral angles. The power of the experiment derives from the alternate {sup 13}C-{sup 12}C labeling with [1,3-{sup 13}C] glycerol or [2-{sup 13}C] glycerol, which allows utilizing the small scalar {sup 3}J{sub CC} couplings that are masked by strong {sup 1}J{sub CC} couplings in uniformly {sup 13}C labeled samples.

  17. Synthesis of selectively 13C-labelled benzoic acid for nuclear magnetic resonance spectroscopic measurement of glycine conjugation activity

    International Nuclear Information System (INIS)

    Akira, Kazuki; Hasegawa, Hiroshi; Baba, Shigeo

    1995-01-01

    The synthesis of [4- 13 C]benzoic acid (BA) labelled in a single protonated carbon, for use as a probe to measure glycine conjugation activity by nuclear magnetic resonance (NMR) spectroscopy, has been reported. The labelled compound was prepared by a seven-step synthetic scheme on a relatively small scale using [2- 13 C] acetone as the source of label in overall yield of 16%. The usefulness of [4- 13 C]BA was demonstrated by the NMR spectroscopic monitoring of urinary excretion of [4- 13 C]hippuric acid in the rat administered with the labelled BA. (Author)

  18. Resonance production in π-p interactions at 100 GeV/c. Technical report No. 77-039

    International Nuclear Information System (INIS)

    Svrcek, F.C.

    1976-11-01

    A bubble chamber-wide-gap optical spark chamber experiment has been performed in order to make use of precision momentum measurements (delta p/p less than 0.25) in studying the π - p interaction at 100 GeV/c. These measurements were used to study phenomenological characteristics of and resonance production in the π - p interaction. Peyrou plots and single particle inclusive distributions in rapidity, Feynman x, and transverse momentum for π + , π - , and p production were used to point out the incident particle and leading proton effects. Factorization of the differential cross section was tested, indicating a slight preference for the variables (rapidity, transverse momentum). Two-particle rapidity correlations as a function of rapidity gap for like and unlike charge pion pairs were investigated inclusively, where short range correlation behavior was noted, and semi-inclusively, where a suggestion that clusters may consist of one positive particle and one negative particle was seen. A search for the production of known resonances was conducted in the following effective mass distributions: (pπ +- ), (π + π - ), (π + π - π +- ), (π + π - π + π - ), (K +- π -+ ), and (K + K - ). The Δ ++ (1236) was seen in the (pπ + ) channel, and substantial rho 0 (770) was seen in the (π + π - ) spectrum. Differential cross sections in center of mass rapidity and transverse momentum for the rho 0 indicated the dominance of production in the central and forward rapidity regions and production comparable to that for pions at p 2 /sub T/ greater than 0.5 (GeV/c) 2 . No other resonances were observed

  19. Resonances in the system of π+π--mesons from np→npπ+π- reaction at Pn=5.20 GeV/c: search, results of direct observations, interpretation

    International Nuclear Information System (INIS)

    Troyan, Yu.A.; Plekhanov, E.B.; Pechenov, V.N.; Troyan, A.Yu.; Belyaev, A.V.; Ierusalimov, A.P.; Arakelyan, S.G.

    2002-01-01

    Ten resonances were found in the mass spectrum of a π + π - system based on 66075 events from np→npπ + π - reaction in np-interactions at P n =(5.20±0.16)GeV/c in the one-meter hydrogen bubble chamber of the LHE (JINR) by using the criterion cos Θ* p>0. These masses are the following: (347±12), (418±6), (511±12), (610±5), (678±17), (757±5), (880±12), (987±12), (1133±15), and (1285±22) MeV/c 2 ; their excesses above the background are 2.9, 5.2, 3.5, 1.4, 2.0, 8.5, 4.8, 3.8, 5.2, and 6.0 standard deviations, respectively. The experimental widths of the resonances vary within the region from 16 to 94 MeV/c 2 . Such effects were not found in π - π 0 combinations from np→ppπ - π 0 reaction. Therefore, it is necessary to attribute the value of isotopic spin I=0 to the resonances found in the mass spectrum of the π + π - system. The spin was estimated for the most statistically provided resonances at masses of 418, 511 and 757 MeV/c 2 . We determine with a high degree of confidence that J=0 for the resonances at M R =757 MeV/c 2 and M R =418 MeV/c 2 and the most probable value of J=0 for the resonance at M R =511 MeV/c 2 . Therefore, it can be affirmed that at least 3 states with quantum numbers of σ 0 -meson 0 + (0 ++ ) have been found at masses of 418, 511 and 757 MeV/c 2 . The fact that low-mass σ 0 -mesons are glueballs is one of the possible interpretations. Comparison with the data of other papers has also been made

  20. CACA-TOCSY with alternate 13C-12C labeling: a 13Cα direct detection experiment for mainchain resonance assignment, dihedral angle information, and amino acid type identification

    International Nuclear Information System (INIS)

    Takeuchi, Koh; Frueh, Dominique P.; Sun, Zhen-Yu J.; Hiller, Sebastian; Wagner, Gerhard

    2010-01-01

    We present a 13 C direct detection CACA-TOCSY experiment for samples with alternate 13 C- 12 C labeling. It provides inter-residue correlations between 13 C α resonances of residue i and adjacent C α s at positions i - 1 and i + 1. Furthermore, longer mixing times yield correlations to C α nuclei separated by more than one residue. The experiment also provides C α -to-sidechain correlations, some amino acid type identifications and estimates for ψ dihedral angles. The power of the experiment derives from the alternate 13 C- 12 C labeling with [1,3- 13 C] glycerol or [2- 13 C] glycerol, which allows utilizing the small scalar 3 J CC couplings that are masked by strong 1 J CC couplings in uniformly 13 C labeled samples.

  1. CACA-TOCSY with alternate 13C-12C labeling: a 13Calpha direct detection experiment for mainchain resonance assignment, dihedral angle information, and amino acid type identification.

    Science.gov (United States)

    Takeuchi, Koh; Frueh, Dominique P; Sun, Zhen-Yu J; Hiller, Sebastian; Wagner, Gerhard

    2010-05-01

    We present a (13)C direct detection CACA-TOCSY experiment for samples with alternate (13)C-(12)C labeling. It provides inter-residue correlations between (13)C(alpha) resonances of residue i and adjacent C(alpha)s at positions i - 1 and i + 1. Furthermore, longer mixing times yield correlations to C(alpha) nuclei separated by more than one residue. The experiment also provides C(alpha)-to-sidechain correlations, some amino acid type identifications and estimates for psi dihedral angles. The power of the experiment derives from the alternate (13)C-(12)C labeling with [1,3-(13)C] glycerol or [2-(13)C] glycerol, which allows utilizing the small scalar (3)J(CC) couplings that are masked by strong (1)J(CC) couplings in uniformly (13)C labeled samples.

  2. The binding of cytochrome c to neuroglobin: A docking and surface plasmon resonance study

    DEFF Research Database (Denmark)

    Bønding, Signe Helbo; Henty, K.; Dingley, A.J.

    2008-01-01

    is associated with a small unfavourable enthalpy change (1.9 kcal mol-1) and a moderately large, favourable entropy change (14.8 cal mol-1 deg-1). The sensitivity of the binding constant to the presence of salt suggests that the complex formation involves electrostatic interactions....... one major binding site for cytochrome c to neuroglobin. The results yield a plausible structure for the most likely complex structure in which the hemes of each protein are in close contact. NMR analysis identifies the formation of a weak complex in which the heme group of cytochrome c is involved....... surface plasmon resonance studies provide a value of 45 μM for the equilibrium constant for cytochrome c binding to neuroglobin, which increases significantly as the ionic strength of the solution increases. The temperature dependence of the binding constant indicates that the complex formation...

  3. Quasi-bound alpha resonant states populated by the {sup 12}C({sup 6}Li, d) reaction

    Energy Technology Data Exchange (ETDEWEB)

    Rodrigues, M.R.D.; Borello-Lewin, T.; Miyake, H.; Horodynski-Matsushigue, L.B.; Duarte, J.L.M.; Rodrigues, C.L.; Souza, M.A. [Universidade de Sao Paulo (IF/USP), SP (Brazil). Inst. de Fisica; Cunsolo, A.; Cappuzzello, F.; Foti, A.; Agodi, C.; Cavallaro, M. [Istituto Nazionale di Fisica Nucleare (LNS/INFN), Catania (Italy). Lab. Nazionali del Sud; Ukita, G.M. [Universidade de Santo Amaro (UNISA), Sao Paulo, SP (Brazil). Faculdade de Psicologia

    2012-07-01

    Full text: The alpha cluster phenomenon in the light nuclei structure has been the subject of a long time investigation since the proposal of the Ikeda diagrams [1]. The main purpose of the research program in progress is the investigation of this phenomenon in (x{alpha}) and (x{alpha}+n) nuclei through the ({sup 6}Li, d) alpha transfer reaction [2-4]. Alpha resonant states around the (4{alpha}) threshold in the nucleus {sup 16}O are the focus of the present contribution. In fact, the importance of these resonances at the elements production in stars is recognized, as primarily pointed out by Hoyle in {sup 12}C [6]. The existence of a rotational band with the {alpha} +{sup 12} C (Hoyle) cluster state structure was recently demonstrated by Ohkubo and Hirabayashi [6]. In order to explore this region of interest, measurements of the {sup 12}C({sup 6}Li, d){sup 16}O reaction up to 17 MeV of excitation at an incident energy of 25.5 MeV, have been performed employing the Sao Paulo Pelletron-Enge Split-Pole facility and the nuclear emulsion detection technique (plates Fuji G6B, 50 {mu}m thick). Spectra associated with six scattering angles, from 5 deg to 29 deg in the laboratory frame, each one 50 cm along the focal surface, were measured. Several narrow resonances with a quasi-bound behavior embedded in the continuum were detected and the resolution of 25 keV allowed for the separation of doublets not resolved before [7,8]. The absolute cross sections and the respective deuteron angular distributions were determined and the analysis is in progress. [1] K. Ikeda et al., Prog. Theor. Phys. Suppl. E 68, 464 (1968); H. Horiuchi, K. Ikeda, and Y. Suzuki, ibid. 44, 225 (1978). [2] M.R.D.Rodrigues et al., in12th International Conference on Nuclear Reaction Mechanism, Varenna, Italy, edited by F. Cerutti and A. Ferrari , CERN Proceedings, 2010-2, pp. 331- 335. [3] T. Borello-Lewin et al., Proceedings of SOTANCP2, Brussels, Belgium 2010, edited by P. Descouvemount et al., Int. J

  4. Direct monitoring by carbon-13 nuclear magnetic resonance spectroscopy of the metabolism and metabolic rate of 13C-labeled compounds in vivo.

    Science.gov (United States)

    Iida, K; Hidoh, O; Fukami, J; Kajiwara, M

    1991-01-01

    Carbon-13 nuclear magnetic resonance spectroscopy has been used to observe the transformations of [1-13C]-D-glucose to [1,1'-13C2]-D-trehalose, and [3-13C]-L-alanine to [2-13C]-L-glutamic acid in the living body of Gryllodes sigillatus. [3-13C]-D-Alanine was not metabolized. The metabolic rate of [1-13C]-D-glucose was found to be altered by prior injection of boric acid.

  5. Multipolarity analysis for 14C high-energy resonance populated by (18O,16O) two-neutron transfer reaction

    International Nuclear Information System (INIS)

    Carbone, D.; Cavallaro, M.; Bondì, M.; Agodi, C.; Cunsolo, A.; Cappuzzello, F.; Azaiez, F.; Franchoo, S.; Khan, E.; Bonaccorso, A.; Fortunato, L.; Foti, A.; Linares, R.; Lubian, J.; Scarpaci, J. A.; Vitturi, A.

    2015-01-01

    The 12 C( 18 O, 16 O) 14 C reaction at 84 MeV incident energy has been explored up to high excitation energy of the residual nucleus thanks to the use of the MAGNEX spectrometer to detect the ejectiles. In the region above the two-neutron separation energy, a resonance has been observed at 16.9 MeV. A multipolarity analysis of the cross section angular distribution indicates an L = 0 character for such a transition

  6. Characteristics of one-port surface acoustic wave resonator fabricated on ZnO/6H-SiC layered structure

    Science.gov (United States)

    Li, Qi; Qian, Lirong; Fu, Sulei; Song, Cheng; Zeng, Fei; Pan, Feng

    2018-04-01

    Characteristics of one-port surface acoustic wave (SAW) resonators fabricated on ZnO/6H-SiC layered structure were investigated experimentally and theoretically. Phase velocities (V p), electromechanical coupling coefficients (K 2), quality factors (Q), and temperature coefficients of frequency (TCF) of Rayleigh wave (0th mode) and first- and second-order Sezawa wave (1st and 2nd modes, respectively) for different piezoelectric film thickness-to-wavelength (h ZnO /λ) ratios were systematically studied. Results demonstrated that one-port SAW resonators fabricated on the ZnO/6H-SiC layered structure were promising for high-frequency SAW applications with moderate K 2 and TCF values. A high K 2 of 2.44% associated with a V p of 5182 m s‑1 and a TCF of  ‑41.8 ppm/°C was achieved at h ZnO /λ  =  0.41 in the 1st mode, while a large V p of 7210 m s‑1 with a K 2 of 0.19% and a TCF of  ‑36.4 ppm/°C was obtained for h ZnO /λ  =  0.31 in the 2nd mode. Besides, most of the parameters were reported for the first time and will be helpful for the future design and optimization of SAW devices fabricated on ZnO/6H-SiC layered structures.

  7. Generating a resonance-like structure in the reaction B{sub c} → B{sub s}ππ

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Xiao-Hai [Institut fuer Kernphysik and Juelich Center for Hadron Physics, Forschungszentrum Juelich, Institute for Advanced Simulation, Juelich (Germany); Meissner, Ulf G. [Institut fuer Kernphysik and Juelich Center for Hadron Physics, Forschungszentrum Juelich, Institute for Advanced Simulation, Juelich (Germany); Universitaet Bonn, Helmholtz-Institut fuer Strahlen- und Kernphysik and Bethe Center for Theoretical Physics, Bonn (Germany)

    2017-12-15

    We investigate the process B{sub c}{sup +} → B{sub s}{sup 0}π{sup +}π{sup 0} via B anti K* rescattering. The kinematic conditions for triangle singularities are perfectly satisfied in the rescattering diagrams. A resonance-like structure around the B anti K threshold, which we denote X(5777), is predicted to be present in the invariant mass distribution of B{sub s}{sup 0}π{sup +}. Because the relative weak B anti K (I = 1) interaction does not support the existence of a dynamically generated hadronic molecule, X(5777) can be identified as a pure kinematical effect due to the triangle singularity. Its observation may help to establish a non-resonance interpretation for some XYZ particles. (orig.)

  8. Study of the K Kπ meson resonances produced in antiproton proton annihilations at 750 MeV/c

    International Nuclear Information System (INIS)

    Gil Lopez, E.

    1977-01-01

    In this work we present an analysis of the antiproton proton annihilations into strange particles at 700 and 750 MeV/c, restricted to the four and five body final states. We study in detail the resonances decaying into the K Kπ; system, in particular the D and E mesons. For the D meson we present a determination of i ts mass, width, isospin, G-parity, C-parity and spin. For the E meson we present parametrizations of the complete final state which decrease its statistical significance in this type of production. (Author)

  9. Resonance capture and Saturn's rings

    International Nuclear Information System (INIS)

    Patterson, C.W.

    1986-05-01

    We have assigned the resonances apparently responsible for the stabilization of the Saturn's shepherd satellites and for the substructure seen in the F-ring and the ringlets in the C-ring. We show that Saturn's narrow ringlets have a substructure determined by three-body resonances with Saturn's ringmoons and the sun. We believe such resonances have important implications to satellite formation. 17 refs., 1 fig., 1 tab

  10. Confinement-induced resonances in anharmonic waveguides

    Energy Technology Data Exchange (ETDEWEB)

    Peng Shiguo [Department of Physics, Tsinghua University, Beijing 100084 (China); Centre for Atom Optics and Ultrafast Spectroscopy, Swinburne University of Technology, Melbourne 3122 (Australia); Hu Hui; Liu Xiaji; Drummond, Peter D. [Centre for Atom Optics and Ultrafast Spectroscopy, Swinburne University of Technology, Melbourne 3122 (Australia)

    2011-10-15

    We develop the theory of anharmonic confinement-induced resonances (ACIRs). These are caused by anharmonic excitation of the transverse motion of the center of mass (c.m.) of two bound atoms in a waveguide. As the transverse confinement becomes anisotropic, we find that the c.m. resonant solutions split for a quasi-one-dimensional (1D) system, in agreement with recent experiments. This is not found in harmonic confinement theories. A new resonance appears for repulsive couplings (a{sub 3D}>0) for a quasi-two-dimensional (2D) system, which is also not seen with harmonic confinement. After inclusion of anharmonic energy corrections within perturbation theory, we find that these ACIRs agree extremely well with anomalous 1D and 2D confinement-induced resonance positions observed in recent experiments. Multiple even- and odd-order transverse ACIRs are identified in experimental data, including up to N=4 transverse c.m. quantum numbers.

  11. An investigation of narrow meson resonance production in antiproton-proton and antiproton-neutron interactions at 6.1 and 8.9 GeV/c

    International Nuclear Information System (INIS)

    Azooz, F.; Butterworth, I.; Dornan, P.J.

    1984-04-01

    The authors made a comprehensive search for narrow meson resonance production in reactions of the type p-barN → π +- sub(fast)X and p-barN → psub(fast)(sub(n-bar)sup(p-bar)X at 6.1 and 8.9 GeV.c in a triggered bubble chamber experiment at the SLAC Hybrid Facility. From a study of all accessible inclusive, semi-inclusive and exclusive states, upper limits are given for production of non-strange resonances with width 2 . The authors find two further peaks of statistical significance in excess of 4 standard deviations with masses in the M approx. 2 GeV/c 2 region, and one further multipion peak with mass approx. 1.54 GeV/c 2 . (author)

  12. Potentiation of C1-esterase inhibitor by heparin and interactions with C1s protease as assessed by surface plasmon resonance.

    Science.gov (United States)

    Rajabi, Mohsen; Struble, Evi; Zhou, Zhaohua; Karnaukhova, Elena

    2012-01-01

    Human C1-esterase inhibitor (C1-INH) is a multifunctional plasma protein with a wide range of inhibitory and non-inhibitory properties, mainly recognized as a key down-regulator of the complement and contact cascades. The potentiation of C1-INH by heparin and other glycosaminoglycans (GAGs) regulates a broad spectrum of C1-INH activities in vivo both in normal and disease states. SCOPE OF RESEARCH: We have studied the potentiation of human C1-INH by heparin using Surface Plasmon Resonance (SPR), circular dichroism (CD) and a functional assay. To advance a SPR for multiple-unit interaction studies of C1-INH we have developed a novel (consecutive double capture) approach exploring different immobilization and layout. Our SPR experiments conducted in three different design versions showed marked acceleration in C1-INH interactions with complement protease C1s as a result of potentiation of C1-INH by heparin (from 5- to 11-fold increase of the association rate). Far-UV CD studies suggested that heparin binding did not alter C1-INH secondary structure. Functional assay using chromogenic substrate confirmed that heparin does not affect the amidolytic activity of C1s, but does accelerate its consumption due to C1-INH potentiation. This is the first report that directly demonstrates a significant acceleration of the C1-INH interactions with C1s due to heparin by using a consecutive double capture SPR approach. The results of this study may be useful for further C-INH therapeutic development, ultimately for the enhancement of current C1-INH replacement therapies. Published by Elsevier B.V.

  13. Josephson plasma resonance in superconducting multilayers

    DEFF Research Database (Denmark)

    Pedersen, Niels Falsig

    1999-01-01

    We derive an analytical solution for the josephson plasma resonance of superconducting multilayers. This analytical solution is derived mainly for low T-c systems with magnetic coupling between the superconducting layers, but many features of our results are more general, and thus an application...... to the recently derived plasma resonance phenomena for high T-c superconductors of the BSCCO type is discussed....

  14. Micro string resonators as temperature sensors

    DEFF Research Database (Denmark)

    Larsen, T.; Schmid, S.; Boisen, A.

    2013-01-01

    The resonance frequency of strings is highly sensitive to temperature. In this work we have investigated the applicability of micro string resonators as temperature sensors. The resonance frequency of strings is a function of the tensile stress which is coupled to temperature by the thermal...... to the low thermal mass of the strings. A temperature resolution of 2.5×10-4 °C has been achieved with silicon nitride strings. The theoretical limit for the temperature resolution of 8×10-8 °C has not been reached yet and requires further improvement of the sensor....

  15. Cyclotron Resonances in Electron Cloud Dynamics

    International Nuclear Information System (INIS)

    Celata, C.M.; Furman, M.A.; Vay, J.L.; Grote, D.P.; Ng, J.T.; Pivi, M.F.; Wang, L.F.

    2009-01-01

    A new set of resonances for electron cloud dynamics in the presence of a magnetic field has been found. For short beam bunch lengths and low magnetic fields where l b c , (l b = bunch duration, ω c = non-relativistic cyclotron frequency) resonances between the bunch frequency and harmonics of the cyclotron frequency cause an increase in the electron cloud density in narrow ranges of magnetic field near the resonances. For ILC parameters the increase in the density is up to a factor ∼ 3, and the spatial distribution of the electrons is broader near resonances, lacking the well-defined density 'stripes' of multipactoring found for non-resonant cases. Simulations with the 2D computer code POSINST, as well as a single-particle tracking code, were used to elucidate the physics of the dynamics. The resonances are expected to affect the electron cloud dynamics in the fringe fields of conventional lattice magnets and in wigglers, where the magnetic fields are low. Results of the simulations, the reason for the bunch-length dependence, and details of the dynamics will be discussed

  16. Simulating the Mg II NUV Spectra & C II Resonance Lines During Solar Flares

    Science.gov (United States)

    Kerr, Graham Stewart; Allred, Joel C.; Leenaarts, Jorrit; Butler, Elizabeth; Kowalski, Adam

    2017-08-01

    The solar chromosphere is the origin of the bulk of the enhanced radiative output during solar flares, and so comprehensive understanding of this region is important if we wish to understand energy transport in solar flares. It is only relatively recently, however, with the launch of IRIS that we have routine spectroscopic flarea observations of the chromsphere and transition region. Since several of the spectral lines observed by IRIS are optically thick, it is necessary to use forward modelling to extract the useful information that these lines carry about the flaring chromosphere and transition region. We present the results of modelling the formation properties Mg II resonance lines & subordinate lines, and the C II resonance lines during solar flares. We focus on understanding their relation to the physical strucutre of the flaring atmosphere, exploiting formation height differences to determine if we can extract information about gradients in the atmosphere. We show the effect of degrading the profiles to the resolution of the IRIS, and that the usual observational techniques used to identify the line centroid do a poor job in the early stages of the flare (partly due to multiple optically thick line components). Finally, we will tentatively comment on the effects that 3D radiation transfer may have on these lines.

  17. Simultaneous PET/MRI with 13C magnetic resonance spectroscopic imaging (hyperPET): phantom-based evaluation of PET quantification

    DEFF Research Database (Denmark)

    Hansen, Adam E.; Andersen, Flemming L.; Henriksen, Sarah T.

    2016-01-01

    Background: Integrated PET/MRI with hyperpolarized 13C magnetic resonance spectroscopic imaging (13C-MRSI) offers simultaneous, dual-modality metabolic imaging. A prerequisite for the use of simultaneous imaging is the absence of interference between the two modalities. This has been documented...... for a clinical whole-body system using simultaneous 1 H-MRI and PET but never for 13C-MRSI and PET. Here, the feasibility of simultaneous PET and 13C-MRSI as well as hyperpolarized 13C-MRSI in an integrated whole-body PET/MRI hybrid scanner is evaluated using phantom experiments. Methods: Combined PET and 13C......-MRSI phantoms including a NEMA [18F]-FDG phantom, 13C-acetate and 13C-urea sources, and hyperpolarized 13C-pyruvate were imaged repeatedly with PET and/or 13C-MRSI. Measurements evaluated for interference effects included PET activity values in the largest sphere and a background region; total number of PET...

  18. The discovery of resonances in multibaryon systems

    International Nuclear Information System (INIS)

    Shahbazian, B.A.

    1978-01-01

    The properties of multibaryon resonances discovered in the collisions of fast neutrons and pions minus with the C 12 nuclei at 7.0 and 4.0 GeV/c momenta, respectively, in the JINR propane bubble chamber have been investigated. It has been shown that due to the hypercharge selection rule (Y<=1) found earlier multibaryon resonances are ultra-high density superstrange objects. The hypothesis has been brought up: the central regions of galaxies and quasars up to certain densities are huge multibaryon or even multihyperon resonances

  19. Resonator quantum electrodynamics on a microtrap chip; Resonator-Quantenelektrodynamik auf einem Mikrofallenchip

    Energy Technology Data Exchange (ETDEWEB)

    Steinmetz, Tilo

    2008-04-29

    In the present dissertation experiments on resonator quantum electrodynamics on a microtrap chip are described. Thereby for the first time single atoms catched in a chip trap could be detected. For this in the framework of this thesis a novel optical microresonator was developed, which can because of its miniaturization be combined with the microtrap technique introduced in our working group for the manipulation of ultracold atoms. For this resonator glass-fiber ends are used as mirror substrates, between which a standing light wave is formed. With such a fiber Fabry-Perot resonator we obtain a finess of up to {approx}37,000. Because of the small mode volumina in spite of moderate resonator quality the coherent interaction between an atom and a photon can be made so large that the regime of the strong atom-resonator coupling is reached. For the one-atom-one-photon coupling rate and the one-atom-one-photon cooperativity thereby record values of g{sub 0}=2{pi}.300 MHz respectively C{sub 0}=210 are reached. Just so for the first time the strong coupling regime between a Bose-Einstein condensate (BEC) and the field of a high-quality resonator could be reached. The BEC was thereby by means of the magnetic microtrap potentials deterministically brought to a position within the resonator and totally transformed in a well defined antinode of an additionally optical standing-wave trap. The spectrum of the coupled atom-resonator system was measured for different atomic numbers and atom-resonator detunings, whereby a collective vacuum Rabi splitting of more than 20 GHz could be reached. [German] In der vorliegenden Dissertation werden Experimente zur Resonator-Quantenelektrodynamik auf einem Mikrofallenchip beschrieben. Dabei konnte u. a. erstmals einzelne, in einer Chipfalle gefangene Atome detektiert werden. Hier fuer wurde im Rahmen dieser Arbeit ein neuartiger optischer Mikroresonator entwickelt, der sich dank seiner Miniaturisierung mit der in unserer Arbeitsgruppe

  20. Is the resonance C(1480) in the φπ0 mass spectrum a new meson?

    International Nuclear Information System (INIS)

    Achasov, N.N.; Kozhevnikov, A.A.

    1988-01-01

    It is shown that the recently discovered resonance structure C (1480) in the φπ 0 mass spectrum of the reaction π - p → φπ 0 n can originate from the rare decay p' (1600) → φπ 0 arising as a result of the OZI-rule violation via intermediate processes p' (1600) → K * anti K+anti K * K → φπ 0 . The study of the reaction e + e - → p' (1600) → φπ 0 is the crucial test of this explanation. (orig.)

  1. Vertebral artery variations at the C1-2 level diagnosed by magnetic resonance angiography

    Energy Technology Data Exchange (ETDEWEB)

    Uchino, Akira; Saito, Naoko; Watadani, Takeyuki; Okada, Yoshitaka; Kozawa, Eito; Nishi, Naoko; Mizukoshi, Waka; Inoue, Kaiji; Nakajima, Reiko; Takahashi, Masahiro [Saitama Medical University International Medical Center, Department of Diagnostic Radiology, Hidaka, Saitama (Japan)

    2012-01-15

    The craniovertebral junction is clinically important. The vertebral artery (VA) in its several variations runs within this area. We report the prevalence of these VA variations on magnetic resonance angiography (MRA). We retrospectively reviewed MRA images, obtained using two 1.5-T imagers, of 2,739 patients, and paid special attention to the course and branching of the VA at the level of the C1-2 vertebral bodies. There were three types of VA variation at the C1-2 level: (1) persistent first intersegmental artery (FIA), (2) VA fenestration, and (3) posterior inferior cerebellar artery (PICA) originating from the C1/2 level. The overall prevalence of these three variations was 5.0%. There was no laterality in frequency, but we found female predominance (P < 0.05). We most frequently observed the persistent FIA (3.2%), which was sometimes bilateral. We found VA fenestration (0.9%) and PICA of C1/2 origin (1.1%) with almost equal frequency. Two PICAs of C1/2 origin had no normal VA branch. We frequently observed VA variations at the C1-2 level and with female predominance. The persistent FIA was most prevalent and sometimes seen bilaterally. Preoperative identification of these variations in VA is necessary to avoid complications during surgery at the craniovertebral junction. (orig.)

  2. C P Gopalakrishnan

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. C P Gopalakrishnan. Articles written in Resonance – Journal of Science Education. Volume 9 Issue 6 June 2004 pp 74-85 Classroom. The Real Effects of Pseudo Forces · P Chaitanya Das G Srinivasa Murthy C P Gopalakrishnan P C Deshmukh · More Details ...

  3. Approximate fuzzy C-means (AFCM) cluster analysis of medical magnetic resonance image (MRI) data

    International Nuclear Information System (INIS)

    DelaPaz, R.L.; Chang, P.J.; Bernstein, R.; Dave, J.V.

    1987-01-01

    The authors describe the application of an approximate fuzzy C-means (AFCM) clustering algorithm as a data dimension reduction approach to medical magnetic resonance images (MRI). Image data consisted of one T1-weighted, two T2-weighted, and one T2*-weighted (magnetic susceptibility) image for each cranial study and a matrix of 10 images generated from 10 combinations of TE and TR for each body lymphoma study. All images were obtained with a 1.5 Tesla imaging system (GE Signa). Analyses were performed on over 100 MR image sets with a variety of pathologies. The cluster analysis was operated in an unsupervised mode and computational overhead was minimized by utilizing a table look-up approach without adversely affecting accuracy. Image data were first segmented into 2 coarse clusters, each of which was then subdivided into 16 fine clusters. The final tissue classifications were presented as color-coded anatomically-mapped images and as two and three dimensional displays of cluster center data in selected feature space (minimum spanning tree). Fuzzy cluster analysis appears to be a clinically useful dimension reduction technique which results in improved diagnostic specificity of medical magnetic resonance images

  4. C Ramakrishnan

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. C Ramakrishnan. Articles written in Resonance – Journal of Science Education. Volume 6 Issue 10 October 2001 pp 48-56 General Article. Ramachandran and his Map · C Ramakrishnan · More Details Fulltext PDF. Volume 13 Issue 1 January 2008 pp 89-98 ...

  5. Out-and-back {sup 13}C-{sup 13}C scalar transfers in protein resonance assignment by proton-detected solid-state NMR under ultra-fast MAS

    Energy Technology Data Exchange (ETDEWEB)

    Barbet-Massin, Emeline; Pell, Andrew J. [University of Lyon, CNRS/ENS Lyon/UCB Lyon 1, Centre de RMN a Tres Hauts Champs (France); Jaudzems, Kristaps [Latvian Institute of Organic Synthesis (Latvia); Franks, W. Trent; Retel, Joren S. [Leibniz-Institut fuer Molekulare Pharmakologie (Germany); Kotelovica, Svetlana; Akopjana, Inara; Tars, Kaspars [Biomedical Research and Study Center (Latvia); Emsley, Lyndon [University of Lyon, CNRS/ENS Lyon/UCB Lyon 1, Centre de RMN a Tres Hauts Champs (France); Oschkinat, Hartmut [Leibniz-Institut fuer Molekulare Pharmakologie (Germany); Lesage, Anne; Pintacuda, Guido, E-mail: guido.pintacuda@ens-lyon.fr [University of Lyon, CNRS/ENS Lyon/UCB Lyon 1, Centre de RMN a Tres Hauts Champs (France)

    2013-08-15

    We present here {sup 1}H-detected triple-resonance H/N/C experiments that incorporate CO-CA and CA-CB out-and-back scalar-transfer blocks optimized for robust resonance assignment in biosolids under ultra-fast magic-angle spinning (MAS). The first experiment, (H)(CO)CA(CO)NH, yields {sup 1}H-detected inter-residue correlations, in which we record the chemical shifts of the CA spins in the first indirect dimension while during the scalar-transfer delays the coherences are present only on the longer-lived CO spins. The second experiment, (H)(CA)CB(CA)NH, correlates the side-chain CB chemical shifts with the NH of the same residue. These high sensitivity experiments are demonstrated on both fully-protonated and 100 %-H{sup N} back-protonated perdeuterated microcrystalline samples of Acinetobacter phage 205 (AP205) capsids at 60 kHz MAS.

  6. An investigation of narrow meson resonance production in antiproton-proton and antiproton-neutron interactions at 6.1 and 8.9 GeV/c

    International Nuclear Information System (INIS)

    Azooz, F.; Butterworth, I.; Dornan, P.J.; Hall, G.; Stern, R.A.; White, A.P.; Brown, R.C.; Butler, N.; Gopal, G.P.; McPherson, A.; Sekulin, R.L.; Brau, J.E.; Carroll, J.T.; Chaloupka, V.; Cautis, C.V.; Dumont, J.J.; Ericson, R.A.; Field, R.C.; Freytag, D.R.; Grandpeix, J.Y.; Kitagaki, T.; Tanaka, S.; Yuta, H.; Abe, K.; Hasegawa, K.; Yamaguchi, A.; Tamai, K.; Takanashi, H.; Mann, W.A.; Schneps, J.; Wald, H.B.

    1984-01-01

    We have made a comprehensive search for narrow meson resonance production in reactions of the type anti pN->πsub(fast)sup(+-)X and anti pN->psub(fast)X at 6.1 and 8.9 Gev/c in a triggered bubble chamber experiment at the SLAC hybrid facility. From a study of all accessible inclusive, semi-inclusive and exclusive states we give upper limits for production of non-strange resonances with width 2 . In a previous publication [1] we gave evidence for production of a narrow state of mass 2.02 GeV/c 2 , coupled to Nanti N, in our data. In the present study we find two further peaks of statistical significance in excess of 4 standard deviations with masses in the Mproportional2 GeV/c 2 region, and one further multipion peak with mass proportional1.54 GeV/c 2 , all of which merit further experimental investigation. (orig.)

  7. Optimizing C4+ and C5+ beams of the Kei2 electron cyclotron resonance ion source using a special gas-mixing technique

    International Nuclear Information System (INIS)

    Drentje, A.G.; Muramatsu, M.; Kitagawa, A.

    2006-01-01

    With the prototype electron cyclotron resonance ion source for the next carbon therapy facility in Japan a series of measurements has been performed in order (a) to find the best condition for producing high beam currents of C 4+ ions, and (b) to study the effect of 'special' gas mixing by using a chemical compound as a feed gas. The effect would then appear as an increase in high charge state production in this case of C 5+ ions. In 'regular' gas-mixing experiments it is well known that an isotopic phenomenon occurs: a heavier isotope of the mixing gas is increasing the production of high charge states of the beam gas ions. A similar isotopic effect has been found in the present experiment: with deuterated methane (CD 4 gas) the C 5+ beam currents are about 10% higher than with regular methane (CH 4 gas). The 'mixing-gas' ratio D (or H) to C can be decreased by choosing, e.g., butane gas; in this case the isotopic effect for C 5+ production is even stronger (>15%). For production of C 4+ ions the isotopic effect appears to be absent. Clearly this is related to the much easier production. It turns out that the relative amount of carbon is much more important: butane gives about 10% higher C 4+ -ion currents than methane

  8. Equivalent circuit for the characterization of the resonance mode in piezoelectric systems

    Science.gov (United States)

    Fernández-Afonso, Y.; García-Zaldívar, O.; Calderón-Piñar, F.

    2015-12-01

    The impedance properties in polarized piezoelectric can be described by electric equivalent circuits. The classic circuit used in the literature to describe real systems is formed by one resistor (R), one inductance (L) and one capacitance C connected in series and one capacity (C0) connected in parallel with the formers. Nevertheless, the equation that describe the resonance and anti-resonance frequencies depends on a complex manner of R, L, C and C0. In this work is proposed a simpler model formed by one inductance (L) and one capacity (C) in series; one capacity (C0) in parallel; one resistor (RP) in parallel and one resistor (RS) in series with other components. Unlike the traditional circuit, the equivalent circuit elements in the proposed model can be simply determined by knowing the experimental values of the resonance frequency fr, anti-resonance frequency fa, impedance module at resonance frequency |Zr|, impedance module at anti-resonance frequency |Za| and low frequency capacitance C0, without fitting the impedance experimental data to the obtained equation.

  9. Equivalent circuit for the characterization of the resonance mode in piezoelectric systems

    Directory of Open Access Journals (Sweden)

    Y. Fernández-Afonso

    2015-12-01

    Full Text Available The impedance properties in polarized piezoelectric can be described by electric equivalent circuits. The classic circuit used in the literature to describe real systems is formed by one resistor (R, one inductance (L and one capacitance C connected in series and one capacity (C0 connected in parallel with the formers. Nevertheless, the equation that describe the resonance and anti-resonance frequencies depends on a complex manner of R, L, C and C0. In this work is proposed a simpler model formed by one inductance (L and one capacity (C in series; one capacity (C0 in parallel; one resistor (RP in parallel and one resistor (RS in series with other components. Unlike the traditional circuit, the equivalent circuit elements in the proposed model can be simply determined by knowing the experimental values of the resonance frequency fr, anti-resonance frequency fa, impedance module at resonance frequency |Zr|, impedance module at anti-resonance frequency |Za| and low frequency capacitance C0, without fitting the impedance experimental data to the obtained equation.

  10. An analytical approximation for resonance integral

    International Nuclear Information System (INIS)

    Magalhaes, C.G. de; Martinez, A.S.

    1985-01-01

    It is developed a method which allows to obtain an analytical solution for the resonance integral. The problem formulation is completely theoretical and based in concepts of physics of general character. The analytical expression for integral does not involve any empiric correlation or parameter. Results of approximation are compared with pattern values for each individual resonance and for sum of all resonances. (M.C.K.) [pt

  11. Feshbach resonances in cold collisions of potassium atoms

    International Nuclear Information System (INIS)

    Bambini, A.; Geltman, S.

    2002-01-01

    In this paper we briefly review the basic steps that allow the calculation of the scattering length in the collision of two alkali-metal atoms in a well defined magnetic polarization state, and in the presence of a static magnetic field. Calculations are actually done for the low-field seeking state F=1, μ F =-1 of bosonic potassium atoms. The electrostatic potentials obtained through Rydberg-Klein-Rees data are connected to a dispersive, long range tail in which the dominant dipole-dipole C 6 term may take different values within a specified range. We show the occurrence of Feshbach resonances in the ultra cold collision of two identical atoms, belonging either to the bosonic species 39 K or 41 K. Our results demonstrate that there is a range of C 6 values for which the collision of two 39 K atoms displays a single resonance, while for other values of C 6 no resonance occurs. On the other hand, Feshbach resonances are present in the collision of two 41 K atoms for almost all values of the dispersion coefficient C 6 in that range. We also show the origin of the different types of Feshbach resonances that occur in the cold collision of two 41 K atoms. The detection of such resonances can help establish the actual value of the dispersive coefficient

  12. Excitation of the Roper resonance and study of higher baryon resonances

    International Nuclear Information System (INIS)

    Morsch, H.P.; Forschungszentrum Juelich GmbH

    1992-01-01

    The region of the P 11 resonance N(1440) is investigated in inelastic α-scattering on hydrogen using alpha-particles from Saturne with a beam momentum of 7 GeV/c. In the missing mass spectra of the scattered α-particles two effects are observed, excitation of the projectile, preferentially excited to the Δ-resonance, and excitation of the Roper resonance. The large differential cross sections indicate a structure of a compression mode. From this the compressibility of the nucleon K N may be extracted. The Roper resonance excitation corresponds to a surface mode which may be related to an oscillation of the meson cloud. The other monopole mode which corresponds to a vibration of the valence quarks should lie at about 800 MeV of excitation or above. This is the region of the P 11 (1710 MeV) resonance. Therefore experiments are important to measure the monopole strength in this energy region. Another interesting aspect is the scalar polarizability which can be extracted from inelastic dipole excitations (squeezing modes) as excitation energies above 500 MeV

  13. C S Smith

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. C S Smith. Articles written in Resonance – Journal of Science Education. Volume 11 Issue 6 June 2006 pp 79-93 Classics. Excerpts from A Search for Structure · C S Smith · More Details Fulltext PDF ...

  14. 13C-detected NMR experiments for automatic resonance assignment of IDPs and multiple-fixing SMFT processing

    International Nuclear Information System (INIS)

    Dziekański, Paweł; Grudziąż, Katarzyna; Jarvoll, Patrik; Koźmiński, Wiktor; Zawadzka-Kazimierczuk, Anna

    2015-01-01

    Intrinsically disordered proteins (IDPs) have recently attracted much interest, due to their role in many biological processes, including signaling and regulation mechanisms. High-dimensional 13 C direct-detected NMR experiments have proven exceptionally useful in case of IDPs, providing spectra with superior peak dispersion. Here, two such novel experiments recorded with non-uniform sampling are introduced, these are 5D HabCabCO(CA)NCO and 5D HNCO(CA)NCO. Together with the 4D (HACA)CON(CA)NCO, an extension of the previously published 3D experiments (Pantoja-Uceda and Santoro in J Biomol NMR 59:43–50, 2014. doi: 10.1007/s10858-014-9827-1 10.1007/s10858-014-9827-1 ), they form a set allowing for complete and reliable resonance assignment of difficult IDPs. The processing is performed with sparse multidimensional Fourier transform based on the concept of restricting (fixing) some of spectral dimensions to a priori known resonance frequencies. In our study, a multiple-fixing method was developed, that allows easy access to spectral data. The experiments were tested on a resolution-demanding alpha-synuclein sample. Due to superior peak dispersion in high-dimensional spectrum and availability of the sequential connectivities between four consecutive residues, the overwhelming majority of resonances could be assigned automatically using the TSAR program

  15. Nanoelectromechanical resonator for logic operations

    KAUST Repository

    Kazmi, Syed N. R.

    2017-08-29

    We report an electro-thermally tunable in-plane doubly-clamped nanoelectromechanical resonator capable of dynamically performing NOR, NOT, XNOR, XOR, and AND logic operations. Toward this, a silicon based resonator is fabricated using standard e-beam lithography and surface nanomachining of a highly conductive device layer of a silicon-on-insulator (SOI) wafer. The performance of this logic device is examined at elevated temperatures, ranging from 25 °C to 85 °C, demonstrating its resilience for most of the logic operations; thereby paving the way towards nano-elements-based mechanical computing.

  16. Optical and magnetic resonance signatures of deep levels in semi-insulating 4H SiC

    International Nuclear Information System (INIS)

    Carlos, W.E.; Glaser, E.R.; Shanabrook, B.V.

    2003-01-01

    We have studied semi-insulating (SI) 4H SiC grown by physical vapor transport (PVT) and by high-temperature chemical vapor deposition (HTCVD) using electron paramagnetic resonance (EPR) and infrared photoluminescence (IR-PL) to better understand the defect(s) responsible for the SI behavior. Although intrinsic defects such as the isolated carbon vacancy and in some cases the isolated Si vacancies have previously been observed by EPR in undoped SI SiC, their concentrations are an order of magnitude too low to be responsible for the SI behavior. We are able to observe the EPR signature of the carbon vacancy-carbon antisite pair (V C -C Si ) pair defect in an excited state of its 2+ charge state in all PVT samples and some HTCVD samples. We also establish the IR-PL signature of this EPR center as the UD2 spectrum - a set of four sharp lines between 1.1 and 1.15 eV previously observed by Magnusson et al. in neutron-irradiated 4H-SiC. We also observe the UD1 line, a pair of sharp IR-PL lines at ∼1.06 eV and UD3, a single sharp line at ∼1.36 eV. We propose a simple model for the SI behavior in material in which the (V C -C Si ) pair defect is the dominant deep defect

  17. Elastic relaxations associated with the Pm3m-R3c transition in LaA103 III: superattenuation of acoustic resonances

    Energy Technology Data Exchange (ETDEWEB)

    Darling, Timothy W [Los Alamos National Laboratory; Carpenter, M A [UNIV OF CAMBRIDGE; Buckley, A [UNIV OF CAMBRIDGE; Taylor, P A [UNIV OF CAMBRIDGE; Mcknight, R E A [UNIV OF CAMBRIDGE

    2009-01-01

    Resonant Ultrasound Spectroscopy has been used to characterize elastic softening and a variety of new acoustic dissipation processes associated with the Pm{bar 3}m {leftrightarrow} R{bar 3}c transition in single crystal and ceramic samples of LaAlO{sub 3}. Softening of the cubic structure ahead of the transition point is not accompanied by an increase in dissipation but follows different temperature dependences for the bulk modulus, 1/3(C{sub 11} + 2C{sub 12}), and the shear components 1/2(C{sub 11}-C{sub 12}) and C{sub 44} as if the tilting instability contains two slightly different critical temperatures. The transition itself is marked by the complete disappearance of resonance peaks (superattenuation), which then reappear below {approx}700 K in spectra from single crystals. Comparison with low frequency, high stress data from the literature indicate that the dissipation is not due to macroscopic displacement of needle twins. An alternative mechanism, local bowing of twin walls under low dynamic stress, is proposed. Pinning of the walls with respect to this displacement process occurs below {approx}350 K. Anelasticity maps, analogous to plastic deformation mechanism maps, are proposed to display dispersion relations and temperature/frequency/stress fields for different twin wall related dissipation mechanisms. An additional dissipation process, with an activation energy of 43 {+-} 6 kJ.mole{sup -1}, occurs in the vicinity of 250 K. The mechanism for this is not known, but it is associated with C{sub 44} and therefore appears to be related in some way to the cubic {leftrightarrow} rhombohedral transition at {approx}817 K. Slight softening in the temperature interval {approx}220 {yields} 70 K of resonance peaks determined by shear elastic constants hints at an incipient E{sub g} ferroelastic instability in LaAlO{sub 3}. The softening interval ends with a further dissipation peak at {approx} 60 K, the origin of which is discussed in terms of freezing of atomic

  18. Observation of $S=+1$ Narrow Resonances in the System $pK^0_s$ from $p+\\rm {C_3H_8}$ Collision at 10 GeV/$c$

    CERN Document Server

    Aslanyan, P Zh; Rikhvitskaya, G G

    2004-01-01

    Experimental data from a 2 m propane bubble chamber have been analyzed to search for an exotic baryon state, the $\\Theta^+$ baryon, in the $pK^0_s$ decay mode for the reaction $p+{\\rm C_3H_8}$ at 10 GeV/$c$. The $pK^0_s$ invariant mass spectrum shows resonant structures with $M_{p K_s^0}=1540\\pm 8$, $1613\\pm10$, $1821\\pm11$ MeV/$c^2$ and $\\Gamma_{p K_s^0}= 9.2\\pm1.8$, $16.1\\pm4.1$, $28.0\\pm9.4$ MeV/$c^2$. The statistical significance of these peaks has been estimated as $5.5$, $4.8$ and $5.0$ s.d., respectively. There are also small peaks in mass regions of 1487 (3.0 s.d.), 1690 (3.6 s.d.) and 1980 (3.0 s.d.) MeV/$c^2$.

  19. Vanishing chiral couplings in the large-NC resonance theory

    International Nuclear Information System (INIS)

    Portoles, Jorge; Rosell, Ignasi; Ruiz-Femenia, Pedro

    2007-01-01

    The construction of a resonance theory involving hadrons requires implementing the information from higher scales into the couplings of the effective Lagrangian. We consider the large-N C chiral resonance theory incorporating scalars and pseudoscalars, and we find that, by imposing LO short-distance constraints on form factors of QCD currents constructed within this theory, the chiral low-energy constants satisfy resonance saturation at NLO in the 1/N C expansion

  20. Measurement of resonance production in pion-carbon interactions at 158 and 350 GeV/c with NA61/SHINE

    Energy Technology Data Exchange (ETDEWEB)

    Herve, Alexander [KIT, Karlsruhe (Germany); Collaboration: NA61/SHINE-Collaboration

    2016-07-01

    The interpretation of extensive air shower measurements, produced by ultra-high energy cosmic rays, relies on the correct modelling of the hadron-air interactions that occur during the shower development. The majority of hadronic particles is produced at equivalent beam energies below the TeV range. NA61/SHINE is a fixed target experiment at the CERN Super Proton Synchrotron, studying hadron production in hadron-nucleus and nucleus-nucleus collisions to provide valuable contributions to a number of subjects, from neutrino through cosmic-ray to heavy-ion physics. Pion-Carbon interactions have been performed, at 158 and 350 GeV/c, to give precise particle production measurements for the most numerous projectile in air showers, the π meson. The ability to measure the production of resonances, such as the ρ{sup 0} and ω mesons, is particularly important to predict the number of muons produced in air showers. In this contribution we present updated results of resonance spectra at 158 and 350 GeV/c measured by NA61/SHINE.

  1. (π±, π±' N) reactions on 12C and 208Pb near the giant resonance region

    International Nuclear Information System (INIS)

    Yoo, Sung Hoon.

    1990-05-01

    Angular distributions for the 12 C(π ± , π ± ' p) and 208 Pb(π ± , π ± ' p or n) reactions near the giant resonance region have been measured at T π = 180 MeV, and found different between π + and π - data. This observation is interpreted as evidence for different excitation mechanisms dominating the π - -nucleus and π + -nucleus interactions in the giant resonance region of these targets. A comparison with the single-nucleon knock-out distorted-wave impulse approximation calculations shows, even though these calculations underestimate (π ± , π ± ' N) data for both targets, the dominance of direct process for (π + , π + ' p) or (π - , π - ' n) in contrast to (π - , π - ' p) or (π + , π + ' n). In the (π + , π + ' p) reaction proton-proton hole states are excited directly and appear to have a large probability for direct decay with escape width, whereas in (π - , π - ' p) the preferentially excited neutron-neutron hole doorway states couple to resonance states and decay with spreading width. This interpretation led us to suggest that the ratio of cross-sections for inelastic scattering to the giant resonance region should be written in terms of an incoherent sum of cross-sections to neutron and proton doorway states. In a heavy nucleus such as 208 Pb, neutron and proton doorway states. In a heavy nucleus such as 208 Pb, neutron and proton doorway states contribute incoherently because the different decay processes do not populate the same final states of the residual nucleus

  2. Energy transport in mirror machine LISA at electron cyclotron resonance

    International Nuclear Information System (INIS)

    Cunha Rapozo, C. da; Serbeto, A.; Torres-Silva, H.

    1993-01-01

    It is shown that a classical transport calculation is adequate to predict the steady state temperature of the RF produced plasma in LISA machine for both large and small resonant volumes. Temperature anisotropy ranging from 55 to 305 was found which was larger for small resonant volume, and the temperature relaxation was larger at large resonant one. This agrees with the fact that there is a Coulomb relaxation ν c which is proportional to T e -3/2 . It is also shown that the fitting parameter alpha is larger for large resonant volume than for small resonant one. (L.C.J.A.)

  3. Two-body molecular model for resonances in heavy ion reactions

    International Nuclear Information System (INIS)

    Abe, Y.

    1978-01-01

    It is necessary to develop qualitative arguments on resonance mechanisms, which will give an overview on occurrences of resonances in heavy ion reactions, and further to identify typical examples of nuclear molecules among existing experimental data. In section 2, qualitative arguments on resonance mechanisms are given by exemplifying the 12 C + 16 O system with the 3 - excitation of the 16 O nucleus. In section 3 a simple formulation in the coupled channel framework is given. Resonances in the 12 C - 16 O system, which has been observed well above the Coulomb barrier, are investigated in section 4. In section 5 an old, but not yet solved problem on resonances in the 12 C + 12 C system which have been observed at sub-Coulomb energies, is taken up along the nuclear molecular picture. Further discussions are given on a role of the 20 Ne-α channel along the present simple qualitative picture given in section 2, which can be extended to rearrangement channels. (Auth.)

  4. Investigation of 3C-SiC/SiO2 interfacial point defects from ab initio g-tensor calculations and electron paramagnetic resonance measurements

    Science.gov (United States)

    Nugraha, T. A.; Rohrmueller, M.; Gerstmann, U.; Greulich-Weber, S.; Stellhorn, A.; Cantin, J. L.; von Bardeleben, J.; Schmidt, W. G.; Wippermann, S.

    SiC is widely used in high-power, high-frequency electronic devices. Recently, it has also been employed as a building block in nanocomposites used as light absorbers in solar energy conversion devices. Analogous to Si, SiC features SiO2 as native oxide that can be used for passivation and insulating layers. However, a significant number of defect states are reported to form at SiC/SiO2 interfaces, limiting mobility and increasing recombination of free charge carriers. We investigated the growth of oxide on different 3C-SiC surfaces from first principles. Carbon antisite Csi defects are found to be strongly stabilized in particular at the interface, because carbon changes its hybridization from sp3 in the SiC-bulk to sp2 at the interface, creating a dangling bond inside a porous region of the SiO2 passivating layer. Combining ab initio g-tensor calculations and electron paramagnetic resonance (EPR) measurements, we show that Csi defects explain the measured EPR signatures, while the hyperfine structure allows to obtain local structural information of the oxide layer. Financial support from BMBF NanoMatFutur Grant 13N12972 and DFG priority program SPP-1601 is gratefully acknowledged.

  5. The effect of resonance production and diffraction on the inclusive spectra of pions and protons in 19 GeV/c pn interactions

    International Nuclear Information System (INIS)

    Bakken, V.; Breivik, F.O.; Jacobsen, T.

    1984-01-01

    Bubble chamber data on pn interactions at 19 GeV/c are used to investigate the effects of nucleon diffraction and resonance production on the inclusive x- and psub(T)sup(2)-distributions of protons and pions. The differential distributions of p, π - and distributions from the decay of the strong resonances Δsup(++)(1232) and Δ - (1232) and from rho 0 (770) are determined. The x-distributions of the protons in the two c.m. hemispheres become quite similar when the effect of diffraction and Δsup(++) is subtracted. The psub(T)sup(2)-distributions can then be described by a single exponential in the whole kinematic region. The net effect on the shape of the x-distributions of the pions due to diffraction, effect of these processes on the particle ratio π - /π + is investigated. By excluding the diffraction and Δsup(++)/Δ - production, the strength of the low-psub(T)sup(2) component of the psub(T)sup(2)-distributions of the pions is reduced, but it seems that diffraction and resonance production cannot account for all oft his low-psub(T)sup(2) enhancement

  6. Dhruv C Hoysall

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. Dhruv C Hoysall. Articles written in Resonance – Journal of Science Education. Volume 13 Issue 4 April 2008 pp 378-393 Classroom. Spinning Ball Flight Under Moderate Wind · K R Y Simha Dhruv C Hoysall · More Details Fulltext PDF ...

  7. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. C E Veni Madhavan. Articles written in Resonance – Journal of Science Education. Volume 1 Issue 1 January 1996 pp 108-108 Research News. Factoring Fermat Numbers · C E Veni Madhavan · More Details Fulltext PDF ...

  8. Observation of overlapping spin-1 and spin-3 D0K- resonances at mass 2.86 GeV/c2.

    Science.gov (United States)

    Aaij, R; Adeva, B; Adinolfi, M; Affolder, A; Ajaltouni, Z; Akar, S; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves, A A; Amato, S; Amerio, S; Amhis, Y; An, L; Anderlini, L; Anderson, J; Andreassen, R; Andreotti, M; Andrews, J E; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Baalouch, M; Bachmann, S; Back, J J; Badalov, A; Baesso, C; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Batozskaya, V; Battista, V; Bay, A; Beaucourt, L; Beddow, J; Bedeschi, F; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M-O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Borsato, M; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brodzicka, J; Brook, N H; Brown, H; Bursche, A; Busetto, G; Buytaert, J; Cadeddu, S; Calabrese, R; Calvi, M; Calvo Gomez, M; Campana, P; Campora Perez, D; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carson, L; Carvalho Akiba, K; Casse, G; Cassina, L; Castillo Garcia, L; Cattaneo, M; Cauet, Ch; Cenci, R; Charles, M; Charpentier, Ph; Chefdeville, M; Chen, S; Cheung, S-F; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Corvo, M; Counts, I; Couturier, B; Cowan, G A; Craik, D C; Cruz Torres, M; Cunliffe, S; Currie, R; D'Ambrosio, C; Dalseno, J; David, P; David, P N Y; Davis, A; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Del Buono, L; Déléage, N; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dijkstra, H; Donleavy, S; Dordei, F; Dorigo, M; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dreimanis, K; Dujany, G; Dupertuis, F; Durante, P; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Ely, S; Esen, S; Evans, H-M; Evans, T; Falabella, A; Färber, C; Farinelli, C; Farley, N; Farry, S; Fay, Rf; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fiore, M; Fiorini, M; Firlej, M; Fitzpatrick, C; Fiutowski, T; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Fu, J; Furfaro, E; Gallas Torreira, A; Galli, D; Gallorini, S; Gambetta, S; Gandelman, M; Gandini, P; Gao, Y; García Pardiñas, J; Garofoli, J; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gavardi, L; Gavrilov, G; Geraci, A; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gianelle, A; Gianì, S; Gibson, V; Giubega, L; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gotti, C; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Griffith, P; Grillo, L; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hamilton, B; Hampson, T; Han, X; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; He, J; Head, T; Heijne, V; Hennessy, K; Henrard, P; Henry, L; Hernando Morata, J A; van Herwijnen, E; Heß, M; Hicheur, A; Hill, D; Hoballah, M; Hombach, C; Hulsbergen, W; Hunt, P; Hussain, N; Hutchcroft, D; Hynds, D; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jalocha, J; Jans, E; Jaton, P; Jawahery, A; Jing, F; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Jurik, N; Kaballo, M; Kandybei, S; Kanso, W; Karacson, M; Karbach, T M; Karodia, S; Kelsey, M; Kenyon, I R; Ketel, T; Khanji, B; Khurewathanakul, C; Klaver, S; Klimaszewski, K; Kochebina, O; Kolpin, M; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucewicz, W; Kucharczyk, M; Kudryavtsev, V; Kurek, K; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanfranchi, G; Langenbruch, C; Langhans, B; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J-P; Lefèvre, R; Leflat, A; Lefrançois, J; Leo, S; Leroy, O; Lesiak, T; Leverington, B; Li, Y; Likhomanenko, T; Liles, M; Lindner, R; Linn, C; Lionetto, F; Liu, B; Lohn, S; Longstaff, I; Lopes, J H; Lopez-March, N; Lowdon, P; Lu, H; Lucchesi, D; Luo, H; Lupato, A; Luppi, E; Lupton, O; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Malinin, A; Manca, G; Mancinelli, G; Mapelli, A; Maratas, J; Marchand, J F; Marconi, U; Marin Benito, C; Marino, P; Märki, R; Marks, J; Martellotti, G; Martens, A; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martinez Vidal, F; Martins Tostes, D; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Mazurov, A; McCann, M; McCarthy, J; McNab, A; McNulty, R; McSkelly, B; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M-N; Moggi, N; Molina Rodriguez, J; Monteil, S; Morandin, M; Morawski, P; Mordà, A; Morello, M J; Moron, J; Morris, A-B; Mountain, R; Muheim, F; Müller, K; Mussini, M; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neri, N; Neubert, S; Neufeld, N; Neuner, M; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Novoselov, A; O'Hanlon, D P; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Onderwater, G; Orlandea, M; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pal, B K; Palano, A; Palombo, F; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Pappalardo, L L; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrignani, C; Pazos Alvarez, A; Pearce, A; Pellegrino, A; Pepe Altarelli, M; Perazzini, S; Perez Trigo, E; Perret, P; Perrin-Terrin, M; Pescatore, L; Pesen, E; Petridis, K; Petrolini, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Pistone, A; Playfer, S; Plo Casasus, M; Polci, F; Poluektov, A; Polycarpo, E; Popov, A; Popov, D; Popovici, B; Potterat, C; Price, E; Prisciandaro, J; Pritchard, A; Prouve, C; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Rachwal, B; Rademacker, J H; Rakotomiaramanana, B; Rama, M; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Reichert, S; Reid, M M; Dos Reis, A C; Ricciardi, S; Richards, S; Rihl, M; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Rodrigues, A B; Rodrigues, E; Rodriguez Perez, P; Roiser, S; Romanovsky, V; Romero Vidal, A; Rotondo, M; Rouvinet, J; Ruf, T; Ruffini, F; Ruiz, H; Ruiz Valls, P; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salustino Guimaraes, V; Sanchez Mayordomo, C; Sanmartin Sedes, B; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sarti, A; Satriano, C; Satta, A; Saunders, D M; Savrie, M; Savrina, D; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M-H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Sepp, I; Serra, N; Serrano, J; Sestini, L; Seyfert, P; Shapkin, M; Shapoval, I; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, V; Shires, A; Silva Coutinho, R; Simi, G; Sirendi, M; Skidmore, N; Skwarnicki, T; Smith, N A; Smith, E; Smith, E; Smith, J; Smith, M; Snoek, H; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Sridharan, S; Stagni, F; Stahl, M; Stahl, S; Steinkamp, O; Stenyakin, O; Stevenson, S; Stoica, S; Stone, S; Storaci, B; Stracka, S; Straticiuc, M; Straumann, U; Stroili, R; Subbiah, V K; Sun, L; Sutcliffe, W; Swientek, K; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szilard, D; Szumlak, T; T'Jampens, S; Teklishyn, M; Tellarini, G; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tomassetti, L; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Ustyuzhanin, A; Uwer, U; Vagnoni, V; Valenti, G; Vallier, A; Vazquez Gomez, R; Vazquez Regueiro, P; Vázquez Sierra, C; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vieites Diaz, M; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; de Vries, J A; Waldi, R; Wallace, C; Wallace, R; Walsh, J; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Websdale, D; Whitehead, M; Wicht, J; Wiedner, D; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wimberley, J; Wishahi, J; Wislicki, W; Witek, M; Wormser, G; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, Z; Xu, Z; Yang, Z; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhokhov, A; Zhong, L; Zvyagin, A

    2014-10-17

    The resonant substructure of B(s)(0) → D(0)K(-)π(+) decays is studied using a data sample corresponding to an integrated luminosity of 3.0 fb(-1) of pp collision data recorded by the LHCb detector. An excess at m(D(0)K(-))≈ 2.86 GeV/c(2) is found to be an admixture of spin-1 and spin-3 resonances. Therefore, the D(sJ)*(2860)(-) state previously observed in inclusive e(+)e(-) → D(0)K(-)X and pp → D(0)K(-)X processes consists of at least two particles. This is the first observation of a heavy flavored spin-3 resonance, and the first time that any spin-3 particle has been seen to be produced in B decays. The masses and widths of the new states and of the D(s2)*(2573)(-) meson are measured, giving the most precise determinations to date.

  9. Shekhar C Mande

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. Shekhar C Mande. Articles written in Resonance – Journal of Science Education. Volume 22 Issue 9 September 2017 pp 829-833 General Article. Nobel Prize in Physiology or Medicine 2016 · Shekhar C Mande Jyoti Rao · More Details Abstract Fulltext PDF.

  10. NMR 1H,13C, 15N backbone and 13C side chain resonance assignment of the G12C mutant of human K-Ras bound to GDP.

    Science.gov (United States)

    Sharma, Alok K; Lee, Seung-Joo; Rigby, Alan C; Townson, Sharon A

    2018-05-02

    K-Ras is a key driver of oncogenesis, accounting for approximately 80% of Ras-driven human cancers. The small GTPase cycles between an inactive, GDP-bound and an active, GTP-bound state, regulated by guanine nucleotide exchange factors and GTPase activating proteins, respectively. Activated K-Ras regulates cell proliferation, differentiation and survival by signaling through several effector pathways, including Raf-MAPK. Oncogenic mutations that impair the GTPase activity of K-Ras result in a hyperactivated state, leading to uncontrolled cellular proliferation and tumorogenesis. A cysteine mutation at glycine 12 is commonly found in K-Ras associated cancers, and has become a recent focus for therapeutic intervention. We report here 1 H N, 15 N, and 13 C resonance assignments for the 19.3 kDa (aa 1-169) human K-Ras protein harboring an oncogenic G12C mutation in the GDP-bound form (K-RAS G12C-GDP ), using heteronuclear, multidimensional NMR spectroscopy. Backbone 1 H- 15 N correlations have been assigned for all non-proline residues, except for the first methionine residue.

  11. Extracellular diffusion quantified by magnetic resonance imaging during rat C6 glioma cell progression

    Directory of Open Access Journals (Sweden)

    G. Song

    Full Text Available Solution reflux and edema hamper the convection-enhanced delivery of the standard treatment for glioma. Therefore, a real-time magnetic resonance imaging (MRI method was developed to monitor the dosing process, but a quantitative analysis of local diffusion and clearance parameters has not been assessed. The objective of this study was to compare diffusion into the extracellular space (ECS at different stages of rat C6 gliomas, and analyze the effects of the extracellular matrix (ECM on the diffusion process. At 10 and 20 days, after successful glioma modeling, gadolinium-diethylenetriamine pentaacetic acid (Gd-DTPA was introduced into the ECS of rat C6 gliomas. Diffusion parameters and half-life of the reagent were then detected using MRI, and quantified according to the mathematical model of diffusion. The main ECM components [chondroitin sulfate proteoglycans (CSPGs, collagen IV, and tenascin C] were detected by immunohistochemical and immunoblot analyses. In 20-day gliomas, Gd-DTPA diffused more slowly and derived higher tortuosity, with lower clearance rate and longer half-life compared to 10-day gliomas. The increased glioma ECM was associated with different diffusion and clearance parameters in 20-day rat gliomas compared to 10-day gliomas. ECS parameters were altered with C6 glioma progression from increased ECM content. Our study might help better understand the glioma microenvironment and provide benefits for interstitial drug delivery to treat brain gliomas.

  12. Pion elastic scattering from polarized 13C in the energy region of the P33 resonance

    International Nuclear Information System (INIS)

    Yifen, Yen

    1992-08-01

    Asymmetries (A y ) and differential cross sections (dσ/dΩ) were measured for π + and π - elastic scattering using polarized and unpolarized 13 C targets. The experiment was done at the Los Alamos Meson Physics Facility with the pion beam from the Low Energy Pion channel. The scattered pions were detected with the Large Acceptance Spectrometer. The 13 C nuclei in 13 C-enriched 1-butanol were polarized by the dynamic nuclear polarilization method. Angular distributions of both A y and dσ/dΩ were measured below the P 33 resonance at the incident energy of 130 MeV for π + and π - , and above the resonance at 223 MeV for π + and at 226 MeV for π - . In addition, A y and dσ/dΩ were measured in a range of momentum transfers, 1.75 ≤ q ≤ 2.05 fm - , at several energies. At 130 MeV, the values of A y are significantly different from zero for π - scattering. For π + at 130 MeV and for both π - and π + at all other energies, the A y are mostly consistent with zero. Theoretical analyses were done using different nuclear structure models. The data were not reproduced by the presently available nuclear wave functions. It was found that the asymmetry is strongly sensitive to the quadrupole spin flip part of the transition. The data of this thesis complement measurements of the magnetic form factor from electron scattering. In attempts to fit both the asymmetry and the magnetic form factor, it was found that the pion asymmetry data are not reproduced by the wavefunctions which fit the magnetic form factor at low momentum transfers

  13. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. C P Navathe. Articles written in Resonance – Journal of Science Education. Volume 11 Issue 3 March 2006 pp 80-85 Classroom. Understanding Vanishing Energy During Charging of Capacitor Level · C P Navathe S Nigam · More Details Fulltext PDF ...

  14. Segmentation of Brain Tissues from Magnetic Resonance Images Using Adaptively Regularized Kernel-Based Fuzzy C-Means Clustering

    Directory of Open Access Journals (Sweden)

    Ahmed Elazab

    2015-01-01

    Full Text Available An adaptively regularized kernel-based fuzzy C-means clustering framework is proposed for segmentation of brain magnetic resonance images. The framework can be in the form of three algorithms for the local average grayscale being replaced by the grayscale of the average filter, median filter, and devised weighted images, respectively. The algorithms employ the heterogeneity of grayscales in the neighborhood and exploit this measure for local contextual information and replace the standard Euclidean distance with Gaussian radial basis kernel functions. The main advantages are adaptiveness to local context, enhanced robustness to preserve image details, independence of clustering parameters, and decreased computational costs. The algorithms have been validated against both synthetic and clinical magnetic resonance images with different types and levels of noises and compared with 6 recent soft clustering algorithms. Experimental results show that the proposed algorithms are superior in preserving image details and segmentation accuracy while maintaining a low computational complexity.

  15. Magnetically coupled Fano resonance of dielectric pentamer oligomer

    International Nuclear Information System (INIS)

    Zhang, Fuli; Li, Chang; He, Xuan; Chen, Lei; Fan, Yuancheng; Zhao, Qian; Zhang, Weihong; Zhou, Ji

    2017-01-01

    We present magnetically induced Fano resonance inside a dielectric metamaterial pentamer composed of ceramic bricks. Unlike previous reports where different sizes of dielectric resonators were essential to produce Fano resonance, under external magnetic field excitation, central and outer dielectric bricks with identical sizes exhibit in-phase and out-of-phase magnetic Mie oscillations. An asymmetric line shape of Fano resonance along with enhanced group delay is observed due to the interference between the magnetic resonance of the central brick and the symmetric magnetic resonance of outer bricks. Besides, Fano resonance blueshifts with the increasing resonance of the smaller central brick. The thermal-dependent permittivity of ceramics allows Fano resonance to be reversibly tuned by 300 MHz when temperature varies by 60 °C. (paper)

  16. Ultra-small v-shaped gold split ring resonators for biosensing using fundamental magnetic resonance in the visible spectrum

    Science.gov (United States)

    Mauluidy Soehartono, Alana; Mueller, Aaron David; Tobing, Landobasa Yosef Mario; Chan, Kok Ken; Zhang, Dao Hua; Yong, Ken-Tye

    2017-10-01

    Strong light localization within metal nanostructures occurs by collective oscillations of plasmons in the form of electric and magnetic resonances. This so-called localized surface plasmon resonance (LSPR) has gained much interest in the development of low-cost sensing platforms in the visible spectrum. However, demonstrations of LSPR-based sensing are mostly limited to electric resonances due to the technological limitations for achieving magnetic resonances in the visible spectrum. In this work, we report the first demonstration of LSPR sensing based on fundamental magnetic resonance in the visible spectrum using ultrasmall gold v-shaped split ring resonators. Specifically, we show the ability for detecting adsorption of bovine serum albumin and cytochrome c biomolecules at monolayer levels, and the selective binding of protein A/G to immunoglobulin G.

  17. Home

    Science.gov (United States)

    AF Branding & Trademark Licensing Join the Air Force Home About Us The Air Force Symbol Display Resources Document Library TM Connect Search AF Branding and Trademark Licensing Program: important links Legal Documents 10 U.S.C. § 2260 15 U.S.C. § 167;167; 1114-1125 DODI 5535.12, DoD Branding and

  18. Two-dimensional nuclear magnetic resonance spectroscopy

    International Nuclear Information System (INIS)

    Bax, A.; Lerner, L.

    1986-01-01

    Great spectral simplification can be obtained by spreading the conventional one-dimensional nuclear magnetic resonance (NMR) spectrum in two independent frequency dimensions. This so-called two-dimensional NMR spectroscopy removes spectral overlap, facilitates spectral assignment, and provides a wealth of additional information. For example, conformational information related to interproton distances is available from resonance intensities in certain types of two-dimensional experiments. Another method generates 1 H NMR spectra of a preselected fragment of the molecule, suppressing resonances from other regions and greatly simplifying spectral appearance. Two-dimensional NMR spectroscopy can also be applied to the study of 13 C and 15 N, not only providing valuable connectivity information but also improving sensitivity of 13 C and 15 N detection by up to two orders of magnitude. 45 references, 10 figures

  19. Measurement of resonances in {sup 12} C + {sup 4} He through inverse kinematics with thick targets; Medicion de resonancias en {sup 12} C + {sup 4} He mediante cinematica inversa con blancos gruesos

    Energy Technology Data Exchange (ETDEWEB)

    Aguilera, E.F.; Lizcano, D.; Martinez Q, E.; Fernandez, M.C.; Murillo, G. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico); Goldberg, V. [Cyclotron Institute, Texas A and M University, College Station, TX 77843 (United States); Skorodumov, B.B.; Rogachev, G. [Physics Department, University of Notre Dame, IN 46556 (United States)

    2003-07-01

    The excitation function of elastic scattering for the system {sup 12} C + {sup 4} He to energy from 0.5 to 3.5 MeV in the center of mass system (c.m.) was measured. We use a gassy thick target and the technique of inverse kinematics which allows to make measurements at 180 degrees in c.m. Using the R matrix theory those was deduced parameters of the resonances and the results were compared with measurements reported in the literature made with other techniques. (Author)

  20. Optically transmitted and inductively coupled electric reference to access in vivo concentrations for quantitative proton-decoupled ¹³C magnetic resonance spectroscopy.

    Science.gov (United States)

    Chen, Xing; Pavan, Matteo; Heinzer-Schweizer, Susanne; Boesiger, Peter; Henning, Anke

    2012-01-01

    This report describes our efforts on quantification of tissue metabolite concentrations in mM by nuclear Overhauser enhanced and proton decoupled (13) C magnetic resonance spectroscopy and the Electric Reference To access In vivo Concentrations (ERETIC) method. Previous work showed that a calibrated synthetic magnetic resonance spectroscopy-like signal transmitted through an optical fiber and inductively coupled into a transmit/receive coil represents a reliable reference standard for in vivo (1) H magnetic resonance spectroscopy quantification on a clinical platform. In this work, we introduce a related implementation that enables simultaneous proton decoupling and ERETIC-based metabolite quantification and hence extends the applicability of the ERETIC method to nuclear Overhauser enhanced and proton decoupled in vivo (13) C magnetic resonance spectroscopy. In addition, ERETIC signal stability under the influence of simultaneous proton decoupling is investigated. The proposed quantification method was cross-validated against internal and external reference standards on human skeletal muscle. The ERETIC signal intensity stability was 100.65 ± 4.18% over 3 months including measurements with and without proton decoupling. Glycogen and unsaturated fatty acid concentrations measured with the ERETIC method were in excellent agreement with internal creatine and external phantom reference methods, showing a difference of 1.85 ± 1.21% for glycogen and 1.84 ± 1.00% for unsaturated fatty acid between ERETIC and creatine-based quantification, whereas the deviations between external reference and creatine-based quantification are 6.95 ± 9.52% and 3.19 ± 2.60%, respectively. Copyright © 2011 Wiley Periodicals, Inc.

  1. Vector and scalar charmonium resonances with lattice QCD

    International Nuclear Information System (INIS)

    Lang, C. B.; Leskovec, Luka; Mohler, Daniel; Prelovsek, Sasa

    2015-01-01

    We perform an exploratory lattice QCD simulation of DD¯ scattering, aimed at determining the masses as well as the decay widths of charmonium resonances above open charm threshold. Neglecting coupling to other channels, the resulting phase shift for DD¯ scattering in p-wave yields the well-known vector resonance ψ(3770). For m π = 156 MeV, the extracted resonance mass and the decay width agree with experiment within large statistical uncertainty. The scalar charmonium resonances present a puzzle, since only the ground state χ c0 (1P) is well understood, while there is no commonly accepted candidate for its first excitation. We simulate DD¯ scattering in s-wave in order to shed light on this puzzle. The resulting phase shift supports the existence of a yet-unobserved narrow resonance with a mass slightly below 4 GeV. A scenario with this narrow resonance and a pole at χ c0 (1P) agrees with the energy-dependence of our phase shift. In addition, further lattice QCD simulations and experimental efforts are needed to resolve the puzzle of the excited scalar charmonia

  2. Effect of resonance production and diffraction on the inclusive spectra of pions and protons in 19 GeV/c pn interactions

    Energy Technology Data Exchange (ETDEWEB)

    Baken, V.; Breivik, F.O.; Jacobsen, T. (Oslo Univ. (Norway). Fysisk Inst.)

    1984-01-01

    Bubble chamber data on pn interactions at 19 GeV/c are used to investigate the effects of nucleon diffraction and resonance production on the inclusive x- and psub(T)/sup 2/-distributions of protons and pions. We determine the differential distributions of p, ..pi../sup -/ and ..pi../sup +/ due to neutron and proton diffraction and similarly the distributions from the decay of the strong resonances ..delta../sup + +/(1232) and ..delta../sup -/(1232) and from rho/sup 0/(770). The x-distributions of the protons in the two c.m. hemispheres become quite similar when the effect of diffraction and ..delta../sup + +/ is subtracted. The psub(T)/sup 2/-distributions can then be described by a single exponential in the whole kinematic region. The net effect on the shapes of the x-distributions of the pions due to diffraction, ..delta../sup + +//..delta../sup -/ and rho/sup 0/ production is rather small. The separate effects of these processes on the particle ratio ..pi../sup -//..pi../sup +/ is investigated. By excluding the diffraction and ..delta../sup + +//..delta../sup -/ production, the strength of the low-psub(T)/sup 2/ component of the psub(T)/sup 2/-distributions of the pions is reduced, but it seems that diffraction and resonance production cannot account for all of this low-psub(T)/sup 2/ enhancement.

  3. The nuclear magnetic resonance spectroscopy

    International Nuclear Information System (INIS)

    Goyer, Ph.

    1997-01-01

    The spectroscopy of nuclear magnetic resonance constitutes a major analytical technique in biological and organic analysis. This technique appears now in the programme of preparatory classes and its teaching is developed in the second year of DEUG. The following article reviews on the nuclear magnetic resonance and on the possibilities it offers to bring to the fore the physico-chemical properties of molecules. (N.C.)

  4. 13C-nuclear magnetic resonance studies of the biosynthesis of 5-aminolevolinic acid destined for chlorophyll formation in dark-grown Scenedesmus Obliquus

    International Nuclear Information System (INIS)

    Oh-hama, Tamiko; Seto, Harvo; Miyachi, Shigetoh

    1985-01-01

    The 13 C-nuclear magnetic resonance (NMR) spectra of chlorophyll-α-formed in dark-grown Scenedesmus Obliquus (Turp.) Kutzing in the presence of (1- 13 C) glutamate, (2- 13 C) and (1- 13 C) glycine showed that the 13 C of glutamate was specifically incorporated into the eight-carbon atoms in the tetrapyrrole macrocyles derived from C-5 of 5-aminolevolinic acid (ALA), while the C-2 of glycine was only incorporated into the methyl carbon of the methoxycarbonyl group attached to the isolcyclic ring of chlorophyll a formed in the presence of (1- 13 C)-glycine. These labelling patterns provide evidence for the operation of the C 5 -pathway and against the operation of the ALA synthase pathway for chlorophyll formation in darkness. (author)

  5. The S-wave resonance contributions to the three-body decays B{sup 0}{sub (s)} → η{sub c}f{sub 0}(X) → η{sub c}π{sup +}π{sup -} in perturbative QCD approach

    Energy Technology Data Exchange (ETDEWEB)

    Li, Ya; Ma, Ai-Jun; Xiao, Zhen-Jun [Nanjing Normal University, Department of Physics, Institute of Theoretical Physics, Nanjing, Jiangsu (China); Wang, Wen-Fei [Shanxi University, Department of Physics, Institute of Theoretical Physics, Taiyuan, Shanxi (China)

    2016-12-15

    In this paper, we study the three-body decays B{sup 0}/B{sup 0}{sub s} → η{sub c}f{sub 0}(X) → η{sub c}π{sup +}π{sup -} by employing the perturbative QCD (PQCD) factorization approach. We evaluate the S-wave resonance contributions by using the two-pion distribution amplitude Φ{sub ππ}{sup S}. The Breit-Wigner formula for the f{sub 0}(500), f{sub 0}(1500), and f{sub 0}(1790) resonances and the Flatte model for the f{sub 0}(980) resonance are adopted to parameterize the time-like scalar form factors F{sub s}(ω{sup 2}). We also use the Bugg model to parameterize the f{sub 0}(500) and compare the relevant theoretical predictions from different models. We found the following results: (a) the PQCD predictions for the branching ratios are B(B{sup 0} → η{sub c}f{sub 0}(500)[π{sup +}π{sup -}]) = (1.53{sup +0.76}{sub -0.35}) x 10{sup -6} for Breit-Wigner model and B(B{sup 0} → η{sub c}f{sub 0}(500)[π{sup +}π{sup -}]) = (2.31{sup +0.96}{sub -0.48}) x 10{sup -6} for Bugg model; (b) B(B{sub s} → η{sub c}f{sub 0}(X)[π{sup +}π{sup -}]) =(5.02{sup +1.49}{sub -1.08}) x 10{sup -5} when the contributions from f{sub 0}(X) = (f{sub 0}(980), f{sub 0}(1500), f{sub 0}(1790)) are all taken into account; and (c) The considered decays could be measured at the ongoing LHCb experiment, consequently, the formalism of two-hadron distribution amplitudes could also be tested by such experiments. (orig.)

  6. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. C S Yogananda. Articles written in Resonance – Journal of Science Education. Volume 1 Issue 1 January 1996 ... Galileo Galilei: Father of Modern Science · C S Yogananda · More Details Fulltext PDF. Volume 6 Issue 9 September 2001 pp 1-2 Editorial. Editorial.

  7. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. T N C Vidya. Articles written in Resonance – Journal of Science Education. Volume 20 Issue 7 July 2015 pp 617-627 General Article. Why So Toxic?: Venom Evolution in Animals · Pritha Kundu Srikant Venkitachalam T N C Vidya · More Details Fulltext PDF ...

  8. Mutual Coupling Reduction of E-Shaped MIMO Antenna with Matrix of C-Shaped Resonators

    Directory of Open Access Journals (Sweden)

    Raghad Ghalib Saadallah Alsultan

    2018-01-01

    Full Text Available E-shaped multiple-input-multiple-output (MIMO microstrip antenna systems operating in WLAN and WiMAX bands (between 5 and 7.5 GHz are proposed with enhanced isolation features. The systems are comprised of two antennas that are placed parallel and orthogonal to each other, respectively. According to the simulation results, the operating frequency of the MIMO antenna system is 6.3 GHz, and mutual coupling is below −18 dB in a parallel arrangement, whereas they are 6.4 GHz and −25 dB, respectively, in the orthogonal arrangement. The 2 × 3 matrix of C-shaped resonator (CSR is proposed and placed between the antenna elements over the substrate, to reduce the mutual coupling and enhance the isolation between the antennas. More than 30 dB isolation between the array elements is achieved at the resonant frequency for both of the configurations. The essential parameters of the MIMO array such as mutual coupling, surface current distribution, envelop correlation coefficient (ECC, diversity gain (DG, and the total efficiency have been simulated to verify the reliability and the validity of the MIMO system in both parallel and orthogonal configurations. The experimental results are also provided and compared for the mutual coupling with simulated results. An adequate match between the measured and simulated results is achieved.

  9. Paramagnetic centers in nanocrystalline TiC/C system

    International Nuclear Information System (INIS)

    Guskos, N.; Bodziony, T.; Maryniak, M.; Typek, J.; Biedunkiewicz, A.

    2008-01-01

    Electron paramagnetic resonance is applied to study the defect centers in nanocrystalline titanium carbide dispersed in carbon matrix (TiC x /C) synthesized by the non-hydrolytic sol-gel process. The presence of Ti 3+ paramagnetic centers is identified below 120 K along with a minor contribution from localized defect spins coupled with the conduction electron system in the carbon matrix. The temperature dependence of the resonance intensity of the latter signal indicates weak antiferromagnetic interactions. The presence of paramagnetic centers connected with trivalent titanium is suggested to be the result of chemical disorder, which can be further related to the observed anomalous behavior of conductivity, hardness, and corrosion resistance of nanocrystalline TiC x /C

  10. Triple resonance experiments for the simultaneous correlation of H6/H5 and exchangeable protons of pyrimidine nucleotides in 13C,15N-labeled RNA applicable to larger RNA molecules

    International Nuclear Information System (INIS)

    Woehnert, Jens; Goerlach, Matthias; Schwalbe, Harald

    2003-01-01

    Triple-resonance two-dimensional H6/H5(C4N)H and C6/C5(C4N)H experiments are described that provide through-bond H6/H5 or C6/C5 to imino/amino correlations in pyrimidine bases in 13 C, 15 N-labeled RNA. The experiments simultaneously transfer H6/H5 magnetization by an INEPT step to the C6/C5 nuclei and by homonuclear CC- and heteronuclear CN-TOCSY steps via the intervening C4 nucleus to the N3/N4 nuclei and then by a reverse INEPT step to the imino/amino hydrogens. The sensitivity of these experiments is high as demonstrated using a 30-nucleotide pyrimidine rich RNA at a concentration of 0.9 mM at temperatures of 10 deg. C and 25 deg. C. This indicates the general applicability of the experiments and the possibility to obtain correlations for imino resonances in non-canonical regions of the target RNA

  11. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. S C Lakhotia. Articles written in Resonance – Journal of Science Education. Volume 2 Issue 4 April 1997 pp 38-47 General Article. What is a Gene? A Question With Variable Answers · S C Lakhotia · More Details Fulltext PDF. Volume 2 Issue 5 May 1997 pp ...

  12. Multipolarity analysis for {sup 14}C high-energy resonance populated by ({sup 18}O,{sup 16}O) two-neutron transfer reaction

    Energy Technology Data Exchange (ETDEWEB)

    Carbone, D., E-mail: carboned@lns.infn.it; Cavallaro, M.; Bondì, M.; Agodi, C.; Cunsolo, A. [INFN-Laboratori Nazionali del Sud, Catania (Italy); Cappuzzello, F. [INFN-Laboratori Nazionali del Sud, Catania (Italy); Dipartimento di Fisica e Astronomia, Università di Catania, Catania (Italy); Azaiez, F.; Franchoo, S.; Khan, E. [Institut de Physique Nucleaire, Universitè Paris-Sud, Orsay (France); Bonaccorso, A. [INFN-Sezione di Pisa, Pisa (Italy); Fortunato, L. [Dipartimento di Fisica e Astronomia, Università di Padova, Padova (Italy); INFN-Sezione di Padova, Padova (Italy); Foti, A. [Dipartimento di Fisica e Astronomia, Università di Catania, Catania (Italy); INFN-Sezione di Catania, Catania (Italy); Linares, R.; Lubian, J. [Instituto de Fisica, Universidade Federal Fluminense, Niteroi (Brazil); Scarpaci, J. A. [Centre de Sciences Nucleaires et de Sciences de Matieres, Universitè Paris-Sud, Orsay (France); Vitturi, A. [INFN-Sezione di Padova, Padova (Italy); INFN-Sezione di Catania, Catania (Italy)

    2015-10-15

    The {sup 12}C({sup 18}O,{sup 16}O){sup 14}C reaction at 84 MeV incident energy has been explored up to high excitation energy of the residual nucleus thanks to the use of the MAGNEX spectrometer to detect the ejectiles. In the region above the two-neutron separation energy, a resonance has been observed at 16.9 MeV. A multipolarity analysis of the cross section angular distribution indicates an L = 0 character for such a transition.

  13. K C Manorama Thampatti

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. K C Manorama Thampatti. Articles written in Resonance – Journal of Science Education. Volume 4 Issue 3 March 1999 pp 62-70 Feature Article. Nature Watch - Rice Bowl in Turmoil: The Kuttanad Wetland Ecosystem · K C Manorama Thampatti K G Padmakumar.

  14. K C Kumara Swamy

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. K C Kumara Swamy. Articles written in Resonance – Journal of Science Education. Volume 11 Issue 9 September 2006 pp 72-75 Feature Article. Molecule Matters - A Chromium Compound with a Quintuple Bond · K C Kumara Swamy · More Details Fulltext PDF ...

  15. Redox reactions of cytochrome c in isolated mitochondria exposed to blue or red lasers using resonance Raman spectroscopy

    Science.gov (United States)

    Denton, Michael L.; Gonzalez, Cherry C.; Noojin, Gary D.; Yakovlev, Vladislav V.

    2018-02-01

    Resonance Raman spectroscopy of cytochrome c was used to follow reduction/oxidation (redox) states of isolated mitochondria in response to blue or red laser exposure. Mitochondria were isolated from hTERT-RPE1 cells and were kept in a buffer formulation known to be conducive to electron transport chain (ETC) activity. Using either pyruvate or succinate as substrates for ETC, we found differences in the redox responses of cytochrome c for different exposure laser irradiance and excitation wavelength. We anticipate that the proposed new method will be valuable in the study of metabolic processes in mitochondria in response to low level laser exposure, and thus aid in elucidating the mechanism(s) of photobiomodulation.

  16. Angular correlation measurements for {sup 12}C{sup 12}C,{sup 12}C{sup 12}C 3{sup -} scattering

    Energy Technology Data Exchange (ETDEWEB)

    Wuosmaa, A.H.; Betts, R.R.; Freer, M.

    1995-08-01

    Previous studies of inelastic {sup 12}C + {sup 12}C scattering to a variety of final states identified significant resonance behavior in a number of different reaction channels. These resonances can be interpreted as either potential scattering resonances, or as population of cluster structures in the compound nucleus {sup 24}Mg, or as some interplay between the two mechanisms. Currently, for many of these resonances the situation remains unclear. One example is a large peak observed in the excitation function for the 3{sup -} - g.s. excitation, identified in previous work performed at the Daresbury Laboratory in England. This peak is observed at the same center-of-mass energy as one observed in the O{sub 2}{sup +}-O{sub 2}{sup +} inelastic scattering channel. That structure was suggested to correspond to exotic deformed configurations in the compound nucleus {sup 24}Mg. As the peak in the 3{sup -} + g.s. exit channel occurs at precisely the same energy as the purported resonance, it is tempting to associate the two. Before such an association can be confirmed or ruled out, further information must be obtained about the 3{sup -} + g.s. structure. In particular, it is important to determine the angular momenta that dominate the 3{sup -} + g.s. structure.

  17. C V R Murty

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. C V R Murty. Articles written in Resonance – Journal of Science Education. Volume 9 Issue 8 August 2004 pp 75-78 Classroom. Learning Earthquake Design and Construction – 1. What causes Earthquakes? C V R Murty · More Details Fulltext PDF. Volume 9 ...

  18. Analysis and design of a coupled coaxial line TEM resonator for magnetic resonance imaging

    International Nuclear Information System (INIS)

    Benahmed, Nasreddine; Feham, Mohammed; Khelif, M'Hamed

    2006-01-01

    In this paper, we have successfully realized a numerical tool to analyse and to design an n-element unloaded coaxial line transverse electromagnetic (TEM) resonator. This numerical tool allows the determination of the primary parameters, matrices [L], [C] and [R], and simulates the frequency response of S 11 at the RF port of the designed TEM resonator. The frequency response permits evaluation of the unloaded quality factor Q 0 . As an application, we present the analysis and the design of an eight-element unloaded TEM resonator for animal studies at 4.7 T. The simulated performance has a -62.81 dB minimum reflection and a quality factor of 260 around 200 MHz

  19. (p,γ) resonance strengths in the s-d shell

    International Nuclear Information System (INIS)

    Paine, B.M.; Sargood, D.G.

    1979-01-01

    The strengths of selected resonances in the energy range 0.5-2.0 MeV in the (p,γ) reactions on 26 Mg, 30 Si, 34 S, 37 C1, 39 K and 40 Ca have been found relative to the 632 and 992 keV resonances in 27 A1(p,γ) 28 Si by relative yield measurements. Absolute measurements were conducted on the selected resonances in 27 A1(p,γ) 28 Si and 30 Si(p,γ) 31 p by semi-thick target and thin target techniques with the target thickness, needed for the latter technique, found by Rutherford backscattering of protons. Absolute strengths for all of the resonances treated, together with one from each of 23 Na, 31 p and 35 C1, reported in a previous paper, were deduced by normalizing to the absolute measurements on the 27 A1(p,γ) 28 Si resonances

  20. Nonlinear elasticity in resonance experiments

    Science.gov (United States)

    Li, Xun; Sens-Schönfelder, Christoph; Snieder, Roel

    2018-04-01

    Resonant bar experiments have revealed that dynamic deformation induces nonlinearity in rocks. These experiments produce resonance curves that represent the response amplitude as a function of the driving frequency. We propose a model to reproduce the resonance curves with observed features that include (a) the log-time recovery of the resonant frequency after the deformation ends (slow dynamics), (b) the asymmetry in the direction of the driving frequency, (c) the difference between resonance curves with the driving frequency that is swept upward and downward, and (d) the presence of a "cliff" segment to the left of the resonant peak under the condition of strong nonlinearity. The model is based on a feedback cycle where the effect of softening (nonlinearity) feeds back to the deformation. This model provides a unified interpretation of both the nonlinearity and slow dynamics in resonance experiments. We further show that the asymmetry of the resonance curve is caused by the softening, which is documented by the decrease of the resonant frequency during the deformation; the cliff segment of the resonance curve is linked to a bifurcation that involves a steep change of the response amplitude when the driving frequency is changed. With weak nonlinearity, the difference between the upward- and downward-sweeping curves depends on slow dynamics; a sufficiently slow frequency sweep eliminates this up-down difference. With strong nonlinearity, the up-down difference results from both the slow dynamics and bifurcation; however, the presence of the bifurcation maintains the respective part of the up-down difference, regardless of the sweep rate.

  1. Radiative widths of resonances (experiments)

    International Nuclear Information System (INIS)

    Gidal, G.

    1988-07-01

    After a hiatus of several years, this conference brings us considerable new data on resonance production in photon photon interactions. I will first discuss the contributions concerning the tensor, pseudoscalar and scalar mesons, then review the current status of the (c/ovr string/c /eta//sub c/) and finally summarize the exciting new results concerning the spin 1 mesons. 40 refs., 21 figs., 7 tabs

  2. Fourier Transform Ion Cyclotron Resonance Mass Spectrometry at the Cyclotron Frequency.

    Science.gov (United States)

    Nagornov, Konstantin O; Kozhinov, Anton N; Tsybin, Yury O

    2017-04-01

    The phenomenon of ion cyclotron resonance allows for determining mass-to-charge ratio, m/z, of an ensemble of ions by means of measurements of their cyclotron frequency, ω c . In Fourier transform ion cyclotron resonance mass spectrometry (FT-ICR MS), the ω c quantity is usually unavailable for direct measurements: the resonant state is located close to the reduced cyclotron frequency (ω + ), whereas the ω c and the corresponding m/z values may be calculated via theoretical derivation from an experimental estimate of the ω + quantity. Here, we describe an experimental observation of a new resonant state, which is located close to the ω c frequency and is established because of azimuthally-dependent trapping electric fields of the recently developed ICR cells with narrow aperture detection electrodes. We show that in mass spectra, peaks close to ω + frequencies can be reduced to negligible levels relative to peaks close to ω c frequencies. Due to reduced errors with which the ω c quantity is obtained, the new resonance provides a means of cyclotron frequency measurements with precision greater than that achieved when ω + frequency peaks are employed. The described phenomenon may be considered for a development into an FT-ICR MS technology with increased mass accuracy for applications in basic research, life, and environmental sciences. Graphical Abstract ᅟ.

  3. Resonance – Journal of Science Education | News

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. Face to Face. Articles in Resonance – Journal of Science Education. Volume 13 Issue 1 January 2008 pp 89-98 Face to Face. Viewing Life Through Numbers · C Ramakrishnan Sujata Varadarajan · More Details Fulltext PDF. Volume 13 Issue 3 March 2008 pp ...

  4. The Dependence of the Resonance Integral on the Doppler Effect

    Energy Technology Data Exchange (ETDEWEB)

    Rosen, J

    1960-12-15

    The Doppler sensitive contributions to the resonance integral for metal and oxide cylinders have been calculated using tables compiled by Adler, Hinman and Nordheim. The temperatures 20, 200, 350, 500 and 650 deg C have been investigated for the pure metal and 20, 300, 600, 900 and 1200 deg C for the oxide. Contributions from the separate resonances in the resolved region and for certain energies in the unresolved region are accounted for in detail. Integration over adequate statistical distributions has been carried out for the resonance parameters in the unresolved region. The increase in the resonance integral at elevated temperatures due to the Doppler effect is given separately in tables and diagrams.

  5. Nanodiamond graphitization: a magnetic resonance study

    International Nuclear Information System (INIS)

    Panich, A M; Shames, A I; Sergeev, N A; Olszewski, M; McDonough, J K; Mochalin, V N; Gogotsi, Y

    2013-01-01

    We report on the first nuclear magnetic resonance (NMR) and electron paramagnetic resonance (EPR) study of the high-temperature nanodiamond-to-onion transformation. 1 H, 13 C NMR and EPR spectra of the initial nanodiamond samples and those annealed at 600, 700, 800 and 1800 ° C were measured. For the samples annealed at 600 to 800 ° C, our NMR data reveal the early stages of the surface modification, as well as a progressive increase in sp 2 carbon content with increased annealing temperature. Such quantitative experimental data were recorded for the first time. These findings correlate with EPR data on the sensitivity of the dangling bond EPR line width to air content, progressing with rising annealing temperature, that evidences consequent graphitization of the external layers of the diamond core. The sample annealed at 1800 ° C shows complete conversion of nanodiamond particles into carbon onions. (paper)

  6. Extracting the cross section angular distributions for 15C high-energy resonance excited via the (18O,16O two-neutron transfer reaction

    Directory of Open Access Journals (Sweden)

    Carbone D.

    2016-01-01

    Full Text Available The 13C(18O,16O15C reaction has been studied at 84 MeV incident energy. The ejectiles have been momentum analized by the MAGNEX spectrometer and 15C excitation energy spectra have been obtained up to about 20 MeV. In the region above the two-neutron separation energy, a bump has been observed at 13.7 MeV. The extracted cross section angular distribution for this structure, obtained by using different models for background, displays a clear oscillating pattern, typical of resonant state of the residual nucleus.

  7. Reactive carbon-chain molecules: synthesis of 1-diazo-2,4-pentadiyne and spectroscopic characterization of triplet pentadiynylidene (H-C[triple bond]C-:C-C[triple bond]C-H).

    Science.gov (United States)

    Bowling, Nathan P; Halter, Robert J; Hodges, Jonathan A; Seburg, Randal A; Thomas, Phillip S; Simmons, Christopher S; Stanton, John F; McMahon, Robert J

    2006-03-15

    1-Diazo-2,4-pentadiyne (6a), along with both monodeuterio isotopomers 6b and 6c, has been synthesized via a route that proceeds through diacetylene, 2,4-pentadiynal, and 2,4-pentadiynal tosylhydrazone. Photolysis of diazo compounds 6a-c (lambda > 444 nm; Ar or N2, 10 K) generates triplet carbenes HC5H (1) and HC5D (1-d), which have been characterized by IR, EPR, and UV/vis spectroscopy. Although many resonance structures contribute to the resonance hybrid for this highly unsaturated carbon-chain molecule, experiment and theory reveal that the structure is best depicted in terms of the dominant resonance contributor of penta-1,4-diyn-3-ylidene (diethynylcarbene, H-C[triple bond]C-:C-C[triple bond]C-H). Theory predicts an axially symmetric (D(infinity h)) structure and a triplet electronic ground state for 1 (CCSD(T)/ANO). Experimental IR frequencies and isotope shifts are in good agreement with computed values. The triplet EPR spectrum of 1 (absolute value(D/hc) = 0.6157 cm(-1), absolute value(E/hc) = 0.0006 cm(-1)) is consistent with an axially symmetric structure, and the Curie law behavior confirms that the triplet state is the ground state. The electronic absorption spectrum of 1 exhibits a weak transition near 400 nm with extensive vibronic coupling. Chemical trapping of triplet HC5H (1) in an O2-doped matrix affords the carbonyl oxide 16 derived exclusively from attack at the central carbon.

  8. Complete assignment of the methionyl carbonyl carbon resonance in switch variant anti-dansyl antibodies labeled with [1-13C]methionine

    International Nuclear Information System (INIS)

    Kato, Koichi; Matsunaga, C.; Igarashi, Takako; Kim, Hahyung; Odaka, Asano; Shimada, Ichio; Arata, Yoji

    1991-01-01

    A 13 C NMR study is reported of switch variant anti-dansyl antibodies developed by Dangl et al. who had used the fluorescence-activated cell sorter to select and clone these variants. These switch variant antibodies possess the identical V H , V L , and C L domains in conjunction with different heavy chain constant regions. In the present study, switch variant antibodies of IgG1, IgG2a, and IgG2b subclasses were used along with a short-chain IgG2a antibody, in which the entire C H 1 domain is deleted. The switch variant antibodies were specifically labeled with [1- 13 C]methionine by growing hybridoma cells in serum-free medium. Assignments of all the methionyl carbonyl carbon resonances have been completed by using the intact antibodies along with their fragments and recombined proteins in which either heavy or light chain is labeled. A double labeling method has played a crucial role in the process of the spectral assignments. The strategy used for the assignments has been described in detail. In incorporating 15 N-labeled amino acids into the antibodies for the double labeling, isotope dilution caused a serious problem except in the cases of [α- 15 N]lysine and [ 15 N]threonine, both of which cannot become the substrate of transaminases. It was found that β-chloro-L-alanine is most effective in suppressing the isotope scrambling. So far, spectral assignments by the double labeling method have been possible with 15 N-labeled Ala, His, Ile, Lys, Met, Ser, Thr, Tyr, and Val. On the basis of the results of the present 13 C study, possible use of the assigned carbonyl carbon resonances for the elucidation of the structure-function relationship in the antibody system has been briefly discussed

  9. Induced high-order resonance linewidth shrinking with multiple coupled resonators in silicon-organic hybrid slotted two-dimensional photonic crystals for reduced optical switching power in bistable devices

    Science.gov (United States)

    Hoang, Thu Trang; Ngo, Quang Minh; Vu, Dinh Lam; Le, Khai Q.; Nguyen, Truong Khang; Nguyen, Hieu P. T.

    2018-01-01

    Shrinking the linewidth of resonances induced by multiple coupled resonators is comprehensively analyzed using the coupled-mode theory (CMT) in time. Two types of coupled resonators under investigation are coupled resonator optical waveguides (CROWs) and side-coupled resonators with waveguide (SCREW). We examine the main parameters influencing on the spectral response such as the number of resonators (n) and the phase shift (φ) between two adjacent resonators. For the CROWs geometry consisting of n coupled resonators, we observe the quality (Q) factor of the right- and left-most resonant lineshapes increases n times larger than that of a single resonator. For the SCREW geometry, relying on the phase shift, sharp, and asymmetric resonant lineshape of the high Q factor a narrow linewidth of the spectral response could be achieved. We employ the finite-difference time-domain (FDTD) method to design and simulate two proposed resonators for practical applications. The proposed coupled resonators in silicon-on-insulator (SOI) slotted two-dimensional (2-D) photonic crystals (PhCs) filled and covered with a low refractive index organic material. Slotted PhC waveguides and cavities are designed to enhance the electromagnetic intensity and to confine the light into small cross-sectional area with low refractive index so that efficient optical devices could be achieved. A good agreement between the theoretical CMT analysis and the FDTD simulation is shown as an evidence for our accurate investigation. All-optical switches based on the CROWs in the SOI slotted 2-D PhC waveguide that are filled and covered by a nonlinear organic cladding to overcome the limitations of its well-known intrinsic properties are also presented. From the calculations, we introduce a dependency of the normalized linewidth of the right-most resonance and its switching power of the all-optical switches on number of resonator, n. This result might provide a guideline for all-optical signal processing on

  10. The discovery of resonances in multibaryon systems

    International Nuclear Information System (INIS)

    Shahbazian, B.A.; Temnikov, P.P.; Timonina, A.A.

    1978-01-01

    The ΛΛ and ΛΛp effective mass spectra are studied with a propane bubble chamber irradiated by π - mesons at 4.0 GeV/c and neutrons with mean momentum 7.0 GeV/c. Multibaryon resonances ΛΛ and ΛΛp with masses and widths Msub(ΛΛ)=(2365,3+-9,6) MeV/csup(2), GITAsub(ΛΛ)=(47,2+-15,1) MeV/csup(2) and Msub(ΛΛp)=3568,3 MeV/csup(2), GITAsub(ΛΛp) < 60 MeV/csup(2) are found. The production effective cross sections are equal σsub(ΛΛ) (2365)=(24,2+-7.0)μb and σsub(ΛΛp) (3568)=16.1 +- 5.2)μb. Possible mechanisms of multibaryon resonance production have been discussed. According to the Y<--1 hypercharge selection rule multibaryon resonances are shown to be superdense superstrange objects. The ΛΛ and ΛΛp effective mass spectra reveal peculiarities near the masses of the most of two- and three- baryon resonances

  11. High-resolution 13C nuclear magnetic resonance evidence of phase transition of Rb,Cs-intercalated single-walled nanotubes

    KAUST Repository

    Bouhrara, M.

    2011-09-06

    We present 13 C high-resolution magic-angle-turning (MAT) and magic angle spinning nuclear magnetic resonance data of Cs and Rb intercalated single walled carbon nanotubes. We find two distinct phases at different intercalation levels. A simple charge transfer is applicable at low intercalation level. The new phase at high intercalation level is accompanied by a hybridization of alkali (s) orbitals with the carbon (sp2) orbitals of the single walled nanotubes, which indicate bundle surface sites is the most probable alkali site.

  12. In vivo detection of c-MET expression in a rat hepatocarcinogenesis model using molecularly targeted magnetic resonance imaging.

    Science.gov (United States)

    Towner, Rheal A; Smith, Nataliya; Tesiram, Yasvir A; Abbott, Andrew; Saunders, Debbie; Blindauer, Rebecca; Herlea, Oana; Silasi-Mansat, Robert; Lupu, Florea

    2007-01-01

    The multifunctional growth factor scatter factor/hepatocyte growth factor and its tyrosine kinase receptor, c-MET, have been implicated in the genesis and malignant progression of numerous human malignancies, including hepatocellular carcinomas. The incidence of hepatocellular carcinomas in the United States has increased noticeably over the past two decades and is listed as the fifth major cancer in men worldwide. In this study, we used a choline-deficient l-amino acid (CDAA)-defined rat hepatocarcinogenesis model to visualize increased in vivo expression of the c-MET antigen in neoplastic lesion formation with the use of a super paramagnetic iron oxide (SPIO)-anti-c-MET molecularly targeted magnetic resonance imaging (MRI) contrast agent. SPIO-anti-c-MET was used for the first time to detect overexpression of c-MET in neoplastic nodules and tumors within the livers of CDAA-treated rats, as determined by a decrease in MRI signal intensity and a decrease in regional T(2) values. Specificity for the binding of the molecularly targeted anti-c-MET contrast agent was determined using rat hepatoma (H4-II-E-C3) cell cultures and immunofluorescence microscopic imaging of the targeting agents within neoplastic liver tissue 1 to 2 hours following intravenous administration of SPIO-anti-c-MET and MRI investigation. This method has the ability to visualize in vivo the overexpression of c-MET at early developmental stages of tumor formation.

  13. Continuous Flow-Resonance Raman Spectroscopy of an Intermediate Redox State of Cytochrome-C

    DEFF Research Database (Denmark)

    Forster, M.; Hester, R. E.; Cartling, B.

    1982-01-01

    An intermediate redox state of cytochrome c at alkaline pH, generated upon rapid reduction by sodium dithionite, has been observed by resonance Raman (RR) spectroscopy in combination with the continuous flow technique. The RR spectrum of the intermediate state is reported for excitation both...... in the (alpha, beta) and the Soret optical absorption band. The spectra of the intermediate state are more like those of the stable reduced form than those of the stable oxidized form. For excitation of 514.5 nm, the most prominent indication of an intermediate state is the wave-number shift of one RR band from...... 1,562 cm-1 in the stable oxidized state through 1,535 cm-1 in the intermediate state to 1,544 cm-1 in the stable reduced state. For excitation at 413.1 nm, a band, present at 1,542 cm-1 in the stable reduced state but not present in the stable oxidized state, is absent in the intermediate state. We...

  14. (1)H, (13)C, (15)N backbone and side-chain resonance assignment of Nostoc sp. C139A variant of the heme-nitric oxide/oxygen binding (H-NOX) domain.

    Science.gov (United States)

    Alexandropoulos, Ioannis I; Argyriou, Aikaterini I; Marousis, Kostas D; Topouzis, Stavros; Papapetropoulos, Andreas; Spyroulias, Georgios A

    2016-10-01

    The H-NOX (Heme-nitric oxide/oxygen binding) domain is conserved across eukaryotes and bacteria. In human soluble guanylyl cyclase (sGC) the H-NOX domain functions as a sensor for the gaseous signaling agent nitric oxide (NO). sGC contains the heme-binding H-NOX domain at its N-terminus, which regulates the catalytic site contained within the C-terminal end of the enzyme catalyzing the conversion of GTP (guanosine 5'-triphosphate) to GMP (guanylyl monophosphate). Here, we present the backbone and side-chain assignments of the (1)H, (13)C and (15)N resonances of the 183-residue H-NOX domain from Nostoc sp. through solution NMR.

  15. 12 CFR 612.2260 - Standards of conduct for agents.

    Science.gov (United States)

    2010-01-01

    ... agent to carry out other agent duties as required by contract, FCA regulations, or law. (c) System... employees of the institutions; the solicitation and acceptance of gifts, contributions, or special...

  16. Fourier photospectroscopy of Xe-C60 through a Xe 4d resonance window: theory versus recent experiment

    International Nuclear Information System (INIS)

    Patel, Aakash B; Chakraborty, Himadri S

    2011-01-01

    The photoionization cross section of endohedral Xe-C 60 over a Xe 4d giant resonance energy region, calculated in the time-dependent local density approximation, is compared with recent measurements (Kilcoyne et al 2010 Phys. Rev. Lett. 105 213001). An analysis based on the Fourier transforms of oscillatory cross sections is performed to derive a number of inherent similarities between the prediction and the data, including a large beating-type oscillation and several others of intermediate size. Results stress the need for more accurate measurements to access the wealth of information about the geometry of the system. (fast track communication)

  17. Threshold states in /sup 26/Al. Pt. 2. Extraction of resonance strengths

    Energy Technology Data Exchange (ETDEWEB)

    Champagne, A E; Howard, A J; Parker, P D [Yale Univ., New Haven, CT (USA). Wright Nuclear Structure Lab.

    1983-06-20

    The total width of the Esub(c.m.)=376 keV resonance in the /sup 25/Mg+p system has been measured using the /sup 25/Mg(p,..gamma..)/sup 26/Al reaction and is found to be 460+-70 eV. From this information, a resonance strength ..omega gamma..=5.7x10/sup 16/ eV is obtained for the astrophysically important 37.2 keV resonance in /sup 26/Al through an R-matrix parameterization of the relative energy dependence of the resonance width. In a similar manner, an upper limit ..omega gamma..<=1.0x10/sup -11/ eV is deduced for a possible resonance at Esub(c.m.)=94.0 keV.

  18. Deformations of the Heme Group of Different Ferrocytochrome c Proteins Probed by Resonance Raman Spectroscopy

    International Nuclear Information System (INIS)

    Hagarman, Andrew; Schweitzer-Stenner, Reinhard; Wallace, Carmichael; Laberge, Monique

    2008-01-01

    We measured the low-frequency polarized resonance Raman spectra of horse heart, chicken, and yeast(C102T) ferrocytochromes c with Soret excitation. We examined the out-of-plane deformations of the heme groups by determining the relative intensities and depolarization ratios of a variety of out-of-plane and in-plane Raman active bands. Analysis of relative Raman intensities shows differences in non-planarity of the heme groups of yeast(C102T), horse heart and chicken cytochrome c. Cytochrome c has been shown to have a dominant ruffling (B 1u ) deformation by means of normal coordinate structural decomposition (NSD) analysis of the heme group in crystal structures. The presence and intensity of B 1u modes, γ 10 -γ 12 , support the indication of ruffling being the major contribution to the non-planar deformations in cytochrome c. Other types of non-planar deformations like doming (A 2U ) and waving (E g ) can be deduced from the Raman activity of γ 5 (A 2u ), γ 21 and γ 22 (E g ). The depolarization ratios of γ 5 , γ 10 , γ 11 and γ 12 are larger than 0.125, indicating the presence of other deformations such as saddling (B 2u ) and propellering (A 1u ), which is again in agreement with the crystal structures of horse heart and yeast ferrocytochrome c. An analysis of the intensities and depolarization ratios of out-of-plane modes revealed that ruffling is comparable in yeast and horse heart cytochrome c, saddling is larger and doming as well as propellering are lower in yeast cytochrome c. With respect to doming and ruffling our results contradict values obtained from the NSD analysis of the corresponding crystal structures. With respect to saddling, our data are in agreement with the crystal structure. The NSD analysis of heme structures resulting from MD simulations did not correlate very well with the spectroscopically obtained results concerning the ruffling and doming coordinate, whereas a qualitative agreement was again obtained for saddling.

  19. Resonance saturation of the chiral couplings at next-to-leading order in 1/NC

    International Nuclear Information System (INIS)

    Rosell, Ignasi; Ruiz-Femenia, Pedro; Sanz-Cillero, Juan Jose

    2009-01-01

    The precision obtainable in phenomenological applications of chiral perturbation theory is currently limited by our lack of knowledge on the low-energy constants (LECs). The assumption that the most important contributions to the LECs come from the dynamics of the low-lying resonances, often referred to as the resonance saturation hypothesis, has stimulated the use of large-N C resonance Lagrangians in order to obtain explicit values for the LECs. We study the validity of the resonance saturation assumption at the next-to-leading order in the 1/N C expansion within the framework of resonance chiral theory. We find that, by imposing QCD short-distance constraints, the chiral couplings can be written in terms of the resonance masses and couplings and do not depend explicitly on the coefficients of the chiral operators in the Goldstone boson sector of resonance chiral theory. As we argue, this is the counterpart formulation of the resonance saturation statement in the context of the resonance Lagrangian. Going beyond leading order in the 1/N C counting allows us to keep full control of the renormalization scale dependence of the LEC estimates.

  20. C reaction from the Coulomb dissociation of C

    Indian Academy of Sciences (India)

    non-resonant continuum (corresponding to all multipoles and relative orbital angular ..... As mentioned earlier, 14C(n, γ )15C is in direct competition with proton, deuteron .... The local momentum approximation is also a price one has to pay to.

  1. Non-invasive assessment of hepatic fat accumulation in chronic hepatitis C by 1H magnetic resonance spectroscopy

    International Nuclear Information System (INIS)

    Krssak, Martin; Hofer, Harald; Wrba, Fritz; Meyerspeer, Martin; Brehm, Attila; Lohninger, Alfred; Steindl-Munda, Petra; Moser, Ewald; Ferenci, Peter; Roden, Michael

    2010-01-01

    Background: Liver biopsy is the standard method for diagnosis of hepatic steatosis, but is invasive and carries some risk of morbidity. Aims and methods: Quantification of hepatocellular lipid content (HCL) with non-invasive single voxel 1 H magnetic resonance spectroscopy (MRS) at 3 T was compared with histological grading and biochemical analysis of liver biopsies in 29 patients with chronic hepatitis C. Body mass index, indices of insulin resistance (homeostasis model assessment index, HOMA-IR), serum lipids and serum liver transaminases were also quantified. Results: HCL as assessed by 1 H MRS linearly correlated (r = 0.70, p 1 H MRS (r = 0.63, p 1 H MRS is a valid and useful method for quantification of HCL content in patients with chronic hepatitis C and can be easily applied to non-invasively monitoring of steatosis during repeated follow-up measurements in a clinical setting.

  2. Study of leading strange meson resonances and spin-orbit splittings in K-p → K-π+n at 11 GeV/c

    International Nuclear Information System (INIS)

    Honma, A.K.

    1980-11-01

    The results from a high-statistics study of Kπ elastic scattering in the reaction K - p → K - π + n are presented. The data for this analysis are taken from an 11-GeV/c K - p experiment performed on the Large Aperture Solenoidal Spectrometer (LASS) facility at the Stanford Linear Accelerator Center (SLAC). By selecting the very forward produced K - π + events, a sample consisting of data for the Kπ → Kπ elastic scattering reaction was extracted. The angular distribution for this meson-meson scattering is studied by use of both a spherical harmonic moments analysis and a partial-wave analysis (PWA). The previously established leading natural spin-parity strange meson resonances (the J/sup P/ = 1 - K*(895), the 2 + K*(1430), and the 3 - K*(1780)) are observed in the results from both the moments analysis and the PWA. In addition, evidence for a new spin 4 - K* resonance with a mass of 2080 MeV and a width of about 225 MeV is presented. The results from the PWA confirm the existence of a 0 + kappa (1490) and propose the existence of a second scalar meson resonance, the 0 + kappa' (1900). Structure in the P-wave amplitude indicates resonance behavior in the mass region near 1700 MeV. In two of the four ambiguous solutions for the mass region above 1800 MeV, there is strong evidence for another P-wave resonant structure near 2100 MeV. The observed strange meson resonances are found to have a natural interpretation in terms of states predicted by the quark model. In particular, the mass splittings of the leading trajectory natural spin-parity strange meson states and the mass splittings between the spin-orbit triplet states are discussed. 59 figures, 17 tables

  3. Integrated phononic crystal resonators based on adiabatically-terminated phononic crystal waveguides

    Directory of Open Access Journals (Sweden)

    Razi Dehghannasiri

    2016-12-01

    Full Text Available In this letter, we demonstrate a new design for integrated phononic crystal (PnC resonators based on confining acoustic waves in a heterogeneous waveguide-based PnC structure. In this architecture, a PnC waveguide that supports a single mode at the desired resonance frequencies is terminated by two waveguide sections with no propagating mode at those frequencies (i.e., have mode gap. The proposed PnC resonators are designed through combining the spatial-domain and the spatial-frequency domain (i.e., the k-domain analysis to achieve a smooth mode envelope. This design approach can benefit both membrane-based and surface-acoustic-wave-based architectures by confining the mode spreading in k-domain that leads to improved electromechanical excitation/detection coupling and reduced loss through propagating bulk modes.

  4. Tailoring stress in pyrolytic carbon for fabrication of nanomechanical string resonators

    DEFF Research Database (Denmark)

    Quang, Long Nguyen; Larsen, Peter Emil; Boisen, Anja

    2018-01-01

    In order to achieve high resonance frequencies and quality factors of pyrolytic carbon MEMS string resonators the resonator material needs to have a large tensile stress. In this study, the influence of pyrolysis temperature, dwell time and ramping rate on the residual stress in thin pyrolytic...... carbon films is investigated with the bending plate method. The results show that the pyrolysis temperature is the most important parameter for tailoring the residual stress, with a transition from tensile stress at temperature below 800ºC to compressive stress at temperatures above 800ºC. Two kinds...... of photoresist: positive (AZ5214E) and negative (SU-8) and different pyrolysis conditions are used to fabricate pyrolytic carbon string resonators at variable pyrolysis conditions. The best performance is obtained for devices with a length of 400 µm fabricated at a pyrolysis temperature of 700ºC, ramping rate...

  5. High resolution spectroscopy in solids by nuclear magnetic resonance

    International Nuclear Information System (INIS)

    Bonagamba, T.J.

    1991-07-01

    The nuclear magnetic resonance (NMR) techniques for High Resolution Spectroscopy in Solids are described. Also the construction project of a partially home made spectrometer and its applications in the characterization of solid samples are shown in detail. The high resolution spectrometer used is implemented with the double resonance multiple pulses sequences and magic angle spinning (MAS) and can be used with solid and liquid samples. The maximum spinning frequency for the MAS experiment is in excess of 5 Khz, the double resonance sequences can be performed with any type of nucleus, in the variable temperature operating range with nitrogen gas: -120 0 C to +160 0 C, and is fully controlled by a Macintosh IIci microcomputer. (author)

  6. Current correlators and form factors in the resonance region

    Energy Technology Data Exchange (ETDEWEB)

    Rosell, I. [Departamento de Ciencias Fisicas, Matematicas y de la Computacion, Universidad CEU Cardenal Herrera, c/Sant Bartomeu 55, E-46115 Alfara del Patriarca, Valencia (Spain); IFIC, Universitat de Valencia - CSIC, Apt. Correus 22085, E-46071 Valencia (Spain)

    2009-01-15

    Within Resonance Chiral Theory and in the context of QCD current correlators at next-to-leading order in 1/N{sub C}, we have analyzed the two-body form factors which include resonances as a final state. The short-distance constraints have been studied. One of the main motivations is the estimation of the chiral low-energy constants at subleading order, that is, keeping full control of the renormalization scale dependence. As an application we show the resonance estimation of some coupling, L{sub 10}{sup r}({mu}{sub 0})=(-4.4{+-}0.9).10{sup -3} and C{sub 87}{sup r}({mu}{sub 0})=(3.1{+-}1.1).10{sup -5}.

  7. In Vivo Detection of c-MET Expression in a Rat Hepatocarcinogenesis Model Using Molecularly Targeted Magnetic Resonance Imaging

    Directory of Open Access Journals (Sweden)

    Rheal A. Towner

    2007-01-01

    Full Text Available The multifunctional growth factor scatter factor/hepatocyte growth factor and its tyrosine kinase receptor, c-MET, have been implicated in the genesis and malignant progression of numerous human malignancies, including hepatocellular carcinomas. The incidence of hepatocellular carcinomas in the United States has increased noticeably over the past two decades and is listed as the fifth major cancer in men worldwide. In this study, we used a choline-deficient l-amino acid (CDAA-defined rat hepatocarcinogenesis model to visualize increased in vivo expression of the c-MET antigen in neoplastic lesion formation with the use of a super paramagnetic iron oxide (SPIO–anti-c-MET molecularly targeted magnetic resonance imaging (MRI contrast agent. SPIO–anti-c-MET was used for the first time to detect overexpression of c-MET in neoplastic nodules and tumors within the livers of CDAA-treated rats, as determined by a decrease in MRI signal intensity and a decrease in regional T2 values. Specificity for the binding of the molecularly targeted anti-c-MET contrast agent was determined using rat hepatoma (H4-II-E-C3 cell cultures and immunofluorescence microscopic imaging of the targeting agents within neoplastic liver tissue 1 to 2 hours following intravenous administration of SPIO–anti-c-MET and MRI investigation. This method has the ability to visualize in vivo the overexpression of c-MET at early developmental stages of tumor formation.

  8. Deep-level defects in semiconductors: studies by magnetic resonance

    International Nuclear Information System (INIS)

    Ammerlaan, C.A.J.

    1983-01-01

    This work is divided into two parts. In the first one, the following topics are discussed: paramagnetic centers in semiconductors, principles of magnetic resonance, spin-Hamiltonian, g-tensor, hyperfine interaction, magnetic resonance spectrometer. In the second part it is dicussed defects studied by magnetic resonance including vacancy and divacancy in silicon, iron in silicon, nitrogen in diamond and antisite defects in III-V compounds. (A.C.A.S.) [pt

  9. Synthetic Swan band profile of (1,0) of 12C12C and (0,0) of 12C12C and 12C13C in comets

    International Nuclear Information System (INIS)

    Swamy, K.S.K.

    1987-01-01

    The statistical equilibrium calculations of the 12 C 13 C molecule based on the resonance fluorescence process give similar results to those of the normal molecule. Therefore the assumption that the observed intensities of bands of the normal and the isotopic molecule differ only by their abundance ratio is reasonable. The synthetic profile of the (1,0) Swan band of 12 C 13 C (0,0) band of 12 C 12 C and 12 C 13 C have been calculated. The relative merits of using the rotational structure of the (1,0) or (0,0) band for the determination of the isotopic ratio 12 C/ 13 C is discussed briefly. (author)

  10. Validated ¹H and 13C Nuclear Magnetic Resonance Methods for the Quantitative Determination of Glycerol in Drug Injections.

    Science.gov (United States)

    Lu, Jiaxi; Wang, Pengli; Wang, Qiuying; Wang, Yanan; Jiang, Miaomiao

    2018-05-15

    In the current study, we employed high-resolution proton and carbon nuclear magnetic resonance spectroscopy (¹H and 13 C NMR) for quantitative analysis of glycerol in drug injections without any complex pre-treatment or derivatization on samples. The established methods were validated with good specificity, linearity, accuracy, precision, stability, and repeatability. Our results revealed that the contents of glycerol were convenient to calculate directly via the integration ratios of peak areas with an internal standard in ¹H NMR spectra, while the integration of peak heights were proper for 13 C NMR in combination with an external calibration of glycerol. The developed methods were both successfully applied in drug injections. Quantitative NMR methods showed an extensive prospect for glycerol determination in various liquid samples.

  11. Complete assignment of the methionyl carbonyl carbon resonance in switch variant anti-dansyl antibodies labeled with (1- sup 13 C)methionine

    Energy Technology Data Exchange (ETDEWEB)

    Kato, Koichi; Matsunaga, C.; Igarashi, Takako; Kim, Hahyung; Odaka, Asano; Shimada, Ichio; Arata, Yoji (Univ. of Tokyo, Hongo (Japan))

    1991-01-01

    A {sup 13}C NMR study is reported of switch variant anti-dansyl antibodies developed by Dangl et al. who had used the fluorescence-activated cell sorter to select and clone these variants. These switch variant antibodies possess the identical V{sub H}, V{sub L}, and C{sub L} domains in conjunction with different heavy chain constant regions. In the present study, switch variant antibodies of IgG1, IgG2a, and IgG2b subclasses were used along with a short-chain IgG2a antibody, in which the entire C{sub H}1 domain is deleted. The switch variant antibodies were specifically labeled with (1-{sup 13}C)methionine by growing hybridoma cells in serum-free medium. Assignments of all the methionyl carbonyl carbon resonances have been completed by using the intact antibodies along with their fragments and recombined proteins in which either heavy or light chain is labeled. A double labeling method has played a crucial role in the process of the spectral assignments. The strategy used for the assignments has been described in detail. In incorporating {sup 15}N-labeled amino acids into the antibodies for the double labeling, isotope dilution caused a serious problem except in the cases of ({alpha}-{sup 15}N)lysine and ({sup 15}N)threonine, both of which cannot become the substrate of transaminases. It was found that {beta}-chloro-L-alanine is most effective in suppressing the isotope scrambling. So far, spectral assignments by the double labeling method have been possible with {sup 15}N-labeled Ala, His, Ile, Lys, Met, Ser, Thr, Tyr, and Val. On the basis of the results of the present {sup 13}C study, possible use of the assigned carbonyl carbon resonances for the elucidation of the structure-function relationship in the antibody system has been briefly discussed.

  12. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. Amritanshu Sinha. Articles written in Resonance – Journal of Science Education. Volume 6 Issue 3 March 2001 pp 55-65 General Article. Buckyball C60 – The Story so Far… Amritanshu Sinha · More Details Fulltext PDF ...

  13. Alpha resonant scattering for astrophysical reaction studies

    International Nuclear Information System (INIS)

    Yamaguchi, H.; Kahl, D.; Nakao, T.; Wakabayashi, Y.; Kubano, S.; Hashimoto, T.; Hayakawa, S.; Kawabata, T.; Iwasa, N.; Teranishi, T.; Kwon, Y. K.; Binh, D. N.; Khiem, L. H.; Duy, N. G.

    2014-01-01

    Several alpha-induced astrophysical reactions have been studied at CRIB (CNS Radioactive Ion Beam separator), which is a low-energy RI beam separator at Center for Nuclear Study (CNS) of the University of Tokyo. One of the methods to study them is the α resonant scattering using the thick-target method in inverse kinematics. Among the recent studies at CRIB, the measurement of 7 Be+α resonant scattering is discussed. Based on the result of the experiment, we evaluated the contributions of high-lying resonances for the 7 Be(α,γ) reaction, and proposed a new cluster band in 11 C

  14. Two Photon Decay Widths of Charmonium Resonances Formed in Proton Antiproton Annihilations

    Energy Technology Data Exchange (ETDEWEB)

    Stancari, Michelle Dawn [UC, Irvine

    1999-01-01

    E835 is an experiment dedicated to the precision study of charmonium formed in $\\bar{p}p$ annihilations at the Fermilab Antiproton Accumulator. E835 has measured the resonance parameters of the $\\eta_c$ resonance: $M(\\eta_c$) = 2985.4 $\\pm$ 2.1 MeV, ,($\\eta_c$) = 21.1 $\\pm$ $^{7.5}_{6.2}$ MeV, and, ($\\eta_c \\to \\gamma\\gamma$ ) = 3.9 $^{1.5}_{ 1.3}$ $\\pm$ $^{1.8}_ {1.1}$. Also reported is the two photon width of the $X_2$,,($X_2 \\to \\gamma\\gamma$) = 0.29 $\\pm$ 0.06 $\\pm$ 0:04. A search for the $\\eta^{\\prime}_c$ resonance has resulted in an upper limit for the product of the branching ratios $B(\\eta^{\\prime}_c \\to \\bar{p}p$) x $B(\\eta^{\\prime}_c \\to \\gamma\\gamma$ ) < 12 x $10^{-8}$. An upper limit, ($\\chi_0 \\to \\gamma\\gamma$) < 2.7 keV is set.

  15. Comparison of Protective Effect of Green Tea and Vitamin C Against Cypermethrin Induce Nephrotoxicity in Mice

    International Nuclear Information System (INIS)

    Manzoor, S.; Mehboob, K.; Naveed, A. K.

    2016-01-01

    Background: Insecticide toxicity is the problem of every person in under developed countries. It is necessary to counteract its effect by natural and cheap remedies like green tea and vitamin C. In this manner common man can also enjoy blessings of life. The current research was performed to compare the protective function of green tea and vitamin C on experimental cypermethrin provoked nephrotoxicity Method: Forty healthy Balb/C mice purchased from National Institute of Health, Islamabad, Pakistan and divided in to four groups (10 each). Group a was control which received only normal diet. Group B, group C and group D were experimental groups which were given Cypermethrin, Cypermethrin with green tea and Cypermethrin with vitamin C respectively. These groups were also given normal diet. After 1 month blood was drawn by intra-cardiac method to assess renal parameters. Results: One month research showed increase in serum urea to 6.8±.48 m.mol/l (n=3.9±.44) while green tea and vitamin C normalize them to 4.0±.83 m.mol/l and 3.4±.33 m.mol/l respectively. Serum creatinine increased to 42.90±3.28 m.mol/l (n=29.50±3.95) while green tea and vitamin C normalize them to 28.80±4.58 m.mol/l and 22.60±2.06 m.mol/l correspondingly. Conclusion The results showed that green tea and vitamin C neutralized toxicity induced by Cypermethrin in mice and their effect is comparable. (author)

  16. Sensitivity limits of capacitive transducer for gravitational wave resonant antennas

    Energy Technology Data Exchange (ETDEWEB)

    Bassan, M; Pizzella, G [Rome Tor Vergata Univ. (Italy). Dip. di Fisica

    1996-12-01

    It is analyzed the performance of a resonant gravitational wave antenna equipped with a resonant, d.c. biased capacitive transducer, an untuned superconducting matching circuit and a d.c. Squid. It is derived simple relations for the detector energy sensitivity that serve as guidelines for device development and it is shown that, with reasonable improvements in Squid technology, an effective temperature for burst detection of 2miK can be achieved.

  17. Tunability of resonance frequencies in a superconducting microwave resonator by using SrTiO sub 3 ferroelectric films

    CERN Document Server

    Sok, J; Lee, E H

    1998-01-01

    An applied dc voltage varies the dielectric constant of ferroelectric SrTiO sub 3 films. A tuning mechanism for superconducting microwave resonators was realized by using the variation in the dielectric constant of SrTiO sub 3 films. In order to estimate the values of the capacitance, C, and the loss tangent, tan delta, of SrTiO sub 3 ferroelectric capacitors, we used high-temperature superconducting microwave resonators which were composed of two ports, two poles, and dc bias circuits at the zero-field points. SrTiO sub 3 ferroelectric capacitors successfully controlled the resonant frequency of the resonator. Resonant frequencies of 3.98 GHz and 4.20 GHz were measured at bias voltages of 0 V and 50 V which correspond to capacitance values of 0.94 pF and 0.7pF, respectively. The values of the loss tangent, tan delta sub e sub f sub f , obtained in this measurements, were about 0.01.

  18. Properties of K,Rb-intercalated C60 encapsulated inside carbon nanotubes called peapods derived from nuclear magnetic resonance

    KAUST Repository

    Mahfouz, Remi

    2015-09-18

    We present a detailed experimental study on how magnetic and electronic properties of Rb,K-intercalated C60 encapsulated inside carbon nanotubes called peapods can be derived from 13C nuclear magnetic resonance investigations. Ring currents do play a basic role in those systems; in particular, the inner cavities of nanotubes offer an ideal environment to investigate the magnetism at the nanoscale. We report the largest diamagnetic shifts down to −68.3 ppm ever observed in carbon allotropes, which is connected to the enhancement of the aromaticity of the nanotube envelope upon intercalation. The metallization of intercalated peapods is evidenced from the chemical shift anisotropy and spin-lattice relaxation (T1) measurements. The observed relaxation curves signal a three-component model with two slow and one fast relaxing components. We assigned the fast component to the unpaired electrons charged C60 that show a phase transition near 100 K. The two slow components can be rationalized by the two types of charged C60 at two different positions with a linear regime following Korringa behavior, which is typical for metallic system and allow us to estimate the density of sate at Fermi level n(EF).

  19. Dielectric studies of fluids with reentrant resonators

    International Nuclear Information System (INIS)

    Goodwin, A.R.H.; Moldover, M.R.

    1993-01-01

    The authors have used a reentrant radio-frequency (rf) cavity as a resonator operating near 375 MHz to measure changes in the dielectric constant of fluids within it. The utility of these measurements was demonstrated by determining the dipole moment of 1,1,1,2,3,3-hexafluoropropane, a candidate replacement refrigerant (denoted R236ea) and by detecting the phase boundaries in the mixture [(1-x)C 2 H 6 + xCO 2 ], for the mole fraction x = 0.492. The densities of the coexisting phases of the mixture were determined using the Clausius-Mossotti relation which has errors on the order of 0.5% in this application. To test the accuracy of the present techniques, the rf resonator was calibrated with helium and then used to redetermine the molar polarizability A e of argon. The results were in excellent agreement with published values. The design of the reentrant resonator makes it suitable for use with corrosive fluids at temperature up to 400 degrees C

  20. Stability and delayed fragmentation of highly charged C60 trapped in a conic-electrode electrostatic ion resonator (ConeTrap)

    International Nuclear Information System (INIS)

    Bernard, J.; Wei, B.; Bourgey, A.; Bredy, R.; Chen, L.; Kerleroux, M.; Martin, S.; Montagne, G.; Salmoun, A.; Terpend-Ordaciere, B.

    2007-01-01

    We employed a conic-electrode electrostatic ion resonator (ConeTrap) to store the recoil ions (C 60 r+ ) resulting from collision between 56keV Ar 8+ ions and C 60 in order to study their stability over a long time range (several milliseconds). The originality of our method, based on the trapping of a single ion to preserve the detection in coincidence of all the products of the collision, is presented in detail. Our results show that C 60 ions produced in such collisions are stable in the considered observation time. By employing the ConeTrap as a secondary mass spectrometer in order to let the ions oscillate only for a single period, we have been able to observe delayed evaporation of cold C 60 3+ ions 20μs after the collision. We interpret quantitatively the relative yields of daughter ions with a cascade model in which the transition rates are estimated via the commonly used Arrhenius law, taking into account the contribution of the radiative decay

  1. Fourier photospectroscopy of Xe-C{sub 60} through a Xe 4d resonance window: theory versus recent experiment

    Energy Technology Data Exchange (ETDEWEB)

    Patel, Aakash B; Chakraborty, Himadri S, E-mail: himadri@nwmissouri.edu [Center for Innovation and Entrepreneurship, Department of Chemistry and Physics, Northwest Missouri State University, Maryville, Missouri 64468 (United States)

    2011-10-14

    The photoionization cross section of endohedral Xe-C{sub 60} over a Xe 4d giant resonance energy region, calculated in the time-dependent local density approximation, is compared with recent measurements (Kilcoyne et al 2010 Phys. Rev. Lett. 105 213001). An analysis based on the Fourier transforms of oscillatory cross sections is performed to derive a number of inherent similarities between the prediction and the data, including a large beating-type oscillation and several others of intermediate size. Results stress the need for more accurate measurements to access the wealth of information about the geometry of the system. (fast track communication)

  2. Decay of giant resonance E2 isoscalar in heavy nuclei

    International Nuclear Information System (INIS)

    Herdade, S.B.

    1980-01-01

    In this work, it is made a study of the giant resonance E2 isoscalar, in heavy nuclei. Fission probabilities for this resonance were determined by various authors, in different experiments, for 238 U. (A.C.A.S.) [pt

  3. Search for aligned structure of /sup 12/C-. cap alpha. -/sup 12/C type at high excitation energy in /sup 28/Si. [46 MeV, J,. pi. , resonance, three-body problem

    Energy Technology Data Exchange (ETDEWEB)

    Burnereau, N

    1975-01-01

    The /sup 16/O+/sup 12/C..-->../sup 12/C+..cap alpha..+/sup 12/C reaction is studied mainly at 46MeV (at this energy a state of /sup 28/Si is presumably formed with a spin value of 14/sup +/; resonance of 19.7MeV c.m.). The motivation is to detect an ..cap alpha.. particle with a negligible energy in the c.m. system. This is the signature of the preformation of three aligned clusters in which the average location of the ..cap alpha.. particle is in between the two /sup 12/C's at the center of symmetry of the system. Such a detection is performed by detecting two /sup 12/C's in coincidence at specific angles. The data are understood by three-body calculations with a coupling of relative angular momenta governed by an unique J value. Experimentally, an ..cap alpha.. energy of 200keV is measured with good statistics, supporting the idea of aligned clusters as /sup 28/Si intrinsic shape, related to some highly excited states.

  4. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. K G Padmakumar. Articles written in Resonance – Journal of Science Education. Volume 4 Issue 3 March 1999 pp 62-70 Feature Article. Nature Watch - Rice Bowl in Turmoil: The Kuttanad Wetland Ecosystem · K C Manorama Thampatti K G Padmakumar.

  5. Temperature dependence of the resonance frequency of thermogravimetric devices

    NARCIS (Netherlands)

    Iervolino, E.; Riccio, M.; Van Herwaarden, A.W.; Irace, A.; Breglio, G.; Van der Vlist, W.; Sarro, P.M.

    2010-01-01

    This paper investigates the temperature dependence of the resonance frequency of thermogravimetric (TG) devices for tip heating over the temperature range of View the MathML source 25–600?C. The resonance frequency of a fabricated TG device shows to be temperature independent for tip heating up to

  6. Measurement of elastic modules of structural ceramic by acoustic resonance

    International Nuclear Information System (INIS)

    Ahn, Bong Young; Lee Seong Suck; Kim, Young Gil

    1993-01-01

    Elastic moduli of structural ceramic materials, Al 2 O 3 , SiC, Si 3 N 4 , were measured by acoustic resonance method. Young's modulus, shear modulus, and Poisson's ratio were calculated from the torsional and flexural resonant frequencies, densities, and the dimensions of the specimen. The results by acoustic resonance method were compared with the results by ultrasonic method and the differences were less than 4%.

  7. Resonant shallow donor magnetopolaron effect in a GaAs/AlGaAs quantum dot in high magnetic fields

    International Nuclear Information System (INIS)

    Zhu Kadi.

    1993-11-01

    Resonant shallow donor magnetopolaron effect in a GaAs/AlGaAs quantum dot in high magnetic fields is investigated by the variational treatment. It is shown that both the cyclotron resonant frequency ω * c+ due to the 1s-p+ hydrogenic transition and the cyclotron resonant frequency ω * c- due to the 1s-p - hydrogenic transition increase with the decrease of the dot size. The cyclotron resonant frequency ω * c+ is always larger than the bulk LO-phonon frequency ω LO , while the cyclotron resonant frequency ω * c- is lower than ω LO for larger quantum dots (l 0 > 2.0.r 0 , r 0 is the polaron radius). The results also show that the Coulomb interaction effect on the resonant frequencies is significant. (author). 26 refs, 3 figs

  8. Non-resonant oscillations for some third-order differential equations II

    International Nuclear Information System (INIS)

    Ezeilo, J.O.C.; Omari, P.

    1987-11-01

    The existence of 2π-periodic solutions to the equation x'''+ax''+g(t,x')+cx=p(t) is proved, under certain non-resonance conditions on the non-linear function g(t,y). Here a,c are constants, but the case where a,c are not necessarily constants is also discussed, subject to some rather special non-resonance conditions on g. The uniqueness of the solutions is also examined. (author). 12 refs

  9. Search for the exotic baryon resonances with isospin I=5/2 in the π+p → pπ+π+π- reaction at π+ meson momentum of 3.94 GeV/c

    International Nuclear Information System (INIS)

    Aref'ev, A.V.; Bayukov, Yu.D.; Grishuk, Yu.G.

    1986-01-01

    For the first time, in the π + p → pπ + π + π- reaction at 3.94 Gev/c initial momentum an experimental evidence has been observed for exotic resonances with I=5/2 isospin and masses of 1.48 ± 0.02 and 1.65 ± 0.03 GeV in π - -backward production. In the transfer momentum interval u' 2 production cross sections for M 1 =1.48 and M 2 =1.65 GeV/c 2 resonance equal, respectively, σ 1 =0.35 ± 0.08 σ 2 =0.37 ± 0.13 μb

  10. 3C-Silicon Carbide Microresonators for Timing and Frequency Reference

    Directory of Open Access Journals (Sweden)

    Graham S. Wood

    2016-11-01

    Full Text Available In the drive to miniaturise and integrate reference oscillator components, microelectromechanical systems (MEMS resonators are excellent candidates to replace quartz crystals. Silicon is the most utilised resonator structural material due to its associated well-established fabrication processes. However, when operation in harsh environments is required, cubic silicon carbide (3C-SiC is an excellent candidate for use as a structural material, due to its robustness, chemical inertness and high temperature stability. In order to actuate 3C-SiC resonators, electrostatic, electrothermal and piezoelectric methods have been explored. Both electrothermal and piezoelectric actuation can be accomplished with simpler fabrication and lower driving voltages, down to 0.5 V, compared to electrostatic actuation. The vibration amplitude at resonance can be maximised by optimising the design and location of the electrodes. Electrical read out of the resonator can be performed with electrostatic or piezoelectric transduction. Finally, a great deal of research has focused on tuning the resonant frequency of a 3C-SiC resonator by adjusting the DC bias applied to the electrodes, with a higher (up to 160-times tuning range for electrothermal tuning compared to piezoelectric tuning. Electrothermal tuning lowers the frequency, while piezoelectric tuning can be used to raise the frequency.

  11. Coupling ultracold atoms to a superconducting coplanar waveguide resonator

    OpenAIRE

    Hattermann, H.; Bothner, D.; Ley, L. Y.; Ferdinand, B.; Wiedmaier, D.; Sárkány, L.; Kleiner, R.; Koelle, D.; Fortágh, J.

    2017-01-01

    We demonstrate coupling of magnetically trapped ultracold $^87$Rb ground state atoms to a coherently driven superconducting coplanar resonator on an integrated atom chip. We measure the microwave field strength in the cavity through observation of the AC shift of the hyperfine transition frequency when the cavity is driven off-resonance from the atomic transition. The measured shifts are used to reconstruct the field in the resonator, in close agreement with transmission measurements of the c...

  12. Sequence-specific {sup 1}H, {sup 13}C, and {sup 15}N resonance assignments for intestinal fatty-acid-binding protein complexed with palmitate (15.4 kDA)

    Energy Technology Data Exchange (ETDEWEB)

    Hodsdon, M.E.; Toner, J.J.; Cistola, D.P. [Washington Univ. School of Medicine, St. Louis, MO (United States)

    1994-12-01

    Intestinal fatty-acid-binding protein (I-FABP) belongs to a family of soluble, cytoplasmic proteins that are thought to function in the intracellular transport and trafficking of polar lipids. Individual members of this protein family have distinct specificities and affinities for fatty acids, cholesterol, bile salts, and retinoids. We are comparing several retinol- and fatty-acid-binding proteins from intestine in order to define the factors that control molecular recognition in this family of proteins. We have established sequential resonance assignments for uniformly {sup 13}C/{sup 15}N-enriched I-FABP complexed with perdeuterated palmitate at pH7.2 and 37{degrees}C. The assignment strategy was similar to that introduced for calmodulin. We employed seven three-dimensional NMR experiments to establish scalar couplings between backbone and sidechain atoms. Backbone atoms were correlated using triple-resonance HNCO, HNCA, TOCSY-HMQC, HCACO, and HCA(CO)N experiments. Sidechain atoms were correlated using CC-TOCSY, HCCH-TOCSY, and TOCSY-HMQC. The correlations of peaks between three-dimensional spectra were established in a computer-assisted manner using NMR COMPASS (Molecular Simulations, Inc.) Using this approach, {sup 1}H, {sup 13}C, and {sup 15}N resonance assignments have been established for 120 of the 131 residues of I-FABP. For 18 residues, amide {sup 1}H and {sup 15}N resonances were unobservable, apparently because of the rapid exchange of amide protons with bulk water at pH 7.2. The missing amide protons correspond to distinct amino acid patterns in the protein sequence, which will be discussed. During the assignment process, several sources of ambiguity in spin correlations were observed. To overcome this ambiguity, the additional inter-residue correlations often observed in the HNCA experiment were used as cross-checks for the sequential backbone assignments.

  13. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. B R Vyshakh. Articles written in Resonance – Journal of Science Education. Volume 22 Issue 9 September 2017 pp 847-866 General Article. The Brachistochrone · P C Deshmukh Parth Rajauria Abiya Rajans B R Vyshakh Sudipta Dutta · More Details Abstract ...

  14. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. Vishal Gupta. Articles written in Resonance – Journal of Science Education. Volume 5 Issue 9 September 2000 pp 69-81 General Article. Quantum Computing - Building Blocks of a Quantum Computer · C S Vijay Vishal Gupta · More Details Fulltext PDF. Volume ...

  15. Recommendations concerning magnetic resonance spectroscopy

    International Nuclear Information System (INIS)

    1986-01-01

    In medicine the technique of nuclear magnetic resonance (NMR) is applied in the form of in vivo nuclear magnetic resonance spectroscopy (MRS). In vivo MRS can be carried out non-invasively. The committee of the Dutch Health Council briefly discusses the qualities and potentialities of the nuclei that will probably be used in future clinical spectroscopy: 31 P, 13 C, 1 H (and possibly 19 F and 23 Na). The committee discusses several possibilities of combining imaging and spectroscopy. The imaging of nuclei other than protons is also possible with MRS. Potential applications are considered in oncology, cardiology, neurology and hepatology. (Auth.)

  16. Giant resonances: reaction theory approach

    International Nuclear Information System (INIS)

    Toledo Piza, A.F.R. de; Foglia, G.A.

    1989-09-01

    The study of giant resonances through the use of reaction theory approach is presented and discussed. Measurements of cross-sections to the many available decay channels following excitation of giant multipole resonances (GMR) led one to view these phenomena as complicated dynamical syndromes so that theoretical requirements for their study must be extended beyond the traditional bounds of nuclear structure models. The spectra of decay products following GMR excitation in heavy nuclei are well described by statistical model (Hauser-Feshback, HF) predictions indicated that spreading of the collective modes plays a major role in shaping exclusive cross-sections. (A.C.A.S.) [pt

  17. Surface plasmon enhanced interfacial electron transfer and resonance Raman, surface-enhanced resonance Raman studies of cytochrome C mutants

    Energy Technology Data Exchange (ETDEWEB)

    Zheng, Junwei [Iowa State Univ., Ames, IA (United States)

    1999-11-08

    Surface plasmon resonance was utilized to enhance the electron transfer at silver/solution interfaces. Photoelectrochemical reductions of nitrite, nitrate, and CO2 were studied on electrochemically roughened silver electrode surfaces. The dependence of the photocurrent on photon energy, applied potential and concentration of nitrite demonstrates that the photoelectrochemical reduction proceeds via photoemission process followed by the capture of hydrated electrons. The excitation of plasmon resonances in nanosized metal structures resulted in the enhancement of the photoemission process. In the case of photoelectrocatalytic reduction of CO2, large photoelectrocatalytic effect for the reduction of CO2 was observed in the presence of surface adsorbed methylviologen, which functions as a mediator for the photoexcited electron transfer from silver metal to CO2 in solution. Photoinduced reduction of microperoxidase-11 adsorbed on roughened silver electrode was also observed and attributed to the direct photoejection of free electrons of silver metal. Surface plasmon assisted electron transfer at nanostructured silver particle surfaces was further determined by EPR method.

  18. Alpha resonant scattering for astrophysical reaction studies

    Energy Technology Data Exchange (ETDEWEB)

    Yamaguchi, H.; Kahl, D.; Nakao, T. [Center for Nuclear Study (CNS), University of Tokyo, RIKEN campus, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Wakabayashi, Y.; Kubano, S. [The Institute of Physical and Chemical Research (RIKEN), 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Hashimoto, T. [Research Center for Nuclear Physics (RCNP), Osaka University, 10-1 Mihogaoka, Ibaraki, Osaka 567-0047 (Japan); Hayakawa, S. [Istituto Nazionale Fisica Nucleare - Laboratori Nazionali del Sud (INFN-LNS), Via S. Sofia 62, 95125 Catania (Italy); Kawabata, T. [Department of Physics, Kyoto University, Kita-Shirakawa, Kyoto 606-8502 (Japan); Iwasa, N. [Department of Physics, Tohoku University, Aoba, Sendai, Miyagi 980-8578 (Japan); Teranishi, T. [Department of Physics, Kyushu University, 6-10-1 Hakozaki, Fukuoka 812-8581 (Japan); Kwon, Y. K. [Institute for Basic Science, 70, Yuseong-daero 1689-gil, Yuseong-gu, Daejeon 305-811 (Korea, Republic of); Binh, D. N. [30 MeV Cyclotron Center, Tran Hung Dao Hospital, Hoan Kiem District, Hanoi (Viet Nam); Khiem, L. H.; Duy, N. G. [Institute of Physics, Vietnam Academy of Science and Technology, 18 Hong Quoc Viet, Nghia do, Hanoi (Viet Nam)

    2014-05-02

    Several alpha-induced astrophysical reactions have been studied at CRIB (CNS Radioactive Ion Beam separator), which is a low-energy RI beam separator at Center for Nuclear Study (CNS) of the University of Tokyo. One of the methods to study them is the α resonant scattering using the thick-target method in inverse kinematics. Among the recent studies at CRIB, the measurement of {sup 7}Be+α resonant scattering is discussed. Based on the result of the experiment, we evaluated the contributions of high-lying resonances for the {sup 7}Be(α,γ) reaction, and proposed a new cluster band in {sup 11}C.

  19. Evidence for the 3-fold α-cluster symmetry of 12C

    International Nuclear Information System (INIS)

    Rae, W.D.M.; Fry, P.E.; Merchant, A.C.

    1996-01-01

    Recently, resonances have been observed in the reactions 12 C( 12 C, 12 C(O 2 + )) 12 C(3 - ) and 12 C( 12 C, 12 C(3 - )) 12 C(3 - ) at E cm ∼ 33 MeV. Previously resonances in the reaction 12 C( 12 C, 12 C) 12 C(3 - ) have been reported by Fulton et al. Here we present a new model of these resonances. We relate this model to the classical theory of both the asymmetric rotor and the symmetric top. We believe that detailed spin measurements from these data will provide evidence for the 3-fold symmetry of 12 C. (author). Letter-to-the-editor

  20. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. Martin Ryle. Articles written in Resonance – Journal of Science Education. Volume 23 Issue 2 February 2018 pp 235-239 Classics. Observations of Radio Galaxies with the One-mile Telescope at Cambridge · Martin Ryle B Elsmore Ann C Neville · More Details ...

  1. Simultaneous PET/MRI with (13)C magnetic resonance spectroscopic imaging (hyperPET): phantom-based evaluation of PET quantification.

    Science.gov (United States)

    Hansen, Adam E; Andersen, Flemming L; Henriksen, Sarah T; Vignaud, Alexandre; Ardenkjaer-Larsen, Jan H; Højgaard, Liselotte; Kjaer, Andreas; Klausen, Thomas L

    2016-12-01

    Integrated PET/MRI with hyperpolarized (13)C magnetic resonance spectroscopic imaging ((13)C-MRSI) offers simultaneous, dual-modality metabolic imaging. A prerequisite for the use of simultaneous imaging is the absence of interference between the two modalities. This has been documented for a clinical whole-body system using simultaneous (1)H-MRI and PET but never for (13)C-MRSI and PET. Here, the feasibility of simultaneous PET and (13)C-MRSI as well as hyperpolarized (13)C-MRSI in an integrated whole-body PET/MRI hybrid scanner is evaluated using phantom experiments. Combined PET and (13)C-MRSI phantoms including a NEMA [(18)F]-FDG phantom, (13)C-acetate and (13)C-urea sources, and hyperpolarized (13)C-pyruvate were imaged repeatedly with PET and/or (13)C-MRSI. Measurements evaluated for interference effects included PET activity values in the largest sphere and a background region; total number of PET trues; and (13)C-MRSI signal-to-noise ratio (SNR) for urea and acetate phantoms. Differences between measurement conditions were evaluated using t tests. PET and (13)C-MRSI data acquisition could be performed simultaneously without any discernible artifacts. The average difference in PET activity between acquisitions with and without simultaneous (13)C-MRSI was 0.83 (largest sphere) and -0.76 % (background). The average difference in net trues was -0.01 %. The average difference in (13)C-MRSI SNR between acquisitions with and without simultaneous PET ranged from -2.28 to 1.21 % for all phantoms and measurement conditions. No differences were significant. The system was capable of (13)C-MRSI of hyperpolarized (13)C-pyruvate. Simultaneous PET and (13)C-MRSI in an integrated whole-body PET/MRI hybrid scanner is feasible. Phantom experiments showed that possible interference effects introduced by acquiring data from the two modalities simultaneously are small and non-significant. Further experiments can now investigate the benefits of simultaneous PET and

  2. Resonant inelastic scattering of quasifree electrons on ions

    International Nuclear Information System (INIS)

    Grabbe, S.

    1994-01-01

    Several studies of resonant-transfer excitation (RTE) have been reported in ion-atom collisions where the doubly excited autoionizing states are produced. Such a complex collision can be approximated as the scattering of quasifree electrons of the target from the projectile ion. Most of the investigations have been restricted to the deexcitation of the autoionizing states to the ground state by Auger electron emission. It has been shown that there is a strong interference between the elastic scattering amplitude and the resonance amplitude. The authors present here the cases where the corresponding interference is between the inelastic scattering and the resonance process. Recent work on 3 ell 3 ell ' resonances that decay predominantly to n=2 states will be presented for C 5+ -molecular hydrogen collisions

  3. Contribution of giant resonances in elastic and inelastic scattering of polarized protons on 12C between 19 and 23MeV

    International Nuclear Information System (INIS)

    Gaillard, Y.R.

    1975-01-01

    Angular distributions of analyzing power and differential cross section have been measured for the elastic and inelastic scattering of polarized protons on 12 C, up to 12.7MeV excitation energy. Incident energy varied from 19 to 23MeV by steps of about 200keV, the cyclotron beam energy, varying by steps of about 1MeV, was measured using crossover techniques. Fine steps of energy were obtained by use of carbon absorbers. Elastic scattering data were analyzed using a linear energy-dependent optical model. Data for the level at 4.4MeV excitation energy were analyzed using coupled channel calculations. Preliminary results for the level (1 - , Esub(x)=12.7MeV) were analyzed including giant resonances as doorways states in inelastic scattering, according to Geramb-Amos formalism. This analysis shows that it should be possible to study high-lying giant resonances through their contribution to low-lying state excitation [fr

  4. Study of leading strange meson resonances and spin-orbit splittings in K/sup -/p. -->. K/sup -/. pi. /sup +/n at 11 GeV/c

    Energy Technology Data Exchange (ETDEWEB)

    Honma, A.K.

    1980-11-01

    The results from a high-statistics study of K..pi.. elastic scattering in the reaction K/sup -/p ..-->.. K/sup -/..pi../sup +/n are presented. The data for this analysis are taken from an 11-GeV/c K/sup -/p experiment performed on the Large Aperture Solenoidal Spectrometer (LASS) facility at the Stanford Linear Accelerator Center (SLAC). By selecting the very forward produced K/sup -/..pi../sup +/ events, a sample consisting of data for the K..pi.. ..-->.. K..pi.. elastic scattering reaction was extracted. The angular distribution for this meson-meson scattering is studied by use of both a spherical harmonic moments analysis and a partial-wave analysis (PWA). The previously established leading natural spin-parity strange meson resonances (the J/sup P/ = 1/sup -/ K*(895), the 2/sup +/ K*(1430), and the 3/sup -/ K*(1780)) are observed in the results from both the moments analysis and the PWA. In addition, evidence for a new spin 4/sup -/ K* resonance with a mass of 2080 MeV and a width of about 225 MeV is presented. The results from the PWA confirm the existence of a 0/sup +/ kappa (1490) and propose the existence of a second scalar meson resonance, the 0/sup +/ kappa' (1900). Structure in the P-wave amplitude indicates resonance behavior in the mass region near 1700 MeV. In two of the four ambiguous solutions for the mass region above 1800 MeV, there is strong evidence for another P-wave resonant structure near 2100 MeV. The observed strange meson resonances are found to have a natural interpretation in terms of states predicted by the quark model. In particular, the mass splittings of the leading trajectory natural spin-parity strange meson states and the mass splittings between the spin-orbit triplet states are discussed. 59 figures, 17 tables.

  5. An Enhanced Plane Wave Expansion Method to Solve Piezoelectric Phononic Crystal with Resonant Shunting Circuits

    Directory of Open Access Journals (Sweden)

    Ziyang Lian

    2016-01-01

    Full Text Available An enhanced plane wave expansion (PWE method is proposed to solve piezoelectric phononic crystal (PPC connected with resonant shunting circuits (PPC-C, which is named as PWE-PPC-C. The resonant shunting circuits can not only bring about the locally resonant (LR band gap for the PPC-C but also conveniently tune frequency and bandwidth of band gaps through adjusting circuit parameters. However, thus far, more than one-dimensional PPC-C has been studied just by Finite Element method. Compared with other methods, the PWE has great advantages in solving more than one-dimensional PC as well as various lattice types. Nevertheless, the conventional PWE cannot accurately solve coupling between the structure and resonant shunting circuits of the PPC-C since only taking one-way coupling from displacements to electrical parameters into consideration. A two-dimensional PPC-C model of orthorhombic lattice is established to demonstrate the whole solving process of PWE-PPC-C. The PWE-PPC-C method is validated by Transfer Matrix method as well as Finite Element method. The dependence of band gaps on circuit parameters has been investigated in detail by PWE-PPC-C. Its advantage in solving various lattice types is further illustrated by calculating the PPC-C of triangular and hexagonal lattices, respectively.

  6. A set of triple-resonance nuclear magnetic resonance experiments for structural characterization of organophosphorus compounds in mixture samples

    Energy Technology Data Exchange (ETDEWEB)

    Koskela, Harri, E-mail: Harri.T.Koskela@helsinki.fi [VERIFIN, University of Helsinki, P.O. Box 55, FIN-00014 Helsinki (Finland)

    2012-11-02

    Highlights: Black-Right-Pointing-Pointer New {sup 1}H, {sup 13}C, {sup 31}P triple-resonance NMR pulse experiments. Black-Right-Pointing-Pointer Analysis of organophosphorus (OP) compounds in complex matrix. Black-Right-Pointing-Pointer Selective extraction of {sup 1}H, {sup 31}P, and {sup 13}C chemical shifts and connectivities. Black-Right-Pointing-Pointer More precise NMR identification of OP nerve agents and their degradation products. - Abstract: The {sup 1}H, {sup 13}C correlation NMR spectroscopy utilizes J{sub CH} couplings in molecules, and provides important structural information from small organic molecules in the form of carbon chemical shifts and carbon-proton connectivities. The full potential of the {sup 1}H, {sup 13}C correlation NMR spectroscopy has not been realized in the Chemical Weapons Convention (CWC) related verification analyses due to the sample matrix, which usually contains a high amount of non-related compounds obscuring the correlations of the relevant compounds. Here, the results of the application of {sup 1}H, {sup 13}C, {sup 31}P triple-resonance NMR spectroscopy in characterization of OP compounds related to the CWC are presented. With a set of two-dimensional triple-resonance experiments the J{sub HP}, J{sub CH} and J{sub PC} couplings are utilized to map the connectivities of the atoms in OP compounds and to extract the carbon chemical shift information. With the use of the proposed pulse sequences the correlations from the OP compounds can be recorded without significant artifacts from the non-OP compound impurities in the sample. Further selectivity of the observed correlations is achieved with the application of phosphorus band-selective pulse in the pulse sequences to assist the analysis of multiple OP compounds in mixture samples. The use of the triple-resonance experiments in the analysis of a complex sample is shown with a test mixture containing typical scheduled OP compounds, including the characteristic degradation

  7. Molecular resonances, fusion reactions and surface transparency of interaction between heavy ions

    International Nuclear Information System (INIS)

    Abe, Yasuhisa.

    1980-01-01

    A review of the Band Crossing Model is given, including recent results on the 16 O + 16 O system. Surface Transparency is discussed in the light of the recent development in our understanding of the fusion reaction mechanisms and by calculating the number of open channels available to direct reactions. The existence of the Molecular Resonance Region is suggested in several systems by the fact that Band Crossing Region overlaps with the Transparent Region. A systematic study predicts molecular resonances in the 14 C + 14 C and 12 C + 14 C systems as prominent as those observed in the 16 O + 16 O and 12 C + 16 O systems

  8. Detection of tannins in modern and fossil barks and in plant residues by high-resolution solid-state 13C nuclear magnetic resonance

    Science.gov (United States)

    Wilson, M.A.; Hatcher, P.G.

    1988-01-01

    Bark samples isolated from brown coal deposits in Victoria, Australia, and buried wood from Rhizophora mangle have been studies by high-resolution solid-state nuclear magnetic resonance (NMR) techniques. Dipolar dephasing 13C NMR appears to be a useful method of detecting the presence of tannins in geochemical samples including barks, buried woods, peats and leaf litter. It is shown that tannins are selectively preserved in bark during coalification to the brown coal stage. ?? 1988.

  9. Resonances, resonance functions and spectral deformations

    International Nuclear Information System (INIS)

    Balslev, E.

    1984-01-01

    The present paper is aimed at an analysis of resonances and resonance states from a mathematical point of view. Resonances are characterized as singular points of the analytically continued Lippman-Schwinger equation, as complex eigenvalues of the Hamiltonian with a purely outgoing, exponentially growing eigenfunction, and as poles of the S-matrix. (orig./HSI)

  10. 'Blocking' effects in magnetic resonance? The ferromagnetic nanowires case

    International Nuclear Information System (INIS)

    Ramos, C.A.; De Biasi, E.; Zysler, R.D.; Vassallo Brigneti, E.; Vazquez, M.

    2007-01-01

    We present magnetic resonance results obtained at L, X, and Q bands (1.2, 9.4 and 34GHz, respectively) on ferromagnetic nanowires with a hysteresis cycle characterized by a remanent magnetization M r /M s ∼0.92 and a coercive field H c =1.0kOe. The hysteretic response of the ferromagnetic resonance spectra is discussed in terms of independent contributions of the nanowires aligned along and opposite to the applied field. We will discuss the implications of this study on the magnetic resonance in nanoparticles and other systems with large anisotropy

  11. Resonance line-profiles in galactic disk UV-bright stars

    International Nuclear Information System (INIS)

    Carrasco, L.; Costero, R.

    1987-01-01

    We have made a comparative analysis of UV resonance line-profiles in O-type stars members of young clusters and OB associations, with those of hot stars located away from sites of recent star formation (including ''runaway'' stars). The resonance line-profiles are found to be generally dominated by stellar winds that appear to depend mainly on the surface gravity and temperature of the star, and not on its mass. We also present the C IV, Si IV and N V resonance line-profiles for eleven stars not published in the previous two papers. The use of only the largest stellar wind velocity detectable in the resonance lines as a stellar population indicator, is disputed. (author)

  12. Microscopic investigation of the 12C + 12C interaction

    International Nuclear Information System (INIS)

    Baye, D.; Pecher, N.; Brussels Univ.

    1982-01-01

    The 12 C + 12 C system is studied in the framework of the generator coordinate method. Each 12 C nucleus is described by a closed psub(3/2) subshell. Phase shifts and resonances are determined for several effective two-body interactions involving a spin-orbit term. The existence and properties of simple local equivalent potentials for the 12 C + 12 C collision are discussed. The 12 C + 12 C system is too light to be well described by potentials independent of the angular momentum or weakly dependent on it. (orig.)

  13. Non-resonant triple alpha reaction rate at low temperature

    Energy Technology Data Exchange (ETDEWEB)

    Itoh, T.; Tamii, A.; Aoi, N.; Fujita, H.; Hashimoto, T.; Miki, K.; Ogata, K. [Research Center for Nuclear Physics, Osaka University, Ibaraki, Osaka 567-0047 (Japan); Carter, J.; Donaldson, L.; Sideras-Haddad, E. [Schools of Physics, University of Witwatersrand, Johannesburg 2050 (South Africa); Furuno, T.; Kawabata, T. [Departments of Physics, Kyoto University, Sakyo, Kyoto, 606-8502 (Japan); Kamimura, M. [RIKEN Nishina Center, Wako, Saitama, 351-0198 (Japan); Nemulodi, F.; Neveling, R.; Smit, F. D.; Swarts, C. [iThemba Laboratory for Accelerator Based Sciences Somerset, West, 7129 (South Africa)

    2014-05-02

    Our experimental goal is to study the non-resonant triple alpha reaction rate at low temperture (T < 10{sup 8} K). The {sup 13}C(p,d) reaction at 66 MeV has been used to probe the alpha-unbound continuum state in {sup 12}C just below the 2{sup nd} 0{sup +} state at 7.65 MeV. The transition strength to the continuum state is predicted to be sensitive to the non-resonant triple alpha reaction rate. The experiment has been performed at iThemba LABS. We report the present status of the experiment.

  14. Resonant Magnon-Phonon Polaritons in a Ferrimagnet

    Science.gov (United States)

    2000-09-29

    UNCLASSIFIED Defense Technical Information Center Compilation Part Notice ADPO 11604 TITLE: Resonant Magnon -Phonon Polaritons in a Ferrimagnet...part numbers comprise the compilation report: ADP011588 thru ADP011680 UNCLASSIFIED 75 Resonant Magnon -Phonon Polaritons in a Ferrimagnet I. E...susceptibilities X"aa and X’m << X’m appear, where 77 xem - DPx igEo0 i_ Xxy - hy- C1 (0)2 _ 00t2) 4= -7• 4 3. Phonon and magnon polaritons We solve the

  15. Pharyngeal branchial cyst: magnetic resonance findings

    Energy Technology Data Exchange (ETDEWEB)

    Cerezal, L.; Canga, A. [Department of Radiology of the ' Santa Cruz' Hospital Liencres, Cantabria (Spain); Morales, C. [Department of Otorhinolaryngology of the ' Sierrallana' Hospital Torrelavega, Cantabria (Spain); Abascal, F.; Usamentiaga, E.; Bustamante, M. [Department of Radiology of the University Hospital ' Marques de Valdecilla' , Av. de Valdecilla s/n Santander 39008 (Spain); Olcinas, O. [Department of Pathology of the University Hospital ' Marques de Valdecilla' , Av. de Valdecilla s/n Santander 39008 (Spain)

    1998-11-01

    An unusual case of pharyngeal cyst in a 25-year-old man studied by Magnetic Resonance (MR) is described. Anatomic location and pathological findings indicated the second branchial pouch origin. (Copyright (c) 1998 Elsevier Science B.V., Amsterdam. All rights reserved.)

  16. Pharyngeal branchial cyst: magnetic resonance findings

    International Nuclear Information System (INIS)

    Cerezal, L.; Canga, A.; Morales, C.; Abascal, F.; Usamentiaga, E.; Bustamante, M.; Olcinas, O.

    1998-01-01

    An unusual case of pharyngeal cyst in a 25-year-old man studied by Magnetic Resonance (MR) is described. Anatomic location and pathological findings indicated the second branchial pouch origin. (Copyright (c) 1998 Elsevier Science B.V., Amsterdam. All rights reserved.)

  17. Wave propagation through an electron cyclotron resonance layer

    International Nuclear Information System (INIS)

    Westerhof, E.

    1997-01-01

    The propagation of a wave beam through an electron cyclotron resonance layer is analysed in two-dimensional slab geometry in order to assess the deviation from cold plasma propagation due to resonant, warm plasma changes in wave dispersion. For quasi-perpendicular propagation, N ' 'parallel to'' ≅ v t /c, an O-mode beam is shown to exhibit a strong wiggle in the trajectory of the centre of the beam when passing through the fundamental electron cyclotron resonance. The effects are largest for low temperatures and close to perpendicular propagation. Predictions from standard dielectric wave energy fluxes are inconsistent with the trajectory of the beam. Qualitatively identical results are obtained for the X-mode second harmonic. In contrast, the X-mode at the fundamental resonance shows significant deviations form cold plasma propagation only for strongly oblique propagation and/or high temperatures. On the basis of the obtained results a practical suggestion is made for ray tracing near electron cyclotron resonance. (Author)

  18. Study of isovector resonances with pion charge exchange

    International Nuclear Information System (INIS)

    Baer, H.W.; Bolton, R.; Bowman, J.D.

    1982-01-01

    Studies with the pion charge exchange reactions (π/sup +-/,π 0 ) at 164 MeV using the LAMPF π 0 spectrometer are yielding new results on the existence and systematic features of isovector resonances in nuclei. These experiments possess an unusually high signal/background ratio for isovector resonances of low-multipolarity. Results obtained to date are: (1) observation and angular disribution measurement of the giant dipole resonance in nuclei 12 C, 40 Ca, 90 Zr, and 120 Sn; and (2) observation and angular distribution measurements in the (π - ,π 0 ) reaction on 90 Zr and 120 Sn of large signals possessing the expected angular distribution shapes and magnitudes for the isovector monopole resonance. Excitation energies are near the hydrodynamical model values 170 A - /sup 1/3/ MeV. Differential cross sections are approximately 0.7 J 1 2 (qR) mb/sr. An overview of this experimental program, with emphasis on new results and how they correlate with existing knowledge on the isovector resonances, is presented

  19. Real-time high-resolution X-ray imaging and nuclear magnetic resonance study of the hydration of pure and Na-doped C3A in the presence of sulfates

    KAUST Repository

    Kirchheim, A. P.; Dal Molin, Denise Carpena Coitinho; Fischer, Peter J.; Emwas, Abdul-Hamid M.; Provis, John L.; Monteiro, Paulo José Meleragno

    2011-01-01

    window, combined with solution analysis by 27Al nuclear magnetic resonance (NMR) spectroscopy, was used to capture information regarding the mechanism of C3A hydration during the early stages. There are differences in the hydration mechanism between

  20. The 12C+12C → 8Begs+16Ogs reaction at Ecm=27 to 36 MeV

    International Nuclear Information System (INIS)

    Aliotta, M.; Lattuada, M.; Spitaleri, C.

    1996-01-01

    The 12 C + 12 C → 8 Be gs + 16 O gs reaction has been experimentally investigated at c.m. energies between 27 and 36 MeV. A resonance is present at 32.5 MeV, i.e. at the same energy of the resonance previously observed [1] in the 12 C(0 + 2 ) + 12 C(0 + 2 ) exit channel, but its width is about three times narrower. Moreover the data indicate an enhancement of the cross section at a c.m. energy close to 29 MeV. These results are discussed and compared to the predictions of the Band Crossing Model obtained for different exit channels of the 12 C + 12 C reaction. (orig.)

  1. Off-resonant vibrational excitation: Orientational dependence and spatial control of photofragments

    DEFF Research Database (Denmark)

    Machholm, Mette; Henriksen, Niels Engholm

    2000-01-01

    Off-resonant and resonant vibrational excitation with short intense infrared (IR) laser pulses creates localized oscillating wave packets, but differs by the efficiency of the excitation and surprisingly by the orientational dependence. Orientational selectivity of the vibrational excitation...... of randomly oriented heteronuclear diatomic molecules can be obtained under simultaneous irradiation by a resonant and an off-resonant intense IR laser pulse: Molecules with one initial orientation will be vibrationally excited, while those with the opposite orientation will be at rest. The orientation-dependent...... distribution. (C) 2000 American Institute of Physics....

  2. Resonance capture and dynamics of three-planet systems

    Science.gov (United States)

    Charalambous, C.; Martí, J. G.; Beaugé, C.; Ramos, X. S.

    2018-06-01

    We present a series of dynamical maps for fictitious three-planet systems in initially circular coplanar orbits. These maps have unveiled a rich resonant structure involving two or three planets, as well as indicating possible migration routes from secular to double resonances or pure three-planet commensurabilities. These structures are then compared to the present-day orbital architecture of observed resonant chains. In a second part of the paper, we describe N-body simulations of type-I migration. Depending on the orbital decay time-scale, we show that three-planet systems may be trapped in different combinations of independent commensurabilities: (i) double resonances, (ii) intersection between a two-planet and a first-order three-planet resonances, and (iii) simultaneous libration in two first-order three-planet resonances. These latter outcomes are found for slow migrations, while double resonances are almost always the final outcome in high-density discs. Finally, we discuss an application to the TRAPPIST-1 system. We find that, for low migration rates and planetary masses of the order of the estimated values, most three-planet sub-systems are able to reach the observed double resonances after following evolutionary routes defined by pure three-planet resonances. The final orbital configuration shows resonance offsets comparable with present-day values without the need of tidal dissipation. For the 8/5 resonance proposed to dominate the dynamics of the two inner planets, we find little evidence of its dynamical significance; instead, we propose that this relation between mean motions could be a consequence of the interaction between a pure three-planet resonance and a two-planet commensurability between planets c and d.

  3. Active tuning of surface phonon polariton resonances via carrier photoinjection

    Science.gov (United States)

    Dunkelberger, Adam D.; Ellis, Chase T.; Ratchford, Daniel C.; Giles, Alexander J.; Kim, Mijin; Kim, Chul Soo; Spann, Bryan T.; Vurgaftman, Igor; Tischler, Joseph G.; Long, James P.; Glembocki, Orest J.; Owrutsky, Jeffrey C.; Caldwell, Joshua D.

    2018-01-01

    Surface phonon polaritons (SPhPs) are attractive alternatives to infrared plasmonics for subdiffractional confinement of infrared light. Localized SPhP resonances in semiconductor nanoresonators are narrow, but that linewidth and the limited extent of the Reststrahlen band limit spectral coverage. To address this limitation, we report active tuning of SPhP resonances in InP and 4H-SiC by photoinjecting free carriers into nanoresonators, taking advantage of the coupling between the carrier plasma and optic phonons to blueshift SPhP resonances. We demonstrate state-of-the-art tuning figures of merit upon continuous-wave excitation (in InP) or pulsed excitation (in 4H-SiC). Lifetime effects cause the tuning to saturate in InP, and carrier redistribution leads to rapid (electronic and phononic excitations.

  4. The effect of non-uniform fuel rod temperatures on effective resonance integrals

    International Nuclear Information System (INIS)

    Reichel, A.

    1961-06-01

    The effective resonance integral for heterogeneous lattices can be reduced to the effective resonance integral for an equivalent homogeneous system with a fairly well defined error depending on lump size and geometry. This report investigates the effect of a radial parabolic temperature variation in cylindrical lumps on the equivalent homogeneous effective resonance integral. Also determined is the equivalent uniform temperature to be taken in the usual formulae to allow for non-uniform fuel rod temperature. This effective temperature is found to be T eff. = T s + 4/9 (T c - T s ) where T s and T c are the surface and central temperatures of the lump. (author)

  5. Solution and solid state NMR studies of the structure and dynamics of C60 and C70

    International Nuclear Information System (INIS)

    Johnson, R.D.; Yannoni, C.S.; Salem, J.; Meijer, G.; Bethune, D.S.

    1991-01-01

    This paper investigates the structure and dynamics of C 60 and C 70 with 13 C NMR spectroscopy. In solution, high-resolution spectra reveal that C 60 has a single resonance at 143 ppm, indicating a strained, aromatic system with high symmetry. This is strong evidence for a C 60 soccer ball geometry. A 2D NMR INADEQUATE experiment on 13 C-enriched C 70 reveals the bonding connectivity to be a linear string, in firm support of the proposed rugby ball structure with D 5h symmetry, and furnishes resonance assignments. Solid state NMR spectra of C 60 at ambient temperatures yield a narrow resonance, indicative of rapid molecular reorientation. Variable temperature T 1 measurements show that the rotational correlation time is ∼ 10 - 9 s at 230 K. At 77 K, this time increases to more than 1 ms, and the 13 C NMR spectrum of C 60 is a powder pattern due to chemical shift anisotropy (tensor components 220, 186, 40 ppm). At intermediate temperatures a narrow peak is superimposed on the powder pattern, suggesting a distribution of barriers to molecular motion in the sample, or the presence of an additional phase in the solid state. A Carr-Purcell dipolar experiment on C 60 in the solid state allows the first precise determination of the C 60 bond lengths: 1.45 and 1.40 Angstrom

  6. The market for magnetic resonance spectroscopy

    International Nuclear Information System (INIS)

    Carlson, L.

    1990-01-01

    The medical market is, at present, the most dominant market for low T c superconductors. Indeed, without magnetic resonance imaging (MRI), there would hardly be a low T c superconductor market at all. According to the author, any development that can expand the medical market for MRI machines would be a welcome one. This paper reports how the recent advances in magnetic resonance spectroscopy (MRS) are such a development. While the principle of MRS has bee around as long as MRI, only recently have advances in technique, computer programming and magnet technology allowed MRS to advance to a point where it may become an important technology-one that could increase the medical market for superconductors. The author discussed how MRS can be used to analyze oil core samples for their oil content, oil/water ratios, how the oil is bound and how to extract it

  7. Tunable nanoelectromechanical resonator for logic computations

    KAUST Repository

    Kazmi, Syed N R; Hafiz, Md Abdullah Al; Chappanda, Karumbaiah N.; Ilyas, Saad; Holguin, Jorge; Da Costa, Pedro M. F. J.; Younis, Mohammad I.

    2017-01-01

    There has been remarkable interest in nanomechanical computing elements that can potentially lead to a new era in computation due to their re-configurability, high integration density, and high switching speed. Here we present a nanomechanical device capable of dynamically performing logic operations (NOR, NOT, XNOR, XOR, and AND). The concept is based on the active tuning of the resonance frequency of a doubly-clamped nanoelectromechanical beam resonator through electro-thermal actuation. The performance of this re-configurable logic device is examined at elevated temperatures, ranging from 25 °C to 85 °C, demonstrating its resilience for most of the logic operations. The proposed device can potentially achieve switching rate in μs, switching energy in nJ, and an integration density up to 10 per cm. The practical realization of this re-configurable device paves the way for nano-element-based mechanical computing.

  8. Tunable nanoelectromechanical resonator for logic computations

    KAUST Repository

    Kazmi, Syed N R

    2017-02-14

    There has been remarkable interest in nanomechanical computing elements that can potentially lead to a new era in computation due to their re-configurability, high integration density, and high switching speed. Here we present a nanomechanical device capable of dynamically performing logic operations (NOR, NOT, XNOR, XOR, and AND). The concept is based on the active tuning of the resonance frequency of a doubly-clamped nanoelectromechanical beam resonator through electro-thermal actuation. The performance of this re-configurable logic device is examined at elevated temperatures, ranging from 25 °C to 85 °C, demonstrating its resilience for most of the logic operations. The proposed device can potentially achieve switching rate in μs, switching energy in nJ, and an integration density up to 10 per cm. The practical realization of this re-configurable device paves the way for nano-element-based mechanical computing.

  9. Resonator quantum electrodynamics on a microtrap chip

    International Nuclear Information System (INIS)

    Steinmetz, Tilo

    2008-01-01

    In the present dissertation experiments on resonator quantum electrodynamics on a microtrap chip are described. Thereby for the first time single atoms catched in a chip trap could be detected. For this in the framework of this thesis a novel optical microresonator was developed, which can because of its miniaturization be combined with the microtrap technique introduced in our working group for the manipulation of ultracold atoms. For this resonator glass-fiber ends are used as mirror substrates, between which a standing light wave is formed. With such a fiber Fabry-Perot resonator we obtain a finess of up to ∼37,000. Because of the small mode volumina in spite of moderate resonator quality the coherent interaction between an atom and a photon can be made so large that the regime of the strong atom-resonator coupling is reached. For the one-atom-one-photon coupling rate and the one-atom-one-photon cooperativity thereby record values of g 0 =2π.300 MHz respectively C 0 =210 are reached. Just so for the first time the strong coupling regime between a Bose-Einstein condensate (BEC) and the field of a high-quality resonator could be reached. The BEC was thereby by means of the magnetic microtrap potentials deterministically brought to a position within the resonator and totally transformed in a well defined antinode of an additionally optical standing-wave trap. The spectrum of the coupled atom-resonator system was measured for different atomic numbers and atom-resonator detunings, whereby a collective vacuum Rabi splitting of more than 20 GHz could be reached. [de

  10. Properties of K,Rb-intercalated C{sub 60} encapsulated inside carbon nanotubes called peapods derived from nuclear magnetic resonance

    Energy Technology Data Exchange (ETDEWEB)

    Mahfouz, R. [Division of Physical Sciences & Engineering, King Abdullah University of Science and Technology, Thuwal (Saudi Arabia); Bouhrara, M. [Department of Chemistry, School of Science and Technology, Nazarbayev University, 010000 Astana, Republic of Kazakhstan (Kazakhstan); Kim, Y. [Department of Materials Science and Engineering, University of Pennsylvania, Philadelphia, Pennsylvania 19104 (United States); Wågberg, T. [Department of Physics, Umeå University, 901 87 Umeå (Sweden); Goze-Bac, C. [nanoNMRI Group, UMR5587, Université Montpellier II, Place E. Bataillon, 34095 Montpellier, Cedex 5 (France); Abou-Hamad, E., E-mail: edy.abouhamad@kaust.edu.sa [KAUST Catalysis Center (KCC) King Abdullah University of Science and Technology, Thuwal (Saudi Arabia)

    2015-09-21

    We present a detailed experimental study on how magnetic and electronic properties of Rb,K-intercalated C{sub 60} encapsulated inside carbon nanotubes called peapods can be derived from {sup 13}C nuclear magnetic resonance investigations. Ring currents do play a basic role in those systems; in particular, the inner cavities of nanotubes offer an ideal environment to investigate the magnetism at the nanoscale. We report the largest diamagnetic shifts down to −68.3 ppm ever observed in carbon allotropes, which is connected to the enhancement of the aromaticity of the nanotube envelope upon intercalation. The metallization of intercalated peapods is evidenced from the chemical shift anisotropy and spin-lattice relaxation (T{sub 1}) measurements. The observed relaxation curves signal a three-component model with two slow and one fast relaxing components. We assigned the fast component to the unpaired electrons charged C{sub 60} that show a phase transition near 100 K. The two slow components can be rationalized by the two types of charged C{sub 60} at two different positions with a linear regime following Korringa behavior, which is typical for metallic system and allow us to estimate the density of sate at Fermi level n(E{sub F})

  11. The resonance Bremsstrahlung of a fast charged particle in a medium

    International Nuclear Information System (INIS)

    Beshtoev, Kh.M.

    1998-01-01

    The Bremsstrahlung of the fast charged particle in the medium with dielectric permittivity ε at velocities υ ≥ c/n (n 2 =Reε) is considered. The Bremsstrahlung has singularity at β = 1/ncosθ (β = υ/c, θ is an angle of the Bremsstrahlung). This Bremsstrahlung is interpreted as resonance Bremsstrahlung with the width characterized by Imε=ε 2 , and the less ε 2 is, the higher the peak of this resonance rises. The angular distribution of the Bremsstrahlung is determined by cos θ=1/nβ and this angle coincides with the angle of the Cherenkov radiation. At β=1/n this resonance Bremsstrahlung goes in the forward direction and depends on frequency ω (ε=ε (ω))

  12. Enhanced forensic discrimination of pollutants by position-specific isotope analysis using isotope ratio monitoring by (13)C nuclear magnetic resonance spectrometry.

    Science.gov (United States)

    Julien, Maxime; Nun, Pierrick; Höhener, Patrick; Parinet, Julien; Robins, Richard J; Remaud, Gérald S

    2016-01-15

    In forensic environmental investigations the main issue concerns the inference of the original source of the pollutant for determining the liable party. Isotope measurements in geochemistry, combined with complimentary techniques for contaminant identification, have contributed significantly to source determination at polluted sites. In this work we have determined the intramolecular (13)C profiles of several molecules well-known as pollutants. By giving additional analytical parameters, position-specific isotope analysis performed by isotope ratio monitoring by (13)C nuclear magnetic resonance (irm-(13)C NMR) spectrometry gives new information to help in answering the major question: what is the origin of the detected contaminant? We have shown that isotope profiling of the core of a molecule reveals both the raw materials and the process used in its manufacture. It also can reveal processes occurring between the contamination site 'source' and the sampling site. Thus, irm-(13)C NMR is shown to be a very good complement to compound-specific isotope analysis currently performed by mass spectrometry for assessing polluted sites involving substantial spills of pollutant. Copyright © 2015 Elsevier B.V. All rights reserved.

  13. Electrochemistry, surface plasmon resonance, and quartz crystal microbalance: an associative study on cytochrome c adsorption on pyridine tail-group monolayers on gold.

    Science.gov (United States)

    Paulo, Tércio de F; de Sousa, Ticyano P; de Abreu, Dieric S; Felício, Nathalie H; Bernhardt, Paul V; Lopes, Luiz G de F; Sousa, Eduardo H S; Diógenes, Izaura C N

    2013-07-25

    Quartz crystal microbalance (QCM), surface plasmon resonance (SPR), and electrochemistry techniques were used to study the electron-transfer (ET) reaction of cytochrome c (Cyt c) on gold surfaces modified with thionicotinamide, thioisonicotinamide, 4-mercaptopyridine, 5-(4-pyridyl)-1,3,4-oxadiazole-2-thiol, 5-phenyl-1,3,4-oxadiazole-2-thiol, 4,4'-bipyridine, and 4,4'-dithiopyridine. The electrochemical results showed that the ET process is complex, being chiefly diffusional with steps depending on the orientation of the pyridine or phenyl tail group of the modifiers. The correlation between the electrochemical results and those acquired by SPR and QCM indicated the presence of an adlayer of Cyt c adsorbed on the thiolate SAMs. This adlayer, although being not electroactive, is essential to assess the ET reaction of Cyt c in solution. The results presented in this work are consistent with the statement (Feng, Z. Q.; Imabayashi, S.; Kakiuchi, T.; Niki, K. J. Electroanal. Chem. 1995, 394, 149-154) that the ET reaction of Cyt c can be explained in terms of the through-bond tunneling mechanism.

  14. Josephson plasma resonance in superconducting multilayers

    DEFF Research Database (Denmark)

    Pedersen, Niels Falsig; Sakai, S

    1998-01-01

    We derive an analytical solution for the Josephson plasma resonance of superconducting multilayers. This analytical solution is derived mainly for low-T-c systems with magnetic coupling between the superconducting layers. but many features of our results are more general, and thus an application...

  15. Theoretical studies of the local structure and electron paramagnetic resonance parameters for tetragonal VO{sup 2+} in C{sub 6}H{sub 7}KO{sub 7}

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, Ping [Chongqing Jiaotong Univ. (China). School of Science; Li, Ling [Sichuan University of Arts and Science, Dazhou (China). Dept. of Maths and Finance-Economics

    2015-07-01

    The optical spectra, electron paramagnetic resonance parameters (i.e., the spin Hamiltonian parameters, including paramagnetic g factors and the hyperfine structure constants A{sub i}) and the local distortion structure for the tetragonal VO{sup 2+} in C{sub 6}H{sub 7}KO{sub 7} are theoretically studied based on the crystal-field theory and three-order perturbation formulas of a 3d{sup 1} centre in tetragonal site. The magnitude of orbital reduction factor, core polarisation constant κ, and local structure parameters are obtained by fitting the calculated optical spectra and electron paramagnetic resonance parameters to the experimental values. The theoretical results are in reasonable agreement with the experimental values.

  16. Nuclear magnetic resonance data of C36H30Br2OSb2

    Science.gov (United States)

    Mikhova, B. M.

    This document is part of Part 6 `Organic Metalloid Compounds' of Subvolume D 'Chemical Shifts and Coupling Constants for Carbon-13' of Landolt-Börnstein III/35 'Nuclear Magnetic Resonance Data', Group III 'Condensed Matter'.

  17. Nuclear magnetic resonance data of C36H30Cl2OSb2

    Science.gov (United States)

    Mikhova, B. M.

    This document is part of Part 6 `Organic Metalloid Compounds' of Subvolume D 'Chemical Shifts and Coupling Constants for Carbon-13' of Landolt-Börnstein III/35 'Nuclear Magnetic Resonance Data', Group III 'Condensed Matter'.

  18. CACA-TOCSY with alternate 13C–12C labeling: a 13Cα direct detection experiment for mainchain resonance assignment, dihedral angle information, and amino acid type identification

    Science.gov (United States)

    Takeuchi, Koh; Frueh, Dominique P.; Sun, Zhen-Yu J.; Hiller, Sebastian

    2010-01-01

    We present a 13C direct detection CACA-TOCSY experiment for samples with alternate 13C–12C labeling. It provides inter-residue correlations between 13Cα resonances of residue i and adjacent Cαs at positions i − 1 and i + 1. Furthermore, longer mixing times yield correlations to Cα nuclei separated by more than one residue. The experiment also provides Cα-to-sidechain correlations, some amino acid type identifications and estimates for ψ dihedral angles. The power of the experiment derives from the alternate 13C–12C labeling with [1,3-13C] glycerol or [2-13C] glycerol, which allows utilizing the small scalar 3JCC couplings that are masked by strong 1JCC couplings in uniformly 13C labeled samples. PMID:20383561

  19. Correlation between the 12C+12C, 12C+13C, and 13C+13C fusion cross sections

    Science.gov (United States)

    Notani, M.; Esbensen, H.; Fang, X.; Bucher, B.; Davies, P.; Jiang, C. L.; Lamm, L.; Lin, C. J.; Ma, C.; Martin, E.; Rehm, K. E.; Tan, W. P.; Thomas, S.; Tang, X. D.; Brown, E.

    2012-01-01

    The fusion cross section for 12C+13C has been measured down to Ec.m.=2.6 MeV, at which the cross section is of the order of 20 nb. By comparing the cross sections for the three carbon isotope systems, 12C+12C, 12C+13C, and 13C+13C, it is found that the cross sections for 12C+13C and 13C+13C provide an upper limit for the fusion cross section of 12C+12C over a wide energy range. After calibrating the effective nuclear potential for 12C+12C using the 12C+13C and 13C+13C fusion cross sections, it is found that a coupled-channels calculation with the ingoing wave boundary condition (IWBC) is capable of predicting the major peak cross sections in 12C+12C. A qualitative explanation for this upper limit is provided by the Nogami-Imanishi model and by level density differences among the compound nuclei. It is found that the strong resonance found at 2.14 MeV in 12C+12C exceeds this upper limit by a factor of more than 20. The preliminary result from the most recent measurement shows a much smaller cross section at this energy, which agrees with our predicted upper limit.

  20. Transformer induced instability of the series resonant converter

    Science.gov (United States)

    King, R. J.; Stuart, T. A.

    1983-01-01

    It is shown that the common series resonant power converter is subject to a low frequency oscillation that can lead to the loss of cyclic stability. This oscillation is caused by a low frequency resonant circuit formed by the normal L and C components in series with the magnetizing inductance of the output transformer. Three methods for eliminating this oscillation are presented and analyzed. One of these methods requires a change in the circuit topology during the resonance cycle. This requires a new set of steady state equations which are derived and presented in a normalized form. Experimental results are included which demonstrate the nature of the low frequency oscillation before cyclic stability is lost.

  1. The Nuclear Magnetic Resonance and its utilization in image formation

    International Nuclear Information System (INIS)

    Bonagamba, T.J.; Tannus, A.; Panepucci, H.

    1987-01-01

    Some aspects about Nuclear Magnetic Resonance (as Larmor Theorem, radio frequency pulse, relaxation of spins system) and its utilization in two dimensional image processing with the necessity of a tomography plane are studied. (C.G.C.) [pt

  2. Determination of Structures and Energetics of Small- and Medium-Sized One-Carbon-Bridged Twisted Amides using ab Initio Molecular Orbital Methods: Implications for Amidic Resonance along the C-N Rotational Pathway.

    Science.gov (United States)

    Szostak, Roman; Aubé, Jeffrey; Szostak, Michal

    2015-08-21

    Twisted amides containing nitrogen at the bridgehead position are attractive practical prototypes for the investigation of the electronic and structural properties of nonplanar amide linkages. Changes that occur during rotation around the N-C(O) axis in one-carbon-bridged twisted amides have been studied using ab initio molecular orbital methods. Calculations at the MP2/6-311++G(d,p) level performed on a set of one-carbon-bridged lactams, including 20 distinct scaffolds ranging from [2.2.1] to [6.3.1] ring systems, with the C═O bond on the shortest bridge indicate significant variations in structures, resonance energies, proton affinities, core ionization energies, frontier molecular orbitals, atomic charges, and infrared frequencies that reflect structural changes corresponding to the extent of resonance stabilization during rotation along the N-C(O) axis. The results are discussed in the context of resonance theory and activation of amides toward N-protonation (N-activation) by distortion. This study demonstrates that one-carbon-bridged lactams-a class of readily available, hydrolytically robust twisted amides-are ideally suited to span the whole spectrum of the amide bond distortion energy surface. Notably, this study provides a blueprint for the rational design and application of nonplanar amides in organic synthesis. The presented findings strongly support the classical amide bond resonance model in predicting the properties of nonplanar amides.

  3. Neutral Pion Electroproduction in the Δ Resonance Region

    Energy Technology Data Exchange (ETDEWEB)

    Villano, Anthony [Rensselaer Polytechnic Inst., Troy, NY (United States)

    2007-11-01

    The electroproduction of baryon resonances at high Q2 is examined. Analysis focuses on the Δ(1232) resonance via exclusive pseudoscalar meson production of π0 particles. Differential cross sections are extracted for exclusive π0 electroproduction. In the central invariant mass (W) region the cross sections are used to extract resonant multipole amplitudes. In particular, the ratio of the electric quadrupole to magnetic dipole amplitudes (E2/M1) will be discussed for the Δ(1232) resonance. The transition to pQCD is discussed in terms of E2/M1 and other multipoles. The helicity amplitude A3/2 can be used as a baryon helicity conservation meter in this context and will be discussed. The fast shrinking of the resonant contribution in the Δ region is observed at this high momentum transfer. Apart from the observables related to pQCD scaling, the transition form factor G$*\\atop{M}$ is extracted along with the scalar to magnetic dipole ratio C2/M1.

  4. Reaction rate of the 13C(α,n)16O neutron source using the ANC of the -3 keV resonance measured with the THM

    International Nuclear Information System (INIS)

    La Cognata, M; Spitaleri, C; Trippella, O; Kiss, G G; Guardo, G L; Puglia, S M R; Romano, S; Spartà, R; Rogachev, G V; Avila, M; Koshchiy, E; Kuchera, A; Santiago, D; Mukhamedzhanov, A M; Lamia, L

    2016-01-01

    The s-process is responsible of the synthesis of most of the nuclei in the mass range 90 ≤ A ≤ 208. It consists in a series of neutron capture reactions on seed nuclei followed by β-decays, since the neutron accretion rate is slower than the β-decay rate. Such small neutron flux is supplied by the 13 C(α,n) 16 O reaction. It is active inside the helium-burning shell of asymptotic giant branch stars, at temperatures < 10 8 K, corresponding to an energy interval of 140–230 keV. In this region, the astrophysical S (E)-factor is dominated by the −3 keV sub-threshold resonance due to the 6.356 MeV level in 17 O. In this work, we have applied the Trojan Horse Method (THM) to the 13 C( 6 Li,n 16 O)d quasi-free reaction to extract the 6.356 MeV level resonance parameters, in particular the asymptotic normalization coefficient . A preliminary analysis of a partial data set has lead to , slightly larger than the values in the literature. However, the deduced 13 C(α, n) 16 O reaction rate is in agreement with most results in the literature at ∼ 10 8 K, with enhanced accuracy thanks to our innovative approach merging together ANC and THM. (paper)

  5. Nuclear isovector giant resonances excited by pion single charge exchange

    International Nuclear Information System (INIS)

    King, B.H.

    1993-07-01

    This thesis is an experimental study of isovector giant resonances in light nuclei excited by pion single charge exchange reactions. Giant dipole resonances in light nuclei are known to be highly structured. For the mass 9 and 13 giant dipole resonances, isospin considerations were found to be very important to understanding this structure. by comparing the excitation functions from cross section measurements of the (π + , π 0 ) and (π, π 0 ) inclusive reactions, the authors determined the dominant isospin structure of the analog IVGR's. The comparison was made after decomposing the cross section into resonant and non-resonant components. This decomposition is made in the framework of strong absorption and quasi-free scattering. Measurements in the region of the isovector giant dipole resonances (IVGDR) were made to cover the inclusive angular distributions out to the second minimum. Study of the giant resonance decay process provides further understanding of the resonances. This study was carried out by observing the (π + , π 0 p) coincident reactions involving the resonances of 9 B and 13 N excited from 9 Be and 13 C nuclei. These measurements determined the spectra of the decay protons. This method also permitted a decomposition of the giant resonances into their isospin components. The multipolarities of the resonances were revealed by the decay proton angular correlations which, for dipoles, are of the form 1 + A 2 P 2 (cos θ)

  6. Casein-Coated Fe5C2 Nanoparticles with Superior r2 Relaxivity for Liver-Specific Magnetic Resonance Imaging.

    Science.gov (United States)

    Cowger, Taku A; Tang, Wei; Zhen, Zipeng; Hu, Kai; Rink, David E; Todd, Trever J; Wang, Geoffrey D; Zhang, Weizhong; Chen, Hongmin; Xie, Jin

    2015-01-01

    Iron oxide nanoparticles have been extensively used as T2 contrast agents for liver-specific magnetic resonance imaging (MRI). The applications, however, have been limited by their mediocre magnetism and r2 relaxivity. Recent studies show that Fe5C2 nanoparticles can be prepared by high temperature thermal decomposition. The resulting nanoparticles possess strong and air stable magnetism, suggesting their potential as a novel type of T2 contrast agent. To this end, we improve the synthetic and surface modification methods of Fe5C2 nanoparticles, and investigated the impact of size and coating on their performances for liver MRI. Specifically, we prepared 5, 14, and 22 nm Fe5C2 nanoparticles and engineered their surface by: 1) ligand addition with phospholipids, 2) ligand exchange with zwitterion-dopamine-sulfonate (ZDS), and 3) protein adsorption with casein. It was found that the size and surface coating have varied levels of impact on the particles' hydrodynamic size, viability, uptake by macrophages, and r2 relaxivity. Interestingly, while phospholipid- and ZDS-coated Fe5C2 nanoparticles showed comparable r2, the casein coating led to an r2 enhancement by more than 2 fold. In particular, casein coated 22 nm Fe5C2 nanoparticle show a striking r2 of 973 mM(-1)s(-1), which is one of the highest among all of the T2 contrast agents reported to date. Small animal studies confirmed the advantage of Fe5C2 nanoparticles over iron oxide nanoparticles in inducing hypointensities on T2-weighted MR images, and the particles caused little toxicity to the host. The improvements are important for transforming Fe5C2 nanoparticles into a new class of MRI contrast agents. The observations also shed light on protein-based surface modification as a means to modulate contrast ability of magnetic nanoparticles.

  7. Nuclear molecules in the systems 12C+12C and 16O+16O

    International Nuclear Information System (INIS)

    Tiereth, W.

    1986-01-01

    For the two heavy ion systems 12 C+ 12 C and 16 O+ 16 O by means of scattering experiments studies on the phenomena of nuclear molecules were performed. For the 12 C+ 12 C system in the range of the Coulomb wall precision measurements of the elastic scattering were performed. In the two energy ranges of 5.5 ≤ E c.m. ≤ 6.65 MeV and 6.95 ≤ E c.m ≤ 7.375 MeV where the existence of many quasimolecular resonances is known in energy steps of ΔE c.m. = 25 keV angular distributions in the range 10 0 ≤ θ c.m. ≤ 90 0 with Δθ c.m. = 1 0 were measured. For several of the found quasimolecular resonances the spin and the carbon width could be uniquely determined. This was reached by a partial wave analysis of the obtained data. Supplemented were the measurements of the elastic scattering by measurements of the excitation function of the θ 0 exit channel of the reaction 12 ( 12 C, θ) 20 Ne in the energy range from 5.2 ≤ E c.m. ≤ 6.1 MeV. At some known resonances in the 16 O+ 16 O system in the energy range from 15.5 MeV to 18 MeV the spin and the elastic width of these structures could be determined. For this a constrained partial wave analysis on complete angular distributions of the elastic scattering (9 0 ≤ θ c.m. ≤ 90 0 ) which were measured in energy steps of ΔE c.m. = 50 keV was performed. In the 16 O+ 16 O system besides the proof for the existence of a nuclear glory scattering was given. (orig.) [de

  8. Sequence determination and resonance assignments of an Azomonas siderophore using 13C natural abundance 13C-1H HNCA experiment

    Czech Academy of Sciences Publication Activity Database

    Wasielewski, E.; Abdallah, M. A.; Kyslík, Pavel; Kieffer, B.

    2001-01-01

    Roč. 4, - (2001), s. 765-770 ISSN 1387-1609 Institutional research plan: CEZ:AV0Z5020903 Keywords : determination * resonance * assignments Subject RIV: EE - Microbiology, Virology Impact factor: 0.555, year: 2001

  9. Nuclear quadrupole resonance applied for arsenic oxide study

    International Nuclear Information System (INIS)

    Correia, J.A.S.

    1991-04-01

    The objectives of this study are mounting a pulsed Nuclear Quadrupole Resonance (NQR) building a flow cryostat capable of varying the temperature continuously from 77 K to 340 K and using the spectrometer and the cryostat to study the polycrystalline arsenic oxide. The spin-lattice relaxation time (T 1 ), the spin-spin relaxation time (T 2 ) and the resonance frequency are obtained as a function of temperature. These data are obtained in 77 to 330 K interval. The relaxation times are obtained using the spin echo technique. The spin echo phenomenon is due to refocusing spins, when a 180 0 C pulse is applied after a 90 0 C pulse. The spin-lattice relaxation time is obtained using the plot of echo amplitude versus the repetition time. The spin-spin relaxation time is obtained using the plot of echo amplitude versus the separation between the 90 0 C - 180 0 C pulses. The theory developed by Bayer is used to explain the spin-lattice relaxation time and the frequency temperature dependence. The spin-spin relaxation time is discussed using the Bloch equations. (author)

  10. Resonant Auger studies of metallic systems

    International Nuclear Information System (INIS)

    Coulthard, I.; Antel, W. J. Jr.; Frigo, S. P.; Freeland, J. W.; Moore, J.; Calaway, W. S.; Pellin, M. J.; Mendelsohn, M.; Sham, T. K.; Naftel, S. J.

    2000-01-01

    Results of resonant Auger spectroscopy experimental are presented for Cu, Co, and oxidized Al. Sublifetime narrowing of Auger spectra and generation of sublifetime narrowed absorption spectra constructed from Auger yield measurements were observed. Resonant Auger yields are used to identify three chemical states of oxidized Al. Partial absorption yield spectra were derived giving detailed electronic information and thickness information for the various chemical states of the bulk metal, the passivating aluminum oxide layer, and the metal-oxide interface region. In addition, the total absorption yield spectrum for the oxidized Al sample was constructed from the partial yield data, supporting the consistency of our method. (c) 2000 American Vacuum Society

  11. Electron cyclotron resonance multiply charged ion sources

    International Nuclear Information System (INIS)

    Geller, R.

    1975-01-01

    Three ion sources, that deliver multiply charged ion beams are described. All of them are E.C.R. ion sources and are characterized by the fact that the electrons are emitted by the plasma itself and are accelerated to the adequate energy through electron cyclotron resonance (E.C.R.). They can work without interruption during several months in a quasi-continuous regime. (Duty cycle: [fr

  12. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Logo of the Indian Academy of Sciences. Indian Academy of Sciences ... Home; Journals; Resonance – Journal of Science Education; Volume 1; Issue 1. Factoring Fermat Numbers. C E Veni ... C E Veni Madhavan1. Department of Computer Science and Automation, Indian Institute of Science, Bangalore 560 012.

  13. Electroproduction of the Delta(1232) Resonance at High Momentum Transfer

    International Nuclear Information System (INIS)

    Valera Frolov; Gary Adams; Abdellah Ahmidouch; Christopher Armstrong; Ketevi Assamagan; Steven Avery; Baker, O.; Peter Bosted; Volker Burkert; Roger Carlini; Davidson, R.M.; James Dunne; Eden, T.; Rolf Ent; David Gaskell; Paul Gueye; Wendy Hinton; Cynthia Keppel; Wooyoung Kim; Mike Klusman; Douglas Koltenuk; David Mack; Richard Madey; David Meekins; Ralph Minehart; Joseph Mitchell; Hamlet Mkrtchyan; Mukhopadhyay, N.C.A.; James Napolitano; Gabriel Niculescu; Maria-Ioana Niculescu; Mina Nozar; John Price; Paul Stoler; Vardan Tadevosyan; Liguang Tang; Michael Witkowski; Stephen Wood

    1999-01-01

    Jefferson Lab experiment E94-014 measured the excitation of the Delta (1232) resonance via the reaction p(e,e(prime)p)π 0 at Q 2 near 2.8 and 4 Gev 2 . This is the highest Q 2 for which exclusive resonance electroproduction has ever been observed. Decay distributions of the Delta (1232) resonance into the ppi 0 final state were measured over a wide range of barycentric decay angles and energies. The goal of this experiment is to assess the transition in Q 2 from the constituent quark model (CQM) to the regime where hard processes become important. At Q 2 ∼ few GeV 2 /c 2 the ratio E 1+ /M 1+ depends dramatically on the theoretical description, varying from a few 10 -2 in the CQM limit, to about 1 in the pQCD limit. Preliminary analysis of the data shows that the ratio E 1+ /M 1+ remains small at Q 2 up to 4 Gev 2 /c 2 . After first pass analysis we obtain E 1+ /M 1+ = -4.1 ± 1.2 at Q 2 = 2.8 Gev 2 /c 2 and E 1+ /M 1+ = -7.9 ± 0.8 at Q 2 = 4 Gev 2 /c 2 (statistical errors only)

  14. Isotopic Resonance Hypothesis: Experimental Verification by Escherichia coli Growth Measurements

    Science.gov (United States)

    Xie, Xueshu; Zubarev, Roman A.

    2015-03-01

    Isotopic composition of reactants affects the rates of chemical and biochemical reactions. As a rule, enrichment of heavy stable isotopes leads to progressively slower reactions. But the recent isotopic resonance hypothesis suggests that the dependence of the reaction rate upon the enrichment degree is not monotonous. Instead, at some ``resonance'' isotopic compositions, the kinetics increases, while at ``off-resonance'' compositions the same reactions progress slower. To test the predictions of this hypothesis for the elements C, H, N and O, we designed a precise (standard error +/-0.05%) experiment that measures the parameters of bacterial growth in minimal media with varying isotopic composition. A number of predicted resonance conditions were tested, with significant enhancements in kinetics discovered at these conditions. The combined statistics extremely strongly supports the validity of the isotopic resonance phenomenon (p biotechnology, medicine, chemistry and other areas.

  15. High Field In Vivo 13C Magnetic Resonance Spectroscopy of Brain by Random Radiofrequency Heteronuclear Decoupling and Data Sampling

    Science.gov (United States)

    Li, Ningzhi; Li, Shizhe; Shen, Jun

    2017-06-01

    In vivo 13C magnetic resonance spectroscopy (MRS) is a unique and effective tool for studying dynamic human brain metabolism and the cycling of neurotransmitters. One of the major technical challenges for in vivo 13C-MRS is the high radio frequency (RF) power necessary for heteronuclear decoupling. In the common practice of in vivo 13C-MRS, alkanyl carbons are detected in the spectra range of 10-65ppm. The amplitude of decoupling pulses has to be significantly greater than the large one-bond 1H-13C scalar coupling (1JCH=125-145 Hz). Two main proton decoupling methods have been developed: broadband stochastic decoupling and coherent composite or adiabatic pulse decoupling (e.g., WALTZ); the latter is widely used because of its efficiency and superb performance under inhomogeneous B1 field. Because the RF power required for proton decoupling increases quadratically with field strength, in vivo 13C-MRS using coherent decoupling is often limited to low magnetic fields (protons via weak long-range 1H-13C scalar couplings, which can be decoupled using low RF power broadband stochastic decoupling. Recently, the carboxylic/amide 13C-MRS technique using low power random RF heteronuclear decoupling was safely applied to human brain studies at 7T. Here, we review the two major decoupling methods and the carboxylic/amide 13C-MRS with low power decoupling strategy. Further decreases in RF power deposition by frequency-domain windowing and time-domain random under-sampling are also discussed. Low RF power decoupling opens the possibility of performing in vivo 13C experiments of human brain at very high magnetic fields (such as 11.7T), where signal-to-noise ratio as well as spatial and temporal spectral resolution are more favorable than lower fields.

  16. A new strategy for backbone resonance assignment in large proteins using a MQ-HACACO experiment

    International Nuclear Information System (INIS)

    Pervushin, Konstantin; Eletsky, Alexander

    2003-01-01

    A new strategy of backbone resonance assignment is proposed based on a combination of the most sensitive TROSY-type triple resonance experiments such as TROSY-HNCA and TROSY-HNCO with a new 3D multiple-quantum HACACO experiment. The favourable relaxation properties of the multiple-quantum coherences and signal detection using the 13 C' antiphase coherences optimize the performance of the proposed experiment for application to larger proteins. In addition to the 1 H N , 15 N, 13 C α and 13 C' chemical shifts the 3D multiple-quantum HACACO experiment provides assignment for the 1 H α resonances in contrast to previously proposed experiments for large proteins. The strategy is demonstrated with the 44 kDa uniformly 15 N, 13 C-labeled and fractionally 35% deuterated trimeric B. subtilis Chorismate Mutase measured at 20 deg. C and 9 deg. C. Measurements at the lower temperature indicate that the new strategy can be applied to even larger proteins with molecular weights up to 80 kDa

  17. Possible resonance effect of axionic dark matter in Josephson junctions.

    Science.gov (United States)

    Beck, Christian

    2013-12-06

    We provide theoretical arguments that dark-matter axions from the galactic halo that pass through Earth may generate a small observable signal in resonant S/N/S Josephson junctions. The corresponding interaction process is based on the uniqueness of the gauge-invariant axion Josephson phase angle modulo 2π and is predicted to produce a small Shapiro steplike feature without externally applied microwave radiation when the Josephson frequency resonates with the axion mass. A resonance signal of so far unknown origin observed by C. Hoffmann et al. [Phys. Rev. B 70, 180503(R) (2004)] is consistent with our theory and can be interpreted in terms of an axion mass m(a)c2=0.11  meV and a local galactic axionic dark-matter density of 0.05  GeV/cm3. We discuss future experimental checks to confirm the dark-matter nature of the observed signal.

  18. Resonant spin-flavor precession constraints on the neutrino ...

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics; Volume 61; Issue 1. Resonant spin-flavor precession constraints on the neutrino parameters and the twisting structure of the solar magnetic fields from the solar neutrino data. S Dev Jyoti Dhar Sharma U C Pandey S P Sud B C Chauhan. Research Articles Volume 61 Issue 1 ...

  19. Metabolic regulation in Streptomyces parvulus during actinomycin D synthesis, studied with 13C- and 15N-labeled precursors by 13C and 15N nuclear magnetic resonance spectroscopy and by gas chromatography-mass spectrometry

    International Nuclear Information System (INIS)

    Inbar, L.; Lapidot, A.

    1988-01-01

    Recent studies have suggested that the onset of synthesis of actinomycin D in Streptomyces is due to a release from L-glutamate catabolic repression. In the present investigation we showed that S. parvulus has the capacity to maintain high levels of intracellular glutamate during the synthesis of actinomycin D. The results seem contradictory, since actinomycin D synthesis cannot start before a release from L-glutamate catabolic repression, but a relatively high intracellular pool of glutamate is needed for the synthesis of actinomycin D. Utilizing different labeled precursors, D-[U- 13 C]fructose and 13 C- and 15 N-labeled L-glutamate, and nuclear magnetic resonance techniques, we showed that carbon atoms of an intracellular glutamate pool of S. parvulus were not derived biosynthetically from the culture medium glutamte source but rather from D-fructose catabolism. A new intracellular pyrimidine derivative whose nitrogen and carbon skeletons were derived from exogenous L-glutamate was obtained as the main glutamate metabolite. Another new pyrimidine derivative that had a significantly reduced intracellular mobility and that was derived from D-fructose catabolism was identified in the cell extracts of S. parvulus during actinomycin D synthesis. These pyrimidine derivatives may serve as a nitrogen store for actinomycin D synthesis. In the present study, the N-trimethyl group of a choline derivative was observed by 13 C nuclear magnetic resonance spectroscopy in growing S. parvulus cells. The choline group, as well as the N-methyl groups of sarcosine, N-methyl-valine, and the methyl groups of an actinomycin D chromophore, arose from D-fructose catabolism. The 13 C enrichments found in the peptide moieties of actinomycin D were in accordance with a mechanism of actinomycin D synthesis from L-glutamate and D-fructose

  20. How Energy Metabolism Supports Cerebral Function: Insights from 13C Magnetic Resonance Studies In vivo

    Directory of Open Access Journals (Sweden)

    Sarah Sonnay

    2017-05-01

    Full Text Available Cerebral function is associated with exceptionally high metabolic activity, and requires continuous supply of oxygen and nutrients from the blood stream. Since the mid-twentieth century the idea that brain energy metabolism is coupled to neuronal activity has emerged, and a number of studies supported this hypothesis. Moreover, brain energy metabolism was demonstrated to be compartmentalized in neurons and astrocytes, and astrocytic glycolysis was proposed to serve the energetic demands of glutamatergic activity. Shedding light on the role of astrocytes in brain metabolism, the earlier picture of astrocytes being restricted to a scaffold-associated function in the brain is now out of date. With the development and optimization of non-invasive techniques, such as nuclear magnetic resonance spectroscopy (MRS, several groups have worked on assessing cerebral metabolism in vivo. In this context, 1H MRS has allowed the measurements of energy metabolism-related compounds, whose concentrations can vary under different brain activation states. 1H-[13C] MRS, i.e., indirect detection of signals from 13C-coupled 1H, together with infusion of 13C-enriched glucose has provided insights into the coupling between neurotransmission and glucose oxidation. Although these techniques tackle the coupling between neuronal activity and metabolism, they lack chemical specificity and fail in providing information on neuronal and glial metabolic pathways underlying those processes. Currently, the improvement of detection modalities (i.e., direct detection of 13C isotopomers, the progress in building adequate mathematical models along with the increase in magnetic field strength now available render possible detailed compartmentalized metabolic flux characterization. In particular, direct 13C MRS offers more detailed dataset acquisitions and provides information on metabolic interactions between neurons and astrocytes, and their role in supporting neurotransmission. Here

  1. Cyclotron resonance for electrons over helium in resonator

    CERN Document Server

    Shikin, V B

    2002-01-01

    The problem on the cyclotron resonance (CR) for electrons on the helium film, positioned in the resonator lower part, is solved. It is shown, that it relates to one of the examples of the known problem on the oscillations of the coupled oscillators system. The coupling constant between these oscillators constituting the variable function of the problem parameters. It is minimal in the zero magnetic field and reaches its maximum under the resonance conditions, when the cyclotron frequency coincides with one of the resonator modes. The CR details of the Uhf CR-energy absorption coupled by the electrons + resonator system, are calculated. The applications of the obtained results to the available CR experiments for electrons over helium

  2. Induced Proton Polarization for pi0 Electroproduction at Q2 = 0.126 GeV2/c2 Around the Delta(1232) Resonance

    International Nuclear Information System (INIS)

    Glen Warren; Ricardo Alarcon; Christopher Armstrong; Burin Asavapibhop; David Barkhuff; William Bertozzi; Volker Burkert; Chen, J.; Jian-Ping Chen; Joseph Comfort; Daniel Dale; George Dodson; Dolfini, S.; Dow, K.; Martin Epstein; Manouchehr Farkhondeh; John Finn; Shalev Gilad; Ralf Gothe; Xiaodong Jiang; Mark Jones; Kyungseon Joo; Karabarbounis, A.; James Kelly; Stanley Kowalski; Kunz, C.; Liu, D.; Lourie, R.W.; Richard Madey; Demetrius Margaziotis; Pete Markowitz; Justin McIntyre; Mertz, C.; Brian Milbrath; Rory Miskimen; Joseph Mitchell; Mukhopadhyay, S.; Costas Papanicolas; Charles Perdrisat; Vina Punjabi; Liming Qin; Paul Rutt; Adam Sarty; Jeffrey Shaw; Soong, S.B.; Tieger, D.; Christoph Tschalaer; William Turchinetz; Paul Ulmer; Scott Van Verst; Vellidis, C.; Lawrence Weinstein; Steven Williamson; Rhett Woo; Alaen Young

    1998-01-01

    We present a measurement of the induced proton polarization P n in π 0 electroproduction on the proton around the Δ resonance. The measurement was made at a central invariant mass and a squared four-momentum transfer of W = 1231 MeV and Q 2 = 0.126 GeV 2 /c 2 , respectively. We measured a large induced polarization, P n = -0.397 ± 0.055 ± 0.009. The data suggest that the scalar background is larger than expected from a recent effective Hamiltonian model

  3. Temperature dependent behavior of localized and delocalized electrons in nitrogen-doped 6H SiC crystals as studied by electron spin resonance

    Czech Academy of Sciences Publication Activity Database

    Savchenko, Dariia; Kalabukhova, E.; Shanina, B.; Cichoň, Stanislav; Honolka, Jan; Kiselov, V.; Mokhov, E.

    2016-01-01

    Roč. 119, č. 4 (2016), 1-7, č. článku 045701. ISSN 0021-8979 R&D Projects: GA ČR GP13-06697P; GA MŠk LO1409; GA MŠk(CZ) LM2011029 Grant - others:SAFMAT(XE) CZ.2.16/3.1.00/22132; AV ČR(CZ) Fellowship J. E. Purkyně Institutional support: RVO:68378271 Keywords : electron spin resonance * SiC * nitrogen donors * conduction electrons Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.068, year: 2016

  4. Microstrip resonators for electron paramagnetic resonance experiments

    Science.gov (United States)

    Torrezan, A. C.; Mayer Alegre, T. P.; Medeiros-Ribeiro, G.

    2009-07-01

    In this article we evaluate the performance of an electron paramagnetic resonance (EPR) setup using a microstrip resonator (MR). The design and characterization of the resonator are described and parameters of importance to EPR and spin manipulation are examined, including cavity quality factor, filling factor, and microwave magnetic field in the sample region. Simulated microwave electric and magnetic field distributions in the resonator are also presented and compared with qualitative measurements of the field distribution obtained by a perturbation technique. Based on EPR experiments carried out with a standard marker at room temperature and a MR resonating at 8.17 GHz, the minimum detectable number of spins was found to be 5×1010 spins/GHz1/2 despite the low MR unloaded quality factor Q0=60. The functionality of the EPR setup was further evaluated at low temperature, where the spin resonance of Cr dopants present in a GaAs wafer was detected at 2.3 K. The design and characterization of a more versatile MR targeting an improved EPR sensitivity and featuring an integrated biasing circuit for the study of samples that require an electrical contact are also discussed.

  5. Microstrip resonators for electron paramagnetic resonance experiments.

    Science.gov (United States)

    Torrezan, A C; Mayer Alegre, T P; Medeiros-Ribeiro, G

    2009-07-01

    In this article we evaluate the performance of an electron paramagnetic resonance (EPR) setup using a microstrip resonator (MR). The design and characterization of the resonator are described and parameters of importance to EPR and spin manipulation are examined, including cavity quality factor, filling factor, and microwave magnetic field in the sample region. Simulated microwave electric and magnetic field distributions in the resonator are also presented and compared with qualitative measurements of the field distribution obtained by a perturbation technique. Based on EPR experiments carried out with a standard marker at room temperature and a MR resonating at 8.17 GHz, the minimum detectable number of spins was found to be 5 x 10(10) spins/GHz(1/2) despite the low MR unloaded quality factor Q0=60. The functionality of the EPR setup was further evaluated at low temperature, where the spin resonance of Cr dopants present in a GaAs wafer was detected at 2.3 K. The design and characterization of a more versatile MR targeting an improved EPR sensitivity and featuring an integrated biasing circuit for the study of samples that require an electrical contact are also discussed.

  6. New determinations of gamma-ray line intensities of the E{sub p}=550 and 1747 keV resonances of the {sup 13}C(p,{gamma}){sup 14}N reaction

    Energy Technology Data Exchange (ETDEWEB)

    Kiener, J. E-mail: kiener@csnsm.in2p3.fr; Gros, M.; Tatischeff, V.; Attie, D.; Bailly, I.; Bauchet, A.; Chapuis, C.; Cordier, B.; Deloncle, I.; Porquet, M.G.; Schanne, S.; Sereville, N. de; Tauzin, G

    2004-03-01

    Gamma-ray angular distributions for the resonances at E{sub p}=550 and 1747 keV of the radiative capture reaction {sup 13}C(p,{gamma}){sup 14}N have been measured, using intense proton beams on isotopically pure {sup 13}C targets. Experimental gamma-ray spectra were obtained with three HP-Germanium detectors at four angles for E{sub p}=550 keV and six angles for E{sub p}=1747 keV in the range of 0-90 deg. with respect to the proton beam. From the data, relative intensities for the strongest transitions were extracted with an accuracy of typically 5%, making these resonances new useful gamma-ray standards for efficiency calibration in the energy range from E{sub {gamma}}=1.6-9 MeV. Gamma-ray branching ratios were obtained for several levels of {sup 14}N and are compared with literature values.

  7. Dielectrically-Loaded Cylindrical Resonator-Based Wireless Passive High-Temperature Sensor

    Directory of Open Access Journals (Sweden)

    Jijun Xiong

    2016-12-01

    Full Text Available The temperature sensor presented in this paper is based on a microwave dielectric resonator, which uses alumina ceramic as a substrate to survive in harsh environments. The resonant frequency of the resonator is determined by the relative permittivity of the alumina ceramic, which monotonically changes with temperature. A rectangular aperture etched on the surface of the resonator works as both an incentive and a coupling device. A broadband slot antenna fed by a coplanar waveguide is utilized as an interrogation antenna to wirelessly detect the sensor signal using a radio-frequency backscattering technique. Theoretical analysis, software simulation, and experiments verified the feasibility of this temperature-sensing system. The sensor was tested in a metal-enclosed environment, which severely interferes with the extraction of the sensor signal. Therefore, frequency-domain compensation was introduced to filter the background noise and improve the signal-to-noise ratio of the sensor signal. The extracted peak frequency was found to monotonically shift from 2.441 to 2.291 GHz when the temperature was varied from 27 to 800 °C, leading to an average absolute sensitivity of 0.19 MHz/°C.

  8. Measurement of the 13C(α,n)16O reaction at astrophysical energies using the Trojan Horse Method. Focus on the -3 keV subthreshold resonance

    International Nuclear Information System (INIS)

    La Cognata, M.; Spitaleri, C.; Guardo, G.L.; Puglia, S.M.R.; Romano, S.; Sparta, R.; Trippella, O.; Kiss, G.G.; Rogachev, G.V.; Avila, M.; Koshchiy, E.; Kuchera, A.; Santiago, D.; Mukhamedzhanov, A.M.; Lamia, L.

    2014-01-01

    Most of the nuclei in the mass range 90 ≤ A ≤ 208 are produced through the so-called s-process, namely through a series of neutron capture reactions on seed nuclei followed by β-decays. The 13 C(α,n) 16 O reaction is the neutron source for the main component of the s-process. It is active inside the helium-burning shell of asymptotic giant branch stars, at temperatures ≤ 10 8 K, corresponding to an energy interval of 140 - 230 keV. In this region, the astrophysical S (E)-factor is dominated by the -3 keV sub-threshold resonance due to the 6.356 MeV level in 17 O. Direct measurements could not soundly establish its contribution owing to the cross section suppression at astrophysical energies determined by the Coulomb barrier between interacting nuclei. Indirect measurements and extrapolations yielded inconsistent results, calling for further investigations. The Trojan Horse Method turns out to be very suited for the study of the 13 C(α,n) 16 O reaction as it allows us to access the low as well as the negative energy region, in particular in the case of resonance reactions. We have applied the Trojan Horse Method to the 13 C( 6 Li; n 16 O)d quasi-free reaction. By using the modified R-matrix approach, the asymptotic normalization coefficient (C(O(1/2+),α 13 C)] 2 of the 6.356 MeV level has been deduced as well as the n-partial width, allowing to attain an unprecedented accuracy for the 13 C(α,n) 16 O astrophysical factor. A preliminary analysis of a partial data set has lead to (C(O(1/2+),α 13 C)] 2 = (6.7-0.6+0.9) fm -1 , slightly larger than the values in the literature, determining a 13 C(α,n) 16 O reaction rate in agreement with the most results in the literature at ∼ 10 8 K, with enhanced accuracy thanks to this innovative approach. (authors)

  9. Multiphoton resonances

    International Nuclear Information System (INIS)

    Shore, B.W.

    1977-01-01

    The long-time average of level populations in a coherently-excited anharmonic sequence of energy levels (e.g., an anharmonic oscillator) exhibits sharp resonances as a function of laser frequency. For simple linearly-increasing anharmonicity, each resonance is a superposition of various multiphoton resonances (e.g., a superposition of 3, 5, 7, . . . photon resonances), each having its own characteristic width predictable from perturbation theory

  10. X(3872), IG(JPC) = 0+(1++), as the χc1(2P) charmonium

    Science.gov (United States)

    Achasov, N. N.; Rogozina, E. V.

    2015-09-01

    Contrary to almost standard opinion that the X(3872) resonance is the D∗0D¯0 + c.c. molecule or the qcq¯c¯ four-quark state, we discuss the scenario where the X(3872) resonance is the cc¯ = χc1(2P) charmonium which “sits on” the D∗0D¯0 threshold. We explain the shift of the mass of the X(3872) resonance with respect to the prediction of a potential model for the mass of the χc1(2P) charmonium by the contribution of the virtual D∗D¯ + c.c. intermediate states into the self energy of the X(3872) resonance. This allows us to estimate the coupling constant of the X(7872) resonance with the D∗0D¯0 channel, the branching ratio of the X(3872) → D∗0D¯0 + c.c. decay, and the branching ratio of the X(3872) decay into all non-D∗0D¯0 + c.c. states. We predict a significant number of unknown decays of X(3872) via two gluon: X(3872) →gluon gluon →hadrons. We suggest a physically clear program of experimental researches for verification of our assumption.

  11. Proceedings of the nuclear magnetic resonance user meeting

    International Nuclear Information System (INIS)

    1987-01-01

    Studies on utilization of nuclear magnetic resonance, such as: chemical analysis in complexes and organic compounds; structures and magnetic properties of solids; construction of images and; spectrometer designs, are presented. (M.C.K.) [pt

  12. A complex guided spectral transform Lanczos method for studying quantum resonance states

    International Nuclear Information System (INIS)

    Yu, Hua-Gen

    2014-01-01

    A complex guided spectral transform Lanczos (cGSTL) algorithm is proposed to compute both bound and resonance states including energies, widths and wavefunctions. The algorithm comprises of two layers of complex-symmetric Lanczos iterations. A short inner layer iteration produces a set of complex formally orthogonal Lanczos (cFOL) polynomials. They are used to span the guided spectral transform function determined by a retarded Green operator. An outer layer iteration is then carried out with the transform function to compute the eigen-pairs of the system. The guided spectral transform function is designed to have the same wavefunctions as the eigenstates of the original Hamiltonian in the spectral range of interest. Therefore the energies and/or widths of bound or resonance states can be easily computed with their wavefunctions or by using a root-searching method from the guided spectral transform surface. The new cGSTL algorithm is applied to bound and resonance states of HO, and compared to previous calculations

  13. Unexpected enhancements and reductions of rf spin resonance strengths

    Directory of Open Access Journals (Sweden)

    M. A. Leonova

    2006-05-01

    Full Text Available We recently analyzed all available data on spin-flipping stored beams of polarized protons, electrons, and deuterons. Fitting the modified Froissart-Stora equation to the measured polarization data after crossing an rf-induced spin resonance, we found 10–20-fold deviations from the depolarizing resonance strength equations used for many years. The polarization was typically manipulated by linearly sweeping the frequency of an rf dipole or rf solenoid through an rf-induced spin resonance; spin-flip efficiencies of up to 99.9% were obtained. The Lorentz invariance of an rf dipole’s transverse ∫Bdl and the weak energy dependence of its spin resonance strength E together imply that even a small rf dipole should allow efficient spin flipping in 100 GeV or even TeV storage rings; thus, it is important to understand these large deviations. Therefore, we recently studied the resonance strength deviations experimentally by varying the size and vertical betatron tune of a 2.1  GeV/c polarized proton beam stored in COSY. We found no dependence of E on beam size, but we did find almost 100-fold enhancements when the rf spin resonance was near an intrinsic spin resonance.

  14. New results on exotic baryon resonances at LHCb

    CERN Document Server

    Zhang, Liming

    2016-01-01

    Observation of exotic resonant structures decaying into $J/\\psi p$ found in the LHCb experiment is discussed. Examination of the $J/\\psi p$ system in $\\Lambda^{0}_{b} \\to J/\\psi K^{-} p$ decays shows two states, each of which must be composed of at least $c \\bar{c} uud$ quarks, and are thus consistent with pentaquarks. The significance of each of these resonances is more than 9 standard deviations. Their masses are ($4 380 \\pm 8 \\pm 29$) MeV and ($4 449.8 \\pm 1.7 \\pm 2.5$) MeV, and their corresponding widths are ($205 \\pm 18 \\pm 86$) MeV, and ($39 \\pm 5 \\pm 19$) MeV. The preferred $J^{P}$ assignments are of opposite parity, with one state having spin 3/2 and the other 5/2.

  15. Reaction theory for analysis of nuclear giant resonances production and decay processes

    International Nuclear Information System (INIS)

    Foglia, G.A.

    1991-01-01

    The existence of mixing parameters connected to the different decay forms of the giant resonances was theoretically justified, and their energy dependence determined as well using a reaction theory which treats in a consistent manner the giant multipolar resonances formation and their different decay modes. (L.C.J.A.)

  16. Magnetic resonance annual 1986

    International Nuclear Information System (INIS)

    Kressel, H.Y.

    1986-01-01

    This book contains papers written on magnetic resonance during 1986. Topics include: musculosketetal magnetic resonance imaging; imaging of the spine; magnetic resonance chemical shift imaging; magnetic resonance imaging in the central nervous system; comparison to computed tomography; high resolution magnetic resonance imaging using surface coils; magnetic resonance imaging of the chest; magnetic resonance imaging of the breast; magnetic resonance imaging of the liver; magnetic resonance spectroscopy of neoplasms; blood flow effects in magnetic resonance imaging; and current and potential applications of clinical sodium magnetic resonance imaging

  17. Chiral NNLOsat descriptions of nuclear multipole resonances within the random-phase approximation

    Science.gov (United States)

    Wu, Q.; Hu, B. S.; Xu, F. R.; Ma, Y. Z.; Dai, S. J.; Sun, Z. H.; Jansen, G. R.

    2018-05-01

    We study nuclear multipole resonances in the framework of the random-phase approximation by using the chiral potential NNLOsat. This potential includes two- and three-body terms that have been simultaneously optimized to low-energy nucleon-nucleon scattering data and selected nuclear structure data. Our main focuses have been the isoscalar monopole, isovector dipole, and isoscalar quadrupole resonances of the closed-shell nuclei, 4He, O 16 ,22 ,24 , and Ca,4840. These resonance modes have been widely observed in experiment. In addition, we use a renormalized chiral potential Vlow-k, based on the N3LO two-body potential by Entem and Machleidt [Phys. Rev. C 68, 041001 (2011), 10.1103/PhysRevC.68.041001]. This introduces a dependency on the cutoff parameter used in the normalization procedure as reported in previous works by other groups. While NNLOsat can reasonably reproduce observed multipole resonances, it is not possible to find a single cutoff parameter for the Vlow-k potential that simultaneously describes the different types of resonance modes. The sensitivity to the cutoff parameter can be explained by missing induced three-body forces in the calculations. Our results for neutron-rich O,2422 show a mixing nature of isoscalar and isovector resonances in the dipole channel at low energies. We predict that 22O and 24O have low-energy isoscalar quadrupole resonances at energies lower than 5 MeV.

  18. NMR structure analysis of uniformly 13C-labeled carbohydrates.

    Science.gov (United States)

    Fontana, Carolina; Kovacs, Helena; Widmalm, Göran

    2014-06-01

    In this study, a set of nuclear magnetic resonance experiments, some of them commonly used in the study of (13)C-labeled proteins and/or nucleic acids, is applied for the structure determination of uniformly (13)C-enriched carbohydrates. Two model substances were employed: one compound of low molecular weight [(UL-(13)C)-sucrose, 342 Da] and one compound of medium molecular weight ((13)C-enriched O-antigenic polysaccharide isolated from Escherichia coli O142, ~10 kDa). The first step in this approach involves the assignment of the carbon resonances in each monosaccharide spin system using the anomeric carbon signal as the starting point. The (13)C resonances are traced using (13)C-(13)C correlations from homonuclear experiments, such as (H)CC-CT-COSY, (H)CC-NOESY, CC-CT-TOCSY and/or virtually decoupled (H)CC-TOCSY. Based on the assignment of the (13)C resonances, the (1)H chemical shifts are derived in a straightforward manner using one-bond (1)H-(13)C correlations from heteronuclear experiments (HC-CT-HSQC). In order to avoid the (1) J CC splitting of the (13)C resonances and to improve the resolution, either constant-time (CT) in the indirect dimension or virtual decoupling in the direct dimension were used. The monosaccharide sequence and linkage positions in oligosaccharides were determined using either (13)C or (1)H detected experiments, namely CC-CT-COSY, band-selective (H)CC-TOCSY, HC-CT-HSQC-NOESY or long-range HC-CT-HSQC. However, due to the short T2 relaxation time associated with larger polysaccharides, the sequential information in the O-antigen polysaccharide from E. coli O142 could only be elucidated using the (1)H-detected experiments. Exchanging protons of hydroxyl groups and N-acetyl amides in the (13)C-enriched polysaccharide were assigned by using HC-H2BC spectra. The assignment of the N-acetyl groups with (15)N at natural abundance was completed by using HN-SOFAST-HMQC, HNCA, HNCO and (13)C-detected (H)CACO spectra.

  19. Detection of tannins in modern and fossil barks and in plant residues by high-resolution solid-state /sup 13/C nuclear magnetic resonance

    Energy Technology Data Exchange (ETDEWEB)

    Wilson, M A; Hatcher, P G

    1988-01-01

    Bark samples isolated from brown coal deposits in Victoria, Australia, and buried wood from Rhizophora mangle have been studied by high-resolution solid-state nuclear magnetic resonance (NMR) techniques. Dipolar dephasing /sup 13/C NMR appears to be a useful method of detecting the presence of tannins in geochemical samples including barks, buried woods, peats and leaf litter. It is shown that tannins are selectively preserved in bark during coalification to the brown coal stage. 28 refs., 9 figs., 1 tab.

  20. On local and global aspects of the 1:4 resonance in the conservative cubic Hénon maps

    Science.gov (United States)

    Gonchenko, M.; Gonchenko, S. V.; Ovsyannikov, I.; Vieiro, A.

    2018-04-01

    We study the 1:4 resonance for the conservative cubic Hénon maps C± with positive and negative cubic terms. These maps show up different bifurcation structures both for fixed points with eigenvalues ±i and for 4-periodic orbits. While for C-, the 1:4 resonance unfolding has the so-called Arnold degeneracy [the first Birkhoff twist coefficient equals (in absolute value) to the first resonant term coefficient], the map C+ has a different type of degeneracy because the resonant term can vanish. In the last case, non-symmetric points are created and destroyed at pitchfork bifurcations and, as a result of global bifurcations, the 1:4 resonant chain of islands rotates by π/4. For both maps, several bifurcations are detected and illustrated.

  1. Wireless overhead line temperature sensor based on RF cavity resonance

    International Nuclear Information System (INIS)

    Ghafourian, Maryam; Nezhad, Abolghasem Zeidaabadi; Bridges, Greg E; Thomson, Douglas J

    2013-01-01

    The importance of maximizing power transfer through overhead transmission lines necessitates the use of dynamic power control to keep transmission line temperatures within acceptable limits. Excessive conductor operating temperatures lead to an increased sag of the transmission line conductor and may reduce their expected life. In this paper, a passive wireless sensor based on a resonant radio frequency (RF) cavity is presented which can be used to measure overhead transmission line temperature. The temperature sensor does not require a power supply and can be easily clamped to the power line with an antenna attached. Changing temperature causes a change of cavity dimensions and a shift in resonant frequency. The resonant frequency of the cavity can be interrogated wirelessly. This temperature sensor has a resolution of 0.07 °C and can be interrogated from distances greater than 4.5 m. The sensor has a deviation from linearity of less than 2 °C. (paper)

  2. Search for Resonances in the Photoproduction of Proton-Antiproton Pairs

    Energy Technology Data Exchange (ETDEWEB)

    Stokes, Burnham [Florida State Univ., Tallahassee, FL (United States)

    2006-01-01

    Results are reported on the reaction γp → p$\\bar{p}$p with beam energy in the range 4.8-5.5 GeV. The data were collected at the Thomas Jefferson National Accelerator Facility in CLAS experiment E01-017(G6C). The focus of this study is an understanding of the mechanisms of photoproduction of proton-antiproton pairs, and to search for intermediate resonances, both narrow and broad, which decay to p$\\bar{p}$. The total measured cross section in the photon energy range 4.8-5.5 GeV is σ = 33 ± 2 nb. Measurement of the cross section as a function of energy is provided. An upper limit on the production of a narrow resonance state previously observed with a mass of 2.02 GeV/c2 is placed at 0.35 nb. No intermediate resonance states were observed. Meson exchange production appears to dominate the production of the proton-antiproton pairs.

  3. K C Patil

    Indian Academy of Sciences (India)

    K C Patil. Articles written in Resonance – Journal of Science Education. Volume 9 Issue 7 July 2004 pp 92-92 Book Review. Inorganic Chemistry · K C Patil · More Details Fulltext PDF. Volume 20 Issue 5 May 2015 pp 431-444 General Article. High Energy Materials: A Brief History and Chemistry of Fireworks and Rocketry.

  4. 996 RESONANCE November 2013

    Indian Academy of Sciences (India)

    IAS Admin

    996. RESONANCE. November 2013. Page 2. 997. RESONANCE. November 2013. Page 3. 998. RESONANCE. November 2013. Page 4. 999. RESONANCE. November 2013. Page 5. 1000. RESONANCE. November 2013. Page 6. 1001. RESONANCE. November 2013. Page 7. 1002. RESONANCE. November 2013 ...

  5. Dipole resonances in light neutron-rich nuclei studied with time-dependent calculations of antisymmetrized molecular dynamics

    International Nuclear Information System (INIS)

    Kanada-En'yo, Y.; Kimura, M.

    2005-01-01

    To study isovector dipole responses of neutron-rich nuclei, we applied a time-dependent method of antisymmetrized molecular dynamics. The dipole resonances in Be, B, and C isotopes were investigated. In 10 Be, 15 B, and 16 C, collective modes of the vibration between a core and valence neutrons cause soft resonances at the excitation energy E x =10-15 MeV below the giant dipole resonance (GDR). In 16 C, we found that a remarkable peak at E x =14 MeV corresponds to the coherent motion of four valence neutrons against a 12 C core, whereas the GDR arises in the E x >20 MeV region because of vibration within the core. In 17 B and 18 C, the dipole strengths in the low-energy region decline compared with those in 15 B and 16 C. We also discuss the energy-weighted sum rule for the E1 transitions

  6. 817 RESONANCE September 2013

    Indian Academy of Sciences (India)

    IAS Admin

    817. RESONANCE ⎜ September 2013. Page 2. 818. RESONANCE ⎜ September 2013. Page 3. 819. RESONANCE ⎜ September 2013. Page 4. 820. RESONANCE ⎜ September 2013. Page 5. 821. RESONANCE ⎜ September 2013. Page 6. 822. RESONANCE ⎜ September 2013. Page 7. 823. RESONANCE ⎜ September ...

  7. 369 RESONANCE April 2016

    Indian Academy of Sciences (India)

    IAS Admin

    369. RESONANCE ⎜ April 2016. Page 2. 370. RESONANCE ⎜ April 2016. Page 3. 371. RESONANCE ⎜ April 2016. Page 4. 372. RESONANCE ⎜ April 2016. Page 5. 373. RESONANCE ⎜ April 2016. Page 6. 374. RESONANCE ⎜ April 2016. Page 7. 375. RESONANCE ⎜ April 2016.

  8. Non-invasive assessment of hepatic fat accumulation in chronic hepatitis C by {sup 1}H magnetic resonance spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Krssak, Martin [Department of Internal Medicine III, Division of Endocrinology and Metabolism, Medical University of Vienna (Austria); Hofer, Harald [Department of Internal Medicine III, Division of Gastroenterology and Hepatology, Medical University of Vienna (Austria); Wrba, Fritz [Department of Clinical Pathology, Medical University of Vienna (Austria); Meyerspeer, Martin [MR Centre-of-Excellence, Department of Radiodiagnostics, Medical University of Vienna (Austria); Center for Biomedical Engineering and Physics, Medical University of Vienna (Austria); Brehm, Attila [Department of Internal Medicine III, Division of Endocrinology and Metabolism, Medical University of Vienna (Austria); Institute for Clinical Diabetology, German Diabetes Center, Leibniz Center of Diabetes Research and Department of Medicine/Metabolic Diseases, Heinrich Heine University, Duesseldorf (Germany); Lohninger, Alfred [Department of Medical Chemistry, Center for Physiology and Pathophysiology, Medical University of Vienna (Austria); Steindl-Munda, Petra [Department of Internal Medicine III, Division of Endocrinology and Metabolism, Medical University of Vienna (Austria); MR Centre-of-Excellence, Department of Radiodiagnostics, Medical University of Vienna (Austria); Moser, Ewald [MR Centre-of-Excellence, Department of Radiodiagnostics, Medical University of Vienna (Austria); Center for Biomedical Engineering and Physics, Medical University of Vienna (Austria); Ferenci, Peter [Department of Internal Medicine III, Division of Gastroenterology and Hepatology, Medical University of Vienna (Austria); Roden, Michael, E-mail: michael.roden@ddz.uni-duesseldorf.d [Department of Internal Medicine III, Division of Endocrinology and Metabolism, Medical University of Vienna (Austria); Institute for Clinical Diabetology, German Diabetes Center, Leibniz Center of Diabetes Research and Department of Medicine/Metabolic Diseases, Heinrich Heine University, Duesseldorf (Germany)

    2010-06-15

    Background: Liver biopsy is the standard method for diagnosis of hepatic steatosis, but is invasive and carries some risk of morbidity. Aims and methods: Quantification of hepatocellular lipid content (HCL) with non-invasive single voxel {sup 1}H magnetic resonance spectroscopy (MRS) at 3 T was compared with histological grading and biochemical analysis of liver biopsies in 29 patients with chronic hepatitis C. Body mass index, indices of insulin resistance (homeostasis model assessment index, HOMA-IR), serum lipids and serum liver transaminases were also quantified. Results: HCL as assessed by {sup 1}H MRS linearly correlated (r = 0.70, p < 0.001) with histological evaluation of liver biopsies and was in agreement with histological steatosis staging in 65% of the patients. Biochemically assessed hepatic triglyceride contents correlated with HCL measured with {sup 1}H MRS (r = 0.63, p < 0.03) and allowed discriminating between none or mild steatosis versus moderate or severe steatosis. Patients infected with hepatitis C virus genotype 3 had a higher prevalence of steatosis (62%) which was not explained by differences in body mass or whole body insulin resistance. When these patients were excluded from correlation analysis, hepatic fat accumulation positively correlated with insulin resistance in the remaining hepatitis C patients (HCL vs. HOMA-IR, r = 0.559, p < 0.020, n = 17). Conclusion: Localized {sup 1}H MRS is a valid and useful method for quantification of HCL content in patients with chronic hepatitis C and can be easily applied to non-invasively monitoring of steatosis during repeated follow-up measurements in a clinical setting.

  9. Doubly excited 3Pe resonance states of two-electron positive ions in Debye plasmas

    International Nuclear Information System (INIS)

    Hu, Xiao-Qing; Wang, Yang; Kar, Sabyasachi; Jiang, Zishi; Jiang, Pinghui

    2015-01-01

    We investigate the doubly excited 3 P e resonance states of two-electron positive ions Li + , Be 2+ , B 3+ , and C 4+ by employing correlated exponential wave functions. In the framework of the stabilization method, we calculate two series (3pnp and 3dnd) of 3 P e resonances below the N = 3 threshold. The 3 P e resonance parameters (resonance energies and widths) are reported for the first time as a function of the screening parameter. For free-atomic cases, comparisons are made with the reported results and few resonance states are reported for the first time

  10. Dating by electron paramagnetic resonance

    International Nuclear Information System (INIS)

    Poupeau, G.; Rossi, A.M.

    1984-01-01

    Some natural materials behave like dosimeters in front of the ionizing particle flux coming from environmental radioactivity and the cosmic radiation. This property is used for the dating by Electron Paramagnetic Resonance (EPR). Before presenting the basic principles of the EPR analysis and the dating method which uses such a phenomenous, it is reviewed several types of application currently in course of development. (L.C.) [pt

  11. Main component analysis of nuclear magnetic resonance /sup 1/H and /sup 13/C quantitative spectra of hydrogenation products of tars from Kansk-Achinsk Achinsk and Cheremkhovsk coals

    Energy Technology Data Exchange (ETDEWEB)

    Kushnarev, D.F.; Polonov, V.M.; Donskikh, V.I.; Rokhina, E.F.; Kalabin, G.A.

    1986-03-01

    Possibility is discussed of examining nuclear magnetic resonance /sup 1/H and /sup 13/C quantitative spectra of coal tar hydrogenation products using main component factorial analysis and applying special mathematical methods of processing experimental data. Nuclear magnetic resonance spectra of hydrogenation products of low temperature Cheremkhovsk coal carbonization tar and rapid pyrolysis Kansk-Achinsk coal tar were obtained on a WP-200SY (Bruker) spectrometer at 50.3 and 200.1 MHz, respectively. Data processing was carried out on an ODRA-1304 computer. Comparative correlation of parameters are given of tars and hydrogenation products which consist of hydrogenation of aromatic cycles and destruction of alkyl substituents, and factorial loads on structural parameters of tar hydrogenation products. 11 references.

  12. Detection by electron spin resonance of young cock irradiated with 60 Co

    International Nuclear Information System (INIS)

    Villavicencio, A.L.C.H.; Duarte, C.L.; Mastro, N.L. del.

    1992-01-01

    The Electron Spin Resonance was used to measuring the production of free radicals induced by ionizing radiation in young cock bones on doses of 3,5 and 7,0 K Gy. It was studied the design decay by 30 days after the irradiation in environment temperature. The results show that the measures by resonance in bones can be used for detecting if the flesh sample that has bone was irradiated or not. The measures show the possibility of use post-irradiation dosimetry in food producst. (C.G.C.)

  13. resonant inverter supplied interior permanent magnet (ipm)

    African Journals Online (AJOL)

    user

    [5] Zhenyue Hong, “DC-voltage link resonant inverters”, Department of Electrical and. Electronic Engineering University of. Canterbury, New Zealand. [6] Kalyan Kumar Halder, Naruttam Kumar Roy and B.C. Ghosh, “Position Sensorless. Control for an Interior Permanent Magnet. Synchronous Motor SVM Drive with ANN.

  14. Resonance multiphoton ionization and dissociation of dimethyl ether via the {\\skew1\\tilde{\\rm C}^{\\prime}}, {\\skew1\\tilde{\\rm C}} and \\tilde{\\rm B} states

    Science.gov (United States)

    Mejia-Ospino, E.; García, G.; Guerrero, A.; Alvarez, I.; Cisneros, C.

    2005-01-01

    The three-photon resonance four-photon ionization and dissociation spectra of dimethyl ether (DME) are presented in the wavelength range 450-550 nm at 1 nm intervals. The (3+1) REMPI spectra show three prominent bands corresponding to the \\tildeB \\leftarrow \\skew1\\tildeX, {\\skew1\\tildeC} \\leftarrow \\skew1\\tildeX and {\\skew1\\tildeC^{\\prime}} \\leftarrow \\skew1\\tildeX transitions with origins at 61 457 cm-1 (7.615 eV), 59 055 cm-1 (7.322 eV) and 58 010 cm-1 (7.194 eV), respectively. Several ionized species, CH3+, CHnO+ (n = 1-3) and CH3OCH3+, are observed in the region of wavelengths studied here. In order to compare the results, a shorter wavelength multiphoton dissociation and ionization of DME at 355 nm is also presented. At this wavelength, DME undergoes neutral dissociation to CH3 and CH3O and each fragment is then ionized by multiphoton absorption. The fragmentation at 355 nm is very intense and only small fragments such as CH3+, CHO+, CH2+, CH+ and C+ ions are observed. The measurement of photoelectron energy allows us to establish that the DME ionization potential is at least 9.55 ± 0.15 eV. The experiments were performed using a Nd:YAG-OPO (optical parametric oscillator) tunable laser system coupled to a time-of-flight mass spectrometer and a hemispherical electron energy analyser.

  15. Paramagnetic resonance and susceptibility of ilmenite, FeTiO3 crystal

    Science.gov (United States)

    Mcdonald, P. F.; Parasiris, A.; Pandey, R. K.; Gries, B. L.; Kirk, W. P.

    1991-01-01

    Large high-purity single crystals of FeTiO3 with ilmenite structure have been grown from a stoichiometric melt of Fe2O3 and TiO2 under an inert atmosphere using the modified Czochralski technique. Susceptibility and X-band paramagnetic resonance studies have been performed. Susceptibility measurements indicate a Neel temperature of about 59 K. The paramagnetic resonance spectrum for magnetic field perpendicular to the crystal c axis consists of a portion of a single, very intense approximately Lorentzian absorption line with its peak at about 600 G and half width at half maximum almost 1200 G. The absorption extends to zero magnetic field. For magnetic field approximately parallel to the c axis, the paramagnetic absorption is much smaller and may be considered a superposition of two approximately Lorentzian line shapes. The magnetic resonance measurements indicate a weak temperature dependence and large angular anisotropy.

  16. Single-photon switch: Controllable scattering of photons inside a one-dimensional resonator waveguide

    Science.gov (United States)

    Zhou, L.; Gong, Z. R.; Liu, Y. X.; Sun, C. P.; Nori, F.

    2010-03-01

    We analyze the coherent transport of a single photon, which propagates in a one-dimensional coupled-resonator waveguide and is scattered by a controllable two-level system located inside one of the resonators of this waveguide. Our approach, which uses discrete coordinates, unifies low and high energy effective theories for single-photon scattering. We show that the controllable two-level system can behave as a quantum switch for the coherent transport of a single photon. This study may inspire new electro-optical single-photon quantum devices. We also suggest an experimental setup based on superconducting transmission line resonators and qubits. References: L. Zhou, Z.R. Gong, Y.X. Liu, C.P. Sun, F. Nori, Controllable scattering of photons inside a one-dimensional resonator waveguide, Phys. Rev. Lett. 101, 100501 (2008). L. Zhou, H. Dong, Y.X. Liu, C.P. Sun, F. Nori, Quantum super-cavity with atomic mirrors, Phys. Rev. A 78, 063827 (2008).

  17. Δ++ resonance production in multi-nucleon η-12C interactions at the momentum of 40GeV/c

    International Nuclear Information System (INIS)

    Huseynaliyev, Y.H; Rustamova, A.B; Huseynaliyeva, L.Y.

    2012-01-01

    Full text : Study of behavior of the characteristics in hadrons-nucleus interactions at high energy as a function of collision centrality. Centrality dependences are studied in relativistic and ultra-relativistic heavy-ion collisions too. In these experiments as a collision centrality the numbers of participant nucleons, the number of binary nucleon collisions and the mean number of projectile-nucleon interactions have been used. An easy option to set centrality is the use of the number of protons emitted in the reactions to consider multi-nucleon processes. By studying the multi-nucleon events in hadrons nucleon and nucleus interactions on a can get useful information about collective phenomena, for example formation of bound states of the resonances in the nucleus. Physics of these processes serves as a bridge that joins the study of mechanisms for the production of high-energy particles and new phases of strongly-interacting nuclear matter. As the characteristics of secondary particles the transverse momentum, cumulative number and kinetic energy dependences in laboratory frame of the R are studied. An invariant mass distribution of ηp pairs is constructed and the indication on occurrence of a Δ + + baryon resonance and relatively high contribution of deep-inelastic processes in multi-nucleon events are received

  18. Snake resonances

    International Nuclear Information System (INIS)

    Tepikian, S.

    1988-01-01

    Siberian Snakes provide a practical means of obtaining polarized proton beams in large accelerators. The effect of snakes can be understood by studying the dynamics of spin precession in an accelerator with snakes and a single spin resonance. This leads to a new class of energy independent spin depolarizing resonances, called snake resonances. In designing a large accelerator with snakes to preserve the spin polarization, there is an added constraint on the choice of the vertical betatron tune due to the snake resonances. 11 refs., 4 figs

  19. Magnetic resonance spectroscopy and metabolism. Applications of proton and sup 13 C NMR to the study of glutamate metabolism in cultured glial cells and human brain in vivo

    Energy Technology Data Exchange (ETDEWEB)

    Portais, J.C.; Pianet, I.; Merle, M.; Raffard, G.; Biran, M.; Labouesse, J.; Canioni, P. (Bordeaux-2 Univ., 33 (FR)); Allard, M.; Kien, P.; Caille, J.M. (Centre Hospitalier Universitaire, 33 Bordeaux (FR))

    1991-01-01

    Nuclear magnetic resonance (NMR) spectroscopy was used to study the metabolism of cells from the central nervous system both in vitro on perchloric acid extracts obtained either from cultured tumoral cells (C6 rat glioma) or rat astrocytes in primary culture, and in vivo within the human brain. Analysis of carbon 13 NMR spectra of perchloric acid extracts prepared from cultured cells in the presence of NMR (1-{sup 13}C) glucose as substrate allowed determination of the glutamate and glutamine enrichments in both normal and tumoral cells. Preliminary results indicated large changes in the metabolism of these amino acids (and also of aspartate and alanine) in the C6 cell as compared to its normal counterpart. Localized proton NMR spectra of the human brain in vivo were obtained at 1.5 T, in order to evaluate the content of various metabolites, including glutamate, in peritumoral edema from a selected volume of 2 x 2 x 2 cm{sup 3}. N-acetyl aspartate, glutamate, phosphocreatine, creatine, choline and inositol derivative resonances were observed in 15 min spectra. N-acetyl-aspartate was found to be at a lower level in contrast to glutamate which was detected at a higher level in the injured area as compared to the controlateral unaffected side.

  20. Control of integrated micro-resonator wavelength via balanced homodyne locking.

    Science.gov (United States)

    Cox, Jonathan A; Lentine, Anthony L; Trotter, Douglas C; Starbuck, Andrew L

    2014-05-05

    We describe and experimentally demonstrate a method for active control of resonant modulators and filters in an integrated photonics platform. Variations in resonance frequency due to manufacturing processes and thermal fluctuations are corrected by way of balanced homodyne locking. The method is compact, insensitive to intensity fluctuations, minimally disturbs the micro-resonator, and does not require an arbitrary reference to lock. We demonstrate long-term stable locking of an integrated filter to a laser swept over 1.25 THz. In addition, we show locking of a modulator with low bit error rate while the chip temperature is varied from 5 to 60° C.

  1. Agrobacterium tumefaciens-mediated transformation for investigating pathogenicity genes of the phytopathogenic fungus Colletotrichum sansevieriae.

    Science.gov (United States)

    Nakamura, Masayuki; Kuwahara, Hideto; Onoyama, Keisuke; Iwai, Hisashi

    2012-08-01

    Agrobacterium tumefaciens-mediated transformation (AtMT) has become a common technique for DNA transformation of yeast and filamentous fungi. In this study, we first established a protocol of AtMT for the phytopathogenic fungus Colletotrichum sansevieriae. Binary T-DNA vector containing the hygromycin B phosphotransferase gene controlled by the Aspergillus nidulans gpdA promoter and the trpC terminator was constructed with pCAMBIA0380 and used with three different strains LBA4404, GV3101, and GV2260 of A. tumefaciens. Transformants were most effectively obtained when GV2260 and C. sansevieriae Sa-1-2 were co-cultivated; there were about 320 transformants per 10(6) spores. When 1,048 transformants were inoculated on Sansevieria trifasciata, three transformants were found to have completely lost their pathogenicity and two transformants displayed reduced pathogenicity. All of the five transformants had a single copy of T-DNA in their genomes. The three pathogenicity-deficient transformants were subjected to thermal asymmetric interlaced polymerase chain reaction and the reaction allowed us to amplify the sequences flanking the left and/or right borders. The flanking sequences of the two transformants, M154 and M875, showed no homology to any sequences in databases, but the sequences of M678 contained motifs of alpha-1,3-glucan synthase, suggesting that the gene might contribute to the pathogenicity of C. sansevieriae. This study describes a useful method for investigating pathogenicity genes in C. sansevieriae.

  2. 1004 RESONANCE November 2013

    Indian Academy of Sciences (India)

    IAS Admin

    1004. RESONANCE │ November 2013. Page 2. 1005. RESONANCE │ November 2013. Page 3. 1006. RESONANCE │ November 2013. Page 4. 1007. RESONANCE │ November 2013. Page 5. 1008. RESONANCE │ November 2013. Page 6. 1009. RESONANCE │ November 2013. Page 7. 1010. RESONANCE ...

  3. Synchrobetatron resonances

    International Nuclear Information System (INIS)

    1977-03-01

    At the 1975 Particle Accelerator Conference it was reported that a class of resonances were observed in SPEAR II that had not appeared before in SPEAR I. While the existence of sideband resonances of the main betatron oscillation frequencies has been previously observed and analyzed, the resonances observed in SPEAR do not appear to be of the same variety. Experiments were performed at SPEAR to identify the mechanism believed to be the most likely explanation. Some of the current experimental knowledge and theoretical views on the source of these resonances are presented

  4. Magnetic resonance tracking of fluorescent nanodiamond fabrication

    Science.gov (United States)

    Shames, A. I.; Osipov, V. Yu; Boudou, J. P.; Panich, A. M.; von Bardeleben, H. J.; Treussart, F.; Vul', A. Ya

    2015-04-01

    Magnetic resonance techniques (electron paramagnetic resonance (EPR) and nuclear magnetic resonance (NMR)) are used for tracking the multi-stage process of the fabrication of fluorescent nanodiamonds (NDs) produced by high-energy electron irradiation, annealing, and subsequent nano-milling. Pristine commercial high pressure and high temperature microdiamonds (MDs) with mean size 150 μm contain ~5  ×  1018 spins/g of singlet (S = 1/2) substitutional nitrogen defects P1, as well as sp3 C-C dangling bonds in the crystalline lattice. The half-field X-band EPR clearly shows (by the appearance of the intense ‘forbidden’ g = 4.26 line) that high-energy electron irradiation and annealing of MDs induce a large amount (~5  ×  1017 spins/g) of triplet (S = 1) magnetic centers, which are identified as negatively charged nitrogen vacancy defects (NV-). This is supported by EPR observations of the ‘allowed’ transitions between Zeeman sublevels of the triplet state. After progressive milling of the fluorescent MDs down to an ultrasubmicron scale (≤100 nm), the relative abundance of EPR active NV- defects in the resulting fluorescent NDs (FND) substantially decreases and, vice versa, the content of C-inherited singlet defects correlatively increases. In the fraction of the finest FNDs (mean particle size fingerprint of the presence of NV- centers in small ND systems. The same size reduction causes the disappearance of the characteristic hyperfine satellites in the spectra of the P1 centers. We discuss the mechanisms that cause both the strong reduction of the peak intensity of the ‘allowed’ lines in EPR spectra of triplet defects and the transformation of the P1 spectra.

  5. Conditions to obtain precise and true measurements of the intramolecular {sup 13}C distribution in organic molecules by isotopic {sup 13}C nuclear magnetic resonance spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Bayle, Kevin [EBSI Team, Interdisciplinary Chemistry: Synthesis, Analysis, Modelling (CEISAM), University of Nantes-CNRS UMR 6230, 2 Rue de la Houssinière, BP 92208, F-44322, Nantes Cedex 3 (France); Gilbert, Alexis [Department of Environmental Chemistry and Engineering, Tokyo Institute of Technology, 4259 Nagatsuta-cho, Midori-ku, Yokohama, Kanagawa 226-8503 (Japan); Earth–Life Science Institute, Tokyo Institute of Technology, Meguro, Tokyo 152-8551 (Japan); Julien, Maxime [EBSI Team, Interdisciplinary Chemistry: Synthesis, Analysis, Modelling (CEISAM), University of Nantes-CNRS UMR 6230, 2 Rue de la Houssinière, BP 92208, F-44322, Nantes Cedex 3 (France); Yamada, Keita [Department of Environmental Chemistry and Engineering, Tokyo Institute of Technology, 4259 Nagatsuta-cho, Midori-ku, Yokohama, Kanagawa 226-8503 (Japan); Silvestre, Virginie; Robins, Richard J.; Akoka, Serge [EBSI Team, Interdisciplinary Chemistry: Synthesis, Analysis, Modelling (CEISAM), University of Nantes-CNRS UMR 6230, 2 Rue de la Houssinière, BP 92208, F-44322, Nantes Cedex 3 (France); Yoshida, Naohiro [Department of Environmental Chemistry and Engineering, Tokyo Institute of Technology, 4259 Nagatsuta-cho, Midori-ku, Yokohama, Kanagawa 226-8503 (Japan); Earth–Life Science Institute, Tokyo Institute of Technology, Meguro, Tokyo 152-8551 (Japan); Remaud, Gérald S., E-mail: gerald.remaud@univ-nantes.fr [EBSI Team, Interdisciplinary Chemistry: Synthesis, Analysis, Modelling (CEISAM), University of Nantes-CNRS UMR 6230, 2 Rue de la Houssinière, BP 92208, F-44322, Nantes Cedex 3 (France)

    2014-10-10

    dependent to the range covered by the resonance frequencies of the molecule. Therefore, the former can be used directly for studying isotope affiliations, while the latter can only be used directly for comparative data, for example in authenticity studies, but can also be used to obtain the true values by applying appropriate correction factors. The present study assesses several key protocol steps required to enable the determination of position-specific {sup 13}C content by isotopic {sup 13}C NMR, irrespective of the NMR spectrometer: parameters to be adjusted, performance test using [1,2-{sup 13}C{sub 2}]acetic acid, generation of correction factors.

  6. Subthreshold resonances and resonances in the R -matrix method for binary reactions and in the Trojan horse method

    Science.gov (United States)

    Mukhamedzhanov, A. M.; Shubhchintak, Bertulani, C. A.

    2017-08-01

    In this paper we discuss the R -matrix approach to treat the subthreshold resonances for the single-level and one-channel and for the single-level and two-channel cases. In particular, the expression relating the asymptotic normalization coefficient (ANC) with the observable reduced width, when the subthreshold bound state is the only channel or coupled with an open channel, which is a resonance, is formulated. Since the ANC plays a very important role in nuclear astrophysics, these relations significantly enhance the power of the derived equations. We present the relationship between the resonance width and the ANC for the general case and consider two limiting cases: wide and narrow resonances. Different equations for the astrophysical S factors in the R -matrix approach are presented. After that we discuss the Trojan horse method (THM) formalism. The developed equations are obtained using the surface-integral formalism and the generalized R -matrix approach for the three-body resonant reactions. It is shown how the Trojan horse (TH) double-differential cross section can be expressed in terms of the on-the-energy-shell astrophysical S factor for the binary subreaction. Finally, we demonstrate how the THM can be used to calculate the astrophysical S factor for the neutron generator 13C(α ,n )16O in low-mass AGB stars. At astrophysically relevant energies this astrophysical S factor is controlled by the threshold level 1 /2+,Ex=6356 keV. Here, we reanalyzed recent TH data taking into account more accurately the three-body effects and using both assumptions that the threshold level is a subthreshold bound state or it is a resonance state.

  7. Analytically continued Fock space multi-reference coupled-cluster theory: Application to the shape resonance

    International Nuclear Information System (INIS)

    Pal, Sourav; Sajeev, Y.; Vaval, Nayana

    2006-01-01

    The Fock space multi-reference coupled-cluster (FSMRCC) method is used for the study of the shape resonance energy and width in an electron-atom/molecule collision. The procedure is based upon combining a complex absorbing potential (CAP) with FSMRCC theory. Accurate resonance parameters are obtained by solving a small non-Hermitian eigen-value problem. We study the shape resonances in e - -C 2 H 4 and e - -Mg

  8. Controllable scattering of photons in a one-dimensional resonator waveguide

    Science.gov (United States)

    Sun, C. P.; Zhou, L.; Gong, Z. R.; Liu, Y. X.; Nori, F.

    2009-03-01

    We analyze the coherent transport of a single photon, which propagates in a one-dimensional coupled-resonator waveguide and is scattered by a controllable two-level system located inside one of the resonators of this waveguide. Our approach, which uses discrete coordinates, unifies low and high energy effective theories for single-photon scattering. We show that the controllable two-level system can behave as a quantum switch for the coherent transport of a single photon. This study may inspire new electro-optical single-photon quantum devices. We also suggest an experimental setup based on superconducting transmission line resonators and qubits. [4pt] L. Zhou, Z.R. Gong, Y.X. Liu, C.P. Sun, F. Nori, Controllable scattering of photons in a 1D resonator waveguide, Phys. Rev. Lett. 101, 100501 (2008). URL: http://link.aps.org/abstract/PRL/v101/e100501

  9. NMR comparison of prokaryotic and eukaryotic cytochromes c

    International Nuclear Information System (INIS)

    Chau, Meihing; Cai, Meng Li; Timkovich, R.

    1990-01-01

    1 H NMR spectroscopy has been used to examine ferrocytochrome c-551 from Pseudomonas aeruginosa (ATCC 19429) over the pH range 3.5-10.6 and the temperature range 4-60 degree C. Resonance assignments are proposed for main-chain and side-chain protons. Comparison of results for cytochrome c-551 to recently assigned spectra for horse cytochrome c and mutants of yeast iso-1 cytochrome reveals some unique resonances with unusual chemical shifts in all cytochromes that may serve as markers for the heme region. Results for cytochrome c-551 indicate that in the smaller prokaryotic cytochrome, all benzoid side chains are rapidly flipping on the NMR time scale. In contrast, in eukaryotic cytochromes there are some rings flipping slowly on the NMR time scale. The ferrocytochrome c-551 undergoes a transition linked to pH with a pK around 7. The pH behavior of assigned resonances provides evidence that the site of protonation is the inner or buried 17-propionic acid heme substituent (IUPAC-IUB porphyrin nomenclature). Conformational heterogeneity has been observed for segments near the inner heme propionate substituent

  10. Magnetic resonance imaging of generalised musculo-skeletal diseases

    International Nuclear Information System (INIS)

    Kaiser, W.A.; Schalke, B.C.G.

    1989-01-01

    The results presented are drawn from 320 examinations by NMR imaging of patients with various systemic muscle diseases (dystrophies, myositides, metabolic disorders), and are interpreted so as to explain the relevant characteristic distribution patterns of the degenerative processes in the femoral musculature as shown by the NMR images. Four basic patterns are presented according to the criteria homogeneous-heterogeneous and symmetric-asymmetric, and the diseases identified by the differential diagnostic evaluation are discussed. The optimum measuring conditions for magnetic resonance imaging of the musculature are given, and the specific magnetic resonance criteria of myositides, neurogenic myopathies, myofonous dystrophies, c.n. polio, morbus Pompe, familial hypokalemic paralysis, centronuclear mypathy, morbus Duchenne are explained. The significance of NMR imaging with regard to biopsy or therapy planning is discussed, and magnetic resonance examination is recommended to be applied prior to biopsy. (orig.) [de

  11. Sum rule approach to the study of statistical decay properties of nuclear giant resonances

    International Nuclear Information System (INIS)

    Adhikari, S.K.; Hussein, M.S.

    1987-03-01

    Corrections to the well-known statistical sum rule that relates the summed transmission coefficients on the one hand and 2πΓ C.N. .ρ C.N. On the other, in the context of the statistical decay properties of nuclear giant resonances, are discussed. These corrections arise both from pre-equilibrium processes as well as from the giant resonance itself. It is shown that the compound nucleus average width is reduced as a result of these corrections. (Author) [pt

  12. Energy Distributions from Three-Body Decaying Many-Body Resonances

    International Nuclear Information System (INIS)

    Alvarez-Rodriguez, R.; Jensen, A. S.; Fedorov, D. V.; Fynbo, H. O. U.; Garrido, E.

    2007-01-01

    We compute energy distributions of three particles emerging from decaying many-body resonances. We reproduce the measured energy distributions from decays of two archetypal states chosen as the lowest 0 + and 1 + resonances in 12 C populated in β decays. These states are dominated by sequential, through the 8 Be ground state, and direct decays, respectively. These decay mechanisms are reflected in the ''dynamic'' evolution from small, cluster or shell-model states, to large distances, where the coordinate or momentum space continuum wave functions are accurately computed

  13. Statistical Modelling of Resonant Cross Section Structure in URR, Model of the Characteristic Function

    International Nuclear Information System (INIS)

    Koyumdjieva, N.

    2006-01-01

    A statistical model for the resonant cross section structure in the Unresolved Resonance Region has been developed in the framework of the R-matrix formalism in Reich Moore approach with effective accounting of the resonance parameters fluctuations. The model uses only the average resonance parameters and can be effectively applied for analyses of cross sections functional, averaged over many resonances. Those are cross section moments, transmission and self-indication functions measured through thick sample. In this statistical model the resonant cross sections structure is accepted to be periodic and the R-matrix is a function of ε=E/D with period 0≤ε≤N; R nc (ε)=π/2√(S n *S c )1/NΣ(i=1,N)(β in *β ic *ctg[π(ε i - = ε-iS i )/N]; Here S n ,S c ,S i is respectively neutron strength function, strength function for fission or inelastic channel and strength function for radiative capture, N is the number of resonances (ε i ,β i ) that obey the statistic of Porter-Thomas and Wigner's one. The simple case of this statistical model concerns the resonant cross section structure for non-fissile nuclei under the threshold for inelastic scattering - the model of the characteristic function with HARFOR program. In the above model some improvements of calculation of the phases and logarithmic derivatives of neutron channels have been done. In the parameterization we use the free parameter R l ∞ , which accounts the influence of long-distant resonances. The above scheme for statistical modelling of the resonant cross section structure has been applied for evaluation of experimental data for total, capture and inelastic cross sections for 232 Th in the URR (4-150) keV and also the transmission and self-indication functions in (4-175) keV. The set of evaluated average resonance parameters have been obtained. The evaluated average resonance parameters in the URR are consistent with those in the Resolved Resonance Region (CRP for Th-U cycle, Vienna, 2006

  14. Even order snake resonances

    International Nuclear Information System (INIS)

    Lee, S.Y.

    1993-01-01

    We found that the perturbed spin tune due to the imperfection resonance plays an important role in beam depolarization at snake resonances. We also found that even order snake resonances exist in the overlapping intrinsic and imperfection resonances. Due to the perturbed spin tune shift of imperfection resonances, each snake resonance splits into two

  15. Genotipicación de la resistencia natural del ganado blanco orejinegro “BON” a la Salmonella dublin SL 2260

    Directory of Open Access Journals (Sweden)

    Jorge Eliécer Ossa Londoño

    2000-02-01

    Full Text Available Uno de los factores que controla la resistencia a microorganismos intracelulares como Salmonella y Brucella, es el producto del gen Nramp (proteína del macrófago asociada a resistencia natural; esta proteína, en la fase temprana de la infección, controla la capacidad de replicación de estas bacterias en los macrófagos. Recientemente se identificó asociación entre un alelo de 175 pb de un microsatélite (STR, ligado a Nramp, con la resistencia a microorganismos intracelulares en bovinos; adicionalmente, se han identificado otros tres alelos (177, 179 y 181 pb asociados con susceptibilidad. En la especie bovina, la Salmonella Dublín sirve como modelo para estudiar la resistencia natural a otras bacterias intracelulares como la Brucella abortus, ya que se ha demostrado que macrófagos derivados de bovinos resistentes controlan eficientemente el crecimiento de ambas bacterias. En Colombia, se ha propuesto que el ganado criollo “BON” presenta una marcada resistencia a enfermedades infecciosas, entre ellas la brucellosis. El objetivo de esta investigación fue determinar el genotipo y el fenotipo de la resistencia del ganado BON a la Salmonella Dublín SL 2260, para contribuir a la caracterización inmunogenética de la resistencia natural de este ganado a las infecciones microbianas. En este trabajo sé han analizado 80 bovinos de la raza “BON”, 18 holstein y 4 cebú: se extrajo ADN a partir de sangre periférica, se amplificó el STR ligado al Nramp, a través de la técnica de reacción en cadena de la polimerasa (PCR; el producto fue sometido a un análisis de polimorfismos conformacionales de cadena sencilla (SSCP, utilizando un gel de polyacrilamida al 6% en condiciones no reductoras. De acuerdo a la movilidad electroforética de los amplicones, y comparándola con un patrón ya definido de resistencia, se han tipificado los diferentes animales. De los 80 animales “BON”, 79 (98.75% fueron homocigóticos para el alelo de

  16. Sample-size resonance, ferromagnetic resonance and magneto-permittivity resonance in multiferroic nano-BiFeO3/paraffin composites at room temperature

    International Nuclear Information System (INIS)

    Wang, Lei; Li, Zhenyu; Jiang, Jia; An, Taiyu; Qin, Hongwei; Hu, Jifan

    2017-01-01

    In the present work, we demonstrate that ferromagnetic resonance and magneto-permittivity resonance can be observed in appropriate microwave frequencies at room temperature for multiferroic nano-BiFeO 3 /paraffin composite sample with an appropriate sample-thickness (such as 2 mm). Ferromagnetic resonance originates from the room-temperature weak ferromagnetism of nano-BiFeO 3 . The observed magneto-permittivity resonance in multiferroic nano-BiFeO 3 is connected with the dynamic magnetoelectric coupling through Dzyaloshinskii–Moriya (DM) magnetoelectric interaction or the combination of magnetostriction and piezoelectric effects. In addition, we experimentally observed the resonance of negative imaginary permeability for nano BiFeO 3 /paraffin toroidal samples with longer sample thicknesses D=3.7 and 4.9 mm. Such resonance of negative imaginary permeability belongs to sample-size resonance. - Highlights: • Nano-BiFeO 3 /paraffin composite shows a ferromagnetic resonance. • Nano-BiFeO 3 /paraffin composite shows a magneto-permittivity resonance. • Resonance of negative imaginary permeability in BiFeO 3 is a sample-size resonance. • Nano-BiFeO 3 /paraffin composite with large thickness shows a sample-size resonance.

  17. Amplitude saturation of MEMS resonators explained by autoparametric resonance

    International Nuclear Information System (INIS)

    Van der Avoort, C; Bontemps, J J M; Steeneken, P G; Le Phan, K; Van Beek, J T M; Van der Hout, R; Hulshof, J; Fey, R H B

    2010-01-01

    This paper describes a phenomenon that limits the power handling of MEMS resonators. It is observed that above a certain driving level, the resonance amplitude becomes independent of the driving level. In contrast to previous studies of power handling of MEMS resonators, it is found that this amplitude saturation cannot be explained by nonlinear terms in the spring constant or electrostatic force. Instead we show that the amplitude in our experiments is limited by nonlinear terms in the equation of motion which couple the in-plane length-extensional resonance mode to one or more out-of-plane (OOP) bending modes. We present experimental evidence for the autoparametric excitation of these OOP modes using a vibrometer. The measurements are compared to a model that can be used to predict a power-handling limit for MEMS resonators

  18. Amplitude saturation of MEMS resonators explained by autoparametric resonance

    Energy Technology Data Exchange (ETDEWEB)

    Van der Avoort, C; Bontemps, J J M; Steeneken, P G; Le Phan, K; Van Beek, J T M [NXP Research, Eindhoven (Netherlands); Van der Hout, R; Hulshof, J [Department of Mathematics, VU University—Faculty of Sciences, De Boelelaan 1081a, 1081 HV Amsterdam (Netherlands); Fey, R H B, E-mail: cas.van.der.avoort@nxp.com [Department of Mechanical Engineering, Eindhoven University of Technology, PO Box 513, 5600 MB, Eindhoven (Netherlands)

    2010-10-15

    This paper describes a phenomenon that limits the power handling of MEMS resonators. It is observed that above a certain driving level, the resonance amplitude becomes independent of the driving level. In contrast to previous studies of power handling of MEMS resonators, it is found that this amplitude saturation cannot be explained by nonlinear terms in the spring constant or electrostatic force. Instead we show that the amplitude in our experiments is limited by nonlinear terms in the equation of motion which couple the in-plane length-extensional resonance mode to one or more out-of-plane (OOP) bending modes. We present experimental evidence for the autoparametric excitation of these OOP modes using a vibrometer. The measurements are compared to a model that can be used to predict a power-handling limit for MEMS resonators.

  19. Three-particle decays of light-nuclei resonances

    DEFF Research Database (Denmark)

    Álvarez-Rodríguez, R.; Jensen, A.S.; Garrido, E.

    2012-01-01

    We have studied the three-particle decay of 12C, 9Be and 6Be resonances. These nuclei have been described as three-body systems by means of the complex scaled hyperspherical adiabatic expansion method. The short-distance part of the wave function is responsible for the energies, whereas the infor...

  20. Plasma resonance in anisotropic layered high-Tc superconductors

    DEFF Research Database (Denmark)

    Sakai, Shigeki; Pedersen, Niels Falsig

    1999-01-01

    The plasma resonance is described theoretically by the inductive coupling model for a large stacked Josephson-junction system such as the intrinsic Josephson-junction array in anisotropic high- T-c superconductors. Eigenmodes of the plasma oscillation are analytically described and a numerical...

  1. Resonance magnetic x-ray scattering study of erbium

    DEFF Research Database (Denmark)

    Sanyal, M.K.; Gibbs, D.; Bohr, J.

    1994-01-01

    The magnetic phases of erbium have been studied by resonance x-ray-scattering techniques. When the incident x-ray energy is tuned near the L(III) absorption edge, large resonant enhancements of the magnetic scattering are observed above 18 K. We have measured the energy and polarization dependence...... of this magnetic scattering and analyzed it using a simple model based on electric dipole and quadrupole transitions among atomic orbitals. The line shapes can be fitted to a magnetic structure combining both c-axis-modulated and basal-plane components. Below 18 K, we have observed unusual behavior of the magnetic...

  2. The effect of materials properties on the Q of high Tc helical and coaxial resonators

    International Nuclear Information System (INIS)

    Peterson, G.E.; Fleming, D.A.; Johnson, D.W. Jr.; Rhodes, W.W.

    1990-01-01

    High T c helical and coaxial resonators have applications in U.H.F. radio receivers. We have employed a variety of techniques to study the superconducting materials used to form such resonators. These include, X-ray diffraction, SEM, density, dilatometry and sedigraph. We have correlated our data with resonator Q and frequency and have determined optimum conditions for highest Q. Our best resonators perform better than their all copper counterparts by a factor of 10 at 77K and at frequencies below 1,000 MHz. We have used these resonators in local oscillators and Butterworth filters in U.H.F. receivers

  3. Low Temperature (180°C Growth of Smooth Surface Germanium Epilayers on Silicon Substrates Using Electron Cyclotron Resonance Chemical Vapor Deposition

    Directory of Open Access Journals (Sweden)

    Teng-Hsiang Chang

    2014-01-01

    Full Text Available This paper describes a new method to grow thin germanium (Ge epilayers (40 nm on c-Si substrates at a low growth temperature of 180°C using electron cyclotron resonance chemical vapor deposition (ECR-CVD process. The full width at half maximum (FWHM of the Ge (004 in X-ray diffraction pattern and the compressive stain in a Ge epilayer of 683 arcsec and 0.12% can be achieved. Moreover, the Ge/Si interface is observed by transmission electron microscopy to demonstrate the epitaxial growth of Ge on Si and the surface roughness is 0.342 nm. The thin-thickness and smooth surface of Ge epilayer grown on Si in this study is suitable to be a virtual substrate for developing the low cost and high efficiency III-V/Si tandem solar cells in our opinion. Furthermore, the low temperature process can not only decrease costs but can also reduce the restriction of high temperature processes on device manufacturing.

  4. Off-resonance rotating-frame relaxation dispersion experiment for 13C in aromatic side chains using L-optimized TROSY-selection

    DEFF Research Database (Denmark)

    Weininger, Ulrich; Brath, Ulrika; Modig, Kristofer

    2014-01-01

    Protein dynamics on the microsecond-millisecond time scales often play a critical role in biological function. NMR relaxation dispersion experiments are powerful approaches for investigating biologically relevant dynamics with site-specific resolution, as shown by a growing number of publications...... on enzyme catalysis, protein folding, ligand binding, and allostery. To date, the majority of studies has probed the backbone amides or side-chain methyl groups, while experiments targeting other sites have been used more sparingly. Aromatic side chains are useful probes of protein dynamics, because...... they are over-represented in protein binding interfaces, have important catalytic roles in enzymes, and form a sizable part of the protein interior. Here we present an off-resonance R 1ρ experiment for measuring microsecond to millisecond conformational exchange of aromatic side chains in selectively (13)C...

  5. Simultaneous electrical and mechanical resonance drive for large signal amplification of micro resonators

    KAUST Repository

    Hasan, M. H.

    2018-01-12

    Achieving large signal-noise ratio using low levels of excitation signal is key requirement for practical applications of micro and nano electromechanical resonators. In this work, we introduce the double electromechanical resonance drive concept to achieve an order-of-magnitude dynamic signal amplification in micro resonators. The concept relies on simultaneously activating the micro-resonator mechanical and electrical resonance frequencies. We report an input voltage amplification up to 15 times for a micro-resonator when its electrical resonance is tuned to match the mechanical resonance that leads to dynamic signal amplification in air (Quality factor enhancement). Furthermore, using a multi-frequency excitation technique, input voltage and vibrational amplification of up to 30 times were shown for the same micro-resonator while relaxing the need to match its mechanical and electrical resonances.

  6. Simultaneous electrical and mechanical resonance drive for large signal amplification of micro resonators

    KAUST Repository

    Hasan, M. H.; Alsaleem, F. M.; Jaber, Nizar; Hafiz, Md Abdullah Al; Younis, Mohammad I.

    2018-01-01

    Achieving large signal-noise ratio using low levels of excitation signal is key requirement for practical applications of micro and nano electromechanical resonators. In this work, we introduce the double electromechanical resonance drive concept to achieve an order-of-magnitude dynamic signal amplification in micro resonators. The concept relies on simultaneously activating the micro-resonator mechanical and electrical resonance frequencies. We report an input voltage amplification up to 15 times for a micro-resonator when its electrical resonance is tuned to match the mechanical resonance that leads to dynamic signal amplification in air (Quality factor enhancement). Furthermore, using a multi-frequency excitation technique, input voltage and vibrational amplification of up to 30 times were shown for the same micro-resonator while relaxing the need to match its mechanical and electrical resonances.

  7. Erbium-doped fiber ring resonator for resonant fiber optical gyro applications

    Science.gov (United States)

    Li, Chunming; Zhao, Rui; Tang, Jun; Xia, Meijing; Guo, Huiting; Xie, Chengfeng; Wang, Lei; Liu, Jun

    2018-04-01

    This paper reports a fiber ring resonator with erbium-doped fiber (EDF) for resonant fiber optical gyro (RFOG). To analyze compensation mechanism of the EDF on resonator, a mathematical model of the erbium-doped fiber ring resonator (EDFRR) is established based on Jones matrix to be followed by the design and fabrication of a tunable EDFRR. The performances of the fabricated EDFRR were measured and the experimental Q-factor of 2 . 47 × 108 and resonant depth of 109% were acquired separately. Compared with the resonator without the EDF, the resonant depth and Q-factor of the proposed device are increased by 2.5 times and 14 times, respectively. A potential optimum shot noise limited resolution of 0 . 042∘ / h can be obtained for the RFOG, which is promising for low-cost and high precise detection.

  8. The magnetic resonance spectroscopy analysis for fatty acid of cooking oil

    International Nuclear Information System (INIS)

    Yu, Seung Man

    2016-01-01

    The aim of this study was to evaluate possibility for chemical changes analysis of the Soybean and Olive oil using a medical magnetic resonance imaging/spectrometer. The two edible oils including soybean and olive oil were selected for manufacturing the phantom series. For the acquisition of data without any physical environment change, 5 ml was transferred to a sealed plastic vial. All MRI and 1H-MRS experiments were performed on a 3.0 Tesla MRI scanner using a 32-channel brain array coil. The total lipid ((-CH2-)n/noise), total saturated fatty acid, total unsaturated fatty acid, total unsaturated bond, and poly unsaturated bond were quantified by separating each peak area of -CH_3, (-CH_2-)n, -CH_2-C=C-CH_2-, =C-CH_2-C=, and -CH=CH-byCH_3 by MRS analysis. Soybean oil had the highest concentration of methyl protons and methane protons, expressed as 0.9 and 5.3 ppm compared to olive oil. However, its methylene protons at 1.3 ppm were the lowest. Olive oil had the highest amount of methylene protons and allylic protons and the lowest amount of methyl protons. Through the magnetic resonance spectroscopic analysis it was to analyze the chemical characteristics of Olive oil and soybean oil. And it was confirmed that it is possible to proceed to an extended study using magnetic resonance spectroscopy

  9. Theoretical study of hyperfine interactions and optically detected magnetic resonance spectra by simulation of the C291[NV]-H172 diamond cluster hosting nitrogen-vacancy center

    International Nuclear Information System (INIS)

    Nizovtsev, A P; Ya Kilin, S; Pushkarchuk, A L; Pushkarchuk, V A; Jelezko, F

    2014-01-01

    Single nitrogen-vacancy (NV) centers in diamond coupled to neighboring nuclear spins are promising candidates for room-temperature applications in quantum information processing, quantum sensing and metrology. Here we report on a systematic density functional theory simulation of hyperfine coupling of the electronic spin of the NV center to individual 13 C nuclear spins arbitrarily disposed in the H-terminated C 291 [NV] - H 172 cluster hosting the NV center. For the ‘families’ of equivalent positions of the 13 C atom in diamond lattices around the NV center we calculated hyperfine characteristics. For the first time the data are given for a system where the 13 C atom is located on the NV center symmetry axis. Electron paramagnetic resonance transitions in the coupled electron–nuclear spin system 14 NV- 13 C are analyzed as a function of the external magnetic field. Previously reported experimental data from Dréau et al (2012 Phys. Rev. B 85 134107) are described using simulated hyperfine coupling parameters. (paper)

  10. Monitoring mammary tumor progression and effect of tamoxifen treatment in MMTV-PymT using MRI and magnetic resonance spectroscopy with hyperpolarized [1-13C]pyruvate

    DEFF Research Database (Denmark)

    Asghar Butt, Sadia; Søgaard, Lise V.; Ardenkjær-Larsen, Jan Henrik

    2015-01-01

    Purpose: To use dynamic magnetic resonance spectroscopy (MRS) of hyperpolarized 13C-pyruvate to follow the progress over time in vivo of breast cancer metabolism in the MMTV-PymT model, and to follow the response to the anti-estrogen drug tamoxifen. Methods: Tumor growth was monitored by anatomical...... significantly in the treated group. Conclusion: These hyperpolarized 13C MRS findings indicate that tumor metabolic changes affects kP. The measured kp did not relate to treatment response to the same extent as did tumor growth, histological evaluation, and in vitro determination of LDH activity. © 2014 Wiley...

  11. Quantum mechanical resonances

    International Nuclear Information System (INIS)

    Cisneros S, A.; McIntosh, H.V.

    1982-01-01

    A discussion of the nature of quantum mechanical resonances is presented from the point of view of the spectral theory of operators. In the case of Bohr-Feshbach resonances, graphs are presented to illustrate the theory showing the decay of a doubly excited metastable state and the excitation of the resonance by an incident particle with proper energy. A characterization of resonances is given as well as a procedure to determine widths using the spectral density function. A sufficient condition is given for the validity of the Breit-Wigner formula for Bohr-Feshbach resonances. (author)

  12. Fabrication and characterization of thick-film piezoelectric lead zirconate titanate ceramic resonators by tape-casting.

    Science.gov (United States)

    Qin, Lifeng; Sun, Yingying; Wang, Qing-Ming; Zhong, Youliang; Ou, Ming; Jiang, Zhishui; Tian, Wei

    2012-12-01

    In this paper, thick-film piezoelectric lead zirconate titanate (PZT) ceramic resonators with thicknesses down to tens of micrometers have been fabricated by tape-casting processing. PZT ceramic resonators with composition near the morphotropic phase boundary and with different dopants added were prepared for piezoelectric transducer applications. Material property characterization for these thick-film PZT resonators is essential for device design and applications. For the property characterization, a recently developed normalized electrical impedance spectrum method was used to determine the electromechanical coefficient and the complex piezoelectric, elastic, and dielectric coefficients from the electrical measurement of resonators using thick films. In this work, nine PZT thick-film resonators have been fabricated and characterized, and two different types of resonators, namely thickness longitudinal and transverse modes, were used for material property characterization. The results were compared with those determined by the IEEE standard method, and they agreed well. It was found that depending on the PZT formulation and dopants, the relative permittivities ε(T)(33)/ε(0) measured at 2 kHz for these thick-films are in the range of 1527 to 4829, piezoelectric stress constants (e(33) in the range of 15 to 26 C/m(2), piezoelectric strain constants (d(31)) in the range of -169 × 10(-12) C/N to -314 × 10(-12) C/N, electromechanical coupling coefficients (k(t)) in the range of 0.48 to 0.53, and k(31) in the range of 0.35 to 0.38. The characterization results shows tape-casting processing can be used to fabricate high-quality PZT thick-film resonators, and the extracted material constants can be used to for device design and application.

  13. Structural investigation of 18-crown-6 complexes of Tri organotin carboxylate by 1H, 13C, 19F and 119Sn nuclear magnetic resonance spectroscopy

    International Nuclear Information System (INIS)

    Foladi, S.; Yousefi, M.; Mohammadpour Ammini, M. M.

    2002-01-01

    Single crystal structure determination of several 18-crown 6 complexes of orga nation derivatives reveals formation of aqua complex through hydrogen bonding to 18-crown-6, which is an important feature in their structure. In the majority of those studies, mono- and dichloro organotin have been used for complexation of them with crown ethers. In the present work, several 18-crown 6 complexes of tri organotin acetate[(C 6 H 5 ) 3 SnOCOCX 3 ] 2 , 18 C6 ], X=F, Cl, and H, have been prepared. The Lewis acidity of tin moiety in tri organotin carboxylate have been tailored by replacing hydrogen atoms of acetate group with chlorine and fluorine and influence of them in the formation of aqua complex with 18 C6 have been studied by infrared. 1 H, 13 C, 19 F and 119 Sn nuclear magnetic resonance spectroscopes. The effects of coordinating and non-coordinating solvent in status of structure in solution have been explored

  14. Nonlinear resonances

    CERN Document Server

    Rajasekar, Shanmuganathan

    2016-01-01

    This introductory text presents the basic aspects and most important features of various types of resonances and anti-resonances in dynamical systems. In particular, for each resonance, it covers the theoretical concepts, illustrates them with case studies, and reviews the available information on mechanisms, characterization, numerical simulations, experimental realizations, possible quantum analogues, applications and significant advances made over the years. Resonances are one of the most fundamental phenomena exhibited by nonlinear systems and refer to specific realizations of maximum response of a system due to the ability of that system to store and transfer energy received from an external forcing source. Resonances are of particular importance in physical, engineering and biological systems - they can prove to be advantageous in many applications, while leading to instability and even disasters in others. The book is self-contained, providing the details of mathematical derivations and techniques invo...

  15. Quantum RLC circuits: Charge discreteness and resonance

    Energy Technology Data Exchange (ETDEWEB)

    Utreras-Diaz, Constantino A. [Instituto de Fisica, Facultad de Ciencias, Universidad Austral de Chile, Campus Isla Teja s/n, Casilla 567, Valdivia (Chile)], E-mail: cutreras@uach.cl

    2008-10-20

    In a recent article [C.A. Utreras-Diaz, Phys. Lett. A 372 (2008) 5059], we have advanced a semiclassical theory of quantum circuits with discrete charge and electrical resistance. In this work, we present a few elementary applications of this theory. For the zero resistance inductive circuit, we obtain the Stark ladder energies in yet another way; for the circuit driven by a combination d.c. plus a.c. electromotive force (emf) we generalize earlier results by Chandia et al. [K. Chandia, J.C. Flores, E. Lazo, Phys. Lett. A 359 (2006) 693]. As a second application, we investigate the effect of electrical resistance and charge discreteness, in the resonance conditions of a series RLC quantum circuit.

  16. Quantum RLC circuits: Charge discreteness and resonance

    International Nuclear Information System (INIS)

    Utreras-Diaz, Constantino A.

    2008-01-01

    In a recent article [C.A. Utreras-Diaz, Phys. Lett. A 372 (2008) 5059], we have advanced a semiclassical theory of quantum circuits with discrete charge and electrical resistance. In this work, we present a few elementary applications of this theory. For the zero resistance inductive circuit, we obtain the Stark ladder energies in yet another way; for the circuit driven by a combination d.c. plus a.c. electromotive force (emf) we generalize earlier results by Chandia et al. [K. Chandia, J.C. Flores, E. Lazo, Phys. Lett. A 359 (2006) 693]. As a second application, we investigate the effect of electrical resistance and charge discreteness, in the resonance conditions of a series RLC quantum circuit

  17. Regenerative feedback resonant circuit

    Science.gov (United States)

    Jones, A. Mark; Kelly, James F.; McCloy, John S.; McMakin, Douglas L.

    2014-09-02

    A regenerative feedback resonant circuit for measuring a transient response in a loop is disclosed. The circuit includes an amplifier for generating a signal in the loop. The circuit further includes a resonator having a resonant cavity and a material located within the cavity. The signal sent into the resonator produces a resonant frequency. A variation of the resonant frequency due to perturbations in electromagnetic properties of the material is measured.

  18. Micromechanical String Resonators: Analytical Tool for Thermal Characterization of Polymers

    DEFF Research Database (Denmark)

    Bose, Sanjukta; Schmid, Silvan; Larsen, Tom

    2014-01-01

    Resonant microstrings show promise as a new analytical tool for thermal characterization of polymers with only few nanograms of sample. The detection of the glass transition temperature (Tg) of an amorphous poly(d,l-lactide) (PDLLA) and a semicrystalline poly(l-lactide) (PLLA) is investigated....... The polymers are spray coated on one side of the resonating microstrings. The resonance frequency and quality factor (Q) are measured simultaneously as a function of temperature. Change in the resonance frequency reflects a change in static tensile stress, which yields information about the Young’s modulus...... of the polymer, and a change in Q reflects the change in damping of the polymer-coated string. The frequency response of the microstring is validated with an analytical model. From the frequency independent tensile stress change, static Tg values of 40.6 and 57.6 °C were measured for PDLLA and PLLA, respectively...

  19. Detailed analysis of the resonant backscattering spectrum for deeply penetrating protons in carbon

    International Nuclear Information System (INIS)

    Tosaki, Mitsuo; Ito, Shin; Maeda, Nobuhiro

    2000-01-01

    In order to study the spectral response in Rutherford backscattering spectroscopy (RBS) for deeply penetrating ions in matter, the resonant backscattering spectra for 5.05-, 5.5- and 6.0-MeV proton incidence on solid carbon material have been measured at a scattering angle of 179.2 deg. (in lab.). Prominent peaks resulting from the sharp 4.8-MeV resonance in 12 C(p,p) 12 C nuclear elastic scattering are observed, even for a penetration depth of 79 μm. Detailed numerical calculations based on an algorithm of straightforward step-by-step evaluation have been made to simulate the observed spectra. The algorithm enables one to rigorously treat both the effect of sharp resonance structure and that of energy-dependent energy loss. Calculations with the SIMNRA code are also made. Through comparison of these calculations with the measured results, some conclusions on the two effects above are presented. In addition, it is demonstrated that the peak profile due to a sharp resonance is very sensitive to the degree of energy straggling

  20. Observation of a resonance in B+ → K+ μ+ μ- decays at low recoil.

    Science.gov (United States)

    Aaij, R; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves, A A; Amato, S; Amerio, S; Amhis, Y; Anderlini, L; Anderson, J; Andreassen, R; Andrews, J E; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Baalouch, M; Bachmann, S; Back, J J; Baesso, C; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bauer, Th; Bay, A; Beddow, J; Bedeschi, F; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M-O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Burducea, I; Bursche, A; Busetto, G; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Castillo Garcia, L; Cattaneo, M; Cauet, Ch; Cenci, R; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Couturier, B; Cowan, G A; Cowie, E; Craik, D C; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; Davis, A; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Del Buono, L; Déléage, N; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dijkstra, H; Dogaru, M; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Durante, P; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fiore, M; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Furfaro, E; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Giubega, L; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gorbounov, P; Gordon, H; Gotti, C; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Griffith, P; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hamilton, B; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Hartmann, T; He, J; Head, T; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hess, M; Hicheur, A; Hicks, E; Hill, D; Hoballah, M; Hombach, C; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jans, E; Jaton, P; Jawahery, A; Jing, F; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Kaballo, M; Kandybei, S; Kanso, W; Karacson, M; Karbach, T M; Kenyon, I R; Ketel, T; Keune, A; Khanji, B; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kurek, K; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J-P; Lefèvre, R; Leflat, A; Lefrançois, J; Leo, S; Leroy, O; Lesiak, T; Leverington, B; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; Lohn, S; Longstaff, I; Lopes, J H; Lopez-March, N; Lu, H; Lucchesi, D; Luisier, J; Luo, H; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Manca, G; Mancinelli, G; Maratas, J; Marconi, U; Marino, P; Märki, R; Marks, J; Martellotti, G; Martens, A; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Martynov, A; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Maurice, E; Mazurov, A; McCarthy, J; McNab, A; McNulty, R; McSkelly, B; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M-N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mordà, A; Morello, M J; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neubert, S; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pal, B K; Palano, A; Palczewski, T; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pescatore, L; Pesen, E; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, A; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pritchard, A; Prouve, C; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Roberts, D A; Rodrigues, E; Rodriguez Perez, P; Roiser, S; Romanovsky, V; Romero Vidal, A; Rouvinet, J; Ruf, T; Ruffini, F; Ruiz, H; Ruiz Valls, P; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salustino Guimaraes, V; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M-H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Sirendi, M; Skidmore, N; Skwarnicki, T; Smith, N A; Smith, E; Smith, J; Smith, M; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stevenson, S; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Sun, L; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urner, D; Ustyuzhanin, A; Uwer, U; Vagnoni, V; Valenti, G; Vallier, A; Van Dijk, M; Vazquez Gomez, R; Vazquez Regueiro, P; Vázquez Sierra, C; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, C; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiechczynski, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wimberley, J; Wishahi, J; Wislicki, W; Witek, M; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhokhov, A; Zhong, L; Zvyagin, A

    2013-09-13

    A broad peaking structure is observed in the dimuon spectrum of B+ → K+ μ+ μ- decays in the kinematic region where the kaon has a low recoil against the dimuon system. The structure is consistent with interference between the B+ → K+ μ+ μ- decay and a resonance and has a statistical significance exceeding six standard deviations. The mean and width of the resonance are measured to be 4191(-8)(+9)  MeV/c2 and 65(-16)(+22)  MeV/c2, respectively, where the uncertainties include statistical and systematic contributions. These measurements are compatible with the properties of the ψ(4160) meson. First observations of both the decay B+ → ψ(4160)K+ and the subsequent decay ψ(4160) → μ+ μ- are reported. The resonant decay and the interference contribution make up 20% of the yield for dimuon masses above 3770  MeV/c2. This contribution is larger than theoretical estimates.

  1. Sample-size resonance, ferromagnetic resonance and magneto-permittivity resonance in multiferroic nano-BiFeO{sub 3}/paraffin composites at room temperature

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Lei; Li, Zhenyu; Jiang, Jia; An, Taiyu; Qin, Hongwei; Hu, Jifan, E-mail: hujf@sdu.edu.cn

    2017-01-01

    In the present work, we demonstrate that ferromagnetic resonance and magneto-permittivity resonance can be observed in appropriate microwave frequencies at room temperature for multiferroic nano-BiFeO{sub 3}/paraffin composite sample with an appropriate sample-thickness (such as 2 mm). Ferromagnetic resonance originates from the room-temperature weak ferromagnetism of nano-BiFeO{sub 3}. The observed magneto-permittivity resonance in multiferroic nano-BiFeO{sub 3} is connected with the dynamic magnetoelectric coupling through Dzyaloshinskii–Moriya (DM) magnetoelectric interaction or the combination of magnetostriction and piezoelectric effects. In addition, we experimentally observed the resonance of negative imaginary permeability for nano BiFeO{sub 3}/paraffin toroidal samples with longer sample thicknesses D=3.7 and 4.9 mm. Such resonance of negative imaginary permeability belongs to sample-size resonance. - Highlights: • Nano-BiFeO{sub 3}/paraffin composite shows a ferromagnetic resonance. • Nano-BiFeO{sub 3}/paraffin composite shows a magneto-permittivity resonance. • Resonance of negative imaginary permeability in BiFeO{sub 3} is a sample-size resonance. • Nano-BiFeO{sub 3}/paraffin composite with large thickness shows a sample-size resonance.

  2. Depolarization due to the resonance tail during a fast resonance jump

    International Nuclear Information System (INIS)

    Ruth, R.D.

    1980-01-01

    The mechanism of depolarization due to a fast resonance jump is studied. The dominant effect for cases of interest is not dependent on the rate of passage through resonance, but rather on the size of the resonance jump as compared to the width, epsilon, of the resonance. The results are applied to a calculation of depolarization in the AGS at Brookhaven National Laboratory

  3. 12C(d,p) 13C reaction at Esub(d) = 30 MeV to the positive-parity states in 13C

    International Nuclear Information System (INIS)

    Ohnuma, H.; Hoshino, N.; Mikoshiba, O.

    1985-07-01

    The 12 C(d, p) 13 C reaction has been studied at Esub(d) = 30 MeV. All the known positive-parity states of 13 C below 10 MeV in excitation energy, including the 7/2 + and 9/2 + states, are observed in this reaction. The angular distributions for these positive-parity bound and unbound states are analyzed in CCBA frame work. The 13 C wave functions, which reproduce the resonant and non-resonant scattering of neutrons from 12 C, also give good accounts of the experimentally observed angular distributions and energy spectra of outgoing protons in the 12 C(d, p) 13 C reaction. In most cases the cross section magnitude and the angular distribution shape are primarily determined by the 0 + x j component, even if it is only a small fraction of the total wave function. An exception is the 7/2 + state, where the main contribution comes from the 2 + x dsub(5/2) component. The inclusion of the 4 + state in 12 C and the gsub(9/2) and gsub(7/2) neutron components in the n + 12 C system has very small effects on the low-spin states, but is indispensable for a good fit to the 7/2 + and 9/2 + angular distributions. The transitions to the negative-parity states, 1/2 1 - , 3/2 1 - , 5/2 - , 7/2 - and 1/2 3 - , are also observed experimentally, and analyzed by DWBA. (author)

  4. Plasmon resonant liposomes for controlled drug delivery

    Science.gov (United States)

    Knights-Mitchell, Shellie S.; Romanowski, Marek

    2015-03-01

    Nanotechnology use in drug delivery promotes a reduction in systemic toxicity, improved pharmacokinetics, and better drug bioavailability. Liposomes continue to be extensively researched as drug delivery systems (DDS) with formulations such as Doxil® and Ambisome® approved by FDA and successfully marketed in the United States. However, the limited ability to precisely control release of active ingredients from these vesicles continues to challenge the broad implementation of this technology. Moreover, the full potential of the carrier to sequester drugs until it can reach its intended target has yet to be realized. Here, we describe a liposomal DDS that releases therapeutic doses of an anticancer drug in response to external stimulus. Earlier, we introduced degradable plasmon resonant liposomes. These constructs, obtained by reducing gold on the liposome surface, facilitate spatial and temporal release of drugs upon laser light illumination that ultimately induces an increase in temperature. In this work, plasmon resonant liposomes have been developed to stably encapsulate and retain doxorubicin at physiological conditions represented by isotonic saline at 37o C and pH 7.4. Subsequently, they are stimulated to release contents either by a 5o C increase in temperature or by laser illumination (760 nm and 88 mW/cm2 power density). Successful development of degradable plasmon resonant liposomes responsive to near-infrared light or moderate hyperthermia can provide a new delivery method for multiple lipophilic and hydrophilic drugs with pharmacokinetic profiles that limit clinical utility.

  5. Nqrs Data for C3H2Cl10N2PSb[C3HCl4N2P·Cl6HSb](Subst. No. 0601)

    Science.gov (United States)

    Chihara, H.; Nakamura, N.

    This document is part of Subvolume A `Substances Containing Ag … C10H15' of Volume 48 `Nuclear Quadrupole Resonance Spectroscopy Data' of Landolt-Börnstein - Group III `Condensed Matter'. It contains an extract of Section `3.2 Data tables' of the Chapter `3 Nuclear quadrupole resonance data' providing the NQRS data for C3H2Cl10N2PSb [C3HCl4N2P·Cl6HSb] (Subst. No. 0601)

  6. Search for jet-jet resonances in association with a leptonic W decay at the ATLAS experiment

    CERN Document Server

    Nuti, Francesco

    2012-01-01

    The analysis presented in this thesis addresses the study of two processes that share the same signature: the diboson $WW/WZ$ semileptonic decay and a jet-jet resonance with an invariant mass equal to $145~GeV/c^{2}$ produced in association with a $W$. In both cases the leptonic decay of the W is identified as an energetic electron or muon along with missing transverse energy forming a transverse mass~($M_{T}$) consistent with that one produced by the $W$ boson. The hadronically decaying $W/Z$ or the resonance at $145~GeV/c^{2}$ are searched in the jet-jet invariant mass distribution after a selection based on the event kinematics. The resonance at $145~GeV/c^{2}$ has been observed in April 2011 by the CDF detector at the Tevatron collider with a significance of $4.1$ standard deviations and is not predicted by Standard Model. Therefore it is important to determine the presence of this signal in other experiments and this thesis investigates the possibility to reveal the same resonance in data collected by ...

  7. Method to obtain resonances and virtual states

    International Nuclear Information System (INIS)

    Adhikari, S.K.; Fonseca, A.C.; Tomio, L.

    1982-01-01

    A naive method is proposed for the calculation of resonance position and-residue at low energies and of virtual states localized in the non-physical sheet associated to the lowest threshold of two body breaking. This method is applied to the study of some virtual states of the few nucleon system. (L.C.) [pt

  8. Resonance – Journal of Science Education | News

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 13; Issue 4. Issue front cover thumbnail Issue back cover thumbnail. Volume 13, Issue 4. April 2008 ... K R Y Simha Dhruv C Hoysall · More Details Fulltext PDF. pp 394-397 Think It Over. Solution to How Many Birds are Unwatched · Soubhik Chakraborty.

  9. Narrow dibaryon resonances

    International Nuclear Information System (INIS)

    Kajdalov, A.B.

    1986-01-01

    Experimental data on np interactions indicating to existence of narrow resonances in pp-system are discussed. Possible theoretical interpretations of these resonances are given. Experimental characteristics of the dibaryon resonances with isospin I=2 are considered

  10. Electron spin resonance and its application to heat treated carbonaceous materials

    International Nuclear Information System (INIS)

    Emmerich, Francisco Guilherme

    1993-01-01

    This work presents the basic characteristics of the electron spin resonance technique, also called paramagnetic resonance, being discussed its application to heat treated carbonaceous materials. In the low heat treatment temperature (HTT) range (below 700 deg C) the organic free radical are the predominant unpaired spin center, which play a key role in the process of carbonization and meso phase formation. At higher temperatures, it is possible to make correlations between the low H T T range and the high HTT range (above 130 deg C), where the predominant unpaired spin center are the free charge carriers (free electrons) of the graphite like crystallites of the material, which are formed by the carbonization process. (author)

  11. Search for the eta C

    International Nuclear Information System (INIS)

    Garren, L.A.

    1982-01-01

    In an experiment performed at the Alternating Gradient Synchrotron at Brookhaven National Laboratory, we searched for narrow resonances in the reaction pi minus p -> X n, X -> gamma gamma at 13 GeV. We used a double-arm spectrometer with lead glass and scintillation elements. No resonances were observed above mass 2.8 in the gamma-gamma spectrum. The upper limit for the eta c cross section times branching ratio is 23 pb

  12. Decay of a Jπ=36+ Resonance in the 24Mg+24Mg Reaction

    International Nuclear Information System (INIS)

    Salsac, M.-D.; Haas, F.; Courtin, S.

    2005-01-01

    For the 24 Mg+ 24 Mg reaction, striking narrow and correlated resonance structures have been observed previously in the excitation functions of the elastic and low-lying channels. In our study we have decided to focus on the resonance at E C M =45.7 MeV, which is known to have J π =36 + . Despite the very high excitation energy(∼60 MeV) in the 48 Cr composite system, this resonance has a narrow total width of 170 keV. To determine precisely which states in the inelastic 24 Mg channels carry away the resonance flux, an experiment, on the 24 Mg + 24 Mg reaction at energies On and OFF resonance, has been performed at the Legnaro Tandem accelerator using the Prisma fragment spectrometer associated with the CLARA γ array

  13. Resonance cones below the ion cyclotron frequency: theory and experiment

    International Nuclear Information System (INIS)

    Bellan, P.

    1976-03-01

    The resonance cones existing below the ion cyclotron frequency, ω/sub c/sub i//, are shown, theoretically and experimentally, to be the asymptotes of hyperbolic constant-phase surfaces of low-frequency ion acoustic waves. Above ω/sub c/sub i// the surfaces transform into ellipses that are related to the electrostatic ion cyclotron waves and ion acoustic waves

  14. Comments, with reply, on 'Parallel resonant converter with LLC-type commutation' by C. Q. Lee et al.

    Science.gov (United States)

    Hamill, David C.

    1991-05-01

    In a recent paper by Lee et al. (1989), the authors analyzed a DC-DC converter that they termed the LLC-type PRC (parallel resonant converter). Its resonant network contains three active components-two inductances and a parallel capacitance -and as a consequence the the converter might be expected to have third-order dynamics. But Lee et al. employed a matrix transformation to show that the behavior of the circuit may be represented as a state-plane trajectory, as for a second-order circuit. The purpose of this contribution is to show that the converter has a zero-frequency eigenvalue, associated with undesirable circulating DC. The second-order dynamics exhibited by the third-order converter are explained by an application of Thevenin's theorem. Some aerospace applications of the LLC-type parallel resonant converter (PRC) are discussed. In their reply, the authors show that the circulating direct current does not exist in the practical converter circuit.

  15. A microwave resonance dew-point hygrometer

    Science.gov (United States)

    Underwood, R. J.; Cuccaro, R.; Bell, S.; Gavioso, R. M.; Madonna Ripa, D.; Stevens, M.; de Podesta, M.

    2012-08-01

    We report the first measurements of a quasi-spherical microwave resonator used as a dew-point hygrometer. In conventional dew-point hygrometers, the condensation of water from humid gas flowing over a mirror is detected optically, and the mirror surface is then temperature-controlled to yield a stable condensed layer. In our experiments we flowed moist air from a humidity generator through a quasi-spherical resonator and detected the onset of condensation by measuring the frequency ratio of selected microwave modes. We verified the basic operation of the device over the dew-point range 9.5-13.5 °C by comparison with calibrated chilled-mirror hygrometers. These tests indicate that the microwave method may allow a quantitative estimation of the volume and thickness of the water layer which is condensed on the inner surface of the resonator. The experiments reported here are preliminary due to the limited time available for the work, but show the potential of the method for detecting not only water but a variety of other liquid or solid condensates. The robust all-metal construction should make the device appropriate for use in industrial applications over a wide range of temperatures and pressures.

  16. A microwave resonance dew-point hygrometer

    International Nuclear Information System (INIS)

    Underwood, R J; Bell, S; Stevens, M; De Podesta, M; Cuccaro, R; Gavioso, R M; Ripa, D Madonna

    2012-01-01

    We report the first measurements of a quasi-spherical microwave resonator used as a dew-point hygrometer. In conventional dew-point hygrometers, the condensation of water from humid gas flowing over a mirror is detected optically, and the mirror surface is then temperature-controlled to yield a stable condensed layer. In our experiments we flowed moist air from a humidity generator through a quasi-spherical resonator and detected the onset of condensation by measuring the frequency ratio of selected microwave modes. We verified the basic operation of the device over the dew-point range 9.5–13.5 °C by comparison with calibrated chilled-mirror hygrometers. These tests indicate that the microwave method may allow a quantitative estimation of the volume and thickness of the water layer which is condensed on the inner surface of the resonator. The experiments reported here are preliminary due to the limited time available for the work, but show the potential of the method for detecting not only water but a variety of other liquid or solid condensates. The robust all-metal construction should make the device appropriate for use in industrial applications over a wide range of temperatures and pressures. (paper)

  17. Anisotropy in semipolar InGaN laser diodes: Consequences for resonator design and facet formation

    Energy Technology Data Exchange (ETDEWEB)

    Rass, Jens; Vogt, Patrick [Technische Universitaet Berlin (Germany). Institute of Solid State Physics; Wernicke, Tim; John, Wilfred; Einfeldt, Sven; Weyers, Markus [Ferdinand-Braun-Institut fuer Hoechstfrequenztechnik, Berlin (Germany); Kneissl, Michael [Technische Universitaet Berlin (Germany). Institute of Solid State Physics; Ferdinand-Braun-Institut fuer Hoechstfrequenztechnik, Berlin (Germany)

    2010-07-01

    For InAlGaN-based light emitting devices on nonpolar and semipolar substrate orientations the polarization fields can be reduced. Birefringence and gain anisotropy influence the optical modes of semipolar separate confinement hetero structures. We have investigated the threshold for amplified spontaneous emission and the optical polarization state of the eigenmodes for laser resonators with different orientations on various semipolar and nonpolar substrates. We found that semipolar resonators along the projection of the c-axis onto the surface have a lower threshold and the light is TE-polarized. Nonpolar resonators perpendicular to the c-axis on the other hand have elevated thresholds and hence a lower gain as well as a tilted linear optical polarization with the electric field nearly parallel to the c-axis of the crystal. In order to obtain devices with low threshold and maximum performance, laser resonators on semipolar substrates have to be oriented along the semipolar orientation, posing a challenge for the fabrication of laser facets. Technologies such as laser assisted cleaving, chemical dry etching and wet chemical post processing are presented and their suitability for the generation of smooth vertical facets is discussed.

  18. Applied neutron resonance theory

    International Nuclear Information System (INIS)

    Froehner, F.H.

    1980-01-01

    Utilisation of resonance theory in basic and applications-oriented neutron cross section work is reviewed. The technically important resonance formalisms, principal concepts and methods as well as representative computer programs for resonance parameter extraction from measured data, evaluation of resonance data, calculation of Doppler-broadened cross sections and estimation of level-statistical quantities from resonance parameters are described. (author)

  19. RCNP E398 {sup 16}O,{sup 12}C(p,p’) experiment: Measurement of the γ-ray emission probability from giant resonances in relation to {sup 16}O,{sup 12}C(ν,ν’) reactions

    Energy Technology Data Exchange (ETDEWEB)

    Ou, I.; Yamada, Y.; Mori, T.; Yano, T.; Sakuda, M. [Department of Physics, Okayama University, Okayama 700-8530 (Japan); Tamii, A.; Suzuki, T.; Yosoi, M.; Aoi, N.; Ideguchi, E.; Hashimoto, T.; Miki, K.; Ito, T.; Iwamoto, C.; Yamamoto, T. [Research Center for Nuclear Physics (RCNP), Osaka University, Ibaraki, Osaka 567-0047 (Japan); Akimune, H. [Department of Physics, Konan University, Okamoto 8-9-1, Higashinada, Kobe 658-8501 (Japan)

    2015-05-15

    We propose to measure the γ-ray emission probability from excited states above 5 MeV including giant resonance of {sup 16}O and {sup 12}C as a function of excitation energy in 1-MeV step. Here, we measure both the excitation energy (E{sub x}=5-30MeV) at the forward scattering angles (0°-3°) of the {sup 16}O, {sup 12}C (p, p’) reaction using Grand-Raiden Spectrometer and the energy of γ-rays (E{sub γ}) using an array of NaI(Tl) counters. The purpose of the experiment is to provide the basic and important information not only for the γ-ray production from primary neutral-current neutrino-oxygen (-carbon) interactions but also for that from the secondary hadronic (neutron-oxygen and -carbon) interactions.

  20. The α-helical C-terminal domain of full-length recombinant PrP converts to an in-register parallel β-sheet structure in PrP fibrils: evidence from solid state nuclear magnetic resonance.

    Science.gov (United States)

    Tycko, Robert; Savtchenko, Regina; Ostapchenko, Valeriy G; Makarava, Natallia; Baskakov, Ilia V

    2010-11-09

    We report the results of solid state nuclear magnetic resonance (NMR) measurements on amyloid fibrils formed by the full-length prion protein PrP (residues 23−231, Syrian hamster sequence). Measurements of intermolecular 13C−13C dipole−dipole couplings in selectively carbonyl-labeled samples indicate that β-sheets in these fibrils have an in-register parallel structure, as previously observed in amyloid fibrils associated with Alzheimer’s disease and type 2 diabetes and in yeast prion fibrils. Two-dimensional 13C−13C and 15N−13C solid state NMR spectra of a uniformly 15N- and 13C-labeled sample indicate that a relatively small fraction of the full sequence, localized to the C-terminal end, forms the structurally ordered, immobilized core. Although unique site-specific assignments of the solid state NMR signals cannot be obtained from these spectra, analysis with a Monte Carlo/simulated annealing algorithm suggests that the core is comprised primarily of residues in the 173−224 range. These results are consistent with earlier electron paramagnetic resonance studies of fibrils formed by residues 90−231 of the human PrP sequence, formed under somewhat different conditions [Cobb, N. J., Sonnichsen, F. D., McHaourab, H., and Surewicz, W. K. (2007) Proc. Natl. Acad. Sci. U.S.A. 104, 18946−18951], suggesting that an in-register parallel β-sheet structure formed by the C-terminal end may be a general feature of PrP fibrils prepared in vitro.

  1. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 11; Issue 4. The Work of Lagrange in Number Theory and Algebra. Dilip P Patil C R Pranesachar Renuka Ravindran. General Article Volume 11 Issue 4 April 2006 pp 10-25 ...

  2. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 11; Issue 10. Mathematical Contributions of Archimedes: Some Nuggets. C S Yogananda. General Article Volume 11 Issue 10 October 2006 pp 8-17. Fulltext. Click here to view fulltext PDF. Permanent link:

  3. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 15; Issue 9. Symmetry Principles and Conservation Laws in Atomic and Subatomic Physics – 1. P C Deshmukh J Libby. General Article Volume 15 Issue 9 September 2010 pp 832-842 ...

  4. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 15; Issue 10. Symmetry Principles and Conservation Laws in Atomic and Subatomic Physics – 2. P C Deshmukh J Libby. General Article Volume 15 Issue 10 October 2010 pp 926-940 ...

  5. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 3. Learning Earthquake Design and Construction 16. How to make Stone Masonry Buildings Earthquake Resistant? C V R Murty. Classroom Volume 10 Issue 3 March 2005 pp 92-95 ...

  6. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 2. Learning Earthquake Design and Construction 14. Why are Horizontal Bands Necessary in Masonry Buildings? C V R Murty. Classroom Volume 10 Issue 2 February 2005 pp 83-85 ...

  7. Starting from August 2004, Resonance is publishing in the ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 3. Learning Earthquake Design and Construction 15. Why is Vertical Reinforcement Required in Masonry Buildings? C V R Murty. Classroom Volume 10 Issue 3 March 2005 pp 88-91 ...

  8. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 4. Learning Earthquake Design and Construction - 17. How do Earthquakes Affect Reinforced Concrete Buildings? C V R Murty. Classroom Volume 10 Issue 4 April 2005 pp 83-86 ...

  9. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 10. Learning Earthquake Design and Construction – Why are Short Columns more Damaged During Earthquakes? C V R Murty. Classroom Volume 10 Issue 10 October 2005 pp 88-91 ...

  10. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 6. Learning Earthquake Design and Construction – How do Columns in RC Buildings Resist Earthquakes? C V R Murty. Classroom Volume 10 Issue 6 June 2005 pp 78-81 ...

  11. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 9; Issue 10. Learning Earthquake Design and Construction – 6. How Architectural Features Affect Building During Earthquakes? C V R Murty. Classroom Volume 9 Issue 10 October 2004 pp 82-85 ...

  12. High temperature energy harvesters utilizing ALN/3C-SiC composite diaphragms

    Science.gov (United States)

    Lai, Yun-Ju; Li, Wei-Chang; Felmetsger, Valery V.; Senesky, Debbie G.; Pisano, Albert P.

    2014-06-01

    Microelectromechanical systems (MEMS) energy harvesting devices aiming at powering wireless sensor systems for structural health monitoring in harsh environments are presented. For harsh environment wireless sensor systems, sensor modules are required to operate at elevated temperatures (> 250°C) with capabilities to resist harsh chemical conditions, thereby the use of battery-based power sources becomes challenging and not economically efficient if considering the required maintenance efforts. To address this issue, energy harvesting technology is proposed to replace batteries and provide a sustainable power source for the sensor systems towards autonomous harsh environment wireless sensor networks. In particular, this work demonstrates a micromachined aluminum nitride/cubic silicon carbide (AlN/3C-SiC) composite diaphragm energy harvester, which enables high temperature energy harvesting from ambient pulsed pressure sources. The fabricated device yields an output power density of 87 μW/cm2 under 1.48-psi pressure pulses at 1 kHz while connected to a 14.6-kΩ load resistor. The effects of pulse profile on output voltage have been studied, showing that the output voltage can be maximized by optimizing the diaphragm resonance frequency based on specific pulse characteristics. In addition, temperature dependence of the diaphragm resonance frequency over the range of 20°C to 600°C has been investigated and the device operation at temperatures as high as 600°C has been verified.

  13. Applied neutron resonance theory

    International Nuclear Information System (INIS)

    Froehner, F.H.

    1978-07-01

    Utilisation of resonance theory in basic and applications-oriented neutron cross section work is reviewed. The technically important resonance formalisms, principal concepts and methods as well as representative computer programs for resonance parameter extraction from measured data, evaluation of resonance data, calculation of Doppler-broadened cross sections and estimation of level-statistical quantities from resonance parameters are described. (orig.) [de

  14. Dereplication of depsides from the lichen Pseudevernia furfuracea by centrifugal partition chromatography combined to 13C nuclear magnetic resonance pattern recognition

    International Nuclear Information System (INIS)

    Oettl, Sarah K.; Hubert, Jane; Nuzillard, Jean-Marc; Stuppner, Hermann; Renault, Jean-Hugues; Rollinger, Judith M.

    2014-01-01

    Highlights: • The major depsides of a lichen extract were directly identified within mixtures. • The initial extract was rapidly fractionated by CPC in the pH-zone refining mode. • Hierarchical clustering of 13 C NMR signals resulted in the identification of depside molecular skeletons. • 13 C chemical shift clusters were assigned to structures using a 13 C NMR database. • Six depsides were unambiguously identified by this approach. - Abstract: Lichens produce a diversity of secondary metabolites, among them depsides comprised of two or more hydroxybenzoic acid units linked by ester, ether, or C-C-bonds. During classic solid support-based purification processes, depsides are often hydrolyzed and in many cases time, consuming procedures result only in the isolation of decomposition products. In an attempt to avoid extensive purification steps while maintaining metabolite structure integrity, we propose an alternative method to identify the major depsides of a lichen crude extract (Pseudevernia furfuracea var. ceratea (Ach.) D. Hawksw., Parmeliaceae) directly within mixtures. Exploiting the acidic character of depsides and differences in polarity, the extract was fractionated by centrifugal partition chromatography in the pH-zone refining mode resulting in twelve simplified mixtures of depsides. After 13 C nuclear magnetic resonance analysis of the produced fractions, the major molecular structures were directly identified within the fraction series by using a recently developed pattern recognition method, which combines spectral data alignment and hierarchical clustering analysis. The obtained clusters of 13 C chemical shifts were assigned to their corresponding molecular structures with the help of an in-house 13 C NMR chemical shift database, resulting in six unambiguously identified compounds, namely methyl β-orcinolcarboxylate (1), atranorin (2), 5-chloroatranorin (3), olivetol carboxylic acid (4), olivetoric acid (5), and olivetonide (6)

  15. Far from Equilibrium Percolation, Stochastic and Shape Resonances in the Physics of Life

    Directory of Open Access Journals (Sweden)

    Antonio Bianconi

    2011-10-01

    Full Text Available Key physical concepts, relevant for the cross-fertilization between condensed matter physics and the physics of life seen as a collective phenomenon in a system out-of-equilibrium, are discussed. The onset of life can be driven by: (a the critical fluctuations at the protonic percolation threshold in membrane transport; (b the stochastic resonance in biological systems, a mechanism that can exploit external and self-generated noise in order to gain efficiency in signal processing; and (c the shape resonance (or Fano resonance or Feshbach resonance in the association and dissociation processes of bio-molecules (a quantum mechanism that could play a key role to establish a macroscopic quantum coherence in the cell.

  16. Transport and magnetic resonance in normal and superfluid Fermi liquids

    International Nuclear Information System (INIS)

    Smith, H.

    1976-10-01

    This thesis provides a framework for a series of 19 papers published by the author in a study of transport and magnetic resonance in normal and superfluid Fermi liquids. The Boltzmann equation and methods for its solution are discussed. Electron-electron scattering in metals, with particular emphasis on alkali metals, is considered. Transport in a normal uncharged Fermi liquid such as pure 3 He at temperatures well below its degeneracy temperature of approximately 1 K or mixtures of 3 He in 4 He with degeneracy temperatures ranging typically from 100 to 200 mk is discussed with emphasis on comparison with experiments with the aim of testing models of the particle-particle scattering amplitude. Transport and magnetic resonance in superfluid 3 He is considered. The phenomenological treatment of relaxation is reviewed and the magnitude of the phenomenlogical relaxation time close to Tsub(c) is derived for the case of longitudinal resonance. Comments are made on non-linear magnetic resonance and textures and spin waves. (B.R.H.)

  17. Cellular applications of 31P and 13C nuclear magnetic resonance

    International Nuclear Information System (INIS)

    Shulman, R.G.; Brown, T.R.; Ugurbil, K.; Ogawa, S.; Cohen, S.M.; den Hollander, J.A.

    1979-01-01

    High-resolution nuclear magnetic resonance (NMR) studies of cells and purified mitochondria are discussed to show the kind of information that can be obtained in vivo. In suspensions of Escherichia coli both phosphorus-31 and carbon-13 NMR studies of glycolysis of bioenergetics are presented. In rat liver cells the pathways of gluconeogenesis from carbon-13-labeled glycerol are followed by carbon-13 NMR. In the intact liver cells cytosolic and mitochondrial pH's were separately measured by phosphorus-31 NMR. In purified mitochondria the internal and external concentrations of inorganic phosphate, adenosine diphosphate, and adenosine triphosphate were determined by phosphorus-31 while the pH difference across the membrane was measured simultaneously

  18. A deuterium and carbon nuclear magnetic resonance spectroscopic investigation of blood flow and carbohydrate metabolism

    International Nuclear Information System (INIS)

    Bosch, C.S.E.

    1988-01-01

    The purpose of this study is the development and application of nuclear magnetic resonance (NMR) spectroscopic techniques for this study of whole tissue metabolism, tissue perfusion and blood flow. The feasibility of spin imaging deuterium-enriched tissue water is demonstrated in cat brain in vivo and in situ. The potential application of D 2 O administration to deuterium-flow-imaging is considered. NMR investigations of hepatic carbohydrate metabolism were performed in rat liver in vivo and in situ. A coaxial, double-surface-coil, double-resonance probe was developed for carbon detection while decoupling neighboring proton scalar interactions ( 13 C-[ 1 H]) in hepatic tissue within the living animal. Hormonal and substrate regulation of hepatic glucose and glycogen metabolism was investigated by monitoring the metabolic fate of an administered c-dose of [1- 13 C]glucose. Label flux was directed primarily into newly-synthesized 13 C-labeled glycogen. A multiple resonance ( 1 H, 13 C, 31 P) liver perfusion probe was designed for complimentary carbohydrate metabolic studies in rat liver in vitro. A description of the 13 C-[ 1 H]/ 31 P NMR perfusion probe is given. The surgical technique used for liver excision and peripheral life-support apparatus required to maintain hepatic function are also detailed

  19. The magnetic resonance spectroscopy analysis for fatty acid of cooking oil

    Energy Technology Data Exchange (ETDEWEB)

    Yu, Seung Man [Dept. of Radiological Science, College of Health Science, Gimcheon University, Gimcheon (Korea, Republic of)

    2016-11-15

    The aim of this study was to evaluate possibility for chemical changes analysis of the Soybean and Olive oil using a medical magnetic resonance imaging/spectrometer. The two edible oils including soybean and olive oil were selected for manufacturing the phantom series. For the acquisition of data without any physical environment change, 5 ml was transferred to a sealed plastic vial. All MRI and 1H-MRS experiments were performed on a 3.0 Tesla MRI scanner using a 32-channel brain array coil. The total lipid ((-CH2-)n/noise), total saturated fatty acid, total unsaturated fatty acid, total unsaturated bond, and poly unsaturated bond were quantified by separating each peak area of -CH{sub 3}, (-CH{sub 2}-)n, -CH{sub 2}-C=C-CH{sub 2}-, =C-CH{sub 2}-C=, and -CH=CH-byCH{sub 3} by MRS analysis. Soybean oil had the highest concentration of methyl protons and methane protons, expressed as 0.9 and 5.3 ppm compared to olive oil. However, its methylene protons at 1.3 ppm were the lowest. Olive oil had the highest amount of methylene protons and allylic protons and the lowest amount of methyl protons. Through the magnetic resonance spectroscopic analysis it was to analyze the chemical characteristics of Olive oil and soybean oil. And it was confirmed that it is possible to proceed to an extended study using magnetic resonance spectroscopy.

  20. Extraordinary optical transmission with tapered slits: effect of higher diffraction and slit resonance orders

    DEFF Research Database (Denmark)

    Sondergaard, T.; Bozhevolnyi, S. I.; Beermann, J.

    2012-01-01

    Transmission through thin metal films with a periodic arrangement of tapered slits is considered. Transmission maps covering a wide range of periods, film thicknesses, and taper angles are presented. The maps show resonant transmission when fundamental and higher-order slit resonances are excited...... to be in the range of 6 degrees-10 degrees. Both theory and experiments show split-peak spectra and shifted-peak spectra due to interference between a slit resonance and Rayleigh-Wood anomalies. (C) 2011 Optical Society of America...

  1. Resonant snubber inverter

    Science.gov (United States)

    Lai, Jih-Sheng; Young, Sr., Robert W.; Chen, Daoshen; Scudiere, Matthew B.; Ott, Jr., George W.; White, Clifford P.; McKeever, John W.

    1997-01-01

    A resonant, snubber-based, soft switching, inverter circuit achieves lossless switching during dc-to-ac power conversion and power conditioning with minimum component count and size. Current is supplied to the resonant snubber branches solely by the main inverter switches. Component count and size are reduced by use of a single semiconductor switch in the resonant snubber branches. Component count is also reduced by maximizing the use of stray capacitances of the main switches as parallel resonant capacitors. Resonance charging and discharging of the parallel capacitances allows lossless, zero voltage switching. In one embodiment, circuit component size and count are minimized while achieving lossless, zero voltage switching within a three-phase inverter.

  2. Can doubly strange dibaryon resonances be discovered at RHIC?

    International Nuclear Information System (INIS)

    Paganis, S. D.; Hoffmann, G. W.; Ray, R. L.; Tang, J.-L.; Udagawa, T.; Longacre, R. S.

    2000-01-01

    The baryon-baryon continuum invariant mass spectrum generated from relativistic nucleus + nucleus collision data may reveal the existence of doubly strange dibaryons not stable against strong decay if they lie within a few MeV of threshold. Furthermore, since the dominant component of these states is a superposition of two color-octet clusters which can be produced intermediately in a color-deconfined quark-gluon plasma (QGP), an enhanced production of dibaryon resonances could be a signal of QGP formation. A total of eight, doubly strange dibaryon states are considered for experimental search using the STAR detector (solenoidal tracker at RHIC) at the new Relativistic Heavy Ion Collider (RHIC). These states may decay to ΛΛ and/or pΞ - , depending on the resonance energy. STAR's large acceptance, precision tracking and vertex reconstruction capabilities, and large data volume capacity, make it an ideal instrument to use for such a search. Detector performance and analysis sensitivity are studied as a function of resonance production rate and width for one particular dibaryon which can directly strong decay to pΞ - , but not ΛΛ. Results indicate that such resonances may be discovered using STAR if the resonance production rates are comparable to coalescence model predictions for dibaryon bound states. (c) 2000 The American Physical Society

  3. Resonance

    DEFF Research Database (Denmark)

    Petersen, Nils Holger

    2014-01-01

    A chapter in a book about terminology within the field of medievalism: the chapter discusses the resonance of medieval music and ritual in modern (classical) music culture and liturgical practice.......A chapter in a book about terminology within the field of medievalism: the chapter discusses the resonance of medieval music and ritual in modern (classical) music culture and liturgical practice....

  4. Some properties of the psi(3.7) resonance, and features of the total hadronic cross section in e+e- annihilation from 2.4 GeV to 5.0 GeV c.m. energy

    International Nuclear Information System (INIS)

    Kadyk, J.A.; Abrams, G.S.; Briggs, D.D.

    1975-01-01

    An analysis of data at the psi(3.7) resonance gives a partial width to electrons, MMA ub e/ = 2.2 +- 0.5 keV, and limits on total width 200 keV + π - is observed with a branching ratio 0.31 +- 0.04, and psi(3.7) → psi(3.1) + anything has a branching ratio of 0.54 +- 0.08. The psi resonances appear to have the same G-parity. An enhancement occurs in the total hadronic cross section at a c.m. energy of about 4.1 GeV, rising to about 32 nb from a level of 18 nb adjacent to peak, which is about 300 MeV wide. The integrated cross section for the peak is about 5.5 nb-GeV, comparable to that for the psi(3.7) and psi(3.1) resonances. (U.S.)

  5. Some properties of the psi(3.7) resonance, and features of the total hadronic cross section in e+e- annihilation from 2.4GeV to 5.0GeV c.m. energy

    International Nuclear Information System (INIS)

    Abrams, G.S.; Briggs, D.D.; Chinowsky, W.; Friedberg, C.E.; Goldhaber, G.; Hollebeek, R.J.; Litke, A.; Lulu, B.A.; Pierre, F.; Sadoulet, B.; Trilling, G.H.; Whitaker, J.S.; Wiss, J.E.; Zipse, J.E.

    1975-01-01

    An analysis of data at the psi(3.7) resonance gives a partial width to electrons GAMMA(e)=2.2+-0.5keV, and limits on total width 200keV + π - is observed with a branching ratio 0.31+-0.04, and psi(3.7)→psi(3.1) + anything has a branching ratio of 0.54+-0.08. The psi resonances appear to have the same G-parity. An enhancement occurs in the total hadronic cross section at a c.m. energy of about 4.1GeV, rising to about 32nb from a level of 18nb adjacent to peak, which is about 300MeV wide. The integrated cross section for the peak is about 5.5nb-GeV, comparable to that for the psi(3.7) and psi(3.1) resonances

  6. Theoretical model and optimization of a novel temperature sensor based on quartz tuning fork resonators

    International Nuclear Information System (INIS)

    Xu Jun; You Bo; Li Xin; Cui Juan

    2007-01-01

    To accurately measure temperatures, a novel temperature sensor based on a quartz tuning fork resonator has been designed. The principle of the quartz tuning fork temperature sensor is that the resonant frequency of the quartz resonator changes with the variation in temperature. This type of tuning fork resonator has been designed with a new doubly rotated cut work at flexural vibration mode as temperature sensor. The characteristics of the temperature sensor were evaluated and the results sufficiently met the target of development for temperature sensor. The theoretical model for temperature sensing has been developed and built. The sensor structure was analysed by finite element method (FEM) and optimized, including tuning fork geometry, tine electrode pattern and the sensor's elements size. The performance curve of output versus measured temperature is given. The results from theoretical analysis and experiments indicate that the sensor's sensitivity can reach 60 ppm 0 C -1 with the measured temperature range varying from 0 to 100 0 C

  7. Multiple photon resonances

    International Nuclear Information System (INIS)

    Elliott, C.J.; Feldman, B.J.

    1979-02-01

    A detailed theoretical analysis is presented of the interaction of intense near-resonant monochromatic radiation with an N-level anharmonic oscillator. In particular, the phenomenon of multiple photon resonance, the process by which an N-level system resonantly absorbs two or more photons simultaneously, is investigated. Starting from the Schroedinger equation, diagrammatic techniques are developed that allow the resonant process to be analyzed quantitatively, in analogy with well-known two-level coherent phenomena. In addition, multiple photon Stark shifts of the resonances, shifts absent in two-level theory, are obtained from the diagrams. Insights into the nature of multiple photon resonances are gained by comparing the quantum mechanical system with classical coupled pendulums whose equations of motion possess identical eigenvalues and eigenvectors. In certain limiting cases, including that of the resonantly excited N-level harmonic oscillator and that of the equally spaced N-level system with equal matrix elements, analytic results are derived. The influence of population relaxation and phase-disrupting collisions on the multiple photon process are also analyzed, the latter by extension of the diagrammatic technique to the density matrix equations of motion. 11 figures

  8. (1)H, (13)C, and (15)N backbone resonance assignments of the full-length 40 kDa S. acidocaldarius Y-family DNA polymerase, dinB homolog.

    Science.gov (United States)

    Moro, Sean L; Cocco, Melanie J

    2015-10-01

    The dinB homolog (Dbh) is a member of the Y-family of translesion DNA polymerases, which are specialized to accurately replicate DNA across from a wide variety of lesions in living cells. Lesioned bases block the progression of high-fidelity polymerases and cause detrimental replication fork stalling; Y-family polymerases can bypass these lesions. The active site of the translesion synthesis polymerase is more open than that of a replicative polymerase; consequently Dbh polymerizes with low fidelity. Bypass polymerases also have low processivity. Short extension past the lesion allows the high-fidelity polymerase to switch back onto the site of replication. Dbh and the other Y-family polymerases have been used as structural models to investigate the mechanisms of DNA polymerization and lesion bypass. Many high-resolution crystal structures of Y-family polymerases have been reported. NMR dynamics studies can complement these structures by providing a measure of protein motions. Here we report the (15)N, (1)H, and (13)C backbone resonance assignments at two temperatures (35 and 50 °C) for Sulfolobus acidocaldarius Dbh polymerase. Backbone resonance assignments have been obtained for 86 % of the residues. The polymerase active site is assigned as well as the majority of residues in each of the four domains.

  9. Electron spin resonance probed competing states in NiMnInSi Heusler alloy

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Y.S. [Center for Condensed Matter Sciences, National Taiwan University, Taipei 10617, Taiwan (China); Lin, J.G., E-mail: jglin@ntu.edu.tw [Center for Condensed Matter Sciences, National Taiwan University, Taipei 10617, Taiwan (China); Titov, I.S.; Granovsky, A.B. [Faculty of Physics, Lomonosov Moscow State University, Vorob' evy Gory, 11999l Moscow (Russian Federation)

    2016-06-01

    Shape memory Heusler alloy Ni{sub 50}Mn{sub 35}In{sub 12}Si{sub 3} is investigated with electron spin resonance (ESR) technique in a temperature range of 200–300 K. ESR is a dynamic probe allowing us to separate the responses from various magnetic phases, thus to study the complex phase transitions. The sample shows three transition temperatures: T{sub c}{sup A} (271 K), T{sub M} (247 K) and T{sub c}{sup M} (212 K), where T{sub c}{sup A} is the Curie temperature of austenitic phase, T{sub M} and T{sub c}{sup M} are the temperatures of magnetostructural martensitic transition and the Curie temperature of martensitic phase, respectively. Furthermore, ESR data reveals the coexistence of two magnetic modes in whole temperature range of 200–300 K. Particularly in martensitic phase, two magnetic modes are attributed to two different kinds of lattice deformation, the slip and twinning deformations. - Highlights: • Electron spin resonance study on magnetocaloric Heusler alloy within 200–300 K. • Magnetic phase separation below and above the structural transition temperature. • Phase competing is in association with different types of lattice distortions. • Electron spin resonance results are complementary to the magnetization data.

  10. High transverse momentum resonance production in Pb-Pb, pp and p-Pb collisions at LHC

    CERN Document Server

    Nayak, Kishora

    2015-01-01

    Resonance production in heavy-ion collisions is expected to be a sensitive probe to the proper- ties of strongly interacting matter produced in such collisions. The production of resonances at high transverse momentum will help us to understand the mechanism of particle production and parton energy loss in the medium formed in ultra-relativistic heavy-ion collisions. We report the measurements of K ∗ 0 ( τ ∼ 4 fm/ c ) and φ ( τ ∼ 42 fm/ c ) production at high transverse momen- tum in pp, p–Pb and Pb–Pb collisions at LHC energies and nuclear modification factors. These measurements are compared to corresponding results for the other produced hadrons like charged kaons and protons. Some aspects of resonance production and particle production in general are discussed.

  11. Statistical contribution in the giant multipolar resonance decay in hevay nuclei

    International Nuclear Information System (INIS)

    Teruya, N.

    1986-01-01

    Statistical calculations are made for the decay in the electric monopole giant resonance in 208 Pb and electric dipole giant resonance in 209 Bi, using the Hauser-Feshbach formalism. Calculations are done using the experimental energy levels of the corresponding residual nuclei. The particle-vibrator model is used for those experimental levels without spin and parity determination. The influence of different parametrizations of the optical potential in the statistical calculation result is also studied. (L.C.) [pt

  12. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 9; Issue 12. Learning Earthquake Design and Construction – 10. How Flexibility of Buildings Affects their Earthquake Response. C V R Murty. Classroom Volume 9 Issue 12 December 2004 pp 74-77 ...

  13. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 9; Issue 12. Learning Earthquake Design and Construction – 9. How to Make Buildings Ductile for Good Seismic Performance? C V R Murty. Classroom Volume 9 Issue 12 December 2004 pp 70-73 ...

  14. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 9; Issue 11. Learning Earthquake Design and Construction – 8. What is the Seismic Design Philosophy for Buildings? C V R Murty. Classroom Volume 9 Issue 11 November 2004 pp 89-93 ...

  15. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 1. Learning Earthquake Design and Construction – 12. How do Brick Masonry Houses Behave during Earthquakes? C V R Murty. Classroom Volume 10 Issue 1 January 2005 pp 88-90 ...

  16. Assignment of hyperfine shifted haem methyl carbon resonances in paramagnetic low-spin met-cyano complex of sperm whale myoglobin

    Energy Technology Data Exchange (ETDEWEB)

    Yamamoto, Yasuhiko

    1987-09-28

    The hyperfine shifted resonances arising from all four individual haem carbons of the paramagnetic low-spin met-cyano complex of sperm whale myoglobin have been clearly identified and assigned for the first time with the aid of /sup 1/H-/sup 13/C heteronuclear chemical shift correlated spectroscopy. Alteration of the in-plane symmetry of the electronic structure of haem induced by the ligation of proximal histidyl imidazole spreads the haem carbon resonances to 32 ppm at 22/sup 0/C, indicating the sensitivity of those resonances to the haem electronic/molecular structure. Those resonances are potentially powerful probes in characterizing the nature of haem electronic structure. 25 refs.; 2 figs.; 1 table.

  17. Lateral acoustic wave resonator comprising a suspended membrane of low damping resonator material

    Science.gov (United States)

    Olsson, Roy H.; El-Kady; , Ihab F.; Ziaei-Moayyed, Maryam; Branch; , Darren W.; Su; Mehmet F.,; Reinke; Charles M.,

    2013-09-03

    A very high-Q, low insertion loss resonator can be achieved by storing many overtone cycles of a lateral acoustic wave (i.e., Lamb wave) in a lithographically defined suspended membrane comprising a low damping resonator material, such as silicon carbide. The high-Q resonator can sets up a Fabry-Perot cavity in a low-damping resonator material using high-reflectivity acoustic end mirrors, which can comprise phononic crystals. The lateral overtone acoustic wave resonator can be electrically transduced by piezoelectric couplers. The resonator Q can be increased without increasing the impedance or insertion loss by storing many cycles or wavelengths in the high-Q resonator material, with much lower damping than the piezoelectric transducer material.

  18. 21 CFR 522.2260 - Sulfamethazine.

    Science.gov (United States)

    2010-04-01

    ..., thereafter. (2) Indications for use. For cattle for treatment of bacterial pneumonia and bovine respiratory... (Fusobacterium necrophorum), acute mastitis and acute metritis (Streptococcus spp.) when caused by one or more...

  19. Matrix-based autologous chondrocyte implantation for cartilage repair with Hyalograft(R)C: Two-year follow-up by magnetic resonance imaging

    International Nuclear Information System (INIS)

    Trattnig, S.; Pinker, K.; Krestan, C.; Plank, C.; Millington, S.; Marlovits, S.

    2006-01-01

    Objective: Monitoring of articular cartilage repair after matrix-associated autologous chondrocyte implantation with Hyalograft ( R)C by a new grading system based on non-invasive high-resolution magnetic resonance imaging. Patients and methods: In 23 patients, postoperative magnetic resonance imaging (MRI) was performed between 76 and 120 weeks. In nine of these patients, five MRI examinations were performed at 4, 12, 24, 52 and 104 weeks after Hyalograft ( R)C implant. The repair tissue was described with separate variables: degree of defect repair in width and length, signal intensity of the repair tissue and status of the subchondral bone. For these variables a grading system with point scale evaluation was applied. Results: A complete filling of the defect by repair tissue was found in 15 patients. A moderate hypertrophy of the repair tissue was found in two patients. An underfilling of the defect by repair tissue was observed in four patients. In one patient, a partial detachment of the implant with associated subchondral cyst and edema was seen, and in one patient, a complete detachment of the graft was observed. The filling of the defect parallel to cartilage surface (integration) was complete in 18 cases. A split-like incomplete integration was present in one patient. Incomplete integration was found in four patients. The signal intensity of the implant on FSE and on 3D-GRE+FS was isointense compared to native normal cartilage in all cases after 12 months. The subchondral bone was normal in 14 patients. An edema-like signal alteration was found in three cases. In six patients, a non-edema abnormality of the subchondral bone (granulation tissue, cysts or sclerosis) was present. On follow-up exams performed in nine patients at the same postoperative intervals dynamic processes such as filling of partial defects, vanishing of hypertrophies and change of signal intensity of implant to isointensity with native articular cartilage were observed. A comparison

  20. Resonant spin Hall effect in two dimensional electron gas

    Science.gov (United States)

    Shen, Shun-Qing

    2005-03-01

    Remarkable phenomena have been observed in 2DEG over last two decades, most notably, the discovery of integer and fractional quantum Hall effect. The study of spin transport provides a good opportunity to explore spin physics in two-dimensional electron gas (2DEG) with spin-orbit coupling and other interaction. It is already known that the spin-orbit coupling leads to a zero-field spin splitting, and competes with the Zeeman spin splitting if the system is subjected to a magnetic field perpendicular to the plane of 2DEG. The result can be detected as beating of the Shubnikov-de Haas oscillation. Very recently the speaker and his collaborators studied transport properties of a two-dimensional electron system with Rashba spin-orbit coupling in a perpendicular magnetic field. The spin-orbit coupling competes with the Zeeman splitting to generate additional degeneracies between different Landau levels at certain magnetic fields. It is predicted theoretically that this degeneracy, if occurring at the Fermi level, gives rise to a resonant spin Hall conductance, whose height is divergent as 1/T and whose weight is divergent as -lnT at low temperatures. The charge Hall conductance changes by 2e^2/h instead of e^2/h as the magnetic field changes through the resonant point. The speaker will address the resonance condition, symmetries in the spin-orbit coupling, the singularity of magnetic susceptibility, nonlinear electric field effect, the edge effect and the disorder effect due to impurities. This work was supported by the Research Grants Council of Hong Kong under Grant No.: HKU 7088/01P. *S. Q. Shen, M. Ma, X. C. Xie, and F. C. Zhang, Phys. Rev. Lett. 92, 256603 (2004) *S. Q. Shen, Y. J. Bao, M. Ma, X. C. Xie, and F. C. Zhang, cond-mat/0410169

  1. Carbon-deuterium rotational-echo double-resonance NMR spectroscopy of lyophilized aspartame formulations.

    Science.gov (United States)

    Luthra, Suman A; Utz, Marcel; Gorman, Eric M; Pikal, Michael J; Munson, Eric J; Lubach, Joseph W

    2012-01-01

    In this study, changes in the local conformation of aspartame were observed in annealed lyophilized glasses by monitoring changes in the distance between two labeled sites using C-(2)H rotational-echo double-resonance (REDOR) nuclear magnetic resonance (NMR) spectroscopy. Confirmation that the REDOR experiments were producing accurate distance measurement was ensured by measuring the (13)C-(15)N distance in glycine. The experiment was further verified by measuring the REDOR dephasing curve on (13)C-(2)H methionine. (13)C-(2)H REDOR dephasing curves were then measured on lyophilized aspartame-disaccharide formulations. In aspartame-sucrose formulation, the internuclear distances increased upon annealing, which correlated with decreased chemical reactivity. By contrast, annealing had only a minimal effect on the dephasing curve in aspartame-trehalose formulation. The results show that stability is a function of both mobility and local structure (conformation), even in a small molecule system such as lyophilized aspartame-sucrose. Copyright © 2011 Wiley-Liss, Inc.

  2. /sup 14/N nuclear quadrupole resonance in ferroelectric sodium nitrite NaNO/sub 2/

    Energy Technology Data Exchange (ETDEWEB)

    Singh, S; Singh, K [Defence Science Lab., Delhi (India)

    1974-06-01

    Nuclear quadrupole resonance has been studied in ferroelectric sodium nitrite (NaNO/sub 2/) from 77 K to its phase transition point 437 K. The three rotational frequencies ..omega../sub c/ = 190 cm/sup -1/, ..omega../sub b/ = 120 cm/sup -1/ and ..omega../sub c/ = 227 cm/sup -1/ and their temperature variation when fitted in the Bayer-Kushida theory predict the temperature dependence of nqr frequencies reasonably well. A second order phase transition is found to occur at 180 K which is in confirmity with the one found earlier from thermal expansion and dielectric studies. The shift in resonance frequencies is seen to occur mainly by rotation around the 'c' axis and hence it is inferred that the mechanism of polarization reversal is intimately connected with orientational motion about 'c' axis. (auth)

  3. Study of resonances produced in Heavy Ion Collisions

    Science.gov (United States)

    Quattrocchi, L.; Acosta, L.; Auditore, L.; Cardella, G.; Chbihi, A.; De Filippo, E.; Favela, F.; Gnoffo, B.; Lanzalone, G.; Martel, I.; Martorana, N. S.; Pagano, A.; Pagano, E. V.; Papa, M.; Pirrone, S.; Politi, G.; Porto, F.; Rizzo, F.; Russotto, P.; Trifirò, A.; Trimarchi, M.; Verde, G.; Veselsky, M.

    2018-05-01

    At Laboratori Nazionali del Sud of Catania an experiment has been carried out in order to investigate the correlations between particles produced in 12C+24Mg reaction at 35 AMeV incident energy. Two α correlation has been explored because provide information about temperature of 8Be nuclei produced in the reaction, while three α correaltion has been studied in order to evaluate the competition between sequential and direct decay mode of resonances produced in 12C quasi-projectiles.

  4. Determination of the decay parameters of resonant states

    International Nuclear Information System (INIS)

    Tsoupas, N.

    1975-01-01

    The partial decay proton widths and the relative phases of six of the resonances in 29 P from excitation energies 5.7 to 7.1 MeV were determined. For this determination the angular distributions of protons scattered inelastically from the first 2 + excited state in 28 Si have been measured at 88 energies between E/sub p/ = 3.0 to 5.2 MeV. The coefficients describing the angular distributions were extracted from the experimental data and plotted as a function of C.M. bombarding energy over the resonance region. In addition triple angular correlations in the spin-flip geometry of the inelastically scattered protons from the 2 + first excited state of 28 Si with the γ-rays resulted from the de-excitation of 28 Si to its ground state were performed over the energy region E/sub p/ = 3.0 to 4.7 MeV. The coefficients describing these triple angular correlations were extracted and plotted versus C.M. bombarding energy. To aid in the analysis the experimental data of another triple angular correlation in the Goldfarb-Seyler geometry between the two radiations as in the spin flip angular correlation were used. Further analysis of the experimental data for the extraction of the partial decay widths and phases proceeded by calculating the theoretical expressions of the coefficients versus energy, using a Breit-Wigner formalism including interference between the resonances. The calculated theoretical coefficients were compared with the experimental ones through an on-line interactive program which permitted visual comparisons of the theoretically calculated coefficients to the experimental coefficients. The partial decay proton widths and the relative phases for six of the resonances will be presented in this dissertation

  5. Characterizing the astrophysical S factor for 12C+12C fusion with wave-packet dynamics

    Science.gov (United States)

    Diaz-Torres, Alexis; Wiescher, Michael

    2018-05-01

    A quantitative study of the astrophysically important subbarrier fusion of 12C+12C is presented. Low-energy collisions are described in the body-fixed reference frame using wave-packet dynamics within a nuclear molecular picture. A collective Hamiltonian drives the time propagation of the wave packet through the collective potential-energy landscape. The fusion imaginary potential for specific dinuclear configurations is crucial for understanding the appearance of resonances in the fusion cross section. The theoretical subbarrier fusion cross sections explain some observed resonant structures in the astrophysical S factor. These cross sections monotonically decline towards stellar energies. The structures in the data that are not explained are possibly due to cluster effects in the nuclear molecule, which need to be included in the present approach.

  6. Nuclear magnetic resonance method and apparatus

    International Nuclear Information System (INIS)

    Young, I.R.

    1983-01-01

    In a method of investigating the distribution of a quantity in a chosen region of a body (E) by nuclear magnetic resonance techniques movement of the body during the investigation is monitored by probes (A, B C) (C extends orthogonally to A and B) attached to the body and responsive to magnetic fields applied to the body during the investigation. An apparatus for carrying out the method is also described. If movement is detected, due compensation may be made during processing of the collected data, or the latter may be re-ascertained after appropriate adjustment e.g. a change in the RF excitation frequency. (author)

  7. Giant dipole resonance by many levels theory

    International Nuclear Information System (INIS)

    Mondaini, R.P.

    1977-01-01

    The many levels theory is applied to photonuclear effect, in particular, in giant dipole resonance. A review about photonuclear dipole absorption, comparing with atomic case is done. The derivation of sum rules; their modifications by introduction of the concepts of effective charges and mass and the Siegert theorem. The experimental distributions are compared with results obtained by curve adjustment. (M.C.K.) [pt

  8. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 9; Issue 8. Learning Earthquake Design and Construction – 1. What causes Earthquakes? C V R Murty. Classroom Volume 9 Issue 8 August 2004 pp 75-78. Fulltext. Click here to view fulltext PDF. Permanent link:

  9. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 11; Issue 6. C. S. Smith's Development of a Viewpoint - Complex ideas and their Demonstration in the 2D Soap Froth. Denis Weaire. General Article Volume 11 Issue 6 June 2006 pp 31-41 ...

  10. Electron paramagnetic resonance

    CERN Document Server

    Al'tshuler, S A

    2013-01-01

    Electron Paramagnetic Resonance is a comprehensive text on the field of electron paramagnetic resonance, covering both the theoretical background and the results of experiment. This book is composed of eight chapters that cover theoretical materials and experimental data on ionic crystals, since these are the materials that have been most extensively studied by the methods of paramagnetic resonance. The opening chapters provide an introduction to the basic principles of electron paramagnetic resonance and the methods of its measurement. The next chapters are devoted to the theory of spectra an

  11. Observation of a resonance in $B^+ \\to K^+ \\mu^+\\mu^-$ decays at low recoil

    CERN Document Server

    Aaij, R; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amerio, S; Amhis, Y; Anderlini, L; Anderson, J; Andreassen, R; Andrews, J E; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Baalouch, M; Bachmann, S; Back, J J; Baesso, C; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bauer, Th; Bay, A; Beddow, J; Bedeschi, F; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Burducea, I; Bursche, A; Busetto, G; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Castillo Garcia, L; Cattaneo, M; Cauet, Ch; Cenci, R; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Couturier, B; Cowan, G A; Cowie, E; Craik, D C; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; Davis, A; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Del Buono, L; Déléage, N; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dijkstra, H; Dogaru, M; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Durante, P; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fiore, M; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Furfaro, E; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Giubega, L; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gorbounov, P; Gordon, H; Gotti, C; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Griffith, P; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hamilton, B; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Hartmann, T; He, J; Head, T; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hess, M; Hicheur, A; Hicks, E; Hill, D; Hoballah, M; Hombach, C; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jans, E; Jaton, P; Jawahery, A; Jing, F; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Kaballo, M; Kandybei, S; Kanso, W; Karacson, M; Karbach, T M; Kenyon, I R; Ketel, T; Keune, A; Khanji, B; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kurek, K; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leo, S; Leroy, O; Lesiak, T; Leverington, B; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; Lohn, S; Longstaff, I; Lopes, J H; Lopez-March, N; Lu, H; Lucchesi, D; Luisier, J; Luo, H; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Manca, G; Mancinelli, G; Maratas, J; Marconi, U; Marino, P; Märki, R; Marks, J; Martellotti, G; Martens, A; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Martynov, A; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Maurice, E; Mazurov, A; McCarthy, J; McNab, A; McNulty, R; McSkelly, B; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mordà, A; Morello, M J; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neubert, S; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pal, B K; Palano, A; Palczewski, T; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pescatore, L; Pesen, E; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, A; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pritchard, A; Prouve, C; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Roberts, D A; Rodrigues, E; Rodriguez Perez, P; Roiser, S; Romanovsky, V; Romero Vidal, A; Rouvinet, J; Ruf, T; Ruffini, F; Ruiz, H; Ruiz Valls, P; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salustino Guimaraes, V; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Sirendi, M; Skidmore, N; Skwarnicki, T; Smith, N A; Smith, E; Smith, J; Smith, M; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stevenson, S; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Sun, L; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urner, D; Ustyuzhanin, A; Uwer, U; Vagnoni, V; Valenti, G; Vallier, A; Van Dijk, M; Vazquez Gomez, R; Vazquez Regueiro, P; Vázquez Sierra, C; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, C; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiechczynski, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wimberley, J; Wishahi, J; Wislicki, W; Witek, M; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhokhov, A; Zhong, L; Zvyagin, A

    2013-01-01

    A broad peaking structure is observed in the dimuon spectrum of $B^+ \\to K^+ \\mu^+\\mu^-$ decays in the kinematic region where the kaon has a low recoil against the dimuon system. The structure is consistent with interference between the $B^+ \\to K^+ \\mu^+\\mu^-$ decay and a resonance and has a statistical significance exceeding six standard deviations. The mean and width of the resonance are measured to be $4191^{+9}_{-8}\\mathrm{\\,Me\\kern -0.1em V/}c^2$ and $65^{+22}_{-16}\\mathrm{\\,Me\\kern -0.1em V/}c^2$, respectively, where the uncertainties include statistical and systematic contributions. These measurements are compatible with the properties of the $\\psi(4160)$ meson. First observations of both the decay $B^+ \\to \\psi(4160) K^+$ and the subsequent decay $\\psi(4160) \\to \\mu^+\\mu^-$ are reported. The resonant decay and the interference contribution make up 20% of the yield for dimuon masses above 3770  MeV/c2. This contribution is larger than theoretical estimates.

  12. Targeting human c-Myc promoter duplex DNA with actinomycin D by use of multi-way analysis of quantum-dot-mediated fluorescence resonance energy transfer

    DEFF Research Database (Denmark)

    Gholami, Somayeh; Kompany Zare, Mohsen

    2013-01-01

    Actinomycin D (Act D), an oncogenic c-Myc promoter binder, interferes with the action of RNA polymerase. There is great demand for high-throughput technology able to monitor the activity of DNA-binding drugs. To this end, binding of 7-aminoactinomycin D (7AAD) to the duplex c-Myc promoter...... pairs resulted in efficient energy transfer from drug to QD via fluorescence resonance energy transfer (FRET). Multi-way analysis of the three-way data array obtained from titration experiments was performed by use of restricted Tucker3 and hard trilinear decomposition (HTD). These techniques enable...... the important advantage over univariate classical methods of enabling us to investigate the source of variance in the fluorescence signal of the DNA-drug complex. It was established that hard trilinear decomposition analysis of FRET-measured data overcomes the problem of rank deficiency, enabling calculation...

  13. Experimental study of radiative pion capture on 13C, 20Ne, 90Zr, 19F and 12C

    International Nuclear Information System (INIS)

    Martoff, C.J.

    1980-11-01

    Photon spectra for 50 13 C, 19 F, 20 Ne, and 90 Zr. The e + e - pair spectrometer system used has resolution 850 keV fwhm and photon detection efficiency 5 x 10 -6 . The total radiative capture branching ratios measured are 13 C (1.66 +- 0.25)%, 19 F (2.40 +- 0.48)%, 20 Ne (1.60 +- 0.24)%, and 90 Zr (2.1 +- 0.5)%. The partial radiative capture branching ratios to four bound states and two resonances in 20 F, and two bound states and three resonances in 13 B have also been measured. The branching ratio for 13 C(π - ,γ) 13 B g.s. is (6.1 +- 1.2) x 10 -4 . Comparison of this result with the beta decay rate of 13 B shows that (84 +- 16)% of the pion capture amplitude is accounted for by the Gamow-Teller matrix element. Further analysis suggests that much of the remaining strength is E2. The measured branching ratios to resonant states in 13 C(π - ,γ) 13 B are shown to be in agreement with detailed shell model calculations. The total single-particle strength in these transitions is shown to be approximately half as large as that of the T = 3/2 part of the E1 photoresonance (the Giant Dipole Resonance) in 13 C. The branching ratio for 20 Ne(π - ,γ) 20 F (T = 1, J/sup π/ = 1 + , E/sub x/ = 1.06 MeV) is 0.91 +- 0.52).10 -4 . Comparison with the electroexcitation of the analog giant M1 state in 20 Ne (11.24 MeV) shows that the M1 transition amplitude is less than (46 +- 14)% Gamow-Teller. This result is in agreement with detailed shell model calculations of the M1 transition. The photon spectrum for radiative pion capture from flight (reaction 12 C(π + T = 44 MeV, γ at 90 0 )) has been measured. 13 figures, 12 tables

  14. Influence of resonance parameters' correlations on the resonance integral uncertainty; 55Mn case

    International Nuclear Information System (INIS)

    Zerovnik, Gasper; Trkov, Andrej; Capote, Roberto; Rochman, Dimitri

    2011-01-01

    For nuclides with a large number of resonances the covariance matrix of resonance parameters can become very large and expensive to process in terms of the computation time. By converting covariance matrix of resonance parameters into covariance matrices of background cross-section in a more or less coarse group structure a considerable amount of computer time and memory can be saved. The question is how important is the information that is discarded in the process. First, the uncertainty of the 55 Mn resonance integral was estimated in narrow resonance approximation for different levels of self-shielding using Bondarenko method by random sampling of resonance parameters according to their covariance matrices from two different 55 Mn evaluations: one from Nuclear Research and Consultancy Group NRG (with large uncertainties but no correlations between resonances), the other from Oak Ridge National Laboratory (with smaller uncertainties but full covariance matrix). We have found out that if all (or at least significant part of the) resonance parameters are correlated, the resonance integral uncertainty greatly depends on the level of self-shielding. Second, it was shown that the commonly used 640-group SAND-II representation cannot describe the increase of the resonance integral uncertainty. A much finer energy mesh for the background covariance matrix would have to be used to take the resonance structure into account explicitly, but then the objective of a more compact data representation is lost.

  15. The non-linear ion trap. Part 5. Nature of non-linear resonances and resonant ion ejection

    Science.gov (United States)

    Franzen, J.

    1994-01-01

    The superposition of higher order multipole fields on the basic quadrupole field in ion traps generates a non-harmonic oscillator system for the ions. Fourier analyses of simulated secular oscillations in non-linear ion traps, therefore, not only reveal the sideband frequencies, well-known from the Mathieu theory, but additionally a commonwealth of multipole-specific overtones (or higher harmonics), and corresponding sidebands of overtones. Non-linear resonances occur when the overtone frequencies match sideband frequencies. It can be shown that in each of the resonance conditions, not just one overtone matches one sideband, instead, groups of overtones match groups of sidebands. The generation of overtones is studied by Fourier analysis of computed ion oscillations in the direction of thez axis. Even multipoles (octopole, dodecapole, etc.) generate only odd orders of higher harmonics (3, 5, etc.) of the secular frequency, explainable by the symmetry with regard to the planez = 0. In contrast, odd multipoles (hexapole, decapole, etc.) generate all orders of higher harmonics. For all multipoles, the lowest higher harmonics are found to be strongest. With multipoles of higher orders, the strength of the overtones decreases weaker with the order of the harmonics. Forz direction resonances in stationary trapping fields, the function governing the amplitude growth is investigated by computer simulations. The ejection in thez direction, as a function of timet, follows, at least in good approximation, the equation wheren is the order of multipole, andC is a constant. This equation is strictly valid for the electrically applied dipole field (n = 1), matching the secular frequency or one of its sidebands, resulting in a linear increase of the amplitude. It is valid also for the basic quadrupole field (n = 2) outside the stability area, giving an exponential increase. It is at least approximately valid for the non-linear resonances by weak superpositions of all higher odd

  16. Synthesis and Adsorption Study of BSA Surface Imprinted Polymer on CdS Quantum Dots

    Science.gov (United States)

    Tang, Ping-ping; Cai, Ji-bao; Su, Qing-de

    2010-04-01

    A new bovine serum albumin (BSA) surface imprinting method was developed by the incorporation of quantum dots (QDs) into molecularly imprinted polymers (MIP), which can offer shape selectivity. Preparation and adsorption conditions were optimized. Physical appearance of the QDs and QDs-MIP particles was illustrated by scanning electron microscope images. Photoluminescence emission of CdS was quenched when rebinding of the template. The quenching of photoluminescence emissions is presumably due to the fluorescence resonance energy transfer between quantum dots and BSA template molecules. The adsorption is compiled with Langmuir isotherm, and chemical adsorption is the rate-controlling step. The maximum adsorption capacity could reach 226.0 mg/g, which is 142.4 mg/g larger than that of undoped BSA MIP. This study demonstrates the validity of QDs coupled with MIP technology for analyzing BSA.

  17. Resonant Self-Trapping and Absorption of Intense Bessel Beams

    International Nuclear Information System (INIS)

    Fan, J.; Parra, E.; Milchberg, H. M.

    2000-01-01

    We report the observation of resonant self-trapping and enhanced laser-plasma heating resulting from propagation of high intensity Bessel beams in neutral gas. The enhancement in absorption and plasma heating is directly correlated to the spatial trapping of laser radiation. (c) 2000 The American Physical Society

  18. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 9; Issue 8. Learning Earthquake Design and Construction – 2. How the Ground Shakes! C V R Murty. Classroom Volume 9 Issue 8 August 2004 pp 79-82. Fulltext. Click here to view fulltext PDF. Permanent link:

  19. Starting from August 2004, Resonance is publishing in the ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 9; Issue 9. Learning Earthquake Design and Construction – 3. What are Magnitude and Intensity? C V R Murty. Classroom Volume 9 Issue 9 September 2004 pp 79-83. Fulltext. Click here to view fulltext PDF. Permanent link:

  20. Tune space manipulations in jumping depolarizing resonances

    International Nuclear Information System (INIS)

    Ratner, L.G.; Ahrens, L.A.

    1987-01-01

    In February 1986, the AGS polarized beam reached a momentum of 22 GeV/c with a 45% polarization and an intensity of 1 to 2 x 10 10 polarized protons per pulse at a repetition rate of 2.1 seconds. In order to achieve this, one had to overcome the effect of some 40 depolarizing resonances. In our first commissioning run in 1984, we had reached 16.5 GeV/c using, with suitable modifications, the conventional techniques first used at the Argonne ZGS. This worked well, but we found that the fast tune shifts required to cross the intrinsic depolarizing resonances were causing an increase in beam emittance which led to the need for stronger corrections later in the cycle and to diminished extraction efficiency. For the 1986 run, we were prepared to minimize this emittance growth by the application of slow quadrupole pulses to change the region in tune space in which we operated the first tune quads. In this paper we give a brief description of the conventional corrections, but our main emphasis is on the descriptions of tune space manipulations

  1. Mutations around interferon sensitivity-determining region: a pilot resistance report of hepatitis C virus 1b in a Hong Kong population.

    Science.gov (United States)

    Zhou, Xiao-Ming; Chan, Paul Ks; Tam, John S

    2011-12-28

    To explore mutations around the interferon sensitivity-determining region (ISDR) which are associated with the resistance of hepatitis C virus 1b (HCV-1b) to interferon-α treatment. Thirty-seven HCV-1b samples were obtained from Hong Kong patients who had completed the combined interferon-α/ribavirin treatment for more than one year with available response data. Nineteen of them were sustained virological responders, while 18 were non-responders. The amino acid sequences of the extended ISDR (eISDR) covering 64 amino acids upstream and 67 amino acids downstream from the previously reported ISDR were analyzed. One amino acid variation (I2268V, P = 0.023) was significantly correlated with treatment outcome in this pilot study with a limited number of patients, while two amino acid variations (R2260H, P = 0.05 and S2278T, P = 0.05) were weakly associated with treatment outcome. The extent of amino acid variations within the ISDR or eISDR was not correlated with treatment outcome as previously reported. Three amino acid mutations near but outside of ISDR may associate with interferon treatment resistance of HCV-1b patients in Hong Kong.

  2. Contribution to the study of the unresolved resonance range of the neutrons cross sections

    International Nuclear Information System (INIS)

    Noguere, Gilles

    2014-01-01

    This document presents the statistical description of neutron cross sections in the unresolved resonance range. The modeling of the total cross section and of the 'shape - elastic' cross section is based on the 'average R-Matrix' formalism. The partial cross sections describing the radiative capture, elastic scattering, inelastic scattering and fission process are calculated using the Hauser-Feshbach formalism with width fluctuation corrections. In the unresolved resonance range, these models depend on the average resonance parameters (neutron strength function Sc, mean level spacing D c , average partial reaction widths Γ c , channel radius a c , effective radius R' and distant level parameter R-bar c ∞ ). The codes (NJOY, CALENDF...) dedicated to the processing of nuclear data libraries (JEFF, ENDF/B, JENDL, CENDL, BROND... ) use the average parameters to take into account the self-shielding phenomenon for the simulation of the neutron transport in Monte-Carlo (MCNP, TRIPOLI... ) and deterministic (APOLLO, ERANOS...) codes. The evaluation work consists in establishing a consistent set of average parameters as a function of the total angular momentum J of the system and of the orbital moment of the incident neutron l. The work presented in this paper aims to describe the links between the S-Matrix and the 'average R-Matrix' formalism for the calculation of Sc, R-bar c ∞ , ac and R'. (author) [fr

  3. Protein (Cyanobacteria): 298492611 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 551115:2260 ... 50S ribosomal protein L20 'Nostoc azollae' 0708 MTRVKRGNVARKRRNKILKLAKGFRGSHSTLFRTAHQQVMKALRSAYRDRKKKKRDFRRLWITRINAASRQNGLSYSQLIGNLKKANVELNRKMLAQLAVLDPASFAKVAELANSVKA

  4. Bilateral cervical spondylolysis of C7.

    Science.gov (United States)

    Paik, Nam Chull

    2010-11-01

    Cervical spondylolysis, which is defined as a cleft between the superior and inferior articular facets of the articular pillar, is a rare condition. The sixth cervical vertebra (C6) is the level most commonly affected. Cases involving C2, C3, C4, or C5 have also been reported. However, to date, no case of C7 spondylolysis has been reported. To present a rare case of bilateral spondylolysis of the seventh cervical vertebra (C7) in a 58-year-old man. A case report. A 58-year-old man visited our hospital with chronic posterior neck pain radiating to the left upper extremity. Magnetic resonance imaging (MRI) study revealed left foraminal disc herniations at C5-C6 and C6-C7. Cervical spondylolysis involving C7 was discovered incidentally during computed tomography (CT)-guided transforaminal steroid injection. Plain radiographs, CT images, and MRIs were reviewed thoroughly once again. The patient's symptoms were relieved after he received CT-guided transforaminal steroid injections. Plain radiographs revealed a radiolucent defect in the articular pillar and cleft at the spinous process of C7. Computed tomography confirmed bilateral spondylolysis and spina bifida occulta of the C7 vertebra. Magnetic resonance imaging revealed absence of edema, which was suggestive of a chronic lesion. Involvement of C7 is not exceptional in a case of cervical spondylolysis. Copyright © 2010 Elsevier Inc. All rights reserved.

  5. Precision spectroscopy with COMPASS and the observation of a new iso-vector resonance

    Directory of Open Access Journals (Sweden)

    Paul Stephan

    2014-06-01

    Full Text Available We report on the results of a novel partial-wave analysis based on 50 ⋅ 106 events from the reaction π− + p → π−π−π+ + precoil at 190 GeV/c incoming beam momentum using the COMPASS spectrometer. A separated analysis in bins of m3π and four-momentum transfer t′ reveals the interference of resonant and non-resonant particle production and allows their spectral separation. Besides well known resonances we observe a new iso-vector meson a1(1420 at a mass of 1420 MeV/c2 in the f0(980π final state only, the origin of which is unclear. We have also examined the structure of the 0++ππ-isobar in the JPC = 0−+, 1++, 2−+ three pion waves. This clearly reveals the various 0++ππ-isobar components and its correlation to the decay of light mesons.

  6. Production and decay of baryonic resonances in pion induced reactions

    Directory of Open Access Journals (Sweden)

    Przygoda Witold

    2016-01-01

    Full Text Available Pion induced reactions give unique opportunities for an unambiguous description of baryonic resonances and their coupling channels. A systematic energy scan and high precision data, in conjunction with a partial wave analysis, allow for the study of the excitation function of the various contributions. A review of available world data unravels strong need for modern facilities delivering measurements with a pion beam. Recently, HADES collaboration collected data in pion-induced reactions on light (12C and heavy (74W nuclei at a beam momentum of 1.7 GeV/c dedicated to strangeness production. It was followed by a systematic scan at four different pion beam momenta (0.656, 0.69, 0.748 and 0.8 GeV/c in π− − p reaction in order to tackle the role of N(1520 resonance in conjunction with the intermediate ρ production. First results on exclusive channels with one pion (π− p and two pions (nπ+π−, pπ−π0 in the final state are discussed.

  7. An architecture for integrating planar and 3D cQED devices

    Energy Technology Data Exchange (ETDEWEB)

    Axline, C.; Reagor, M.; Heeres, R.; Reinhold, P.; Wang, C.; Shain, K.; Pfaff, W.; Chu, Y.; Frunzio, L.; Schoelkopf, R. J. [Department of Applied Physics, Yale University, New Haven, Connecticut 06511 (United States)

    2016-07-25

    Numerous loss mechanisms can limit coherence and scalability of planar and 3D-based circuit quantum electrodynamics (cQED) devices, particularly due to their packaging. The low loss and natural isolation of 3D enclosures make them good candidates for coherent scaling. We introduce a coaxial transmission line device architecture with coherence similar to traditional 3D cQED systems. Measurements demonstrate well-controlled external and on-chip couplings, a spectrum absent of cross-talk or spurious modes, and excellent resonator and qubit lifetimes. We integrate a resonator-qubit system in this architecture with a seamless 3D cavity, and separately pattern a qubit, readout resonator, Purcell filter, and high-Q stripline resonator on a single chip. Device coherence and its ease of integration make this a promising tool for complex experiments.

  8. Quasi-resonant converter with divided resonant capacitor on primary and secondary side

    OpenAIRE

    Shiroyama, Hironobu; Matsuo, Hirofumi; Ishizuka, Yoichi

    2009-01-01

    This paper presents a quasi-resonant converter with divided resonant capacitor on primary and secondary side of the isolation transformer. A conventional quasi-resonant converter using flyback topology can realize soft switching with simple circuit. However, relatively large surge voltage is generated in the switching device. To suppress such surge voltage, resonant capacitor is divided on primary side and secondary side in the proposed converter. In case of prototype 95W converter, the volta...

  9. New Crystal Ball data on resonance formation by γγ-collisions

    International Nuclear Information System (INIS)

    Bienlein, J.K.

    1992-01-01

    The Crystal Ball detector at DORIS-II has observed a hitherto unknown (though expected) resonance at 1870 MeV/c 2 in the reaction γγ → ηπ o π o . Decay angular distributions and subsystem invariant masses favor the assignment η 2 (1870), a J PC = 2 -+ resonance. An efficient selection of the reaction γγ → π o π o yielded 7000 events. Angular distributions in narrow mass bins became possible and allowed the decomposition of the cross section into S- and D-wave contributions. Thus an f 0 (1250) resonance was found under the dominating f 2 (1270). The search for the channel γγ →ηη in the same selection yielded only (16 ± 6) events. (orig.)

  10. Phosphorus nuclear magnetic resonance in isolated perfused rat pancreas

    International Nuclear Information System (INIS)

    Matsumoto, Takehisa; Kanno, Tomio; Seo, Yoshiteru; Murakami, Masataka; Watari, Hiroshi

    1988-01-01

    Phosphorus nuclear magnetic resonance spectroscopy was applied to measure phosphorus energy metabolites in isolated perfused rat pancreas. The gland was perfused with a modified Krebs-Henseleit solution at room temperature (25 degree C). 31 P resonances of creatine phosphate (PCr), ATP, ADP, inorganic phosphate (P i ) and phosphomonoesters (PMEs) were observed in all the preparations of pancreas. In different individual preparations, the resonance of PCr varied, but those of ATP were almost the same. The initial levels of PCr and ATP in individual preparations, however, remained almost unchanged during perfusion with the standard solution for 2 h. When the perfusion was stopped, the levels of ATP and PCr decreased, while the levels of PME and P i increased. At that time, the P i resonance shfted to a higher magnetic field, indicating that the tissue pH decreased. On reperfusion, the tissue levels of phosphorus compounds and the tissue pH were restored to their initial resting levels. Continuous infusion of 0.1 μM acetylcholine caused marked and sustained increases in the flow of pancreatic juice and protein output. During the stimulation the tissue levels of phosphorus compounds remained unchanged, while the tissue pH was decreased slightly

  11. Dereplication of depsides from the lichen Pseudevernia furfuracea by centrifugal partition chromatography combined to {sup 13}C nuclear magnetic resonance pattern recognition

    Energy Technology Data Exchange (ETDEWEB)

    Oettl, Sarah K. [Institute of Pharmacy/Pharmacognosy, Center for Molecular Biosciences Innsbruck, University of Innsbruck, Innrain 80–82, 6020 Innsbruck (Austria); Hubert, Jane, E-mail: jane.hubert@univ-reims.fr [Institut de Chimie Moléculaire de Reims (UMR CNRS 7312), SFR CAP' sANTE, UFR de Pharmacie, Université de Reims Champagne-Ardenne, BP 1039, 51687 Reims Cedex 2 (France); Nuzillard, Jean-Marc [Institut de Chimie Moléculaire de Reims (UMR CNRS 7312), SFR CAP' sANTE, UFR de Pharmacie, Université de Reims Champagne-Ardenne, BP 1039, 51687 Reims Cedex 2 (France); Stuppner, Hermann [Institute of Pharmacy/Pharmacognosy, Center for Molecular Biosciences Innsbruck, University of Innsbruck, Innrain 80–82, 6020 Innsbruck (Austria); Renault, Jean-Hugues [Institut de Chimie Moléculaire de Reims (UMR CNRS 7312), SFR CAP' sANTE, UFR de Pharmacie, Université de Reims Champagne-Ardenne, BP 1039, 51687 Reims Cedex 2 (France); Rollinger, Judith M. [Institute of Pharmacy/Pharmacognosy, Center for Molecular Biosciences Innsbruck, University of Innsbruck, Innrain 80–82, 6020 Innsbruck (Austria)

    2014-10-10

    Highlights: • The major depsides of a lichen extract were directly identified within mixtures. • The initial extract was rapidly fractionated by CPC in the pH-zone refining mode. • Hierarchical clustering of {sup 13}C NMR signals resulted in the identification of depside molecular skeletons. • {sup 13}C chemical shift clusters were assigned to structures using a {sup 13}C NMR database. • Six depsides were unambiguously identified by this approach. - Abstract: Lichens produce a diversity of secondary metabolites, among them depsides comprised of two or more hydroxybenzoic acid units linked by ester, ether, or C-C-bonds. During classic solid support-based purification processes, depsides are often hydrolyzed and in many cases time, consuming procedures result only in the isolation of decomposition products. In an attempt to avoid extensive purification steps while maintaining metabolite structure integrity, we propose an alternative method to identify the major depsides of a lichen crude extract (Pseudevernia furfuracea var. ceratea (Ach.) D. Hawksw., Parmeliaceae) directly within mixtures. Exploiting the acidic character of depsides and differences in polarity, the extract was fractionated by centrifugal partition chromatography in the pH-zone refining mode resulting in twelve simplified mixtures of depsides. After {sup 13}C nuclear magnetic resonance analysis of the produced fractions, the major molecular structures were directly identified within the fraction series by using a recently developed pattern recognition method, which combines spectral data alignment and hierarchical clustering analysis. The obtained clusters of {sup 13}C chemical shifts were assigned to their corresponding molecular structures with the help of an in-house {sup 13}C NMR chemical shift database, resulting in six unambiguously identified compounds, namely methyl β-orcinolcarboxylate (1), atranorin (2), 5-chloroatranorin (3), olivetol carboxylic acid (4), olivetoric acid (5

  12. Advances in magnetic resonance 10

    CERN Document Server

    Waugh, John S

    2013-01-01

    Advances in Magnetic Resonance, Volume 10, presents a variety of contributions to the theory and practice of magnetic resonance. The book contains three chapters that examine superoperators in magnetic resonance; ultrasonically modulated paramagnetic resonance; and the utility of electron paramagnetic resonance (EPR) and electron-nuclear double-resonance (ENDOR) techniques for studying low-frequency modes of atomic fluctuations and their significance for understanding the mechanism of structural phase transitions in solids.

  13. Computer Assisted Instruction (Cain) For Nuclear Magnetic Resonance Spectroscopy

    International Nuclear Information System (INIS)

    Jaturonrusmee, Wasna; Arthonvorakul, Areerat; Assateranuwat, Adisorn

    2005-10-01

    A computer assisted instruction program for nuclear magnetic resonance spectroscopy was developed by using Author ware 5.0, Adobe Image Styler 1.0, Adobe Photo shop 7.0 and Flash MX. The contents included the basic theory of 1H and 13C nuclear magnetic resonance (NMR) spectroscopy, the instrumentation of NMR spectroscopy, the two dimensional (2D) NMR spectroscopy and the interpretation of NMR spectra. The program was also provided examples, and exercises, with emphasis on NMR spectra interpretation to determine the structure of unknown compounds and solutions for self study. The questionnaire from students showed that they were very satisfied with the software

  14. One-loop renormalization of Resonance Chiral Theory: scalar and pseudoscalar resonances

    International Nuclear Information System (INIS)

    Rosell, Ignasi; Ruiz-FemenIa, Pedro; Portoles, Jorge

    2005-01-01

    We consider the Resonance Chiral Theory with one multiplet of scalar and pseudoscalar resonances, up to bilinear couplings in the resonance fields, and evaluate its β-function at one-loop with the use of the background field method. Thus we also provide the full set of operators that renormalize the theory at one loop and render it finite

  15. Engineered SOI slot waveguide ring resonator V-shape resonance combs for refraction index sensing up to 1300nm/RIU (Conference Presentation)

    Science.gov (United States)

    Zhang, Weiwei; Serna, Samuel; Le Roux, Xavier; Vivien, Laurent; Cassan, Eric

    2016-05-01

    breakthrough of the performance of slot ring resonator sensing ability. Different from the normal sensing regime by monitoring one specific resonance (λres) peak shift, the proposed approach stems from the sensitivity of the RR critical coupling. The critical coupling peak is auto-selected out by matching the following condition: the ring resonator's round trip attenuation coefficient a(λ) being equal to the coupler self-coupling coefficient k(λ), thus resulting in the deepest extinction ratio (ER) among the spectrum RR comb. The obtained sensing comb, based on a V-shape spectrum envelop, is engineered by controlling a(λ) and k(λ) with opposite monotonicities. Both a(λ)and k(λ) are tuned to have a large dispersion along the wavelength, which means that |a(λ)-k(λ)| keeps rapidly increasing as λres is far away from λc, eliminating the resonance ER quickly down to 0. Experimentally, slot waveguide ring resonators with a radius of 50µm have been fabricated on a standard silicon platform with a Si thickness of 220nm, loaded by racetrack couplers with a straight coupling length of 20µm. Sensing experiments have been carried out by changing the top cladding material from a series of Cargille optical liquids with refraction index values ranging from 1.3 to 1.5. The Q factors of critical coupling resonances was monitored from 2,000 to 6,000, and measured wavelength shifts of this peak are from 1.41µm to 1.56µm. The maximum sensitivity of 1300nm/RIU is observed in the cladding index range 1.30-1.35. To conclude, a new sensing regime by tracking the critical coupling resonance λc of slot waveguide ring resonators is demonstrated. The reported sensitivity is up 1300nm/RIU around the water RI of 1.33, and the monitored sensing FOM is about 2300, which is very close to the FOM values achieved from nanobeam cavities. This work can thus contribute to future integrated optical sensing schemes based on slot RRs.

  16. Theoretical implications of the resonance anomalies in the e+-e- system

    International Nuclear Information System (INIS)

    Pakvasa, S.; Rajasekaran, G.; Tuan, S.F.

    1975-01-01

    The phenomenological properties of the recent resonance anomalies at 3.1 GeV and 3.7 GeV in e + -e - systems are confronted in a fairly systematic way with models presently known to us. These include charm-related models, neutral-intermediate-boson-type hypotheses, gauge-related models, and exotic suggestions that the resonant states may have abnormal C parity or that the electromagnetic current has a color triplet piece. We conclude that none of the schemes proposed represents a really satisfactory interpretation of the data

  17. Dependence of excitation frequency of resonant circuit on RF irradiation position of MRI equipment

    International Nuclear Information System (INIS)

    Shimizu, Masato; Yamada, Tsutomu; Takemura, Yasushi; Niwa, Touru; Inoue, Tomio

    2010-01-01

    Hyperthermia using implants is a cancer treatment in which cancer tissue is heated to over 42.5 deg C to selectively kill the cancer cells. In this study, a resonant circuit was used as an implant, and a weak magnetic field of radiofrequency (RF) pulses from a magnetic resonance imaging (MRI) device was used as an excitation source. We report here how the temperature of the resonant circuit was controlled by changing the excitation frequency of the MRI. As a result, the temperature rise of the resonant circuit was successfully found to depend on its position in the MRI device. This significant result indicates that the temperature of the resonant circuit can be controlled only by adjusting the excitation position. Accurate temperature control is therefore expected to be possible by combining this control technique with the temperature measurement function of MRI equipment. (author)

  18. Geography of resonances and Arnold diffusion in a priori unstable Hamiltonian systems

    International Nuclear Information System (INIS)

    Delshams, Amadeu; Huguet, Gemma

    2009-01-01

    In this paper we consider the case of a general C r+2 perturbation, for r large enough, of an a priori unstable Hamiltonian system of 2 + 1/2 degrees of freedom, and we provide explicit conditions on it, which turn out to be C 2 generic and are verifiable in concrete examples, which guarantee the existence of Arnold diffusion. This is a generalization of the result in Delshams et al (2006 Mem. Am. Math. Soc.) where the case of a perturbation with a finite number of harmonics in the angular variables was considered. The method of proof is based on a careful analysis of the geography of resonances created by a generic perturbation and it contains a deep quantitative description of the invariant objects generated by the resonances therein. The scattering map is used as an essential tool to construct transition chains of objects of different topology. The combination of quantitative expressions for both the geography of resonances and the scattering map provides, in a natural way, explicit computable conditions for instability

  19. Quantification of oxygen and carbon in high Tc superconducting films by (α,α) elastic resonance technique

    International Nuclear Information System (INIS)

    Vizkelethy, G.; Revesz, P.

    1993-01-01

    The quantification of oxygen and carbon in high-temperature (T c ) superconducting oxide thin films was made by employing elastic resonance in He backscattering analysis. A method combining the oxygen resonance technique and channeling was presented for measuring the nature of the oxygen disorder near the surface and the interface in a YBCO superconducting film grown on an MgO substrate. The oxygen resonance technique was used to quantify the oxygen profiling in the metal/YBCO contacts, showing that Zr and Nb act as sinks to oxygen from YBCO films and are oxidized in the forms Zr/ZrO 2 /YBCO/MgO and Nb 0.2 O/YBCO/MgO after annealing in a vacuum at 350 o C. We combined the carbon and oxygen resonances to determine the carbon contamination and oxygen concentration changes on the YBCO surface after coating and baking the photoresist. Residual carbon on the surface and a thin layer of oxygen depletion near the YBCO surface have been observed. The residual carbon in Bi 2 Sr 2 CaCu 2 O 8 films made by the decomposition of metallo-organic precursors was quantified using carbon resonance. (author)

  20. Semiclassical description of resonant tunnel effect: bifurcations and periodic orbits in the resonant current; Description semiclassique de l`effet tunnel resonant: bifurcations et orbites periodiques dans le courant resonant

    Energy Technology Data Exchange (ETDEWEB)

    Rouben, D C

    1997-11-28

    A semiclassical method for resonant tunneling in a quantum well in the presence of a magnetic field tilted with regard to an electric field is developed. In particular a semiclassical formula is derived for the total current of electrons after the second barrier of the quantum well. The contribution of the stable and unstable orbits is studied. It appears that the parameters which describe the classical chaos in the quantum well have an important effect on the tunneling current. A numerical experiment is led, the contributions to the current of some particular orbits are evaluated and the results are compared with those given by the quantum theory. (A.C.) 70 refs.

  1. Starting from August 2004, Resonance is publishing in the ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 1. Learning Earthquake Design and Construction – 11. What are the Indian Seismic Codes? C V R Murty. Classroom Volume 10 Issue 1 January 2005 pp 83-87. Fulltext. Click here to view fulltext PDF. Permanent link:

  2. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 9; Issue 9. Learning Earthquake Design and Construction – 4. Where are the Seismic Zones in India? C V R Murty. Classroom Volume 9 Issue 9 September 2004 pp 83-87. Fulltext. Click here to view fulltext PDF. Permanent link:

  3. Slotted cage resonator for high-field magnetic resonance imaging of rodents

    Energy Technology Data Exchange (ETDEWEB)

    Marrufo, O; Vasquez, F; Solis, S E; Rodriguez, A O, E-mail: arog@xanum.uam.mx [Departamento de Ingenieria Electrica, Universidad Autonoma Metropolitana Iztapalapa, Mexico, DF 09340 (Mexico)

    2011-04-20

    A variation of the high-frequency cavity resonator coil was experimentally developed according to the theoretical frame proposed by Mansfield in 1990. Circular slots were used instead of cavities to form the coil endplates and it was called the slotted cage resonator coil. The theoretical principles were validated via a coil equivalent circuit and also experimentally with a coil prototype. The radio frequency magnetic field, B1, produced by several coil configurations was numerically simulated using the finite-element approach to investigate their performances. A transceiver coil, 8 cm long and 7.6 cm in diameter, and composed of 4 circular slots with a 15 mm diameter on both endplates, was built to operate at 300 MHz and quadrature driven. Experimental results obtained with the slotted cage resonator coil were presented and showed very good agreement with the theoretical expectations for the resonant frequency as a function of the coil dimensions and slots. A standard birdcage coil was also built for performance comparison purposes. Phantom images were then acquired to compute the signal-to-noise ratio of both coils showing an important improvement of the slotted cage coil over the birdcage coil. The whole-body images of the mouse were also obtained showing high-quality images. Volume resonator coils can be reliably built following the physical principles of the cavity resonator design for high-field magnetic resonance imaging applications of rodents.

  4. Collaborative resonant writing and musical improvisation to explore the concept of resonance

    DEFF Research Database (Denmark)

    Lindvang, Charlotte; Pedersen, Inge Nygaard; Jacobsen, Stine Lindahl

    2018-01-01

    phenomenon consisting of physical vibrations and acoustic sounding that offers a clear logic, and (2) a metaphorical conceptualization used to describe and understand complex psychological processes of human relationships. The process of collaborative writing led to the discovery or development of a ninestep......Resonance is often used to characterize relationships, but it is a complex concept that explains quite different physical, physiological and psychological processes. With the aim of gaining deeper insight into the concept of resonance, a group of ten music therapy researchers, all colleagues...... procedure including different collaborative resonant writing procedures and musical improvisation, as well as of a series of metaphors to explain therapeutic interaction, resonant learning and ways of resonant exploration....

  5. Dipole and quadrupole magnetic resonances in nuclei of Ni isotopes

    International Nuclear Information System (INIS)

    Goncharova, N.G.; Mishchenko, G.M.; Ehramzhyan, R.A.

    1982-01-01

    Basing on a microscopic approach to the nuclear shell model, magnetic resonances following the electron excitation of the 58 Ni and 60 Ni nuclei are considered. 0h/2π#betta# and 2h/2π#betta#-transitions are taken into accoun for the M1-excitations. For the M2-states, transitions to the next shell are considered only. For the magnetic excitations the form factors and electron-excitation cross sections are calculated, and the effect of the lower 2 1+ , 2 2+ , 3 - , 4 + phonon excitations on the position and structure of the M1- and M2-resonances is traced. +he energies and mean equilibrium deformations are presented for the phonons taken into account. The structure and position of the main magnetic resonance maxima, in difference with the giant dipole resonance in photoabsorption, have proven to be weakly dependent on the isotope choice. For the M1-resonance this effect is related with the fact that the lower excitation states, located in the energy range E 60 Ni and 58 Ni, respectively. A strongly collectivized state, acquiring a notable strength of the M-1 transitions, is located at approximately 32 MeV. The form factor for this level attains the maximum at q=160-190 MeV/c

  6. Injection-controlled laser resonator

    Science.gov (United States)

    Chang, J.J.

    1995-07-18

    A new injection-controlled laser resonator incorporates self-filtering and self-imaging characteristics with an efficient injection scheme. A low-divergence laser signal is injected into the resonator, which enables the injection signal to be converted to the desired resonator modes before the main laser pulse starts. This injection technique and resonator design enable the laser cavity to improve the quality of the injection signal through self-filtering before the main laser pulse starts. The self-imaging property of the present resonator reduces the cavity induced diffraction effects and, in turn, improves the laser beam quality. 5 figs.

  7. MRI (Magnetic Resonance Imaging)

    Science.gov (United States)

    ... Procedures Medical Imaging MRI (Magnetic Resonance Imaging) MRI (Magnetic Resonance Imaging) Share Tweet Linkedin Pin it More sharing options Linkedin Pin it Email Print Magnetic Resonance Imaging (MRI) is a medical imaging procedure for ...

  8. Evaluación térmica y perfil de ácidos grasos del aceite de las semillas del merey, Anacardium occidentale L. | Thermal evaluation and fatty acid profile of cashew tree, Anacardium occidentale L. seed oil

    Directory of Open Access Journals (Sweden)

    Gabriel Ordaz González

    2017-11-01

    Full Text Available Oil from seeds of Anacardium occidentale L. (cashew nut was obtained by Soxhlet solvent extraction using hexane with a 26% yield. Concentrations of this oil lower than 1000 μg·mL-1 were innocuous in the lethality bioassay against Artemia salina. Analysis of Differential Scanning Calorimetric (DSC of this oil exhibited a wide melting range (Tonset = -22.60ºC, Tpico = -12.27ºC, which could be associated with the content of unsaturated fatty acids (76.24%. The oil showed thermal stability between 20 and 100ºC. The GC-MS analysis allowed to identify oleic (C18:1, ω-9, 51.3% and linoleic (C18:2, ω-6, 24.88% acids as major constituents.

  9. Investigating hadronic resonances in pp interactions with HADES

    Directory of Open Access Journals (Sweden)

    Przygoda Witold

    2015-01-01

    Full Text Available In this paper we report on the investigation of baryonic resonance production in proton-proton collisions at the kinetic energies of 1.25 GeV and 3.5 GeV, based on data measured with HADES. Exclusive channels npπ+ and ppπ0 as well as ppe+e− were studied simultaneously in the framework of a one-boson exchange model. The resonance cross sections were determined from the one-pion channels for Δ(1232 and N(1440 (1.25 GeV as well as further Δ and N* resonances up to 2 GeV/c2 for the 3.5 GeV data. The data at 1.25 GeV energy were also analysed within the framework of the partial wave analysis together with the set of several other measurements at lower energies. The obtained solutions provided the evolution of resonance production with the beam energy, showing a sizeable non-resonant contribution but with still dominating contribution of Δ(1232P33. In the case of 3.5 GeV data, the study of the ppe+e− channel gave the insight on the Dalitz decays of the baryon resonances and, in particular, on the electromagnetic transition form-factors in the time-like region. We show that the assumption of a constant electromagnetic transition form-factors leads to underestimation of the yield in the dielectron invariant mass spectrum below the vector mesons pole. On the other hand, a comparison with various transport models shows the important role of intermediate ρ production, though with a large model dependency. The exclusive channels analysis done by the HADES collaboration provides new stringent restrictions on the parameterizations used in the models.

  10. Continuous vacuum processing system for quartz crystal resonators

    International Nuclear Information System (INIS)

    Ney, R.J.; Hafner, E.

    1979-01-01

    An ultrahigh vacuum continuous cycle quartz crystal fabrication facility has been developed that assures an essentially contamination-free environment throughout the final manufacturing steps of the crystal unit. The system consists of five essentially tubular vacuum chambers that are interconnected through gate valves. The unplated crystal resonators, mounted in ceramic flatback frames and loaded on carrier trays, enter the vacuum system through an entrance air lock, are UV/ozone cleaned, baked at 300 0 C, plated to frequency, thermocompression sealed, and exit as completed crystal units through an exit air lock, while the bake, plate and seal chambers remain under continuous vacuum permanently. In-line conveyor belts are used, in conjunction with balanced vacuum manipulators, to move the resonator components to the various work stations. Unique high density, highly directional nozzle beam evaporation sources, capable of long term operation without reloading, are used for electroding the resonators simultaneously on both sides. The design goal for the system is a production rate of 200 units per 8 hour day; it is adaptable to automatic operation

  11. Experimental Investigation of 2:1 and 3:1 Internal Resonances in Nonlinear MEMS Arch Resonators

    KAUST Repository

    Ramini, Abdallah; Hajjaj, Amal Z.; Younis, Mohammad I.

    2016-01-01

    We demonstrate experimentally internal resonances in MEMS resonators. The investigation is conducted on in-plane MEMS arch resonators fabricated with a highly doped silicon. The resonators are actuated electrostatically and their stiffness are tuned by electrothermal loading by passing an electrical current though the microstructures. We show that through this tuning, the ratio of the various resonance frequencies can be varied and set at certain ratios. Particularly, we adjust the resonance frequencies of two different vibrational modes to 2:1 and 3:1. Finally, we validate the internal resonances at these ratios through frequency-response curves and FFTs.

  12. Experimental Investigation of 2:1 and 3:1 Internal Resonances in Nonlinear MEMS Arch Resonators

    KAUST Repository

    Ramini, Abdallah

    2016-12-05

    We demonstrate experimentally internal resonances in MEMS resonators. The investigation is conducted on in-plane MEMS arch resonators fabricated with a highly doped silicon. The resonators are actuated electrostatically and their stiffness are tuned by electrothermal loading by passing an electrical current though the microstructures. We show that through this tuning, the ratio of the various resonance frequencies can be varied and set at certain ratios. Particularly, we adjust the resonance frequencies of two different vibrational modes to 2:1 and 3:1. Finally, we validate the internal resonances at these ratios through frequency-response curves and FFTs.

  13. Resonant ultrasound spectrometer

    Science.gov (United States)

    Migliori, Albert; Visscher, William M.; Fisk, Zachary

    1990-01-01

    An ultrasound resonant spectrometer determines the resonant frequency spectrum of a rectangular parallelepiped sample of a high dissipation material over an expected resonant response frequency range. A sample holder structure grips corners of the sample between piezoelectric drive and receive transducers. Each transducer is mounted on a membrane for only weakly coupling the transducer to the holder structure and operatively contacts a material effective to remove system resonant responses at the transducer from the expected response range. i.e., either a material such as diamond to move the response frequencies above the range or a damping powder to preclude response within the range. A square-law detector amplifier receives the response signal and retransmits the signal on an isolated shield of connecting cabling to remove cabling capacitive effects. The amplifier also provides a substantially frequency independently voltage divider with the receive transducer. The spectrometer is extremely sensitive to enable low amplitude resonance to be detected for use in calculating the elastic constants of the high dissipation sample.

  14. Far off-resonance laser frequency stabilization using multipass cells in Faraday rotation spectroscopy.

    Science.gov (United States)

    Quan, Wei; Li, Yang; Li, Rujie; Shang, Huining; Fang, Zishan; Qin, Jie; Wan, Shuangai

    2016-04-01

    We propose a far off-resonance laser frequency stabilization method by using multipass cells in Rb Faraday rotation spectroscopy. Based on the detuning equation, if multipass cells with several meters optical path length are used in the conventional Faraday spectroscopy, the detuning of the lock point can be extended much further from the alkali metal resonance. A plate beam splitter was used to generate two different Faraday signals at the same time. The transmitted optical path length was L=50  mm and the reflected optical path length was 2L=100  mm. When the optical path length doubled, the detuning of the lock points moved further away from the atomic resonance. The temperature dependence of the detuning of the lock point was also analyzed. A temperature-insensitive lock point was found near resonance when the cell temperature was between 110°C and 130°C. We achieved an rms fluctuation of 0.9 MHz/23 h at a detuning of 0.5 GHz. A frequency drift of 16 MHz/h at a detuning of -5.6  GHz and 4 MHz/h at a detuning of -5.2  GHz were also obtained for the transmitted and reflected light Faraday signal.

  15. Study of giant multipole resonances in 40Ca

    International Nuclear Information System (INIS)

    Rost, H.

    1979-01-01

    In the present thesis giant resonance states in 40 Ca were studied by scattering of 104 MeV a particles on 40 Ca and by the reactions 39 K(p vector,p') 39 K and 39 K(p,α) 36 Ar. The scattered α-particles were measured at extreme forward angles (THETAsub(L) = 4 0 -16 0 C), because at forward angles the cross sections for the excitation of states with spin 0 and 1 strongly differ from those with higher spin. The aim of this experiment was first of all the study of the giant resonance region in 40 Ca on the contribution to 0 + or 1 - states. Beside the known electric giant quadrupole resonances at Esub(x) approx. equal to 18.5 MeV (25% EWSR) contributions of EO-strength at Esub(x) approx. equal to 21 MeV (6% EWSR) and indications to a (isoscalar) E1-strength at Esub(x) approx. equal to 14 MeV and Esub(x) approx. equal to 16 MeV were found. At the reactions 39 K(p vector,p') 39 K and 39 K(p,α) 36 Ar in the channels (p,p 0 ),(p,p 4 ), (p,αsub(o)), and (p,α 1 ) at incident energies at about 10 MeV (Esub(x)( 40 Ca) approx. equal to 18 MeV) resonant structures were observed. A scattering phase analysis performed for the elastic proton scattering didn't however yield quantitative results about the resonance parameter. An expansion of the cross sections by Legendre polynomials for the remaining reaction channel didn't allow a conclusion about the dominance of a certain L-value. The only indication to the connection of the observed resonant structures with the giant quadrupole resonance in 40 Ca is therefore the energetic position at about Esub(x) approx. equal to 18 MeV. Altogether the observed structures however were not very pronounced, so it can be concluded, that the excitation of the giant quadrupole resonance in 40 Ca by protons via the ground state of 39 K occurs not very strongly. (orig./HSI) [de

  16. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    C K John1 Rajani S Nadgauda2. Tissue Culture Pilot Plant National Chemical laboratory Pune 411008, India. Head of the Tissue Culture Pilot Plant at National Chemical Laboratory, Pune. Resonance – Journal of Science Education. Current Issue : Vol. 23, Issue 3 · Current Issue Volume 23 | Issue 3. March 2018.

  17. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Annual Meetings · Mid Year Meetings · Discussion Meetings · Public Lectures · Lecture Workshops · Refresher Courses · Symposia · Live Streaming. Home; Journals; Resonance – Journal of Science Education; Volume 5; Issue 10. Quantum Computing - Algorithms. C S Vijay Vishal Gupta. General Article Volume 5 Issue 10 ...

  18. Magnetic resonance sialography of the parotid glands in chronic hepatitis C virus patients with and without vasculitis.

    Science.gov (United States)

    Shahin, Amira A; Hussein, Hanan; Gaber, Wafaa; Elbaz, Tamer; Salah El Din, Lamia A

    2017-03-01

    Hepatitis C virus (HCV) is sialotropic. The pathogenesis of sicca manifestations in patients with chronic HCV infection is not fully understood. We aimed to detect changes in magnetic resonance sialography (MRS) of HCV patients with and without vasculitis. We studied 32 HCV patients (19 female, mean age 48.8 ± 10.3 years) and 20 age- and gender-matched healthy controls. Half of the patients had vasculitis. Demographic, clinical and serological data were prospectively evaluated. In patients with vasculitis, the disease activity was assessed by the Birmingham Vasculitis Activity Score (BVAS). MRS was performed on all patients and controls. Abnormal MRS was found in 25% of patients, (6/16 and 2/16 in patients with and without vasculitis, respectively). Among patients with vasculitis, those with abnormal MRS had longer disease duration, higher leukocytic and lymphocytic counts and more frequent cryoglobulinemia (P vasculitis, longer disease duration and cryoglobulinemia were associated with abnormal findings on MRS. To confirm our results, we propose larger-scale, multicentre studies with longer evaluation periods. © 2014 Asia Pacific League of Associations for Rheumatology and Wiley Publishing Asia Pty Ltd.

  19. Resonance Raman and quantum chemical studies of short polyene radical cations

    DEFF Research Database (Denmark)

    Keszthelyi, T.; Wilbrandt, R.; Bally, T.

    1997-01-01

    ,3,5-hexatriene have been studied. The radical cations were generated radiolytically in a glassy Freon matrix and investigated by optical absorption and resonance Raman spectroscopy. Ab initio and density functional molecular-orbital calculations have been carried out to predict equilibrium structures...... and to assist assignment of the resonance Raman spectra. A new and improved scaled quantum mechanical force field for the butadiene radical cation was also determined. The presence of more than one rotamer was observed in all the polyene radical cations we investigated. (C) 1997 Elsevier Science B.V....

  20. Magnetic resonance of phase transitions

    CERN Document Server

    Owens, Frank J; Farach, Horacio A

    1979-01-01

    Magnetic Resonance of Phase Transitions shows how the effects of phase transitions are manifested in the magnetic resonance data. The book discusses the basic concepts of structural phase and magnetic resonance; various types of magnetic resonances and their underlying principles; and the radiofrequency methods of nuclear magnetic resonance. The text also describes quadrupole methods; the microwave technique of electron spin resonance; and the Mössbauer effect. Phase transitions in various systems such as fluids, liquid crystals, and crystals, including paramagnets and ferroelectrics, are also