Roesch-McNally, G.; Prendeville, H. R.
2017-12-01
A lack of coproduction, the joint production of new technologies or knowledge among technical experts and other groups, is arguably one of the reasons why much scientific information and resulting decision support systems are not very usable. Increasingly, public agencies and academic institutions are emphasizing the importance of coproduction of scientific knowledge and decision support systems in order to facilitate greater engagement between the scientific community and key stakeholder groups. Coproduction has been embraced as a way for the scientific community to develop actionable scientific information that will assist end users in solving real-world problems. Increasing the level of engagement and stakeholder buy-in to the scientific process is increasingly necessary, particularly in the context of growing politicization of science and the scientific process. Coproduction can be an effective way to build trust and can build-on and integrate local and traditional knowledge. Employing coproduction strategies may enable the development of more relevant and useful information and decision support tools that address stakeholder challenges at relevant scales. The USDA Northwest Climate Hub has increasingly sought ways to integrate coproduction in the development of both applied research projects and the development of decision support systems. Integrating coproduction, however, within existing institutions is not always simple, given that coproduction is often more focused on process than products and products are, for better or worse, often the primary focus of applied research and tool development projects. The USDA Northwest Climate Hub sought to integrate coproduction into our FY2017 call for proposal process. As a result we have a set of proposals and fledgling projects that fall along the engagement continuum (see Figure 1- attached). We will share the challenges and opportunities that emerged from this purposeful integration of coproduction into the work
Energy Technology Data Exchange (ETDEWEB)
Knight, R.A.; Gissy, J.L.; Onischak, M.; Babu, S.P.; Carty, R.H. (Institute of Gas Technology, Chicago, IL (United States)); Duthie, R.G. (Bechtel Group, Inc., San Francisco, CA (United States)); Wootten, J.M. (Peabody Holding Co., Inc., St. Louis, MO (United States))
1991-09-01
Under US DOE sponsorship, a project team consisting of the Institute of Gas Technology, Peabody Holding Company, and Bechtel Group, Inc. has been developing an advanced, mild gasification process to process all types of coal and to produce solid and condensable liquid co-products that can open new markets for coal. The three and a half year program (September 1987 to June 1991) consisted of investigations in four main areas. These areas are: (1) Literature Survey of Mild Gasification Processes, Co-Product Upgrading and Utilization, and Market Assessment; (2) Mild Gasification Technology Development: Process Research Unit Tests Using Slipstream Sampling; (3) Bench-Scale Char Upgrading Study; (4) Mild Gasification Technology Development: System Integration Studies. In this report, the literature and market assessment of mild gasification processes are discussed.
DEFF Research Database (Denmark)
Tortzen, Anne
leadership styles executed by public managers affect the quality and public value of co-production processes? The paper argues that publicly initiated co-production initiatives are influenced by conflicting governance logics placing public managers in an institutional cross pressure (Lowndes & Roberts, 2013...... of building networks and relations, developing trust and focusing on empowerment and on the participants' resources to develop innovative solutions Drawing on three qualitative case studies of ‘most likely' co-production cases in Danish municipalities, the study identifies three different leadership styles...... and increase public value (Bovaird & Löffler, 2012; Osborne, 2010). The paper argues that a deeper understanding of the dynamics of co-production can be gained from analyzing the leadership dimension of co-production processes, which has hitherto not been given much attention by co-production researchers...
Energy Technology Data Exchange (ETDEWEB)
Knight, R.A.; Gissy, J.L.; Onischak, M.; Babu, S.P.; Carty, R.H. [Institute of Gas Technology, Chicago, IL (United States); Duthie, R.G. [Bechtel Group, Inc., San Francisco, CA (United States); Wootten, J.M. [Peabody Holding Co., Inc., St. Louis, MO (United States)
1991-09-01
Under US DOE sponsorship, a project team consisting of the Institute of Gas Technology, Peabody Holding Company, and Bechtel Group, Inc. has been developing an advanced, mild gasification process to process all types of coal and to produce solid and condensable liquid co-products that can open new markets for coal. The three and a half year program (September 1987 to June 1991) consisted of investigations in four main areas. These areas are: (1) Literature Survey of Mild Gasification Processes, Co-Product Upgrading and Utilization, and Market Assessment; (2) Mild Gasification Technology Development: Process Research Unit Tests Using Slipstream Sampling; (3) Bench-Scale Char Upgrading Study; (4) Mild Gasification Technology Development: System Integration Studies. In this report, the literature and market assessment of mild gasification processes are discussed.
Equationally Compact Acts : Coproducts / Peeter Normak
Normak, Peeter
1998-01-01
In this article equational compactness of acts and its generalizations are discussed. As equational compactness does not carry over to coproducts a slight generalization of c-equational campactness is introduced. It is proved that a coproduct of acts is c-equationally compact if and only if all components are c-equationally campact
Co-Production in Community Development: A Day at the Educational Fair.
Burke, Richard C.
1992-01-01
Describes community development efforts of the Educacion Communitaria Radial (Community Education through Radio) in Bolivia during 1979-80 that encouraged cooperation within and between communities through coproduction of learning activities. The use of theater that evolved into a day-long educational fair is described, and school involvement is…
Design Concepts for Co-Production of Power, Fuels & Chemicals Via Coal/Biomass Mixtures
Energy Technology Data Exchange (ETDEWEB)
Rao, A. D.; Chen, Q.; Samuelsen, G. S.
2012-09-30
The overall goal of the program is to develop design concepts, incorporating advanced technologies in areas such as oxygen production, feed systems, gas cleanup, component separations and gas turbines, for integrated and economically viable coal and biomass fed gasification facilities equipped with carbon capture and storage for the following scenarios: (i) coproduction of power along with hydrogen, (ii) coproduction of power along with fuels, (iii) coproduction of power along with petrochemicals, and (iv) coproduction of power along with agricultural chemicals. To achieve this goal, specifically the following objectives are met in this proposed project: (i) identify advanced technology options and innovative preliminary design concepts that synergistically integrate plant subsections, (ii) develop steady state system simulations to predict plant efficiency and environmental signature, (iii) develop plant cost estimates by capacity factoring major subsystems or by major equipment items where required, and then capital, operating and maintenance cost estimates, and (iv) perform techno- economic analyses for the above described coproduction facilities. Thermal efficiencies for the electricity only cases with 90% carbon capture are 38.26% and 36.76% (HHV basis) with the bituminous and the lignite feedstocks respectively. For the coproduction cases (where 50% of the energy exported is in the form of electricity), the electrical efficiency, as expected, is highest for the hydrogen coproduction cases while lowest for the higher alcohols (ethanol) coproduction cases. The electrical efficiencies for Fischer-Tropsch coproduction cases are slightly higher than those for the methanol coproduction cases but it should be noted that the methanol (as well as the higher alcohol) coproduction cases produce the finished coproduct while the Fischer-Tropsch coproduction cases produce a coproduct that requires further processing in a refinery. The cross comparison of the thermal
Utilization and application of wet potato processing coproducts for finishing cattle.
Nelson, M L
2010-04-01
Wet coproducts fed to beef cattle include processing coproducts of the fruit, vegetable, juice, and brewing industries. Considerations for their utilization in beef cattle diets include quantity available, feeding value, quality of animal products produced, economics (e.g., transportation of water), storage and preservation, consumer perception, nuisance concerns, contaminants, and interactions with other diet ingredients. Potato (Solanum tuberosum) coproducts from processing for frozen food products may be quantitatively most important because the 11.3 million t of potatoes (fresh weight) processed in the United States and Canada in 2008 resulted in an estimated 4.3 million t (as-is basis) of coproduct. Chemical composition and feeding value of potato coproducts depends on the coproduct type. The names of coproducts vary among potato processors and some processors combine the different coproducts into one product commonly called slurry. The 4 main potato coproducts are 1) potato peels; 2) screen solids (small potatoes and pieces); 3) fried product (fries, hash browns, batter, crumbles); and 4) material from the water recovery systems (oxidation ditch, belt solids, filter cake). The coproducts, except the fried products, ensile rapidly, reaching pH 5 in 7 d or less. Dry matter content varies from 10 to 30% and on a DM basis varies in CP (5 to 27%), starch (3 to 56%), NDF (4 to 41%), and ether extract (3 to 37%) content among potato coproducts. Type of coproduct and frying greatly affect the energy value (0.6 to 1.6 Mcal of NE(g)/kg of DM). Composition, quality, and shelf life of beef was not affected by potato coproduct feeding in contrast to perceptions of some purveyors and chefs. Potato coproducts are quantitatively important energy sources in beef cattle diets, which, in turn, solve a potentially massive disposal problem for the food processing industry.
Directory of Open Access Journals (Sweden)
Steven Phillips
2009-12-01
Full Text Available Transitive inference, class inclusion and a variety of other inferential abilities have strikingly similar developmental profiles-all are acquired around the age of five. Yet, little is known about the reasons for this correspondence. Category theory was invented as a formal means of establishing commonalities between various mathematical structures. We use category theory to show that transitive inference and class inclusion involve dual mathematical structures, called product and coproduct. Other inferential tasks with similar developmental profiles, including matrix completion, cardinality, dimensional changed card sorting, balance-scale (weight-distance integration, and Theory of Mind also involve these structures. By contrast, (coproducts are not involved in the behaviours exhibited by younger children on these tasks, or simplified versions that are within their ability. These results point to a fundamental cognitive principle under development during childhood that is the capacity to compute (coproducts in the categorical sense.
Co-production of knowledge: An Inuit Indigenous Knowledge perspective
Daniel, R.; Behe, C.
2017-12-01
A "co-production of knowledge" approach brings together different knowledge systems while building equitable and collaborative partnerships from `different ways of knowing.' Inuit Indigenous Knowledge is a systematic way of thinking applied to phenomena across biological, physical, cultural and spiritual systems; rooted with a holistic understanding of ecosystems (ICC Alaska 2016). A holistic image of Arctic environmental change is attained by bringing Indigenous Knowledge (IK) holders and scientists together through a co-production of knowledge framework. Experts from IK and science should be involved together from the inception of a project. IK should be respected as its own knowledge system and should not be translated into science. A co-production of knowledge approach is important in developing adaptation policies and practices, for sustainability and to address biodiversity conservation (Daniel et al. 2016). Co-production of knowledge is increasingly being recognized by the scientific community at-large. However, in many instances the concept is being incorrectly applied. This talk will build on the important components of co-production of knowledge from an Inuit perspective and specifically IK. In this presentation we will differentiate the co-production of knowledge from a multi-disciplinary approach or multi-evidence based decision-making. We underscore the role and value of different knowledge systems with different methodologies and the need for collaborative approaches in identifying research questions. We will also provide examples from our experiences with Indigenous communities and scientists in the Arctic. References: Inuit Circumpolar Council of Alaska. 2016. Alaskan Inuit Food Security Conceptual Framework: How to Assess the Arctic From An Inuit Perspective, 201pp. Daniel, R., C. Behe, J. Raymond-Yakoubian, E. Krummel, and S. Gearhead. Arctic Observing Summit White Paper Synthesis, Theme 6: Interfacing Indigenous Knowledge, Community
A systematic review of co-creation and co-production: Embarking on the social innovation journey
Voorberg, W.H.; Bekkers, V.J.J.M.; Tummers, L.G.|info:eu-repo/dai/nl/341028274
2015-01-01
This article presents a systematic review of 122 articles and books (1987-2013) of co-creation/ co-production with citizens in public innovation. It analyses a) the objectives of co-creation and co-production, b) its influential factors and c) the outcomes of co-creation and co-production processes.
S.P. Osborne; K. Strokosch
2013-01-01
We propose an important theoretical development for our understanding of the co-production of public services. It combines the insights from both public administration and services management theory to produce a novel typology of co-production. This clarifies its role at the operational and strategic levels, as well as its potential for transformational change in public services. Understanding co-production in this way provides a basis through which to explore a whole range of dimensions of c...
When municipalities lead co-production
DEFF Research Database (Denmark)
Tortzen, Anne
2015-01-01
from research in governance and leadership, the paper analyses a critical case of co-production in the Danish Municipality of Holbæk. The main focus is on exploring how leadership interventions are enacted by civil servants and politicians, and how these shape the co-production process. The analysis...... points to the significant role played by municipalities as hands-off leaders of co-production processes, and identifies leadership dynamics which merit further exploration....
EARLY ENTRANCE COPRODUCTION PLANT
International Nuclear Information System (INIS)
William K. Davis
2001-01-01
The overall objective of this project is the three phase development of an Early Entrance Coproduction Plant (EECP) which produces at least one product from at least two of the following three categories: (1) electric power (or heat), (2) fuels, and (3) chemicals. The objective is to have these products produced by technologies capable of using synthesis gas derived from coal and/or other carbonaceous feedstocks. The objective of Phase I is to determine the feasibility and define the concept for the EECP located at a specific site; develop a Research, Development, and Testing (RD and T) Plan for implementation in Phase II; and prepare a Preliminary Project Financing Plan. The objective of Phase II is to implement the work as outlined in the Phase I RD and T Plan to enhance the development and commercial acceptance of coproduction technology that produces high-value products, particularly those that are critical to our domestic fuel and power requirements. The project will resolve critical knowledge and technology gaps on the integration of gasification and downstream processing to coproduce some combination of power, fuels, and chemicals from coal and/or other carbonaceous feedstocks. The objective of Phase III is to develop an engineering design package and a financing plan for an EECP located at a specific site. The project's intended result is to provide the necessary technical, economic, and environmental information needed by industry to move the EECP forward to detailed design, construction, and operation
CO-PRODUCT ENHANCEMENT AND DEVELOPMENT FOR THE MASADA OXYNOL PROCESS PROCESS
Energy Technology Data Exchange (ETDEWEB)
Donald V. Watkins
2010-06-14
The focus of this project was an overall process improvement through the enhancement of the co-product streams. The enhancement of the process operations and co-products will increase both ethanol production and the value of other process outputs and reduces the amount of waste byproducts. This leads to a more economical and environmentally sound alternative to landfill disposal of municipal solid waste (MSW). These enhancements can greatly increase the commercial potential for the production of ethanol from MSW by the Masada CES OxyNol process. Both technological and economical issues were considered for steps throughout the conversion process. The research efforts of this project are varied but synergistic. The project investigated many of the operations involved in the Masada process with the overall goal of process improvements. The general goal of the testing was to improve co-product quality, improve conversions efficiencies, minimize process losses, increase energy efficiency, and mitigate process and commercialization risks. The project was divided into 16 subtasks as described in general terms below. All these tasks are interrelated but not necessarily interdependent.
THE COPRODUCTION BETWEEN PRODUCER AND CONSUMER AS PART OF THE EXPERIENCE ECONOMY
Directory of Open Access Journals (Sweden)
BARABAȘ MARIA
2015-12-01
Full Text Available Traditional economic literature is based on the model that separate producer of consumer, considering that, while the producer creates the value, the consumer damage it during the use. There is, however, a new trend that I approach, too, in this work, which perceives consumer in another aspect, that of co-producer. The main purpose of the paper is to examine if, via co-production with the consumer, the companies register costs’ decreases and thereby increases in sales volume. For this, I compared the estimated expenditure of a specific agricultural firm moving to coproduction with the consumer, on the one hand, and data that reflects the results of the company if it does not engages in co-production, on the other hand . I also brought up the case of Swedish company Ikea , which represents a proof that the consumers’ interest grows if he participate in certain stages of production. Based on these data , I surprised the idea that by the effect of prices’ decrease, the co-production between producer and consumer leads to increasing the sales volume of the company and also its performance. The co-production between producer and consumer is a phrase which seeks yet for an identity. The growth and diversity of consumtion is closely linked of certain favorable conditions, such as the development of the New Economy and the unprecedented gain in the informational means of communication. Developed in the 90’s, the World Wide Web technology , the e-mail and the social networks have led to significant exchanges of information, impressions and feedback from consumers. At the same time they have created, for producers, the opportunity to make themselves known in a quick and economical way, to make known their products, to sell goods or services, no matter where in the world. In less than a minute, one can see the goods offered by a company and as fast, can purchase an item or make a financial transaction. Electronic commerce is based on processing and
Preliminary results on optimising hydrothermal treatment used in co-production of biofuels
DEFF Research Database (Denmark)
Thomsen, M.H.; Thomsen, A.B.; Jørgensen, H.
. The solubilised hemicellulose is in a second step converted by either enzymes or weak acid hydrolyses tomonomeric sugar compounds for ethanol production. The cellulose fraction containing the lignin will be burned for electricity or part of it may be used for ethanol production by means of SSF. By-products from......In December 2002, an EU-project for co-production of biofuels was started. The overall objective is to develop cost and energy effective production systems for co-production of bio ethanol and electricity based on integrated biomass utilization. Duringthe first 12 months period of the project...... illustrates that it is possible to extract more than 95% of the alkaline salts (at 200 C) leaving a solid cellulose rich biofuel for combustion or for further treatment in the ethanol process. In the experiments performed at 190 C, the best totalglucose yield after pre-treatment and following enzymatic...
A systematic review of co-creation and co-production: Embarking on the social innovation journey
W.H. Voorberg (William); V.J.J.M. Bekkers (Victor); L.G. Tummers (Lars)
2014-01-01
markdownabstract__Abstract__ This article presents a systematic review of 122 articles and books (1987-2013) of co-creation/ co-production with citizens in public innovation. It analyses a) the objectives of co-creation and co-production, b) its influential factors and c) the outcomes of
Co-production of knowledge in soils governance
Directory of Open Access Journals (Sweden)
Katrin Prager
2015-06-01
Full Text Available The co-production of knowledge between different actor groups has the potential to generate ‘more socially robust knowledge’ and better decisions, therefore improving governance processes. This paper explores knowledge co-production between different types of actors involved in soils governance in Scotland: policy makers, agency staff, scientists, local authorities, land managers and other stakeholders. In a setting characterised by network governance, we investigate knowledge co-production in three arenas that aimed to implement the Scottish Soil Framework and progress several activities such as a Soil Monitoring Action Plan and the Scotland’s Soils website. Adopting an action research, case study approach, we collected data through document analysis, observation, personal communication with policy actors involved, and semi-structured interviews with soil data users (local authorities, farmers, estate managers. The findings show different levels of interaction in the different arenas, ranging from major interaction and two-way communication to no interaction. The interaction levels indicate the extent to which knowledge exchange has taken place. Analysis highlights the divergence in problem framing between the actor groups, their diverse soil data needs and, therefore, a variation in perceptions of solutions. The combination of co-production in the different arenas enhanced policy actors’ knowledge and allowed them to reconsider policy implementation efforts. However, the delineation of knowledge types remains challenging since the same actor can hold different types of knowledge. We conclude that the concept of knowledge co-production is useful as a frame for developing polycentric, interactive and multi-party processes in soils governance, as well as to identify where interaction requires facilitation and/or improvement, but the concept does not provide a consistent theory.
Operator coproduct-realization of quantum group transformations in two dimensional gravity, 1
Cremmer, E; Schnittger, J; Cremmer, E; Gervais, J L; Schnittger, J
1996-01-01
A simple connection between the universal R matrix of U_q(sl(2)) (for spins \\demi and J) and the required form of the co-product action of the Hilbert space generators of the quantum group symmetry is put forward. This gives an explicit operator realization of the co-product action on the covariant operators. It allows us to derive the quantum group covariance of the fusion and braiding matrices, although it is of a new type: the generators depend upon worldsheet variables, and obey a new central extension of U_q(sl(2)) realized by (what we call) fixed point commutation relations. This is explained by showing that the link between the algebra of field transformations and that of the co-product generators is much weaker than previously thought. The central charges of our extended U_q(sl(2)) algebra, which includes the Liouville zero-mode momentum in a nontrivial way are related to Virasoro-descendants of unity. We also show how our approach can be used to derive the Hopf algebra structure of the extended quant...
Comparative analysis of alternative co-production approaches to conservation science in Alaska
Trammell, E. J.
2017-12-01
Co-production has been suggested as an important tool for reducing the gap between science and management. Although co-production can require substantial investments in time and relationship building, there are a range of possible approaches that can be utilized that honor the focus and intent of co-production. I present here a comparison of three efforts that range from relatively simple, to complex and exhaustive, that illustrate diverse approaches to co-production of conservation science in Alaska. The first example highlights a workshop-based approach to identify long-term environmental monitoring needs in Alaska, while the second example describes stakeholder-driven scenarios that identified stressors to salmon in southcentral Alaska. The third example describes a 2-year cooperative agreement to develop management questions as part of a rapid ecoregional assessment in central Alaska. Results suggest that careful stakeholder selection is essential to successful co-production. Additionally, all three examples highlight the potential disconnect between management questions and specific management decisions, even when working directly with resource managers. As the focus of the Alaska Climate Science Center will be on co-production of climate science over the next 5 years, I conclude with some key pathways forward for successful co-production efforts in the future.
Gnansounou, Edgard
2018-04-01
This study revisited the fundamentals of allocation to joint products and proposed new models for allocating common greenhouse gases emissions among coproducts of biorefineries. These emissions may account for more than 80% of the total emissions of greenhouse gases of the biorefineries. The proposed models optimize the reward of coproducts for their compliance to environmental requirements. They were illustrated by a case study of wheat straw biorefinery built on the literature. Several scenarios were considered with regard to the grain yield, field emissions of greenhouse gases, allocation between grain and straw and policy requirements. The results conform to the expectations and are sensitive to the policy targets and to the environmental performance of the counterpart system. Further research works are necessary to achieve a full application to complex processes. However, the proposed models are promising towards assessing the simultaneous compliance of coproducts of a biorefinery to environment policy requirements. Copyright © 2018 Elsevier Ltd. All rights reserved.
Bio-fuel co-products in France: perspectives and consequences for cattle food
International Nuclear Information System (INIS)
2010-01-01
The development of bio-fuels goes along with that of co-products which can be used to feed animals. After having recalled the political context which promotes the development of renewable energies, this document aims at giving an overview of the impact of bio-fuel co-products on agriculture economy. It discusses the production and price evolution for different crops
The Coordinates of Co-Production in the Educational Services System
Directory of Open Access Journals (Sweden)
Jivan Alexandru
2017-06-01
Full Text Available The paper proposes a certain delimitation of the concepts of cooperation and co-production in services and aims to apply them concretely in education, related to the connections (cooperation between offeror and beneficiary. The article is part of a wider plan that seeks to implement the legitimacy of using the notion of co-production in all sectors of activity, whether it is the one of goods or services to designate cooperative relationships between producer and consumer or, as we like to say, between the offeror and the beneficiary. The article starts with the definition and clarification of the concept of co-production. After briefly setting several conceptual aspects, an applied analysis is performed on a group of respondents from education, using a questionnaire developed to provide adequate information for the purposes set forth: some relationships between the influence factors of the co-production between teacher and student are analysed. The questionnaire allows us to share interesting conclusions regarding the reasons that make people to participate. An analysis of the logic behind the co-production phenomenon is offered, reserves for the improvement of such relations being revealed for the education system. The conclusions following the data analysis confirm the initial assumptions and reveal interesting aspects, as described in the final section.
Successful Coproduction in Water Management and Climate Science
Kaatz, L.
2017-12-01
Frequently described as the "canary in the coal mine," the water sector has been one of the first to experience and begin preparing for the impacts of climate change. Water utilities have lead the way in developing and testing climate information in practice with the end goal of building resiliency and avoiding catastrophic disasters. A key aspect of this leadership is strong, collaborative partnerships resulting in the coproduction of knowledge and actionable science. In this session we will hear from the decision-maker perspective regarding what effective partnerships in real-world applications look like using examples from the Water Utility Climate Alliances (WUCA), and the experience and outcomes of a unique decade-long partnership between Denver Water and the National Center for Atmospheric Research. The lessons learned and challenges encountered in these examples of coproduction are not unique to WUCA, Denver Water nor the water sector, rather they are applicable across sectors and may inform future coproduction efforts.
Understanding the co-production of public services: the case of asylum seekers in Glasgow
Strokosch, Kirsty
2013-01-01
This thesis explores the co-production of public services in the case of asylum seekers in Glasgow. It makes contributions on the theoretical and empirical levels. First, it integrates two theoretical standpoints on co-production from the public administration/management and services management literatures. This integration forms the basis for the development of an original conceptual framework which differentiates three modes of co-production at the level of the individual ser...
Coproduction of healthcare service.
Batalden, Maren; Batalden, Paul; Margolis, Peter; Seid, Michael; Armstrong, Gail; Opipari-Arrigan, Lisa; Hartung, Hans
2016-07-01
Efforts to ensure effective participation of patients in healthcare are called by many names-patient centredness, patient engagement, patient experience. Improvement initiatives in this domain often resemble the efforts of manufacturers to engage consumers in designing and marketing products. Services, however, are fundamentally different than products; unlike goods, services are always 'coproduced'. Failure to recognise this unique character of a service and its implications may limit our success in partnering with patients to improve health care. We trace a partial history of the coproduction concept, present a model of healthcare service coproduction and explore its application as a design principle in three healthcare service delivery innovations. We use the principle to examine the roles, relationships and aims of this interdependent work. We explore the principle's implications and challenges for health professional development, for service delivery system design and for understanding and measuring benefit in healthcare services. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/
Martínez, José M.; Kok, Jan; Sanders, Jan W.; Hernández, Pablo E.
2000-01-01
Antibodies against enterocin A were obtained by immunization of rabbits with synthetic peptides PH4 and PH5 designed, respectively, on the N- and C-terminal amino acid sequences of enterocin A and conjugated to the carrier protein KLH. Anti-PH4-KLH antibodies not only recognized enterocin A but also pediocin PA-1, enterocin P, and sakacin A, three bacteriocins which share the N-terminal class IIa consensus motif (YGNGVXC) that is contained in the sequence of the peptide PH4. In contrast, anti-PH5-KLH antibodies only reacted with enterocin A because the amino acid sequences of the C-terminal parts of class IIa bacteriocins are highly variable. Enterocin A and/or pediocin PA-1 structural and immunity genes were introduced in Lactococcus lactis IL1403 to achieve (co)production of the bacteriocins. The level of production of the two bacteriocins was significantly lower than that obtained by the wild-type producers, a fact that suggests a low efficiency of transport and/or maturation of these bacteriocins by the chromosomally encoded bacteriocin translocation machinery of IL1403. Despite the low production levels, both bacteriocins could be specifically detected and quantified with the anti-PH5-KLH (anti-enterocin A) antibodies isolated in this study and the anti-PH2-KLH (anti-pediocin PA-1) antibodies previously generated (J. M. Martínez, M. I. Martínez, A. M. Suárez, C. Herranz, P. Casaus, L. M. Cintas, J. M. Rodríguez, and P. E. Hernández, Appl. Environ. Microbiol. 64:4536–4545, 1998). In this work, the availability of antibodies for the specific detection and quantification of enterocin A and pediocin PA-1 was crucial to demonstrate coproduction of both bacteriocins by L. lactis IL1403(pJM04), because indicator strains that are selectively inhibited by each bacteriocin are not available. PMID:10919819
Leg tissue composition and physico-chemical parameters of sheep meat fed annatto coproduct
Directory of Open Access Journals (Sweden)
Dorgival Morais de Lima Júnior
2017-10-01
Full Text Available Our objective was to evaluate leg tissue composition and physico-chemical quality parameters of sheep meat fed with increasing levels of annatto coproduct. 32 male uncastrated animals without a defined breed were randomized in four treatments (0, 100, 200 and 300 g kg-1 of annatto coproduct in the DM diet. After 78 days of confinement, the animals were slaughtered and body components were recorded. Reconstituted leg weight, total muscle weight, biceps weight and semitendinosus weight showed a negative linear behavior (P 0.05 were found for leg tissue composition (%, muscle:bone ratio, relative fat or leg muscle. Meat physico-chemical parameters (color, shear force, water retention capacity and cooking losses were not affected by the inclusion of the annatto coproduct in the diet. The annatto coproduct can be included in up to 300 g kg-1 of dietary dry matter without negative effects to the leg tissue composition (% and physical parameters of confined sheep meat.
Some theoretical perspectives of co-creation and co-production of value by customers
Directory of Open Access Journals (Sweden)
Nic S. Terblanche
2014-05-01
Motivation for the study: No real attention was paid to the concepts of co-production and co-creation by marketing academics after the initial introduction of the concepts. Only after the year 2000 did co-production and co-creation begin to receive the attention of marketing academics, with a substantial increase in publications over the past few years. Contribution/value-add: The objective of this article was to present an overview of the origin and development of co-creation and co-production in marketing, to draw a distinction between the two concepts and to address the implications of these concepts for various decision areas in marketing.
User Participation in Coproduction of Health Innovation: Proposal for a Synergy Project.
Nygren, Jens; Zukauskaite, Elena; Westberg, Niklas
2018-05-09
This project concerns advancing knowledge, methods, and logic for user participation in coproduction of health innovations. Such advancement is vital for several reasons. From a user perspective, participation in coproduction provides an opportunity to gain real influence over goal definition, design, and implementation of health innovations, ensuring that the solution developed solves real problems in right ways. From a societal perspective, it's a mean to improve the efficiency of health care and the implementation of the Patient Act. As for industry, frameworks and knowledge of coproduction offer tools to operate in a complex sector, with great potential for innovation of services and products. The fundamental objective of this project is to advance knowledge and methods of how user participation in the coproduction of health innovations can be applied in order to benefit users, industry, and public sector. This project is a synergy project, which means that the objective will be accomplished through collaboration and meta-analysis between three subprojects that address different user groups, apply different strategies to promote human health, and relate to different parts of the health sector. Furthermore, subprojects focus on distinctive stages in the spectrum of innovation, with the objective to generate knowledge of the innovation process as a whole. The project is organized around three work packages related to three challenges-coproduction, positioning, and realization. Each subproject is designed such that it has its own field of study with clearly identified objectives but also targets work packages to contribute to the project as a whole. The work on the work packages will use case methodology for data collection and analysis based on the subprojects as data sources. More concretely, logic of multiple case studies will be applied with each subproject representing a separate case which is similar to each other in its attention to user participation in
Knowledge co-production and boundary work to promote implementation of conservation plans.
Nel, Jeanne L; Roux, Dirk J; Driver, Amanda; Hill, Liesl; Maherry, Ashton C; Snaddon, Kate; Petersen, Chantel R; Smith-Adao, Lindie B; Van Deventer, Heidi; Reyers, Belinda
2016-02-01
Knowledge co-production and boundary work offer planners a new frame for critically designing a social process that fosters collaborative implementation of resulting plans. Knowledge co-production involves stakeholders from diverse knowledge systems working iteratively toward common vision and action. Boundary work is a means of creating permeable knowledge boundaries that satisfy the needs of multiple social groups while guarding the functional integrity of contributing knowledge systems. Resulting products are boundary objects of mutual interest that maintain coherence across all knowledge boundaries. We examined how knowledge co-production and boundary work can bridge the gap between planning and implementation and promote cross-sectoral cooperation. We applied these concepts to well-established stages in regional conservation planning within a national scale conservation planning project aimed at identifying areas for conserving rivers and wetlands of South Africa and developing an institutional environment for promoting their conservation. Knowledge co-production occurred iteratively over 4 years in interactive stake-holder workshops that included co-development of national freshwater conservation goals and spatial data on freshwater biodiversity and local conservation feasibility; translation of goals into quantitative inputs that were used in Marxan to select draft priority conservation areas; review of draft priority areas; and packaging of resulting map products into an atlas and implementation manual to promote application of the priority area maps in 37 different decision-making contexts. Knowledge co-production stimulated dialogue and negotiation and built capacity for multi-scale implementation beyond the project. The resulting maps and information integrated diverse knowledge types of over 450 stakeholders and represented >1000 years of collective experience. The maps provided a consistent national source of information on priority conservation areas
Integrable systems and loop coproducts
International Nuclear Information System (INIS)
Musso, Fabio
2010-01-01
We present a generalization of a framework for the construction of classical integrable systems that we call loop coproduct formulation (Musso 2010 J. Phys. A: Math. Theor. 43 434026). In this paper, the loop coproduct formulation includes systems of Gelfand-Tsetlin type, the linear r-matrix formulation, the Sklyanin algebras, the reflection algebras, the coalgebra symmetry approach and some of its generalizations as particular cases, showing that all these apparently different approaches have a common algebraic origin. On the other hand, all these subcases do not exhaust the domain of applicability of this new technique, so that new possible directions of investigation do naturally emerge in this framework.
Evaluating the Effects of Co-Production Initiatives in Public Service Organizations
DEFF Research Database (Denmark)
Brix, Jacob; Krogstrup, Hanne Kathrine; Mortensen, Nanna Møller
2017-01-01
A change from New Public Management to New Public Governance (NPG) does not occur overnight. This forces public service organizations to develop new hybrid organizational forms as strategic response to the current situation. In NPG the basic assumption is that coproduction will result in increased...... efficiency and effectiveness for public service organizations as a new organizational recipe. However, a recent review determines that only few empirical studies document these claimed effects. To enable the creation of more empirical evidence that establish the effects of co-production, the purpose of our...
Directory of Open Access Journals (Sweden)
Jo Cooke
2017-06-01
Full Text Available The Rycroft-Malone paper states that co-production relies on ‘authentic’ collaboration as a context for action. Our commentary supports and extends this assertion. We suggest that ‘authentic’ co-production involves processes where participants can ‘see’ the difference that they have made within the project and beyond. We provide examples including: the use of design in health projects which seek to address power issues and make contributions visible through iteration and prototyping; and the development of ‘actionable outputs’ from research that are the physical embodiment of coproduction. Finally, we highlight the elements of the Collaboration for Leadership in Applied Health Research and Care (CLAHRC architecture that enables the inclusion of such collaborative techniques that demonstrate visible co-production. We reinforce the notion that maintaining collaboration requires time, flexible resources, blurring of knowledge produceruser boundaries, and leaders who promote epistemological tolerance and methodological exploration.
Coproduction as a structural transformation of the public sector
Meijer, Albert
2016-01-01
Purpose: Coproduction fundamentally changes the roles of citizens and governments. The purpose of this paper is to enhance the theoretical understanding of the transformative changes in the structural order of the public domain that result from the coproduction of public services.
Timm, K.; Reynolds, J.; Littell, J. S.; Murphy, K.; Euskirchen, E. S.; Breen, A. L.; Gray, S. T.; McGuire, A. D.; Rupp, S. T.
2017-12-01
Responding to the impacts of climate change and generating information that helps inform resource management requires exceptional communication and collaboration among researchers, managers, and other stakeholders. However, there is relatively little guidance on how to practically develop, facilitate, and evaluate this process given the highly specific and localized nature of many co-production efforts in terms of information needs, research questions, partners, and associated institutions. The Integrated Ecosystem Model (IEM) for Alaska and Northwest Canada was developed to understand how climate change influences interactions among disturbance (e.g. wildfire, thermokarst), permafrost, hydrology, and vegetation and identify how these changes affect valuable ecosystem services. The IEM was a unique co-production effort in that it was driven by broad management interests (rather than one research question), and because of the landscape-scale outputs, much broader engagement was warranted. Communication between the research team and the broader community of resource managers was facilitated by the Alaska Landscape Conservation Cooperatives and the Alaska Climate Science Center. Team members' reflections on the project confirm the importance of deliberate approaches to collaboration, where everyone has frequent opportunities to discuss goals, assumptions, and presumed outcomes of the project itself, as well as the elements of the process (i.e. meetings, reports, etc.). However, managing these activities requires significant time, resources, and perhaps more dedicated personnel. The lessons learned from the design and application of the IEM are highly relevant to researchers and land managers in other regions that are considering the development of a similar tool or an undertaking of similar magnitude, scale, and complexity.
Scholten, R.H.J.; Rijnen, M.M.J.A.; Schrama, J.W.; Boer, H.; Vesseur, P.C.; Hartog, den L.A.; Peet-Schwering, van der C.M.C.; Verstegen, M.W.A.
2001-01-01
The effects of a 6-day storage period on changes in dry matter, crude ash, crude protein, true protein, crude fat, starch, soluble starch, sugar and lactose of three liquid coproducts and two liquid compound diets were studied. The three liquid coproducts studied were: liquid wheat starch (LWS),
Market analysis of shale oil co-products. Summary report
Energy Technology Data Exchange (ETDEWEB)
1980-12-01
This study examines the potential for separating, upgrading and marketing sodium mineral co-products together with shale oil production. The co-products investigated are soda ash and alumina which are derived from the minerals nahcolite and dawsonite. Five cases were selected to reflect the variance in mineral and shale oil content in the identified resource. In the five cases examined, oil content of the shale was varied from 20 to 30 gallons per ton. Two sizes of facilities were analyzed for each resource case to determine economies of scale between a 15,000 barrel per day demonstration unit and a 50,000 barrel per day full sized plant. Three separate pieces of analysis were conducted in this study: analysis of manufacturing costs for shale oil and co-products; projection of potential world markets for alumina, soda ash, and nahcolite; and determination of economic viability and market potential for shale co-products.
Directory of Open Access Journals (Sweden)
Kathleen P. Bell
2013-09-01
Full Text Available Building successful, enduring research partnerships is essential for improving links between knowledge and action to address sustainability challenges. Communication research can play a critical role in fostering more effective research partnerships, especially those concerned with knowledge co-production processes. This article focuses on community-university research partnerships and factors that influence participation in the co-production process. We identify specific pathways for improving partnership development through a prospective analytical approach that examines community officials’ interest in partnering with university researchers. Using survey responses from a statewide sample of Maine municipal officials, we conduct a statistical analysis of community-university partnership potential to test a conceptual model of partnership interest grounded in natural resource management theory and environmental communication. Our findings both support and advance prior research on collaborations. Results reveal that belief in the helpfulness of the collaborator to solve problems, institutional proximity, familiarity, perceived problem severity and problem type and trust influence interest in developing community-university partnerships. These findings underscore the benefits of proactively assessing partnership potential prior to forming partnerships and the important roles for communication research within sustainability science, especially with regard to strengthening partnership formation and knowledge co-production processes.
Team Science, Justice, and the Co-Production of Knowledge.
Tebes, Jacob Kraemer
2018-06-08
Science increasingly consists of interdisciplinary team-based research to address complex social, biomedical, public health, and global challenges through a practice known as team science. In this article, I discuss the added value of team science, including participatory team science, for generating scientific knowledge. Participatory team science involves the inclusion of public stakeholders on science teams as co-producers of knowledge. I also discuss how constructivism offers a common philosophical foundation for both community psychology and team science, and how this foundation aligns well with contemporary developments in science that emphasize the co-production of knowledge. I conclude with a discussion of how the co-production of knowledge in team science can promote justice. © Society for Community Research and Action 2018.
Bioethanol production potential from Brazilian biodiesel co-products
Energy Technology Data Exchange (ETDEWEB)
Visser, Evan Michael; Filho, Delly Oliveira; Martins, Marcio Aredes [Departamento de Engenharia Agricola, Universidade Federal de Vicosa, Campus Universitario 36570-000 Vicosa, MG (Brazil); Steward, Brian L. [Department of Agricultural and Biosystems Engineering, Iowa State University, 214D Davidson Hall, Ames, IA 50011 (United States)
2011-01-15
One major problem facing the commercial production of cellulosic ethanol is the challenge of economically harvesting and transporting sufficient amounts of biomass as a feedstock at biorefinery plant scales. Oil extraction for biodiesel production, however, yields large quantities of biomass co-products rich in cellulose, sugar and starch, which in many cases may be sufficient to produce enough ethanol to meet the alcohol demands of the transesterification process. Soybean, castor bean, Jatropha curcas, palm kernel, sunflower and cottonseed were studied to determine ethanol production potential from cellulose found in the oil extraction co-products and also their capacity to meet transesterification alcohol demands. All crops studied were capable of producing enough ethanol for biodiesel production and, in the case of cottonseed, 470% of the transesterification demand could be met with cellulosic ethanol production from oil extraction co-products. Based on Brazilian yields of the crops studied, palm biomass has the highest potential ethanol yield of 108 m{sup 3} km{sup -2} followed by J. curcas with 40 m{sup 3} km{sup -2}. A total of 3.5 hm{sup 3} could be produced from Brazilian soybean oil extraction co-products. (author)
Biofuels and Their Co-Products as Livestock Feed: Global Economic and Environmental Implications.
Popp, József; Harangi-Rákos, Mónika; Gabnai, Zoltán; Balogh, Péter; Antal, Gabriella; Bai, Attila
2016-02-29
This review studies biofuel expansion in terms of competition between conventional and advanced biofuels based on bioenergy potential. Production of advanced biofuels is generally more expensive than current biofuels because products are not yet cost competitive. What is overlooked in the discussion about biofuel is the contribution the industry makes to the global animal feed supply and land use for cultivation of feedstocks. The global ethanol industry produces 44 million metric tonnes of high-quality feed, however, the co-products of biodiesel production have a moderate impact on the feed market contributing to just 8-9 million tonnes of protein meal output a year. By economically displacing traditional feed ingredients co-products from biofuel production are an important and valuable component of the biofuels sector and the global feed market. The return of co-products to the feed market has agricultural land use (and GHG emissions) implications as well. The use of co-products generated from grains and oilseeds can reduce net land use by 11% to 40%. The proportion of global cropland used for biofuels is currently some 2% (30-35 million hectares). By adding co-products substituted for grains and oilseeds the land required for cultivation of feedstocks declines to 1.5% of the global crop area.
Cooke, Jo; Langley, Joe; Wolstenholme, Dan; Hampshaw, Susan
2016-10-17
The Rycroft-Malone paper states that co-production relies on 'authentic' collaboration as a context for action. Our commentary supports and extends this assertion. We suggest that 'authentic' co-production involves processes where participants can 'see' the difference that they have made within the project and beyond. We provide examples including: the use of design in health projects which seek to address power issues and make contributions visible through iteration and prototyping; and the development of 'actionable outputs' from research that are the physical embodiment of co-production. Finally, we highlight the elements of the Collaboration for Leadership in Applied Health Research and Care (CLAHRC) architecture that enables the inclusion of such collaborative techniques that demonstrate visible co-production. We reinforce the notion that maintaining collaboration requires time, flexible resources, blurring of knowledge producer-user boundaries, and leaders who promote epistemological tolerance and methodological exploration. © 2017 The Author(s); Published by Kerman University of Medical Sciences. This is an open-access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
EARLY ENTRANCE COPRODUCTION PLANT
Energy Technology Data Exchange (ETDEWEB)
Fred D. Brent; Lalit Shah; Earl Berry; Charles H. Schrader; John Anderson; Ming He; James F. Stevens; Centha A. Davis; Michael Henley; Jerome Mayer; Harry Tsang; Jimell Erwin; Jennifer Adams; Michael Tillman; Chris Taylor; Marjan J. Roos; Robert F. Earhart
2004-01-27
The overall objective of this project is the three phase development of an Early Entrance Coproduction Plant (EECP) which uses petroleum coke to produce at least one product from at least two of the following three categories: (1) electric power (or heat), (2) fuels, and (3) chemicals using ChevronTexaco's proprietary gasification technology. The objective of Phase I is to determine the feasibility and define the concept for the EECP located at a specific site; develop a Research, Development, and Testing (RD&T) Plan to mitigate technical risks and barriers; and prepare a Preliminary Project Financing Plan. The objective of Phase II is to implement the work as outlined in the Phase I RD&T Plan to enhance the development and commercial acceptance of coproduction technology. The objective of Phase III is to develop an engineering design package and a financing and testing plan for an EECP located at a specific site. The project's intended result is to provide the necessary technical, economic, and environmental information needed by industry to move the EECP forward to detailed design, construction, and operation. The partners in this project are Texaco Energy Systems LLC or TES (a subsidiary of ChevronTexaco), General Electric (GE), Praxair, and Kellogg Brown & Root (KBR) in addition to the U.S. Department of Energy (DOE). TES is providing gasification technology and Fischer-Tropsch (F-T) technology developed by Rentech, GE is providing combustion turbine technology, Praxair is providing air separation technology, and KBR is providing engineering. Each of the EECP subsystems was assessed for technical risks and barriers. A plan was developed to mitigate the identified risks (Phase II RD&T Plan, October 2000). The potential technical and economic risks to the EECP from Task 2.5 can be mitigated by demonstrating that the end-use products derived from the upgrading of the F-T synthesis total liquid product can meet or exceed current specifications for the
Huang, Chen; Ragauskas, Arthur J; Wu, Xinxing; Huang, Yang; Zhou, Xuelian; He, Juan; Huang, Caoxing; Lai, Chenhuan; Li, Xin; Yong, Qiang
2018-02-01
A novel bio-refinery sequence yielding varieties of co-products was developed using straw pulping solid residue. This process utilizes neutral sulfite pretreatment which under optimal conditions (160 °C and 3% (w/v) sulfite charge) provides 64.3% delignification while retaining 90% of cellulose and 67.3% of xylan. The pretreated solids exhibited excellent enzymatic digestibility, with saccharification yields of 86.9% and 81.1% for cellulose and xylan, respectively. After pretreatment, the process of semi-simultaneous saccharification and fermentation (S-SSF) and bio-catalysis was investigated. The results revealed that decreased ethanol yields were achieved when solid loading increased from 5% to 30%. An acceptable ethanol yield of 76.8% was obtained at 20% solid loading. After fermentation, bio-catalysis of xylose remaining in fermentation broth resulted in near 100% xylonic acid (XA) yield at varied solid loadings. To complete the co-product portfolio, oxidation ammoniation of the dissolved lignin successfully transformed it into biodegradable slow-release nitrogen fertilizer with excellent agricultural properties. Copyright © 2017 Elsevier Ltd. All rights reserved.
Assessing environmental consequences of using co-products in animal feed
Zanten, van H.H.E.; Mollenhorst, H.; Vries, de J.W.; Middelaar, van C.E.; Kernebeek, van H.R.J.; Boer, de I.J.M.
2014-01-01
The livestock sector has a major impact on the environment. This environmental impact may be reduced by feeding agricultural co-products (e.g. beet tails) to livestock, as this transforms inedible products for humans into edible products, e.g. pork or beef. Nevertheless, co-products have different
Service Co-Production, Customer Efficiency and Market Competition
Mei Xue; Patrick T. Harker
2003-01-01
Customers’ participation in service co-production processes has been increasing with the rapid development of self-service technologies and business models that rely on self-service as the main service delivery channel. However, little is known about how the level of participation of customers in service delivery processes influences the competition among service providers. In this paper, a game-theoretic model is developed to study the competition among service providers when selfservice is ...
International Nuclear Information System (INIS)
Ben Yahmed, Nesrine; Jmel, Mohamed Amine; Ben Alaya, Monia; Bouallagui, Hassib; Marzouki, M. Nejib; Smaali, Issam
2016-01-01
Highlights: • Chaetomorpha linum was used as sustainable feedstock for co-production of bioethanol and biomethane. • An eco-friendly process was developed, only generating 0.3 ± 0.01 g/g of waste. • Ethanol yield obtained was 0.41 g/g reducing sugar. • Methane yield obtained was 0.26 ± 0.045 L/gVS. - Abstract: An innovative integrated biorefinery approach using the green macroalgae Chaetomorpha linum was investigated in the present study for the co-production of bioethanol and biogas. Among three pretreatments of C. linum biomass, consisting of acidic, neutral and alkali ones, 3% NaOH pretreatment gave the best result in terms of thallus disintegration, biomass recovery and enzymatic digestibility as demonstrated by scanning electron microscopy and saccharification tests. The hydrolysis of C. linum feedstock with a crude specific enzyme preparation, locally produced from fermentation of Aspergillus awamori, at 45 °C, pH 5 for 30 h gave the maximum yield of fermentable sugar of 0.22 ± 0.02 g/g dry substrate. An ethanol yield of 0.41 g/g reducing sugar corresponding to about 0.093 g/g pretreated algae was obtained after alcoholic fermentation by Saccharomyces cerevisiae. In the integrated proposed process, mycelium issued from the fungal fermentation, liquid issued from alkali pretreatment, residual from the non-hydrolysable biomass and all effluents and co-products represent a heterogeneous substrate that feed an anaerobic digester for biogas production. GC-analysis of this later showed that the biomethane yield reached 0.26 ± 0.045 L/gVS. This study presents therefore an eco-friendly biorefining process, which efficiently coproduce bioethanol and biomethane and generate only a single waste (0.3 ± 0.01 g/g) allowing an almost complete conversion of the algal biomass.
Experiences of Serveis de Cultura Popular in the Field of Co-Production and Exchange.
Tuni, Lluis
1992-01-01
Describes efforts of Serveis de Cultura Popular, a nonprofit foundation in Barcelona (Spain), in the coproduction of educational videos. Highlights include contests that awarded prizes for completed videos, video scripts, or ideas for videos; coproduction with educational television; coproduction of an interactive videodisc; and international…
Directory of Open Access Journals (Sweden)
Hernández-Alcántara Annel M
2016-12-01
Full Text Available Agro-industrial co-products derived of fruit processing represents an important source of bioactive compounds as fiber, antioxidants and prebiotics. The objective of this work was to determine the content of fiber, antioxidant capacity and prebiotic activity of three flours obtained from commonly co-products (banana peel, apple peel, and carrot bagasse. The results showed a higher total fiber content in carrot bagasse, and lower in apple peel. Significantly differences were found in antioxidant activity. Fruit co-products flours were a suitable carbon source increasing specific growth rate with a reduction in duplication time as compared to glucose. The prebiotic activity was positive in the three co-products, all flours survived at pH 1.0 and showed resistance to simulated gastric acid for about 60 min. Banana peel, apple peel and carrot bagasse showed to be a good source of bioactive compounds as fiber and antioxidants and can be used as prebiotics for lactic acid bacteria.
HCl co-production from CFC alternatives: Threat or opportunity?
International Nuclear Information System (INIS)
Mikulka, C.J.
1990-01-01
CFC production facilities have typically been located near CFC consumers and not necessarily near their feedstock sources. The co-production of HCl from these facilities has in the past been small and manageable by the CFC producers. Production of the CFC replacements, however, will result in larger quantities of HCl co-production at a scrutiny. Since new facilities are likely to be required for the replacements, there may be the opportunity to site facilities next to chlorocarbon suppliers who may be in a better position to take back the HCl co-product for reuse in their production facilities. This paper provides an overview of these issues as well as considers the implications of returning the HCl to the chlorocarbon supplier as well as viability of converting HCl back to chlorine
Cooke, Jo; Langley, Joe; Wolstenholme, Dan; Hampshaw, Susan
2017-01-01
The Rycroft-Malone paper states that co-production relies on ‘authentic’ collaboration as a context for action. Our commentary supports and extends this assertion. We suggest that ‘authentic’ co-production involves processes where participants can ‘see’ the difference that they have made within the project and beyond. We provide examples including: the use of design in health projects which seek to address power issues and make contributions visible through iteration and prototyping; and the development of ‘actionable outputs’ from research that are the physical embodiment of co-production. Finally, we highlight the elements of the Collaboration for Leadership in Applied Health Research and Care (CLAHRC) architecture that enables the inclusion of such collaborative techniques that demonstrate visible co-production. We reinforce the notion that maintaining collaboration requires time, flexible resources, blurring of knowledge producer-user boundaries, and leaders who promote epistemological tolerance and methodological exploration. PMID:28812827
Market analysis of shale oil co-products. Appendices
Energy Technology Data Exchange (ETDEWEB)
1980-12-01
Data are presented in these appendices on the marketing and economic potential for soda ash, aluminia, and nahcolite as by-products of shale oil production. Appendices 1 and 2 contain data on the estimated capital and operating cost of an oil shales/mineral co-products recovery facility. Appendix 3 contains the marketing research data.
Collaboration and Co-Production of Knowledge in Healthcare: Opportunities and Challenges
Directory of Open Access Journals (Sweden)
Jo Rycroft-Malone
2016-04-01
Full Text Available Over time there has been a shift, at least in the rhetoric, from a pipeline conceptualisation of knowledge implementation, to one that recognises the potential of more collaboration, co-productive approaches to knowledge production and use. In this editorial, which is grounded in our research and collective experience, we highlight both the potential and challenge with collaboration and co-production. This includes issues about stakeholder engagement, governance arrangements, and capacity and capability for working in a coproductive way. Finally, we reflect on the fact that this approach is not a panacea, but is accompanied by some philosophical and practical challenges.
The co-production of what? Knowledge, values, and social relations in health care.
Directory of Open Access Journals (Sweden)
Angela Filipe
2017-05-01
Full Text Available "Co-production" is becoming an increasingly popular term in policymaking, governance, and research. While the shift from engagement and involvement to co-production in health care holds the promise of revolutionising health services and research, it is not always evident what counts as co-production: what is being produced, under what circumstances, and with what implications for participants. We discuss these questions and propose that co-production can be understood as an exploratory space and a generative process that leads to different, and sometimes unexpected, forms of knowledge, values, and social relations. By opening up this discussion, we hope to stimulate future debates on co-production as well as draw out ways of thinking differently about collaboration and participation in health care and research. Part of the title of this article is inspired by the book "The Social Construction of What?" by Ian Hacking (Cambridge, MA: Harvard University Press; 2000.
International Nuclear Information System (INIS)
Unknown
2001-01-01
Waste Processors Management Inc. (WMPI), along with its subcontractors entered into a cooperative agreement with the USDOE to assess the techno-economic viability of building an Early Entrance Co-Production Plant (EECP) in the US that produces ultra clean Fischer-Tropsch transportation fuels with either power or steam as the major co-product. The EECP will emphasize on reclaiming and gasifying low-cost coal waste and/or its mixture as the primary feedstocks. The project consists of three phases. Phase I objectives include conceptual development, technical assessment, feasibility design and economic evaluation of a Greenfield commercial co-production plant and a site specific demonstration EECP to be located adjacent to the existing WMPI Gilberton Power Station. There is very little foreseen design differences between the Greenfield commercial coproduction plant versus the EECP plant other than: The greenfield commercial plant will be a stand alone FT/power co-production plant, potentially larger in capacity to take full advantage of economy of scale, and to be located in either western Pennsylvania, West Virginia or Ohio, using bituminous coal waste (gob) and Pennsylvania No.8 coal or other comparable coal as the feedstock; The EECP plant, on the other hand, will be a nominal 5000 bpd plant, fully integrated into the Gilbertson Power Company's Cogeneration Plant to take advantage of the existing infrastructure to reduce cost and minimize project risk. The Gilberton EECP plant will be designed to use eastern Pennsylvania anthracite coal waste and/or its mixture as feedstock
Coproductive capacities: rethinking science-governance relations in a diverse world
Directory of Open Access Journals (Sweden)
Lorrae E. van Kerkhoff
2015-03-01
Full Text Available Tackling major environmental change issues requires effective partnerships between science and governance, but relatively little work in this area has examined the diversity of settings from which such partnerships may, or may not, emerge. In this special feature we draw on experiences from around the world to demonstrate and investigate the consequences of diverse capacities and capabilities in bringing science and governance together. We propose the concept of coproductive capacities as a useful new lens through which to examine these relations. Coproductive capacity is "the combination of scientific resources and governance capability that shapes the extent to which a society, at various levels, can operationalize relationships between scientific and public, private, and civil society institutions and actors to effect scientifically-informed social change." This recasts the relationships between science and society from notions of "gaps" to notions of interconnectedness and interplay (coproduction; alongside the societal foundations that shape what is or is not possible in that dynamic connection (capacities. The articles in this special feature apply this concept to reveal social, political, and institutional conditions that both support and inhibit high-quality environmental governance as global issues are tackled in particular places. Across these articles we suggest that five themes emerge as important to understanding coproductive capacity: history, experience, and perceptions; quality of relationships (especially in suboptimal settings; disjunct across scales; power, interests, and legitimacy; and alternative pathways for environmental governance. Taking a coproductive capacities perspective can help us identify which interventions may best enable scientifically informed, but locally sensitive approaches to environmental governance.
Sustainable multipurpose biorefineries for third-generation biofuels and value-added co-products
Modern biorefinery facilities conduct many types of processes, including those producing advanced biofuels, commodity chemicals, biodiesel, and value-added co-products such as sweeteners and bioinsecticides, with many more co-products, chemicals and biofuels on the horizon. Most of these processes ...
EARLY ENTRANCE COPRODUCTION PLANT
Energy Technology Data Exchange (ETDEWEB)
John S. Abughazaleh; Mushtaq Ahmed; Ashok Anand; John H. Anderson; Charles Benham; Fred D. Brent; Thomas E. Chance; William K. Davis; Raymond F. Drnevich; Larry Hall; Ming He; Stephen A. Lang; David Mintner; Wendy Moore; Jimmy O. Ong; George Potoczniak; Adela G. Sanchez; Charles H. Schrader; Lalit S. Shah; Kalapi D. Sheth; Phil J. Shires; Rae Song
2001-05-17
The overall objective of this project is the three-phase development of an Early Entrance Coproduction Plant (EECP) that produces at least one product from at least two of the following three categories: Electric power (or heat); Fuels; and Chemicals. The objective is to have these products produced by technologies capable of using synthesis gas derived from coal and/or some other carbonaceous feedstock, such as petroleum coke. The objective of Phase I was to determine the feasibility and define the concept for the EECP located at a specific site and to develop a Research, Development, and Testing (RD and T) Plan for implementation in Phase II. This objective has now been accomplished. A specific site, Motiva Refinery in Port Arthur, Texas, has been selected as the location best suited for the EECP. The accomplishments of Phase I are discussed in detail in this Phase I Concept Report. A RD and T Plan and a preliminary project financing plan have been developed and are submitted separately from this report.
Thermodynamic and economic evaluation of co-production plants for electricity and potable water
International Nuclear Information System (INIS)
1997-05-01
Within the framework of the IAEA's activities related to seawater desalination using nuclear energy, a need was identified for developing criteria and methodologies in order to facilitate comparative economic evaluations of nuclear and fossil fuelled energy sources for desalination and generation of electricity. The aspect of costing of electricity and potable water from co-production plants is of particular interest. In response to these needs, the IAEA carried out a study to establish methodologies for allocating costs to the two final products of co-production plants based on thermodynamic criteria and to enable economic ranking of co-production plant alternatives. This publication describes the methodologies and presents the results obtained from analyzing a reference case, taken as an example. This publication has been discussed and reviewed at a consultants meeting convened by the IAEA in September 1996 in Vienna. The methodologies have been incorporated in an EXCEL spreadsheet routine which is available upon request from the IAEA. The IAEA staff member responsible for this publication is L. Breidenbach of the Division of Nuclear Power and the Fuel Cycle. 30 refs, figs, tabs
EARLY ENTRANCE COPRODUCTION PLANT
Energy Technology Data Exchange (ETDEWEB)
Fred D. Brent; Lalit Shah; Earl Berry; Charles H. Schrader; John Anderson; J. Erwin; Matthew G. Banks; Terry L. Ullman
2004-01-12
The overall objective of this project is the three phase development of an Early Entrance Coproduction Plant (EECP) which uses petroleum coke to produce at least one product from at least two of the following three categories: (1) electric power (or heat), (2) fuels, and (3) chemicals using ChevronTexaco's proprietary gasification technology. The objective of Phase I is to determine the feasibility and define the concept for the EECP located at a specific site; develop a Research, Development, and Testing (RD&T) Plan to mitigate technical risks and barriers; and prepare a Preliminary Project Financing Plan. The objective of Phase II is to implement the work as outlined in the Phase I RD&T Plan to enhance the development and commercial acceptance of coproduction technology. The objective of Phase III is to develop an engineering design package and a financing and testing plan for an EECP located at a specific site. The project's intended result is to provide the necessary technical, economic, and environmental information needed by industry to move the EECP forward to detailed design, construction, and operation. The partners in this project are Texaco Energy Systems LLC or TES (a subsidiary of ChevronTexaco), General Electric (GE), Praxair, and Kellogg Brown & Root (KBR) in addition to the U.S. Department of Energy (DOE). TES is providing gasification technology and Fischer-Tropsch (F-T) technology developed by Rentech, GE is providing combustion turbine technology, Praxair is providing air separation technology, and KBR is providing engineering. Each of the EECP subsystems was assessed for technical risks and barriers. A plan was developed to mitigate the identified risks (Phase II RD&T Plan, October 2000). Phase II RD&T Task 2.6 identified as potential technical risks to the EECP the fuel/engine performance and emissions of the F-T diesel fuel products. Hydrotreating the neat F-T diesel product reduces potentially reactive olefins, oxygenates, and acids
Public services management and co-production: a necessity, a fashion or a new public service ethos?
M. Andreani; E. Guarini; R. Ruffini; A. Sancino; M. Sicilia
2013-01-01
This paper aims at investigating the drivers of user/citizen involvement in the public service provision, the formal and informal co-production structures, the roles played by public managers in order to support co-production. We study the case of Lombardy Region (Italy) that is experiencing co-production of services for autistic people. This case allows us to analyze co-production across all the stages of the service cycle. Indeed, both users and public and third sector organizations are...
How Cities Think: Knowledge Co-Production for Urban Sustainability and Resilience
Tischa Muñoz-Erickson; Clark Miller; Thaddeus Miller
2017-01-01
Understanding and transforming how cities think is a crucial part of developing effective knowledge infrastructures for the Anthropocene. In this article, we review knowledge co-production as a popular approach in environmental and sustainability science communities to the generationof useable knowledge for sustainability and resilience. We present knowledge systems...
Microbial Production of Malic Acid from Biofuel-Related Coproducts and Biomass
Directory of Open Access Journals (Sweden)
Thomas P. West
2017-04-01
Full Text Available The dicarboxylic acid malic acid synthesized as part of the tricarboxylic acid cycle can be produced in excess by certain microorganisms. Although malic acid is produced industrially to a lesser extent than citric acid, malic acid has industrial applications in foods and pharmaceuticals as an acidulant among other uses. Only recently has the production of this organic acid from coproducts of industrial bioprocessing been investigated. It has been shown that malic acid can be synthesized by microbes from coproducts generated during biofuel production. More specifically, malic acid has been shown to be synthesized by species of the fungus Aspergillus on thin stillage, a coproduct from corn-based ethanol production, and on crude glycerol, a coproduct from biodiesel production. In addition, the fungus Ustilago trichophora has also been shown to produce malic acid from crude glycerol. With respect to bacteria, a strain of the thermophilic actinobacterium Thermobifida fusca has been shown to produce malic acid from cellulose and treated lignocellulosic biomass. An alternate method of producing malic acid is to use agricultural biomass converted to syngas or biooil as a substrate for fungal bioconversion. Production of poly(β-l-malic acid by strains of Aureobasidium pullulans from agricultural biomass has been reported where the polymalic acid is subsequently hydrolyzed to malic acid. This review examines applications of malic acid, metabolic pathways that synthesize malic acid and microbial malic acid production from biofuel-related coproducts, lignocellulosic biomass and poly(β-l-malic acid.
Co-production of hydrogen and electricity with CO{sub 2} capture
Energy Technology Data Exchange (ETDEWEB)
Arienti, S.; Cotone, P.; Davison, J. [Foster Wheeler Italiana (Italy)
2007-07-01
This paper summarizes the results of a study carried out by Foster Wheeler for the IEA Greenhouse Gas R & D Programme that focused on different IGCC configurations with CO{sub 2} capture and H{sub 2} production. The three following main cases are compared: production of hydrogen, with minimum amount of electricity for a stand-alone plant production; co-production of the optimum hydrogen/electricity ratio; and co-production of hydrogen and electricity in a flexible plant that varies the hydrogen/electricity ratio. The paper reviews three available gasification technologies and presents the results of a more detailed evaluation of the selected one. The scope of this paper is to underline possible advantages of hydrogen and electricity co-production from coal, that is likely going to replace natural gas and petroleum as a source of hydrogen in the long term. Expected advantage of co-production will be the ability to vary the hydrogen/electricity ratio to meet market demands. A natural gas, diesel and gasoline demand market analysis has been performed for the Netherlands and the USA to determine the expected future hydrogen demand. Plant performance and costs are established and electric power production costs are evaluated. Electricity and hydrogen co-production plants are compared to plants that produce electricity only, with and without CO{sub 2} capture, to evaluate the costs of CO{sub 2} avoidance. 4 refs., 8 figs., 4 tabs.
International Nuclear Information System (INIS)
Diebel, William; Reddy, Murali M.; Misra, Manju; Mohanty, Amar
2012-01-01
This paper gives an insight of biofuel production and the status -into the co-products obtained from this industry. Furthermore this work explores the possibility of these co-products as raw materials for value-added uses in material applications. This is achieved by understanding composition, solid density, and moisture content of prominent co-products such as soy meal, DDGS (distillers’ dried grains with solubles) and jatropha meal. Moisture content and density measurements showed no trend. Soy meal has the highest protein content, followed by jatropha and DDGS. Thermal stability of these co-products was analyzed by thermogravimetric analysis (TGA), which revealed that the thermal stabilities are ranked as soy meal>DDGS>jatropha meal. FT-IR spectroscopy was used to understand the functional groups in these meals and it showed that the amide group was prominent in all of these meals. In pursuit of finding value-added uses for these co-products of biofuel industries, biodegradable polymer, i.e. polycaprolactone (PCL), based biocomposites were prepared by melt processing technique using extrusion followed by injection molding. Tensile, flexural and impact properties were evaluated. Also, scanning electron microscopy (SEM) of fractured sections of the biocomposites was examined. -- Highlights: ► This paper gives an insight of biofuel production and its co-products. ► We have characterized biofuel co-products such as soy meal, DDGS and jatropha meal. ► Thermal stability and functional groups of these co-products were determined. ► Polycaprolactone based biocomposites were prepared by melt processing technique. ► Tensile, flexural and impact properties of these biocomposites were evaluated.
A Systematic Review of Co-Creation and Co-Production: Embarking on the social innovation journey
W.H. Voorberg (William); V.J.J.M. Bekkers (Victor); L.G. Tummers (Lars)
2014-01-01
textabstractThis article presents a systematic review of 122 articles and books (1987-2013) of co-creation/co-production with citizens in public innovation. It analyses (a) the objectives of co-creation and co-production, (b) its influential factors and (c) the outcomes of co-creation and
Co-Design in co-production processes:
DEFF Research Database (Denmark)
Seravalli, Anna; Agger Eriksen, Mette; Hillgren, Per-Anders
2017-01-01
The public sector, increasingly acknowledging a need for change but strongly influenced by market logics, is experimenting with new forms of co-production of public services based on collaborations between public providers, citizens and societal actors. At the same time, Co-design researchers...
Physicochemical characterization of raw materials and co-products from the titanium dioxide industry
International Nuclear Information System (INIS)
Gazquez, M.J.; Bolivar, J.P.; Garcia-Tenorio, R.; Vaca, F.
2009-01-01
The present study was conducted to characterize several raw materials and co-products from the titanium dioxide industry in relation to their elemental composition (major, minor and trace elements), granulometry, mineralogy, microscopic morphology and physical composition. The main objective was to gain basic information for the future potential application of these co-products in fields such as agriculture, construction, civil engineering, etc. Microscopic studies were performed by applying scanning electron microscopy with X-ray microanalysis (SEM-XRMA) while the mineralogical compositions were analysed by means of the X-ray diffraction (XRD) technique. The concentrations of major elements such as Na, Al, Si, Ca, Ti, Fe, S and K were determined by X-ray fluorescence (XRF), while heavy metals and other trace elements were determined by ICP-MS. The physicochemical characterization of the raw materials used in the titanium dioxide industry, in addition to the characterization of the co-products generated, has enabled the evaluation of the degree of fractionation of different elements and compounds between the different co-products, as well as the control of the possible variations in the physicochemical composition of the raw materials throughout the time and the study of the influence of these variations in the characteristics of the obtained co-products. As a main conclusion of our study, it is possible to indicate that the levels of the pollutant elements associated to the co-products analysed were, in general, within safe limits and, therefore, they could potentially be used in composites as fertilizers or for building materials in road construction, etc. Nevertheless, for the specific application of each of these co-products in agriculture, construction and civil engineering, additional studies need to be performed to evaluate their appropriateness for the proposed application, together with specific studies on their health and environmental impact.
Effects of co-products on the life-cycle impacts of microalgal biodiesel.
Soratana, Kullapa; Barr, William J; Landis, Amy E
2014-05-01
Microalgal biodiesel production has been investigated for decades, yet it is not commercially available. Part of the problem is that the production process is energy and chemical intensive due, in part, to the high portion of microalgal biomass left as residues. This study investigated cradle-to-gate life-cycle environmental impacts from six different scenarios of microalgal biodiesel and its co-products. Ozone depletion, global warming, photochemical smog formation, acidification and eutrophication potentials were assessed using the Tool for the Reduction and Assessment of Chemical and other environmental Impacts (TRACI). Monte Carlo Analysis was conducted to investigate the processes with major contribution in each impact category. The market opportunity for each co-product was examined based on supply, demand and prices of the products that could potentially be substituted by the co-products. The results indicated that the scenario with the least life-cycle environmental impacts in all the five impact categories with the highest net energy ratio was the scenario utilizing a multitude of co-products including bioethanol from lipid-extracted microalgae (LEA), biomethane (to produce electricity and heat) from simultaneous saccharification-fermentation (SSF) residues, land-applied material from SSF residue anaerobic digestion (AD) solid digestate, recycling nutrients from SSF residue AD liquid digestate and CO2 recovered from SSF process contributed. Decreasing the energy consumption of the centrifuge in the land-applied material production process and increasing the lipid content of microalgae can reduce environmental footprints of the co-products. The same scenario also had the highest total income indicating their potential as co-products in the market. Copyright © 2014 Elsevier Ltd. All rights reserved.
An exploratory study of co-production and its outcomes in the South ...
African Journals Online (AJOL)
Customer retention has become a vital contributor to profi tability in f rms, with the impact thereof over the long term being acknowledged as carrying great weight. The co-production process ... The study found a strong positive relationship between the benefits offered by co-production and customer satisfaction. This finding ...
Pawar, Shweta V; Rathod, Virendra K
2018-01-02
This study explores a novel concept of coproduction of uricase and alkaline protease by Bacillus licheniformis using single substrate in single step. Seven local bacterial strains were screened for uricase production, amongst which B. licheniformis is found to produce highest uricase along with alkaline protease. Optimization of various factors influencing maximum enzyme coproduction by B. licheniformis is performed. Maximum enzyme productivity of 0.386 U/mL uricase and 0.507 U/mL alkaline protease is obtained at 8 hr of incubation period, 1% (v/v) inoculum, and at 0.2% (w/v) uric acid when the organism is cultivated at 25°C, 180 rpm, in a media containing xylose as a carbon source, urea as a nitrogen source, and initial pH of 9.5. The statistical experimental design method of Box-Behnken was further applied to obtain optimal concentration of significant parameters such as pH (9.5), uric acid concentration (0.1%), and urea concentration (0.05%). The maximum uricase and alkaline protease production by B. licheniformis using Box-Behnken design was 0.616 and 0.582 U/mL, respectively, with 1.6- and 1.13-fold increase as compared to one factor at a time optimized media. This study will be useful to develop an economic, commercially viable, and scalable process for simultaneous production of uricase and protease enzymes.
Djenontin, Ida Nadia S.; Meadow, Alison M.
2018-06-01
This review paper addresses the challenging question of "how to" design and implement co-production of knowledge in climate science and other environmental and agricultural sciences. Based on a grounded theory review of nine (9) published case studies of transdisciplinary and collaborative research projects, the paper offers a set of common themes regarding specific components and processes for the design, implementation, and achievement of co-production of knowledge work, which represent the "Modus Operandi" of knowledge co-production. The analysis focuses on practical methodological guidance based on lessons from how different research teams have approached the challenges of complex collaborative research. We begin by identifying broad factors or actions that inhibit or facilitate the process, then highlight specific practices associated with co-production of knowledge and necessary competencies for undertaking co-production. We provide insights on issues such as the integration of social and professional cultures, gender and social equity, and power dynamics, and illustrate the different ways in which researchers have addressed these issues. By exploring the specific practices involved in knowledge co-production, this paper provides guidance to researchers on how to navigate different possibilities of the process of conducting transdisciplinary and co-production of knowledge research projects that best fit their research context, stakeholder needs, and research team capacities.
Energy Technology Data Exchange (ETDEWEB)
NONE
2010-07-01
The development of bio-fuels goes along with that of co-products which can be used to feed animals. After having recalled the political context which promotes the development of renewable energies, this document aims at giving an overview of the impact of bio-fuel co-products on agriculture economy. It discusses the production and price evolution for different crops
Directory of Open Access Journals (Sweden)
Russel N. Menchavez
2017-09-01
Full Text Available Crude glycerol from biodiesel production is a biobased material capable of co-producing biofuels and chemicals. This study aimed to develop a line of Ni catalysts supported on cerium–magnesium (Ce–Mg to improve the process efficiency of glycerol hydrogenolysis for ethanol and 1,2-propanediol (1,2-PDO. Results showed that catalytic activity was greatly improved by changing the preparation method from impregnation to deposition precipitation (DP, and by adjusting calcination temperatures. Prepared via DP, the catalysts of 25 wt % Ni supported on Ce–Mg (9:1 mol/mol greatly improved the effectiveness in glycerol conversion while maintaining the selectivities to ethanol and 1,2-PDO. Calcination at 350 °C provided the catalysts better selectivities of 15.61% to ethanol and 67.93% to 1,2-PDO. Increases in reaction temperature and time improved the conversion of glycerol and the selectivity to ethanol, but reduced the selectivity to 1,2-PDO. A lower initial water content led to a higher conversion of glycerol, but lower selectivities to ethanol and 1,2-PDO. Higher hydrogen application affected the glycerol conversion rate positively, but the selectivities to ethanol and 1,2-PDO negatively. A comparison to the commercial Raney® Ni catalyst showed that the Ni/Ce–Mg catalyst developed in this study showed a better potential for the selective co-production of ethanol and 1,2-PDO from glycerol hydrogenolysis.
Yarbrough, John M; Zhang, Ruoran; Mittal, Ashutosh; Vander Wall, Todd; Bomble, Yannick J; Decker, Stephen R; Himmel, Michael E; Ciesielski, Peter N
2017-03-28
Producing fuels, chemicals, and materials from renewable resources to meet societal demands remains an important step in the transition to a sustainable, clean energy economy. The use of cellulolytic enzymes for the production of nanocellulose enables the coproduction of sugars for biofuels production in a format that is largely compatible with the process design employed by modern lignocellulosic (second generation) biorefineries. However, yields of enzymatically produced nanocellulose are typically much lower than those achieved by mineral acid production methods. In this study, we compare the capacity for coproduction of nanocellulose and fermentable sugars using two vastly different cellulase systems: the classical "free enzyme" system of the saprophytic fungus, Trichoderma reesei (T. reesei) and the complexed, multifunctional enzymes produced by the hot springs resident, Caldicellulosiruptor bescii (C. bescii). We demonstrate by comparative digestions that the C. bescii system outperforms the fungal enzyme system in terms of total cellulose conversion, sugar production, and nanocellulose production. In addition, we show by multimodal imaging and dynamic light scattering that the nanocellulose produced by the C. bescii cellulase system is substantially more uniform than that produced by the T. reesei system. These disparities in the yields and characteristics of the nanocellulose produced by these disparate systems can be attributed to the dramatic differences in the mechanisms of action of the dominant enzymes in each system.
Jaworski, N W; Lærke, H N; Bach Knudsen, K E; Stein, H H
2015-03-01
The objectives of this work were to determine carbohydrate composition and in vitro digestibility of DM and nonstarch polysaccharides (NSP) in corn, wheat, and sorghum and coproducts from these grains. In the initial part of this work, the carbohydrate composition of 12 feed ingredients was determined. The 12 ingredients included 3 grains (corn, sorghum, and wheat), 3 coproducts from the dry grind industry (corn distillers dried grains with solubles [DDGS] and 2 sources of sorghum DDGS), 4 coproducts from the wet milling industry (corn gluten meal, corn gluten feed, corn germ meal, and corn bran), and 2 coproducts from the flour milling industry (wheat middlings and wheat bran). Results indicated that grains contained more starch and less NSP compared with grain coproducts. The concentration of soluble NSP was low in all ingredients. Cellulose, arabinoxylans, and other hemicelluloses made up approximately 22, 49, and 29% (DM basis), respectively, of the NSP in corn and corn coproducts and approximately 25, 43, and 32% (DM basis), respectively, of the NSP in sorghum and sorghum DDGS. Cellulose, arabinoxylans, and other hemicelluloses made up approximately 16, 64, and 20% (DM basis), respectively, of the NSP in wheat and wheat coproducts. The concentration of lignin in grains was between 0.8 and 1.8% (DM basis), whereas coproducts contained between 2.2 and 11.5% lignin (DM basis). The in vitro ileal digestibility of NSP was close to zero or negative for all feed ingredients, indicating that pepsin and pancreas enzymes have no effect on in vitro degradation of NSP. A strong negative correlation ( = 0.97) between in vitro ileal digestibility of DM and the concentration of NSP in feed ingredients was observed. In vitro total tract digestibility of NSP ranged from 6.5% in corn bran to 57.3% in corn gluten meal. In conclusion, grains and grain coproducts contain mostly insoluble NSP and arabinoxylans make up the majority of the total NSP fraction. The in vitro
States of knowledge the co-production of science and the social order
2004-01-01
In the past twenty years, the field of science and technology studies (S&TS) has made considerable progress toward illuminating the relationship between scientific knowledge and political power. These insights are now ready to be synthesized and presented in forms that systematically highlight the connections between S&TS and other social sciences. This timely collection of essays by leading scholars in the field meets this challenge. The book develops the theme of 'co-production', showing how scientific knowledge both embeds and is embedded in social identities, institutions, representations and discourses. Accordingly, the authors argue, ways of knowing the world are inseparably linked to the ways in which people seek to organize and control it. Through studies of emerging knowledges, research practices and political institutions, the authors demonstrate that the idiom of co-production importantly extends the vocabulary of the traditional social sciences, offering fresh analytic perspectives on the...
Directory of Open Access Journals (Sweden)
Hugo Consciência Silvestre
Full Text Available Abstract Co-production includes all actions where citizens assist, as volunteers, in the provision of services by public agencies in order to increase the efficiency and efficacy of the public services provided. This practice, known as co-production, is being adopted by governments in the resolution of conflicts, particularly those regarding administrative and fiscal matters. However, is co-production a more efficient and effective way of settling disputes in administrative and tax areas than the traditional administrative model? And why? In Portugal, the Administrative Arbitration Centre was created in 2009 with the aim of resolving disputes between public administration and taxpayers/service users by means of co-production. The available data support the thesis that efficiency and efficacy are higher under the co-production model. Nevertheless, users are not totally satisfied since the costs associated with the use of this service provision model are also higher.
Sustainable energy conversion for electricity and coproducts principles, technologies, and equipment
Rao, Ashok
2015-01-01
Provides an introduction to energy systems going on to describe various forms of energy sources Provides a comprehensive and a fundamental approach to the study of sustainable fuel conversion for the generation of electricity and for coproducing synthetic fuels and chemicals Covers the underlying principles of physics and their application to engineering including thermodynamics of combustion and power cycles, fluid flow, heat transfer, and mass transfer Details the coproduction of fuels and chemicals including key equipment used in synthesis and specific examples of coproduction in integrated
Brogan, Catherine Mary; Ryan, Michael
2017-01-01
Advancing Recovery in Ireland (ARI) is a HSE national initiative aimed at securing the organisational and cultural changes necessary to develop more “Recovery-oriented” services recognising that recovery is ‘being able to create and live a meaningful and full life in a community of choice with or without the presence of mental health issues’[i] A Recovery orientated service is underpinned by the premises that (1) true partnership through coproduction between those who use and those who pr...
Sokolovska, I.; Andrepont, J. A.; Lach, D.
2017-12-01
The Pacific Northwest Climate Impacts Research Consortium (CIRC) is a climate-science-to-climate-action team funded by the National Oceanic and Atmospheric Administration (NOAA), member of NOAA's Regional Integrated Sciences and Assessments (RISA) program. The internal evaluation of the last 6 years of CIRC's work focused on the co-production of knowledge process. The evaluation was based on CIRC's Reflection and Logic model and used a mixed methods design. During regular monthly meetings in 2014/15, all CIRC PIs reflected on the co-production process and presented their evaluation of the projects they worked on. Additionally, we conducted semi-structured interviews with CIRC participants, purposefully targeting key informants. The Climate Impacts Research Consortium teams also administered surveys to assess participants' experiences of the coproduction process as they were engaging in it. Identifying and cultivating an informant from the local stakeholder group with deep, accessible roots within the target community can lead to better coproduction results than having to build those relationships from naught. Across projects, most participants agreed that the project increased their understanding of their area's hazards and by the end of the project most participants were confident the project would produce useful results for themselves. Finally, most participants intended to share what they had learned from this experience with their colleagues and we found that co-production built capacities necessary for communities to incorporate climate change in discussions even after the end of CIRC's participation. During the projects, the involvement of non-traditional participants along with experts was critical to success and a lot of work and preparation needs to be put into the planning of any co-production meeting to overcome various barriers to communication and build trust.
Co-production of parasporal crystal toxins and antimicrobial ...
African Journals Online (AJOL)
Co-production of antimicrobial substances and insecticidal compounds by Bacillus thuringiensis BAR 3 was investigated. The cell free supernatant (CFS) of B. thuringiensis showed inhibitory activities against both Gram positive (B. thuringiensis IFO13866 and Staphylococcus aureus ATCC 25923) and Gram negative ...
To Participate or Not Participate. Exploring the Perceived Value of Co-production
Merken, Anne; Streukens, Sandra; Leroi-Werelds, Sara
2013-01-01
Self check-outs, self-scanning, online ticket buying, designing your own shoes and dresses. Since co-production is seen as a source of competitive advantage, firms are more and more trying to involve the customer in their production process. But why are customers willing to co-produce? What is in it for them? Building on the notion of customer value, customers only co-produce when the benefits outweigh the costs. To elicit the co-production costs and benefits we conducted in-depth interviews....
Lindsay K. Campbell; Erika S. Svendsen; Lara A. Roman
2016-01-01
Cities are increasingly engaging in sustainability efforts and investment in green infrastructure, including large-scale urban tree planting campaigns. In this context, researchers and practitioners are working jointly to develop applicable knowledge for planning and managing the urban forest. This paper presents three case studies of knowledge co-production in the...
Using the coproduction principle: no more throwaway kids.
Cahn, Edgar S; Gray, Christine
2005-01-01
Youth development does not take place only in institutions or even primarily in institutions. It takes place in the core economy-the economy of family, neighborhood, and community. Major challenges include rebuilding the kind of village it takes to raise a child and enabling a child to be part of that rebuilding. Another challenge is to make sure that any external incentives that are provided to youth are linked to activities that build self-esteem and convey a definition of value that is different from that established by money and market price. This chapter provides an introduction to time banking and to coproduction, approaches to youth development that enable youth to participate as major players, as opposed to recipients, in the reshaping of their lives and communities.
Renewable energy technologies: enlargement of biofuels list and co-products from microalgae
Directory of Open Access Journals (Sweden)
Chernova Nadezhda I.
2017-01-01
Full Text Available Microalgae is a perspective feedstock for producing a wide variety of biofuels and co-products with high added value. An alternative to the traditional technology of biodiesel from algae by the transesterification is the technology of hydrothermal liquefaction (HTL. The article presents the results of promising strains screening and directed cultivation of microalgae for the processing by means of variety of technologies and production of valuable co-products. An algorithm for selecting suitable areas for industrial plantations of algae is presented.
Directory of Open Access Journals (Sweden)
Paula Martins Olivo
2017-07-01
Full Text Available Agroindustrial co-products are a viable alternative for use in animal nutrition. Tests were conducted using eight different types of co-products and feed to evaluate the chemical composition, in vitro digestibility of dry matter, crude protein and neutral detergent fiber, and gas production by them. The co-products tested were: coffee hulls; pelleted citrus pulp; grape residue; soybean hulls; cottonseed; cassava foliage; and foods usually supplied to ruminants: corn silage and ground corn concentrate. Data of in vitro digestibility of dry matter, crude protein and neutral detergent fiber were tested by analysis of variance using the least square method; the results of gas production were interpreted by a non-linear regression by the Gauss-Newton method; and the effects of treatments were evaluated by the Tukey’s test. The coefficients of in vitro digestibility of dry matter, crude protein and neutral detergent fiber of co-products were different. Gas production was also different between co-products and feeds evaluated for the volume of gas produced from the fast and slow degradation fractions, degradation rate, bacterial colonization time, and the total volume of gas produced. The evaluated co-products exhibited greater in vitro dry matter digestibility compared to corn silage, except for cottonseed, grape residue, and cassava foliage. Co-products showed higher values of in vitro crude protein digestibility compared to corn silage, and a reduced in vitro digestibility of neutral detergent fiber, except for pelleted citrus pulp and soybean hulls. Corn silage produced larger volume of gas from the fast degradation fraction compared to the co-products and corn concentrate. Co-products analyzed had appropriate nutritional characteristics according to the techniques applied and can be included in ruminant diets.
Chemical conversion of hemicellulose coproducts from forest biorefineries to polymers and chemicals
Energy Technology Data Exchange (ETDEWEB)
Boluk, Y.; Jost, R. [Alberta Research Council, Edmonton, AB (Canada)
2009-07-01
Raw material is the basis of the chemical industry. This presentation discussed the chemical conversion of hemicellulose coproducts from forest biorefineries to polymers and chemicals. Biorefining pretreatment processes open up the biomass structure, release hemicelluloses and overcome the resistance to enzymatic hydrolysis. Although hemicellulose is the second most abundant carbohydrate, it does not have many industrial applications. The state of released hemicellulose whether polymeric, oligomeric or monosaccharides depends primarily on the pretreatment process conditions. Physical pretreatment methods include high-pressure steaming and steam explosion; milling and grinding; extrusion; and high-energy radiation. The chemical pretreatment methods involve the use of alkali, acid, gas and oxidizing agents as well as solvents. The biological pretreatment methods involve the use of lignin consuming fungi and cellulose consuming fungi. A profitable use of C5 sugars in monomeric, oligomeric and polymeric forms is necessary for a viable wood to bioethanol process. Hemicellulose composition varies depending on the biomass source. It usually has a lower molecular weight than cellulose, contains branching, and is comprised of several different monosaccharides. The existing commercial chemical products include xylitol, mannitol, and furfural. The hemicellulose coproducts from a lignocellulosic biorefinery have the potential to become a feasible replacement for their fossil-based equivalents. tabs., figs.
2011-11-17
... Distillers Co-Products Survey and All Associated Reports AGENCY: National Agricultural Statistics Service... Distillers Co- Products survey currently approved under docket 0535-0247. FOR FURTHER INFORMATION CONTACT... . SUPPLEMENTARY INFORMATION: Title: Suspension of Distillers Co-Products Survey. OMB Control Number: 0535-0247...
'I-as-We' - Powerful boundaries within the field of mental health coproduction.
von Peter, Sebastian; Schulz, Gwen
2018-05-02
To date, there is little research on personal crisis experiences of mental health professionals. The aim of this study was to explore some of the reasons for why self-disclosure is so difficult and how these difficulties may prevent productive forms of coproduction. These questions are addressed both from a psychiatrist's autoethnographic account and from the perspective of a peer worker who works in various coproductive relationships. It is shown that mental health professionals often revert to an "I-as-we", speaking of themselves as a collective and thereby reifying the boundaries between 'vulnerable users' and 'invulnerable professionals'. Ethnographic examples are given, of how these boundaries are produced by a continuous, often invisible, and powerful category work. It is discussed how the dichotomous logic of these boundaries can cause people on both sides to feel reduced to a representation of a certain species, which can take on an existential dimension. Ways out are identified for mental health professionals to self-reflexively engage with their own crisis experience in coproductive and other relationships. © 2018 Australian College of Mental Health Nurses Inc.
Gomaa, Walaa M S; Mosaad, Gamal M; Yu, Peiqiang
2018-04-21
The objectives of this study were to: (1) Use molecular spectroscopy as a novel technique to quantify protein molecular structures in relation to its chemical profiles and bioenergy values in oil-seeds and co-products from bio-oil processing. (2) Determine and compare: (a) protein molecular structure using Fourier transform infrared (FT/IR-ATR) molecular spectroscopy technique; (b) bioactive compounds, anti-nutritional factors, and chemical composition; and (c) bioenergy values in oil seeds (canola seeds), co-products (meal or pellets) from bio-oil processing plants in Canada in comparison with China. (3) Determine the relationship between protein molecular structural features and nutrient profiles in oil-seeds and co-products from bio-oil processing. Our results showed the possibility to characterize protein molecular structure using FT/IR molecular spectroscopy. Processing induced changes between oil seeds and co-products were found in the chemical, bioenergy profiles and protein molecular structure. However, no strong correlation was found between the chemical and nutrient profiles of oil seeds (canola seeds) and their protein molecular structure. On the other hand, co-products were strongly correlated with protein molecular structure in the chemical profile and bioenergy values. Generally, comparisons of oil seeds (canola seeds) and co-products (meal or pellets) in Canada, in China, and between Canada and China indicated the presence of variations among different crusher plants and bio-oil processing products.
DEFF Research Database (Denmark)
Serena, Anja; Bach Knudsen, Knud Erik
2007-01-01
was responsible for the relatively low EDOM. There was a variation from year to year in the concentration of ash (Pprotein (P=0.04) and EDOM (P=0.003) in pea hull. In conclusion, co-products from the vegetable food and agro industries are characterised by a high......Six co-products from the vegetable food and agro industres in Denmark - brewer's spent grain, pea hull, seed residue (rye grass), potato pulp, sugar beet pulp and pectin residue - were collected eight times during two seasons (four samples from each season) (n = 8; N = 48). The samples were...... analysed for dry matter (DM), ash, sand, protein, amino acids, ether extract (EE), carbohydrate constituents, enzyme digestible organic matter (EDOM) and physicochemical properties-water binding capacity (WBC) and swelling. The co-products in general had a low DM (142-216 g/kg as is), EE (6-54 g/kg DM...
CSIR Research Space (South Africa)
Reyers, B
2015-06-01
Full Text Available ’s three spheres of gov- ernment (national, provincial, and local), these four groups included representatives capturing specific legislative, coordination, or implementation powers and functions at each scale. Fig. 1. Location of four case studies... coproduction approach was applied Case study description Participants Case study 1. Flood on a lakeside urban plain: A national insurer and local disaster managers concerned about the causes and responses to increasing flood damage in this region after five...
Energy Technology Data Exchange (ETDEWEB)
NONE
2001-03-01
This project is aimed at surveys on the elementary and peripheral techniques necessary to construct the systems, with the objective to draw the conceptual designs of the total system for co-production of a substance and electric power. In a general reaction process, substances are produced under an advantageous condition that is dependent on reaction rate and equilibrium, where most of the energy is dissipated in the form of sensible and latent heat without being used for the chemical reaction. The co-production system under consideration uses high temperature of 500 degrees C or higher exhausted from a power station or industrial unit to produce macromolecules or synthesis gases, wherein the exothermic reaction increases temperature of the heat source, which is recovered in the form of steam for driving the steam turbine to produce electric power. On the other hand, low-temperature waste heat of around 150 degrees C is converted into a liquid fuel or other value-added products by the liquid phase pressurized system. The elementary techniques to construct these processes are surveyed, and the thermal processes are analyzed. The investigated items include substance production processes, electric power production processes and total systems. (NEDO)
Webber, S.; MacDonald, G. M.
2016-12-01
The last decades have seen scholars argue for a greater integration of science and decision-making in order to more effectively respond to climate change. It has been suggested that overcoming the gap between science, on the one hand, and policy-making and management, on the other, requires building bridges through methods of co-production, creating actionable science, or through boundary organizations. In this paper, we review attempts at co-production for policy-making and management in the context of climate change adaptation in California. Building on field research, including numerous interviews conducted with scientists and decision-makers who are co-producers of adaptation projects, we make three arguments. First, we show that an emphasis on co-production and science-informed climate change adaptation decision-making has bolstered a contract-oriented, and decentralized network-based model of producing climate science. Second, reviewing successes and failures in co-production - as reported in interviews - indicates that it is principally in cases of neatly defined, and spatially and temporarily narrow decision-making contexts, and with highly motivated decision-makers, that climate science is used. Finally, we suggest that the ideas of co-production and actionable science may have increased the institutional and organizational burden at the science-decision interface, lengthening the boundary-organization-chain rather than necessarily facilitating adaptive policy-making and management.
Reyers, Belinda; Nel, Jeanne L; O'Farrell, Patrick J; Sitas, Nadia; Nel, Deon C
2015-06-16
Achieving the policy and practice shifts needed to secure ecosystem services is hampered by the inherent complexities of ecosystem services and their management. Methods for the participatory production and exchange of knowledge offer an avenue to navigate this complexity together with the beneficiaries and managers of ecosystem services. We develop and apply a knowledge coproduction approach based on social-ecological systems research and assess its utility in generating shared knowledge and action for ecosystem services. The approach was piloted in South Africa across four case studies aimed at reducing the risk of disasters associated with floods, wildfires, storm waves, and droughts. Different configurations of stakeholders (knowledge brokers, assessment teams, implementers, and bridging agents) were involved in collaboratively designing each study, generating and exchanging knowledge, and planning for implementation. The approach proved useful in the development of shared knowledge on the sizable contribution of ecosystem services to disaster risk reduction. This knowledge was used by stakeholders to design and implement several actions to enhance ecosystem services, including new investments in ecosystem restoration, institutional changes in the private and public sector, and innovative partnerships of science, practice, and policy. By bringing together multiple disciplines, sectors, and stakeholders to jointly produce the knowledge needed to understand and manage a complex system, knowledge coproduction approaches offer an effective avenue for the improved integration of ecosystem services into decision making.
Introduction to "Transcolonial Film Coproductions in the Japanese Empire"
Directory of Open Access Journals (Sweden)
Nayoung Aimee Kwon
2012-12-01
Full Text Available This special issue brings new perspectives to colonial films by readings of primarily Japanesese-Korean coproductions. At the same time, we have included one study (by Hong specifically on the films of the Manchuria Motion Pictures Corporation (Man’ei. Other papers (by Mizuno and Watanabe further extend their analyses to consider connections with Manchuria. Through a study of Man’ei films as well as coproductions with complex trajectories across Japan, Korea, and Manchuria, these authors collectively help put into relief both the continuities and discontinuities between Japanese cultural rule over its formal colony of Korea, on the one hand, and the nominal nation-state of Manchukuo, on the other. Here we see differences and yet an uncannily similar imperial logic under which contemporaneous continental films were being produced. Building upon recent work on Manchukuo, which has begun to take seriously that this political unit was established in the form of a nation-state rather than a colony, such as Korea or Taiwan (Duara 2003; Han 2004, Hong’s article, for example, charts the antinomies of Japanese-Manchurian coproductions. In some regards, such as the common disavowal of racial or ethnic discrimination and the production of a kind of East Asian regionalism and universalism, the Japanese empire worked in similar ways in both its formal colonies and nominally independent allies within the Greater East Asian Co-Prosperity Sphere. Yet there were critical differences and contradictions specific to the case of Manchukuo—for instance, in the explicit ideology of ethnic harmony and the obvious but still underanalyzed imperative to constitute national subjects of Manchukuo, rather than Japan.
Fuel-Flexible Combustion System for Co-production Plant Applications
Energy Technology Data Exchange (ETDEWEB)
Joel Haynes; Justin Brumberg; Venkatraman Iyer; Jonathan Janssen; Ben Lacy; Matt Mosbacher; Craig Russell; Ertan Yilmaz; Williams York; Willy Ziminsky; Tim Lieuwen; Suresh Menon; Jerry Seitzman; Ashok Anand; Patrick May
2008-12-31
Future high-efficiency, low-emission generation plants that produce electric power, transportation fuels, and/or chemicals from fossil fuel feed stocks require a new class of fuel-flexible combustors. In this program, a validated combustor approach was developed which enables single-digit NO{sub x} operation for a future generation plants with low-Btu off gas and allows the flexibility of process-independent backup with natural gas. This combustion technology overcomes the limitations of current syngas gas turbine combustion systems, which are designed on a site-by-site basis, and enable improved future co-generation plant designs. In this capacity, the fuel-flexible combustor enhances the efficiency and productivity of future co-production plants. In task 2, a summary of market requested fuel gas compositions was created and the syngas fuel space was characterized. Additionally, a technology matrix and chemical kinetic models were used to evaluate various combustion technologies and to select two combustor concepts. In task 4 systems analysis of a co-production plant in conjunction with chemical kinetic analysis was performed to determine the desired combustor operating conditions for the burner concepts. Task 5 discusses the experimental evaluation of three syngas capable combustor designs. The hybrid combustor, Prototype-1 utilized a diffusion flame approach for syngas fuels with a lean premixed swirl concept for natural gas fuels for both syngas and natural gas fuels at FA+e gas turbine conditions. The hybrid nozzle was sized to accommodate syngas fuels ranging from {approx}100 to 280 btu/scf and with a diffusion tip geometry optimized for Early Entry Co-generation Plant (EECP) fuel compositions. The swozzle concept utilized existing GE DLN design methodologies to eliminate flow separation and enhance fuel-air mixing. With changing business priorities, a fully premixed natural gas & syngas nozzle, Protoytpe-1N, was also developed later in the program. It did
DEFF Research Database (Denmark)
Flysjö, Anna Maria; Cederberg, Christel; Henriksson, Maria
2011-01-01
Purpose This paper investigates different methodologies of handling co-products in life cycle assessment (LCA) or carbon footprint (CF) studies. Co-product handling can have a significant effect on final LCA/CF results, and although there are guidelines on the preferred order for different methods...... (when slaughtered), calves, manure, hides, etc., the environmental burden (here GHG emissions) must be distributed between these outputs (in the present study no emissions are attributed to hides specifically, or to manure which is recycled on-farm). Different methodologically approaches, (1) system...
The Politics of Co-Production: Risks, Limits and Pollution
Flinders, Matthew; Wood, Matthew; Cunningham, Malaika
2016-01-01
Co-production is a risky method of social inquiry. It is time-consuming, ethically complex, emotionally demanding, inherently unstable, vulnerable to external shocks, subject to competing demands and it challenges many disciplinary norms. This is what makes it so fresh and innovative. And yet these research-related risks are rarely discussed and,…
An update on the use of co-products from the milling of rice in value added food products
Because of the huge quantity of rice produced annually, milled-rice co-products; such as, rice bran, rice oil, rice wax, rice flour, and rice hull are plentiful and readily available. These co-products could be valuable sources of food ingredients, but they have been vastly under-utilized. Rice bra...
Interactive Knowledge Co-Production and Integration for Healthy Urban Development
Directory of Open Access Journals (Sweden)
Rehana Shrestha
2017-10-01
Full Text Available The transformation of cities towards healthy urban living environments for all is a challenge that needs to be addressed through collaboration of all relevant sectors in a transdisciplinary research processes. This paper reports on the design and showcase implementation of a methodological approach, named Interactive Spatial Understanding Support System (ISUSS, that is intended to support interactive knowledge co-production and integration among practitioners and researcher in a specific local context. The approach involves the combined use of interactive maps on a MapTable and a rich picture. The goal is to stimulate, articulate and map stakeholders’ knowledge on environmental health issues to come to a shared problem understanding. Drawing on the rich seam of data gathered over the reflexive engagement with the participants in Dortmund, Germany, we explored incidences of a transdisciplinary process. Findings suggest that the approach has the potential to encourage communication and social learning geared towards a shared understanding of the holistic problem situation. Whilst locally embedded spatial knowledge was shared using interactive maps on the MapTable, the rich picture elicited issues linked to wider geographical scale as well as non-spatial drivers. The paper concludes discussing research needs to further explore the approach among various other groups, including citizens.
Thom, Katey; Burnside, Dave
2018-04-17
Co-production has begun to make inroads into research, policy, and practice in mental health and addictions. Little is known, however, about the role co-production has or could have in shaping how the criminal justice system responds to mental health and addictions. Given that a large majority of prisoners in Aotearoa New Zealand have been diagnosed with either a mental health or substance use disorder within their lifetime, it is imperative alternative approaches are considered if we are to reduce the high imprisonment rates and contribute positively to health, safety, and well-being of all New Zealanders. In this study, we explore how co-production has been conceptualized and used in criminal justice systems internationally, and offer an experiential account of our first steps into co-production both in service delivery and research. We conclude by proposing a way forward to expand partnerships between those who have experience-based expertise and researchers within the criminal justice context, offering a small- and large-scale project as potential examples of what co-production may look like in this space. © 2018 Australian College of Mental Health Nurses Inc.
26 CFR 1.381(c)(10)-1 - Deferred exploration and development expenditures.
2010-04-01
... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Deferred exploration and development expenditures. 1.381(c)(10)-1 Section 1.381(c)(10)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Insolvency Reorganizations § 1.381(c)(10...
Vaeggemose, Ulla; Ankersen, Pia Vedel; Aagaard, Jørgen; Burau, Viola
2018-01-01
Co-production involves knowledge and skills based on both lived experiences of citizens and professionally training of staff. In Europe, co-production is viewed as an essential tool for meeting the demographic, political and economic challenges of welfare states. However, co-production is facing challenges because public services and civil society are rooted in two very different logics. These challenges are typically encountered by provider organisations and their staff who must convert policies and strategies into practice. Denmark is a welfare state with a strong public services sector and a relatively low involvement of volunteers. The aim of this study was to investigate how provider organisations and their staff navigate between the two logics. The present analysis is a critical case study of two municipalities selected from seven participating municipalities, for their maximum diversity. The study setting was the Community Families programme, which aim to support the social network of mental health users by offering regular contact with selected private families/individuals. The task of the municipalities was to initiate and support Community Families. The analysis built on qualitative data generated at the organisational level in the seven participating municipalities. Within the two "case study" municipalities, qualitative interviews were conducted with front-line co-ordinators (six) and line managers (two). The interviews were recorded, transcribed verbatim and coded using the software program NVivo. The results confirm the central role played by staff and identify a close interplay between public services and civil society logics as essential for the organisation of co-production. Corresponding objectives, activities and collaborative relations of provider organisations are keys for facilitating the co-productive practice of individual staff. Organised in this way, co-production can succeed even in a mental health setting associated with social stigma
Browne, K.; Lemos, M. C.
2017-12-01
Despite a growing recognition of the importance of coproduced information in networks of decision-makers facing climate change, relatively little attention has been paid to how different types of users and forms of engagement (e.g. brokering and bridging of climate information) may yield different coproduction outcomes. In this study, we compare drivers and outcomes of co-production of a large network (twenty-five cases) of users within the scope of the Great Lakes Integrated Sciences and Assessments (GLISA), a boundary organization whose mission is to disseminate climate information in the Great Lakes Region. We focus especially on drivers of co-production within boundary organizations (e.g. embeddness, complementarity, financial and human resources and trust building and legitimacy) to explore different forms of engagement and models of brokering and bridging information. Our case studies span a wide range of users, including cities, businesses, academic and professional organizations and governmental agencies. We find that different kinds of resources and engagement matter in terms of desirable outcomes. In addition, while the supply of resources by boundary organizations is necessary to foster co-production, effective use and stable networks are often not achieved in the absence of sustained engagement and support.
Corré, W.J.; Conijn, J.G.; Meesters, K.P.H.; Bos, H.L.
2016-01-01
Accounting for co-products of vegetable oil production is essential in reviewing the sustainability of biodiesel production, especially since oil crops produce valuable protein-rich co-products in different quantities and qualities. Two accounting methods, allocation on the basis of energy
Financial Rewards Do Not Stimulate Co-Production : Evidence from Two Experiments
W.H. Voorberg (William); S.R. Jilke (Sebastian); L.G. Tummers (Lars); V.J.J.M. Bekkers (Victor)
2017-01-01
textabstractWestern governments are increasingly trying to stimulate citizens to ‘co-produce’ public services, among others, by offering them financial incentives. However, there are competing views on whether financial incentives stimulate co-production. While some argue it increases citizens’
A sustainable biorefinery must convert a broad range of renewable feedstocks into a variety of product streams, including fuels, power, and value-added bioproducts. To accomplish this, microbial-based technologies that enable new commercially viable coproducts from corn-to-ethanol biofuel fermentati...
Smith, R.; Kasprzyk, J. R.; Dilling, L.; Basdekas, L.; Kaatz, L.
2016-12-01
In light of the unpredictable effects of climate change and population shifts, responsible resource management will require new types of information and strategies going forward. For water utilities, this means that water supply infrastructure systems must be expanded and/or managed for changes in overall supply and increased extremes. Utilities have begun seeking innovative tools and methods to support planning and decision making, but there are limited channels through which they can gain exposure to emerging tools from the research world, and for researchers to uptake important real-world planning and decision context. A transdisciplinary team of engineers, social and climate scientists, and water managers designed this study to develop and apply a co-production framework which explores the potential of an emerging decision support tool to enhance flexibility and adaptability in water utility planning. It also demonstrates how to improve the link between research and practice in the water sector. In this study we apply the co-production framework to the use of Multiobjective Evolutionary Algorithms (MOEAs). MOEAs have shown promise in being able to generate and evaluate new planning alternatives but they have had little testing or application in water utilities. Anchored by two workshops, this study (1) elicited input from water managers from six water suppliers on the Front Range of Colorado, USA, to create a testbed MOEA application, and (2) evaluated the managers' responses to multiobjective optimization results. The testbed consists of a Front Range-relevant hypothetical water supply model, the Borg MOEA, hydrology and demand scenarios, and a set of planning decisions and performance objectives that drive the link between the algorithm and the model. In this presentation we describe researcher-manager interactions at the initial workshop that served to establish relationships and provide in-depth information to researchers about regional water management
Characterization of co-products of the pilot digesters to animal ...
African Journals Online (AJOL)
This work consists in evaluating the Co-products of the biomethanisation applied to the animal biomass on the level of various types of digesters (experimental I, II, III and IV, rural and industrial). This work made it possible to arise certain number of observations: The energy performances are more interesting in the case of ...
International Nuclear Information System (INIS)
Cheng, Jun; Ding, Lingkan; Lin, Richen; Yue, Liangchen; Liu, Jianzhong; Zhou, Junhu; Cen, Kefa
2016-01-01
Highlights: • Microanalyses revealed food waste had more gelatinized organics and less mineral ash. • Mixed food waste and sewage sludge at 5 ratios were used for H_2 and CH_4 co-production. • Highest H_2 yield of 174.6 mL/gVS was achieved when food waste:sewage sludge was 3:1. • Co-fermentation enhanced carbon conversion by strengthening hydrolysis of substrates. • Energy yield rose from 1.9 kJ/gVS in H_2 to 11.3 kJ/gVS in H_2 and CH_4 co-production. - Abstract: The accumulation of increasingly generated food waste and sewage sludge is currently a heavy burden on environment in China. In this study, the physiochemical properties of food waste and sewage sludge were identified using scanning electron microscopy and Fourier transform infrared spectroscopy to investigate the effects on the fermentation performance in the co-fermentation of food waste and sewage sludge for biohydrogen production. The high gelatinized organic components in food waste, the enhanced bioaccessibility due to the dilution of mineral compounds in sewage sludge, and the balanced C/N ratio synergistically improved the fermentative biohydrogen production through the co-fermentation of food waste and sewage sludge at a volatile solids (VS) mix ratio of 3:1. The biohydrogen yield of 174.6 mL/gVS was 49.9% higher than the weighted average calculated from mono-fermentation of food waste and sewage sludge. Co-fermentation also strengthened the hydrolysis and acidogenesis of the mixture, resulting in a total carbon conversion efficiency of 63.3% and an energy conversion efficiency of 56.6% during biohydrogen production. After the second-stage anaerobic digestion of hydrogenogenic effluent, the energy yield from the mixed food waste and sewage sludge significantly increased from 1.9 kJ/gVS in the first-stage biohydrogen production to 11.3 kJ/gVS in the two-stage fermentative biohydrogen and biomethane co-production.
Effects of dehydration methods on quality characteristics of yellow passion fruit co-products.
Silva, Neiton C; Duarte, Claudio R; Barrozo, Marcos As
2017-11-01
The production and processing of fruits generate a large amount of residues, which are usually disposed of or under-used, representing losses of raw material and energy. The present paper investigates the effect of four dehydration techniques (convective, infrared, microwave and freeze-drying) on yellow passion fruit (Passiflora edulis f. flavicarpa) co-products and the influence of the main variables on moisture removal and bioactive compounds. The compounds analyzed were total phenolics, total flavonoids, ascorbic acid and pectin. The content of phenolics and flavonoids increased after dehydration in all techniques investigated and the process temperatures directly affected the ascorbic acid content. Microwave dehydration showed the best results for most bioactive compounds analyzed, if performed in suitable process conditions. However, the highest levels of pectin content were obtained by freeze-drying and convective dehydration. This study reinforces the importance of the adequate use of passion fruit co-products due to the high levels of bioactive compounds in this material. Microwave dehydration presented the best results, which indicates the potential use of this technique for a better exploitation of fruit co-products. Larger quantities of pectin were extracted from samples dehydrated through methodologies with long-time process and low temperatures, such as convective drying and freeze-drying. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.
Directory of Open Access Journals (Sweden)
Guangjun Nie
2015-10-01
Full Text Available ABSTRACTThe aim of this work was to study the co-production of nattokinase and poly (γ-glutamic acid by Bacillus subtilis natto with soybean and rice husk under solid-state fermentation (SSF. The results showed that the size of soybean particle and rice husk significantly improved the co-production of nattokinase and poly (γ-glutamic acid, yielding 2503.4 IU/gs and 320 mg/gs, respectively in the improved culture medium composed of 16.7% soybean flour and 13.3% rice husk with 70% water content. The yields increased by approximate 7- and 2-fold factor relative to their original ones. Thus, the co-production of nattokinase and poly (γ-glutamic acid under SSF could be considered as an efficient method to exploit agro-residues for economical production of some higher-value products.
Directory of Open Access Journals (Sweden)
Kathryn J. Bowen
2015-03-01
Full Text Available Multiple active partnerships in the health and water sectors in Cambodia exist to address climate change adaptation, operating beyond typical sectoral and organizational divides. Decisions around national adaptation policy are made predominantly by the relevant lead ministry, contrasting with where funding originates from (i.e., major donors, multilaterals, United Nation agencies. Adaptation policy is thus the result of a process of coproduction by state and nonstate actors. The research we present sought to understand the relationships that exist between knowledge- and decision-makers with respect to climate change adaptation in the health and water sectors in Cambodia, and the factors that enabled or constrained these relationships. Forty-four interviews were conducted with representatives of 32 organizations. We found that coproductive relationships were most effective when there were clearly defined roles and responsibilities, coordination of technical and financial resources, and trust. The two key factors of coproductive capacity that enabled and supported these partnerships were scientific resources and governance capability. Ultimately, the roles and responsibilities given to various actors requires commensurate funding and greater consideration of existing relationships and power dynamics. The reliance on international scientific expertise also needs to be challenged so that local research capabilities can be developed and locally relevant, problem-specific information can be provided. The ongoing funding, codevelopment, and sharing of such knowledge would significantly enhance trust and cooperation.
Opheim, T L; Campanili, P R B; Lemos, B J M; Ovinge, L A; Baggerman, J O; McCuistion, K C; Galyean, M L; Sarturi, J O; Trojan, S J
2016-01-01
Crossbred steers (British × Continental; = 192; initial BW 391 ± 28 kg) were used to evaluate the effects of feeding ethanol coproducts on feedlot cattle growth performance, apparent nutrient digestibility, and carcass characteristics. Steers were blocked by initial BW and assigned randomly to 1 of 6 dietary treatments within block. Treatments (replicated in 8 pens with 4 steers/pen) included 1) control, steam-flaked corn-based diet (CTL), 2) corn dried distillers grains with solubles (DGS; DRY-C), 3) deoiled corn dried DGS (DRY-CLF), 4) blended 50/50 corn/sorghum dried DGS (DRY-C/S), 5) sorghum dried DGS (DRY-S), and 6) sorghum wet DGS (WET-S). Inclusion of DGS was 25% (DM basis). The DGS diets were isonitrogenous, CTL was formulated for 13.5% CP, and all diets were balanced for ether extract. Final shrunk BW, ADG, and DMI did not differ among CTL and DGS treatments ( ≥ 0.19). Overall G:F did not differ from CTL for DRY-C, DRY-CLF, or WET-S ( ≥ 0.12); however, G:F was 9.6% less for DRY-S compared with CTL ( carcass-adjusted G:F vs. DRY-S. For WET-S, final BW and ADG were greater ( Carcass weight, dressing percent, and marbling score did not differ between CTL and DGS diets ( ≥ 0.23). For DRY-S, HCW was lower than for DRY-C ( = 0.02); however, compared with DRY-S, HCW tended to be greater for DRY-C/S ( = 0.10) and WET-S ( = 0.07). At a moderately high (25% DM) inclusion, blending C/S or feeding WET-S resulted in cattle growth performance and carcass characteristics similar to those of CTL and corn-based coproducts.
CSIR Research Space (South Africa)
Ziervogel, G
2016-10-01
Full Text Available plan was presented to the Bergrivier Council to secure buy-in from both the administrative and political spheres. Western Cape government officials, two Climate Systems Analysis Group climate scientists, councillors and officials attended... and innovation. c) d. Capacity opportunity: champions of co-production Deleted: The importance of leaders and champions has been widely cited as critical in driving urban adaptation responses. (61) Maiello et al., (62) for example, observe that public...
International Nuclear Information System (INIS)
Wang, Michael; Huo Hong; Arora, Salil
2011-01-01
Products other than biofuels are produced in biofuel plants. For example, corn ethanol plants produce distillers' grains and solubles. Soybean crushing plants produce soy meal and soy oil, which is used for biodiesel production. Electricity is generated in sugarcane ethanol plants both for internal consumption and export to the electric grid. Future cellulosic ethanol plants could be designed to co-produce electricity with ethanol. It is important to take co-products into account in the life-cycle analysis of biofuels and several methods are available to do so. Although the International Standard Organization's ISO 14040 advocates the system boundary expansion method (also known as the 'displacement method' or the 'substitution method') for life-cycle analyses, application of the method has been limited because of the difficulty in identifying and quantifying potential products to be displaced by biofuel co-products. As a result, some LCA studies and policy-making processes have considered alternative methods. In this paper, we examine the available methods to deal with biofuel co-products, explore the strengths and weaknesses of each method, and present biofuel LCA results with different co-product methods within the U.S. context.
Energy Technology Data Exchange (ETDEWEB)
Wang, Michael, E-mail: mqwang@anl.gov [Center for Transportation Research, Argonne National Laboratory, Argonne, IL 60439 (United States); Huo Hong [Institute of Energy, Environment, and Economics, Tsinghua University, Beijing, 100084 (China); Arora, Salil [Center for Transportation Research, Argonne National Laboratory, Argonne, IL 60439 (United States)
2011-10-15
Products other than biofuels are produced in biofuel plants. For example, corn ethanol plants produce distillers' grains and solubles. Soybean crushing plants produce soy meal and soy oil, which is used for biodiesel production. Electricity is generated in sugarcane ethanol plants both for internal consumption and export to the electric grid. Future cellulosic ethanol plants could be designed to co-produce electricity with ethanol. It is important to take co-products into account in the life-cycle analysis of biofuels and several methods are available to do so. Although the International Standard Organization's ISO 14040 advocates the system boundary expansion method (also known as the 'displacement method' or the 'substitution method') for life-cycle analyses, application of the method has been limited because of the difficulty in identifying and quantifying potential products to be displaced by biofuel co-products. As a result, some LCA studies and policy-making processes have considered alternative methods. In this paper, we examine the available methods to deal with biofuel co-products, explore the strengths and weaknesses of each method, and present biofuel LCA results with different co-product methods within the U.S. context.
EVALUATION OF CO-PRODUCT OF VERMICULITE AS SUBSTRATE IN SEEDLINGS PRODUCTION OF NIM
Directory of Open Access Journals (Sweden)
G. H. Silva
2014-09-01
Full Text Available This study evaluated the effect of different doses of organic matter and fertilizer PK neem seedlings grown in co-product of vermiculite. At the end of the experiment, the seedlings were separated into root, stem and leaves, then the material was placed in an oven and subsequent weighing. The parameters evaluated were: height, diameter, number of leaves, root length, IQD (Dickson quality index and TDM (total dry mass. The design used in the experiment was the DIC with seven levels of organic matter (OM (0, 5, 10, 15, 20, 25, 30% and three fertilization PK (Phosphorus and Potassium (PK0, PK100, PK300 with four replications. For doses of OM and fertilization was applied polynomial regression grade 2 at 5% of probability. The results of the analysis of variance showed that there were significant positive quadratic effect among all levels of treatment with OM on all variables. However, all variables were not statistically different for PK and PK + OM in all parameters evaluated. Thus the species under study shows no demand of chemical fertilizer in their early growth stages. The IQD values at a dose of 20% of OM indicate higher rates of development. The dose of 5% of OM in co-product of vermiculite is enough to produce seedlings of nem of good quality.
Skopal, Pavel
2013-01-01
After four co-productions which the East German and Czech studios made from 1957 to 1965, a five-year hiatus in DEFA-Barrandov co-productions took place. During the Czechoslovak New Wave era, the Czech filmmakers gave DEFA the cold shoulder. But the process of “normalisation” that took place after the August 1968 Warsaw Pact invasion of Czechoslovakia put both the regimes and the film industry structures back in sync. While the end of independent production groups at DEFA and Barrandov damage...
Co-production of healthcare services with immigrant patients
DEFF Research Database (Denmark)
Radl-Karimi, Christina Mathilde; Nicolaisen, Anne; Sodemann, Morten
2018-01-01
’s methodology for scoping reviews. The data will stem from the following databases: PubMed, Scopus, Ovid EMBASE, EBSCO CINAHL, EBSCO PsycINFO, Cochrane Library, and Web of Science. We will also screen the websites of national authorities and research organisations for publications and review the literature...... a new perspective on how to collaboratively create the highest possible value for both the patient and the healthcare system. The concept acknowledges that all services are co-produced and directs attention to the relationship between patient and care provider. Co-production is still a new concept...
DEFF Research Database (Denmark)
Jaworski, N. A.; Lærke, Helle Nygaard; Knudsen, Knud Erik Bach
2015-01-01
The objectives of this work were to determine carbohydrate composition and in vitro digestibility of DM and nonstarch polysaccharides (NSP) in corn, wheat, and sorghum and coproducts from these grains. In the initial part of this work, the carbohydrate composition of 12 feed ingredients was deter......The objectives of this work were to determine carbohydrate composition and in vitro digestibility of DM and nonstarch polysaccharides (NSP) in corn, wheat, and sorghum and coproducts from these grains. In the initial part of this work, the carbohydrate composition of 12 feed ingredients...... was determined. The 12 ingredients included 3 grains (corn, sorghum, and wheat), 3 coproducts from the dry grind industry (corn distillers dried grains with solubles [DDGS] and 2 sources of sorghum DDGS), 4 coproducts from the wet milling industry (corn gluten meal, corn gluten feed, corn germ meal, and corn...... up approximately 22, 49, and 29% (DM basis), respectively, of the NSP in corn and corn coproducts and approximately 25, 43, and 32% (DM basis), respectively, of the NSP in sorghum and sorghum DDGS. Cellulose, arabinoxylans, and other hemicelluloses made up approximately 16, 64, and 20% (DM basis...
Zahed, Omid; Jouzani, Gholamreza Salehi; Abbasalizadeh, Saeed; Khodaiyan, Faramarz; Tabatabaei, Meisam
2016-05-01
The present study was set to develop a robust and economic biorefinery process for continuous co-production of ethanol and xylitol from rice straw in a membrane bioreactor. Acid pretreatment, enzymatic hydrolysis, detoxification, yeast strains selection, single and co-culture batch fermentation, and finally continuous co-fermentation were optimized. The combination of diluted acid pretreatment (3.5 %) and enzymatic conversion (1:10 enzyme (63 floating-point unit (FPU)/mL)/biomass ratio) resulted in the maximum sugar yield (81 % conversion). By concentrating the hydrolysates, sugars level increased by threefold while that of furfural reduced by 50 % (0.56 to 0.28 g/L). Combined application of active carbon and resin led to complete removal of furfural, hydroxyl methyl furfural, and acetic acid. The strains Saccharomyces cerevisiae NCIM 3090 with 66.4 g/L ethanol production and Candida tropicalis NCIM 3119 with 9.9 g/L xylitol production were selected. The maximum concentrations of ethanol and xylitol in the single cultures were recorded at 31.5 g/L (0.42 g/g yield) and 26.5 g/L (0.58 g/g yield), respectively. In the batch co-culture system, the ethanol and xylitol productions were 33.4 g/L (0.44 g/g yield) and 25.1 g/L (0.55 g/g yield), respectively. The maximum ethanol and xylitol volumetric productivity values in the batch co-culture system were 65 and 58 % after 25 and 60 h, but were improved in the continuous co-culture mode and reached 80 % (55 g/L) and 68 % (31 g/L) at the dilution rate of 0.03 L per hour, respectively. Hence, the continuous co-production strategy developed in this study could be recommended for producing value-added products from this hugely generated lignocellulosic waste.
Arnott, J. C.; Kirchhoff, C.
2016-12-01
Co-production, a theory of and approach to knowledge production that accommodates joint effort between scientists and non-scientists in one or more stages of research process, is increasingly identified as a strategy to improve the usability of global change research. However, little research has been done to obtain perspectives of non-scientist participants that contribute to coproduced research projects on the process of co-production itself. The result is that it is often unclear if coproduced research achieves its intended objectives for stakeholders that contribute to it. An added irony is that designs and approaches to co-production often do not in themselves reflect input from non-scientist participants. To meet this gap, this paper reports on an analysis of semi-structured interviews of practitioners that participated in a NOAA-funded study addressing the impacts of climate change on harmful algal blooms in the Western Lake Erie Basin. The interviews solicited responses from these participants about their motivation for participating in the project, the impact to their work as a result of participation, and their suggestions for how to improve the experience in the future. Results indicate that non-scientist participants in research projects possess a very broad range of reasons for participation and a diverse set of attitudes about their experiences and perceived benefits. These findings should add evidence of and perspective to a growing area of recognition that information end-users (e.g., stakeholders, practitioners, decision-makers) are not a homogenous set of actors, and therefore strategies for engaging with them on knowledge production need to adjust accordingly. We reflect on these findings to conclude that future co-production efforts would be better served by considering the work of co-production as more than just bringing together two different but internally similar communities (e.g., "scientists" and "stakeholders") and instead treating its
Woyengo, T A; Jha, R; Beltranena, E; Zijlstra, R T
2016-06-01
Canola co-products are sources of amino acid and energy in pig feeds, but their fermentation characteristics in the pig intestine are unknown. Thus, we determined the in vitro fermentation characteristics of the canola co-products Brassica juncea solvent-extracted canola meal (JSECM), Brassica napus solvent-extracted canola meal (NSECM), B. napus expeller-pressed canola meal (NEPCM) and B. napus cold-pressed canola cake (NCPCC) in comparison with soybean meal (SBM). Samples were hydrolysed in two steps using pepsin and pancreatin. Subsequently, residues were incubated in a buffer solution with fresh pig faeces as inocula for 72 h to measure gas production. Concentration of volatile fatty acids (VFA) per gram of dry matter (DM) of feedstuff was measured in fermented solutions. Apparent ileal digestibility (AID) and apparent hindgut fermentation (AHF) of gross energy (GE) for feedstuffs were obtained from pigs fed the same feedstuffs. On DM basis, SBM, JSECM, NSECM, NEPCM and NCPCC contained 15, 19, 22, 117 and 231 g/kg ether extract; and 85, 223, 306, 208 and 176 g/kg NDF, respectively. In vitro digestibility of DM (IVDDM) of SBM (82.3%) was greater (Pfermentation characteristics of canola co-products and SBM simulated their fermentation in the small and large intestine of pigs, respectively. The 30% greater VFA production for JSECM than NSECM due to lower lignified fibre of JSECM indicates that fermentation characteristics differ between canola species. The NSECM had the highest fermentability followed by NEPCM and then NCPCC, indicating that fat in canola co-products can limit their fermentability in the hindgut.
Method for producing ethanol and co-products from cellulosic biomass
Nguyen, Quang A
2013-10-01
The present invention generally relates to processes for production of ethanol from cellulosic biomass. The present invention also relates to production of various co-products of preparation of ethanol from cellulosic biomass. The present invention further relates to improvements in one or more aspects of preparation of ethanol from cellulosic biomass including, for example, improved methods for cleaning biomass feedstocks, improved acid impregnation, and improved steam treatment, or "steam explosion."
Qi, Zisong; Yu, Songjie; Li, Xingwei
2016-02-19
The synthesis of N-unprotected indoles has been realized via Rh(III)-catalyzed C-H activation/annulation of imidamides with α-diazo β-ketoesters. The reaction occurs with the release of an amide coproduct, which originates from both the imidamide and the diazo as a result of C═N cleavage of the imidamide and C-C(acyl) cleavage of the diazo. A rhodacyclic intermediate has been isolated and a plausible mechanism has been proposed.
Vlasova, Tatiana; Volkov, Sergey
2016-09-01
The paper is an attempt to tie together main biogeophysical and social science projects under the auspice of interdisciplinary sustainability science development. Special attention is put to the necessity of the transdisciplinary knowledge co-production based on activities and problem-solutions approaches. It puts attention to the role of monitoring activities in sustainability interdisciplinary science and transdisciplinary knowledge evolution in the Arctic. Socially focused monitoring named Socially-Oriented Observations creating a transdisciplinary space is viewed as one of sources of learning and transformations towards sustainability making possible to shape rapid changes happening in the Arctic based on sustainability knowledge co-production. Continuous Socially-Oriented Observations integrating scientific, education and monitoring methods enables to define adaptation and transformation pathways in the Arctic - the most rapidly changing region of our planet. Socially-Oriented Observations are based on the existing and developing interdisciplinary scientific approaches emerged within natural science and social science projects, sustainable development and resilience concepts putting principle attention to building sustainable and resilient socio-ecological systems. It is argued that the Arctic sustainability science is a valuable component of the whole and broader system of the Arctic Sustainability knowledge co-produced with the help of transdisciplinary approaches integrating science, local/traditional knowledge, entrepreneurship, education, decision-making. Socially-Oriented Observations are designed to be a transdisciplinary interactive continuous participatory process empowering deliberate choices of people that can shape the changes and enable transformation towards sustainability. Approaches of Socially-Oriented Observations and methods of implementation that have been developed since the IPY 2007/2008 and being practiced in different regions of the
Wu, Felicia; Munkvold, Gary P
2008-06-11
The rapidly expanding U.S. ethanol industry is generating a growing supply of co-products, mostly in the form of dried distillers' grain and solubles (DDGS) or wet distillers' grains (WDG). In the United States, 90% of the co-products of maize-based ethanol are fed to livestock. An unintended consequence is that animals are likely to be fed higher levels of mycotoxins, which are concentrated up to three times in DDGS compared to grain. The model developed in this study estimates current losses to the swine industry from weight gain reduction due to fumonisins in added DDGS at $9 million ($2-18 million) annually. If there is complete market penetration of DDGS in swine feed with 20% DDGS inclusion in swine feed and fumonisins are not controlled, losses may increase to $147 million ($29-293 million) annually. These values represent only those losses attributable to one mycotoxin on one adverse outcome on one species. The total loss due to mycotoxins in DDGS could be significantly higher due to additive or multiplicative effects of multiple mycotoxins on animal health. If mycotoxin surveillance is implemented by ethanol producers, losses are shifted among multiple stakeholders. Solutions to this problem include methods to reduce mycotoxin contamination in both pre- and postharvest maize.
Behar, D. H.; Pfeffer, W. T.; Beier, P.
2015-12-01
"Actionable Science provides data, analyses, projections, or tools that can support decisions regarding the management of the risks and impacts of climate change. It is ideally co-produced by scientists and decision makers and creates rigorous and accessible products to meet the needs of stakeholders. (Report to the Secretary of the Interior, Advisory Committee on Climate Change and Natural Resource Science (ACCCNRS), March 30, 2015)During one 17 month period ending in 2013, three major reports on sea level rise from three highly respected science providers produced three divergent estimates of sea level rise. These reports collectively flummoxed the lay reader seeking direction for adaptation planning. Guidance documents soon emerged from state entities which caused further confusion. The City and County of San Francisco began developing "Guidance for Incorporating Sea Level Rise into Capital Planning" in 2013 at the direction of San Francisco Mayor Edwin Lee (http://onesanfrancisco.org/staff-resources/sea-level-rise-guidance/). The first task in developing this Guidance was to convert these highly technical reports into "actionable science." This required extensive expert elicitation to tease out their meaning and use value for decision making. This process, which resulted in detailed guidance on the use of SLR science in planning, is increasingly being called "co-production."Co-production requires both scientist and decision-maker to hear the other's perspective, reflect upon the decision-maker's precise needs, and translate peer review science into lay language and practical advice for decision making. The co-production dynamic was the subject of extensive discussion in the federal Advisory Committee on Climate Change and Natural Resource Science. The ACCCNRS recommendations (https://nccwsc.usgs.gov/acccnrs) include not only the new definition of Actionable Science cited above, but also a "How-To-Guide" that outlines principles for successfully creating a co-production
Yu, Peiqiang; Xin, Hangshu; Ban, Yajing; Zhang, Xuewei
2014-05-07
Recent advances in biofuel and bio-oil processing technology require huge supplies of energy feedstocks for processing. Very recently, new carinata seeds have been developed as energy feedstocks for biofuel and bio-oil production. The processing results in a large amount of coproducts, which are carinata meal. To date, there is no systematic study on interactive association between biopolymers and biofunctions in carinata seed as energy feedstocks for biofuel and bioethanol processing and their processing coproducts (carinata meal). Molecular spectroscopy with synchrotron and globar sources is a rapid and noninvasive analytical technique and is able to investigate molecular structure conformation in relation to biopolymer functions and bioavailability. However, to date, these techniques are seldom used in biofuel and bioethanol processing in other research laboratories. This paper aims to provide research progress and updates with molecular spectroscopy on the energy feedstock (carinata seed) and coproducts (carinata meal) from biofuel and bioethanol processing and show how to use these molecular techniques to study the interactive association between biopolymers and biofunctions in the energy feedstocks and their coproducts (carinata meal) from biofuel and bio-oil processing before and after biodegradation.
Digital Co-production in Archaeology. An editorial
Directory of Open Access Journals (Sweden)
Chiara Bonacchi
2017-12-01
Full Text Available This special issue focuses on digitally-enabled co-production in archaeology, by bringing together papers that were presented at the session Communication as Collaboration: Digital Methods, Experiences and Values, organised at the 21st Annual Meeting of the European Association of Archaeologists (University of Glasgow, 2015. The session was part of the Communicating Archaeology thematic cluster, which was partly inspired by the first published volume dedicated specifically to the topic of digital public engagement in archaeology (Bonacchi 2012. In that session and in this collection, we have been exploring communication as the collaborative construction of materials and interpretations rather than the dissemination of content at given stages of the archaeological research process (Bonacchi and Moshenska 2015.
System expansion for handling co-products in LCA of sugar cane bio-energy systems
DEFF Research Database (Denmark)
Nguyen, T Lan T; Hermansen, John Erik
2012-01-01
This study aims to establish a procedure for handling co-products in life cycle assessment (LCA) of a typical sugar cane system. The procedure is essential for environmental assessment of ethanol from molasses, a co-product of sugar which has long been used mainly for feed. We compare system...... expansion and two allocation procedures for estimating greenhouse gas (GHG) emissions of molasses ethanol. As seen from our results, system expansion yields the highest estimate among the three. However, no matter which procedure is used, a significant reduction of emissions from the fuel stage...... in the abatement scenario, which assumes implementation of substituting bioenergy for fossil-based energy to reduce GHG emissions, combined with a negligible level of emissions from the use stage, keeps the estimate of ethanol life cycle GHG emissions below that of gasoline. Pointing out that indirect land use...
Tanino, Takanori; Nara, Youhei; Tsujiguchi, Takuya; Ohshima, Takayuki
2013-08-01
The coproduction of a useful material and electricity via a novel application of microbial fuel cell (MFC) technology to oxidative fermentation was investigated. We focused on vinegar production, i.e., acetic acid fermentation, as an initial and model useful material that can be produced by oxidative fermentation in combination with MFC technology. The coproduction of acetic acid and electricity by applying MFC technology was successfully demonstrated by the simultaneous progress of acetic acid fermentation and electricity generation through a series of repeated batch fermentations. Although the production rate of acetic acid was very small, it increased with the number of repeated batch fermentations that were conducted. We obtained nearly identical (73.1%) or larger (89.9%) acetic acid yields than that typically achieved by aerated fermentation (75.8%). The open-cycle voltages measured before and after fermentation increased with the total fermentation time and reached a maximum value of 0.521 V prior to the third batch fermentation. The maximum current and power densities measured in this study (19.1 μA/cm² and 2.47 μW/cm², respectively) were obtained after the second batch fermentation. Copyright © 2013 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.
Co-production, new public governance and third sector social services in Europe
Directory of Open Access Journals (Sweden)
Victor Pestoff
2011-01-01
political and economic challenges facing the welfare state in the 21st century. Co-production provides a model for the mix of public service agents and citizens who contribute to the provision of a public service. New Public Governance (NPG puts much greater emphasis on citizen participation and third sector provision of social services than either traditional public administration or New Public Management. Co-production is a core element of NPG that promotes the mix of public service agents and citizens who contribute to the provis ionof a public service. This paper explores the implications of two comparative studies of paren tparticipation in preschool services in Europe. They observe that citizen participation clearly varies between different providers of social services, as too does client and staff influence. This empirical overview concludes that some third sector providers can facilitate greater citizen participation, while a 'glass ceiling' for participation exists in municipal and for-profit preschool services. These findings can contribute to a better understanding of the emerging paradigm of New Public Governance.
Versatile and on-demand biologics co-production in yeast.
Cao, Jicong; Perez-Pinera, Pablo; Lowenhaupt, Ky; Wu, Ming-Ru; Purcell, Oliver; de la Fuente-Nunez, Cesar; Lu, Timothy K
2018-01-08
Current limitations to on-demand drug manufacturing can be addressed by technologies that streamline manufacturing processes. Combining the production of two or more drugs into a single batch could not only be useful for research, clinical studies, and urgent therapies but also effective when combination therapies are needed or where resources are scarce. Here we propose strategies to concurrently produce multiple biologics from yeast in single batches by multiplexing strain development, cell culture, separation, and purification. We demonstrate proof-of-concept for three biologics co-production strategies: (i) inducible expression of multiple biologics and control over the ratio between biologic drugs produced together; (ii) consolidated bioprocessing; and (iii) co-expression and co-purification of a mixture of two monoclonal antibodies. We then use these basic strategies to produce drug mixtures as well as to separate drugs. These strategies offer a diverse array of options for on-demand, flexible, low-cost, and decentralized biomanufacturing applications without the need for specialized equipment.
Solvent-free lipase-catalyzed preparation of diglycerides from co-products of vegetable oil refining
Directory of Open Access Journals (Sweden)
Tangkam, Kamol
2008-09-01
Full Text Available Co-products of vegetable oil refining such as a mixed deodorizer distillate resulting from the refining of various vegetable oils, a crude distillate resulting from the physical refining of coconut oil and commercial mixtures of distilled sunflower and coconut fatty acids were used as starting materials for the enzymatic preparation of diglycerides. Reaction conditions (temperature, pressure, molar ratio for the formation of diglycerides by lipase-catalyzed esterification/transesterification were studied using the mixed deodorizer distillate and glycerol as starting materials. The best results were obtained with the immobilized lipase B from Candida antarctica (Novozym 435 in vacuo at 60 °C leading to moderate proportions (~52% of diglycerides. The proportion of diglycerides increased when residual acylglycerides of the co-products of vegetable oil refining were hydrolyzed prior to esterification. Thus, the esterification of hydrolyzed co-products of vegetable oil refining with glycerol led to high formation (62-72% of diglycerides. Short-path vacuum distillation of the esterification products yielded distillation residues containing from 70% to 94% diglycerides. The proportions of fatty acids and monoglycerides in the distilled residues were quite low (Subproductos del refinado de los aceites vegetales tales como el destilado obtenido en el desodorizador al refinar distintos aceites vegetales, el destilado crudo resultante de la refinación física del aceite de coco, y mezclas comerciales de los ácidos grasos obtenidos en la destilación de aceites de girasol y coco fueron utilizados como materiales de partida para la preparación enzimática de diglicéridos. Se estudiaron las condiciones de reacción (temperatura, presión, relación molar para la formación de diglicéridos mediante esterificación/ transesterificación catalizada por lipasas usando la mezcla obtenida del desodorizador y glicerol como materiales de partida. Los mejores
Energy Technology Data Exchange (ETDEWEB)
John W. Rich
2001-03-01
Waste Processors Management, Inc. (WMPI), along with its subcontractors Texaco Power and Gasification (now ChevronTexaco), SASOL Technology Ltd., and Nexant Inc. entered into a Cooperative Agreement with the USDOE, National Energy Technology Laboratory (NETL) to assess the techno-economic viability of building an Early Entrance Co-Production Plant (EECP) in the US to produce ultra clean Fischer-Tropsch (FT) transportation fuels with either power or steam as the major co--product. The EECP design includes recovery and gasification of low-cost coal waste (culm) from physical coal cleaning operations and will assess blends of the culm with coal or petroleum coke. The project has three phases: Phase 1 is the concept definition and engineering feasibility study to identify areas of technical, environmental and financial risk. Phase 2 is an experimental testing program designed to validate the coal waste mixture gasification performance. Phase 3 updates the original EECP design based on results from Phase 2, to prepare a preliminary engineering design package and financial plan for obtaining private funding to build a 5,000 barrel per day (BPD) coal gasification/liquefaction plant next to an existing co-generation plant in Gilberton, Schuylkill County, Pennsylvania. The current report is WMPI's third quarterly technical progress report. It covers the period performance from October 1, 2001 through December 31, 2001.
Daneshvar, Hadi; Anderson, Stuart; Williams, Robin; Mozaffar, Hajar
2018-02-12
The future of health care services in the European Union faces the triple challenges of aging, fiscal restriction, and inclusion. Co-production offers ways to manage informal care resources to help them cater for the growing needs of elderly people. Social media (SM) is seen as a critical enabler for co-production. The objective of this study was to investigate how SM-private Facebook groups, forums, Twitter, and blogging-acts as an enabler of co-production in health and care by facilitating its four underlying principles: equality, diversity, accessibility, and reciprocity. We used normalization process theory as our theoretical framework to design this study. We conducted a qualitative study and collected data through 20 semistructured interviews and observation of the activities of 10 online groups and individuals. We then used thematic analysis and drew on principles of co-production (equality, diversity, accessibility, and reciprocity) as a deductive coding framework to analyze our findings. Our findings point to distinct patterns of feature use by different people involved in care of elderly people. This diversity makes possible the principles of co-production by offering equality among users, enabling diversity of use, making experiences accessible, and encouraging reciprocity in the sharing of knowledge and mutual support. We also identified that explication of common resources may lead to new forms of competition and conflicts. These conflicts require better management to enhance the coordination of the common pool of resources. SM uses afford new forms of organizing and collective engagement between patients, carers, and professionals, which leads to change in health and care communication and coordination. ©Hadi Daneshvar, Stuart Anderson, Robin Williams, Hajar Mozaffar. Originally published in JMIR Human Factors (http://humanfactors.jmir.org), 12.02.2018.
Development of coal partial hydropyrolysis process
Energy Technology Data Exchange (ETDEWEB)
Hideaki Yabe; Takafumi Kawamura; Kohichiroh Gotoh; Akemitsu Akimoto [Nippon Steel Corporation, Chiba (Japan)
2005-07-01
Coal partial hydropyrolysis process aims at co-production of high yield of light oil such as BTX and naphthalene and synthesis gas from a low rank coal under a mild hydropyrolysis condition. The characteristic of this process is in the two-staged entrained hydropyrolysis reactor composed of the reformer and gasifier. This reactor arrangement gives us high heat efficiency of this process. So far, in order to evaluate the process concept a small-scale basic experiment and a 1t/day process development unit study were carried out. The experimental results showed that coal volatiles were partially hydrogenated to increase the light oil and hydrocarbon gases at the condition of partial hydropyrolysis such as pressure of 2-3MPa, temperature of 700-900{sup o}C and hydrogen concentration of 30-50%. This process has a possibility of producing efficiently and economically liquid and gas products as chemicals and fuel for power generation. As a further development in the period of 2003 to 2008, a 20t/day pilot plant study named ECOPRO (efficient co-production with coal flash hydropyrolysis technology) has been started to establish the process technologies for commercialization. 12 refs., 6 figs., 3 tabs.
Possibilities of utilization of co-products from corn grain ethanol and starch production
Directory of Open Access Journals (Sweden)
Semenčenko Valentina V.
2013-01-01
Full Text Available In recent decades, the expansion of alternative fuels production from crops traditionally used for food and animal feed has led to significant changes in the field of energy production, agriculture and food industry. Starch and sugar feedstocks for ethanol production (corn, wheat, sugar beet, sugar cane, etc. require increasing arable land to meet market demands for the biofuel production. Although intensive studies are being carried out in order to identify improved and more cost-effective methods for the utilization of lignocellulosic and communal waste in the production of alcohol fuel, the possibility of using dry distillers’ grains with solubles (DDGS, by-product of bioethanol production from corn and wheat as well as alcoholic beverages industry, is now in focus. Application of DDGS in livestock and poultry diets in concentrations greater than traditional could positively affect the economic viability of this biofuel production, but also stabilize the current imbalance in the food and animal feed market. However, DDGS feedstuff should not be treated as a perfect substitute for corn because the complexity of ration formulation determined at the farm or feedlot level is driven by energy and protein and other nutrient requirements, as well as their relative costs in the ration. Nevertheless, processing of corn by wet milling provides a multitude of co-products suitable for feedstuffs, food industry, pharmaceuticals, chemistry etc. Some of the most important wet milling co-products that have their use in feedstuffs are corn gluten feed and corn gluten meal. The use of DDGS as a substitute for traditional feed could prevent indirect land-use changes associated with biofuel production, and therefore preserve the environmental destruction by saving the forests and permanent pastures. The use of distiller’s grains can be beneficial to biofuel growth as this is an additional, the second largest, source of income accounting of 10-20% total
Directory of Open Access Journals (Sweden)
Trish Hafford-Letchfield
2016-03-01
Full Text Available Contemporary themes in public policy have emphasised co-productive approaches within both the access and provision of support services to older people. This paper provides a cross disciplinary exploration from its respective authors perspectives on social work and educational gerontology to examine the potential for lifelong learning and learning interventions from which co-production with those using social care services in later life might be better facilitated. Using an example from the UK, we specifically elicit how co-produced care can enhance the horizon of learning and learning research. The synthesis of ideas across these two disciplines could enrich understanding and provide essential levers for moving towards empowerment and emancipation by engaging with a more co-productive approach in social care for older people.
Collaboration, Coproduction, and Code-Switching: Colonial Cinema and Postcolonial Archaeology
Directory of Open Access Journals (Sweden)
Nayoung Aimee Kwon
2012-12-01
Full Text Available This article reassesses the issue of colonial collaboration in the Japanese empire by examining the rise of cinematic coproductions between Japanese and Korean filmmakers. By the late 1930s, colonial Korea’s filmmaking industry had been fully subsumed into the Japanese film industry, and regulations were established that required all films to assimilate imperial policies. The colonial government’s active promotion of colonial “collaboration” and “coproduction” between the colonizers and the colonized ideologically worked to obfuscate these increasing restrictions in colonial film productions while producing complex and contentious desires across the colonial divide. The very concepts of “collaboration” and “coproduction” need to be redefined in light of increasingly complex imperial hierarchies and entanglements. Taking the concept of “code-switching” beyond its linguistic origins, this article argues that we must reassess texts of colonial collaboration and coproduction produced at a time when Korean film had to “code-switch” into Japanese—to linguistically, culturally, and politically align itself with the wartime empire. The article argues that recently excavated films from colonial and Cold War archives, such as Spring in the Korean Peninsula, offer a rare glimpse into repressed and contested histories and raise the broader conundrum of accessing and assessing uneasily commingled colonial pasts of Asian-Pacific nations in the ruins of postcolonial aftermath.
Organising for Co-Production: Local Interaction Platforms for Urban Sustainability
Directory of Open Access Journals (Sweden)
Beth Perry
2018-04-01
Full Text Available Urban sustainability is a wicked issue unsuited to management through traditional decision-making structures. Co-productive arrangements, spaces and processes are inscribed in new organisational forms to bridge between diverse forms of knowledge and expertise. This article suggests that local interaction platforms (LIPs are innovative responses to these challenges, developed in two African and two European cities between 2010 and 2014. Through elaborating the design and practice of the LIPs, the article concludes that the value of this approach lies in its context-sensitivity and iterative flexibility to articulate between internationally shared challenges and distinctive local practices. Six necessary conditions for the evolution of LIPs are presented: anchorage, co-constitution, context-sensitivity, alignment, connection and shared functions. In the context of increased uncertainty, complexity and the demand for transdisciplinary knowledge production, the platform concept has wider relevance in surfacing the challenges and possibilities for more adaptive urban governance.
Biofuels, including corn-based ethanol, can partially meet the increasing demand for transportation fuels. The production of ethanol in the U.S. has dramatically increased; so too has the quantity of manufacturing coproducts. These nonfermentable residues (i.e., proteins, fibers, oils) are sold as...
DEFF Research Database (Denmark)
Juhl, Joakim; Buch, Anders
institution building where business and management competencies are incorporated to engineering curricula. By comparing experiences from early career alumni from educations that are results of moving engineering institutions into business, we analyze the consequences imposed by changing disciplinary...... of innovation. In the recent two decades, universities and other engineering institutions that are typically identified with technology development have expanded their research and teaching activities towards the business end of innovation. Purpose This paper investigates the new emergent trend in academic...... demarcations within academic and professional engineering knowledges. Theoretical and methodological framework The paper draws upon theoretical frameworks from Practice Theory (e.g. as developed by Theodore Schatzki, Stephen Kemmis et al.), and co-production and sociotechnical imaginaries from Science...
Directory of Open Access Journals (Sweden)
Michael Morton
2016-05-01
Full Text Available In North West London, health and social care leaders decided to design a system of integrated care with the aim of improving the quality of care and supporting people to maintain independence and participation in their community. Patients and carers, known as ‘lay partners,’ were to be equal partners in co-production of the system. Lay partners were recruited by sending a role profile to health, social care and voluntary organisations and requesting nominations. They formed a Lay Partners Advisory Group from which pairs were allocated to system design workstreams, such as which population to focus on, financial flow, information technology and governance. A larger and more diverse Lay Partners Forum provided feedback on the emerging plans. A key outcome of this approach was the development of an integration toolkit co-designed with lay partners. Lay partners provided challenge, encouraged innovation, improved communication, and held the actions of other partners to account to ensure the vision and aims of the emerging integrated care system were met. Key lessons from the North West London experience for effective co-production include: recruiting patients and carers with experience of strategic work; commitment to the vision; willingness to challenge and to listen; strong connections within the community being served; and enough time to do the work. Including lay partners in co-design from the start, and at every level, was important. Agreeing the principles of working together, providing support and continuously recruiting lay representatives to represent their communities are keys to effective co-production.
Morton, Michael; Paice, Elisabeth
2016-05-03
In North West London, health and social care leaders decided to design a system of integrated care with the aim of improving the quality of care and supporting people to maintain independence and participation in their community. Patients and carers, known as 'lay partners,' were to be equal partners in co-production of the system. Lay partners were recruited by sending a role profile to health, social care and voluntary organisations and requesting nominations. They formed a Lay Partners Advisory Group from which pairs were allocated to system design workstreams, such as which population to focus on, financial flow, information technology and governance. A larger and more diverse Lay Partners Forum provided feedback on the emerging plans. A key outcome of this approach was the development of an integration toolkit co-designed with lay partners. Lay partners provided challenge, encouraged innovation, improved communication, and held the actions of other partners to account to ensure the vision and aims of the emerging integrated care system were met. Key lessons from the North West London experience for effective co-production include: recruiting patients and carers with experience of strategic work; commitment to the vision; willingness to challenge and to listen; strong connections within the community being served; and enough time to do the work. Including lay partners in co-design from the start, and at every level, was important. Agreeing the principles of working together, providing support and continuously recruiting lay representatives to represent their communities are keys to effective co-production.
Catalytic-independent roles of UTX-1 in C. elegans development
DEFF Research Database (Denmark)
Vandamme, Julien; Salcini, Anna Elisabetta
2013-01-01
We recently analyzed the functional roles of UTX-1 during development. utx-1 is an essential gene required for the correct embryonic and post-embryonic development of C. elegans, and it displays an H3K27me3 demethylase activity. Rescue experiments demonstrated that the enzymatic activity of UTX-1...
Histone HIST1H1C/H1.2 regulates autophagy in the development of diabetic retinopathy.
Wang, Wenjun; Wang, Qing; Wan, Danyang; Sun, Yue; Wang, Lin; Chen, Hong; Liu, Chengyu; Petersen, Robert B; Li, Jianshuang; Xue, Weili; Zheng, Ling; Huang, Kun
2017-05-04
Autophagy plays critical and complex roles in many human diseases, including diabetes and its complications. However, the role of autophagy in the development of diabetic retinopathy remains uncertain. Core histone modifications have been reported involved in the development of diabetic retinopathy, but little is known about the histone variants. Here, we observed increased autophagy and histone HIST1H1C/H1.2, an important variant of the linker histone H1, in the retinas of type 1 diabetic rodents. Overexpression of histone HIST1H1C upregulates SIRT1 and HDAC1 to maintain the deacetylation status of H4K16, leads to upregulation of ATG proteins, then promotes autophagy in cultured retinal cell line. Histone HIST1H1C overexpression also promotes inflammation and cell toxicity in vitro. Knockdown of histone HIST1H1C reduces both the basal and stresses (including high glucose)-induced autophagy, and inhibits high glucose induced inflammation and cell toxicity. Importantly, AAV-mediated histone HIST1H1C overexpression in the retinas leads to increased autophagy, inflammation, glial activation and neuron loss, similar to the pathological changes identified in the early stage of diabetic retinopathy. Furthermore, knockdown of histone Hist1h1c by siRNA in the retinas of diabetic mice significantly attenuated the diabetes-induced autophagy, inflammation, glial activation and neuron loss. These results indicate that histone HIST1H1C may offer a novel therapeutic target for preventing diabetic retinopathy.
Development of diacyltetrol lipids as activators for the C1 domain of protein kinase C.
Mamidi, Narsimha; Gorai, Sukhamoy; Mukherjee, Rakesh; Manna, Debasis
2012-04-01
The protein kinase C (PKC) family of serine/threonine kinases is an attractive drug target for the treatment of cancer and other diseases. Diacylglycerol (DAG), phorbol esters and others act as ligands for the C1 domain of PKC isoforms. Inspection of the crystal structure of the PKCδ C1b subdomain in complex with phorbol-13-O-acetate shows that one carbonyl group and two hydroxyl groups play pivotal roles in recognition of the C1 domain. To understand the importance of two hydroxyl groups of phorbol esters in PKC binding and to develop effective PKC activators, we synthesized DAG like diacyltetrols (DATs) and studied binding affinities with C1b subdomains of PKCδ and PKCθ. DATs, with the stereochemistry of natural DAGs at the sn-2 position, were synthesized from (+)-diethyl L-tartrate in four to seven steps as single isomers. The calculated EC(50) values for the short and long chain DATs varied in the range of 3-6 μM. Furthermore, the fluorescence anisotropy values of the proteins were increased in the presence of DATs in a similar manner to that of DAGs. Molecular docking of DATs (1b-4b) with PKCδ C1b showed that the DATs form hydrogen bonds with the polar residues and backbone of the protein, at the same binding site, as that of DAG and phorbol esters. Our findings reveal that DATs represent an attractive group of C1 domain ligands that can be used as research tools or further structurally modified for potential drug development.
Novel coproducts from corn milling and their use in ruminants? nutrition
DRAGOMIR, CATALIN; RINNE, MARKETTA; YANEZ-RUIZ, DAVID
2015-01-01
The article reviews published data on two novel coproducts originating from corn milling: high-protein distillers' grain (HPDG) and reduced-fat distillers' grain (RFDG). Based on a literature survey over the last decade, this article focuses on their chemical composition and, consequently, nutritive value and on the effects of their inclusion in ruminants' diets on rumen activity and animal performance. Compared to the classic distillers' grains, the two ne...
Palacio, Manuel; Cascajosa, Concepción
2012-01-01
abstractThis article will look into the case of a European television co-production: Pepe Carvalho (1999), a Spanish-Italian-French series based on the adventures of private detective created by writer Manuel Vázquez Montalbán. Taking account of production and reception issues, it will address the
Towards a stakeholder model for the co-production of the public-sector information system
Directory of Open Access Journals (Sweden)
Zita P. Correia
2005-01-01
Full Text Available Introduction. Proposes a systemic approach to Public Sector Information (PSI, defined as comprising entities in four categories - citizens, businesses, policymakers and administrations. This system also comprises four categories of information - on citizenship, economic and social development, policy and administration. Method. . A selective literature review was conducted to produce a convergence of perspectives from different fields, to provide the foundations for the stakeholder model. Analysis. The implications of the systemic approach to PSI, are: a a holistic and open view of the entities and elements involved; b clarification of the role of each of the stakeholder groups; c commitment of each group to the public sector information system, and hence co-responsibility for the system. The principle of co-production is applied to the PSI system, by building on lessons from development studies. Results. A model is developed where the different groups of stakeholders are seen as groups of people and organizations with distinctive characteristics, playing different roles, but not mutually exclusive regarding their participation in the different subsystems. Conclusion. Success in adopting the proposed model may depend on pre-existing characteristics and conditions of each socio-political context, including existing levels of social capital, as much as on the implementation of technology to improve public service delivery. However, it is possible to build synergistic relations relatively quickly, through an imaginative application of 'soft technologies', such as institution-building and organizational change.
Comparison of heuristics for an economic lot scheduling problem with deliberated coproduction
Directory of Open Access Journals (Sweden)
Pilar I. Vidal-Carreras
2009-12-01
Full Text Available We built on the Economic Lot Scheduling Problem Scheduling (ELSP literature by making some modifications in order to introduce new constraints which had not been thoroughly studied with a view to simulating specific real situations. Specifically, our aim is to propose and simulate different scheduling policies for a new ELSP variant: Deliberated Coproduction. This problem comprises a product system in an ELSP environment in which we may choose if more than one product can be produced on the machine at a given time. We expressly consider the option of coproducing two products whose demand is not substitutable. In order to draw conclusions, a simulation model and its results were developed in the article by employing modified Bomberger data which include two items that could be produced simultaneously.
Qu, Xin; Liu, Quan; Wang, Chao; Wang, Dawei; Oeser, Markus
2018-02-06
Conventional asphalt binder derived from the petroleum refining process is widely used in pavement engineering. However, asphalt binder is a non-renewable material. Therefore, the use of a co-production of renewable bio-oil as a modifier for petroleum asphalt has recently been getting more attention in the pavement field due to its renewability and its optimization for conventional petroleum-based asphalt binder. Significant research efforts have been done that mainly focus on the mechanical properties of bio-asphalt binder. However, there is still a lack of studies describing the effects of the co-production on performance of asphalt binders from a micro-scale perspective to better understand the fundamental modification mechanism. In this study, a reasonable molecular structure for the co-production of renewable bio-oils is created based on previous research findings and the observed functional groups from Fourier-transform infrared spectroscopy tests, which are fundamental and critical for establishing the molecular model of bio-asphalt binder with various biomaterials contents. Molecular simulation shows that the increase of biomaterial content causes the decrease of cohesion energy density, which can be related to the observed decrease of dynamic modulus. Additionally, a parameter of Flexibility Index is employed to characterize the ability of asphalt binder to resist deformation under oscillatory loading accurately.
Directory of Open Access Journals (Sweden)
Xin Qu
2018-02-01
Full Text Available Conventional asphalt binder derived from the petroleum refining process is widely used in pavement engineering. However, asphalt binder is a non-renewable material. Therefore, the use of a co-production of renewable bio-oil as a modifier for petroleum asphalt has recently been getting more attention in the pavement field due to its renewability and its optimization for conventional petroleum-based asphalt binder. Significant research efforts have been done that mainly focus on the mechanical properties of bio-asphalt binder. However, there is still a lack of studies describing the effects of the co-production on performance of asphalt binders from a micro-scale perspective to better understand the fundamental modification mechanism. In this study, a reasonable molecular structure for the co-production of renewable bio-oils is created based on previous research findings and the observed functional groups from Fourier-transform infrared spectroscopy tests, which are fundamental and critical for establishing the molecular model of bio-asphalt binder with various biomaterials contents. Molecular simulation shows that the increase of biomaterial content causes the decrease of cohesion energy density, which can be related to the observed decrease of dynamic modulus. Additionally, a parameter of Flexibility Index is employed to characterize the ability of asphalt binder to resist deformation under oscillatory loading accurately.
Directory of Open Access Journals (Sweden)
Louis Lebel
2015-03-01
Full Text Available Assessments of ecosystem services have been proposed as one way of incorporating concerns about environmental change and ecosystem conditions into subnational development planning. In Thailand a policy window for such initiatives is opening because of a transition in national policy toward area-based planning combined with broader political reforms to expand public participation and encourage more evidence-based decision making. We explored three case studies in Thailand in which central and local government agencies and research organizations partnered to engage local communities and other stakeholders in assessments of ecosystem services and human well-being. The analysis focused on the role ecosystem assessments play in building and creating demand for coproductive capacity. By coproductive capacities we mean the ability to combine scientific resources and governance capabilities in ways that bring about informed social change. We found evidence that the assessments built capacities for governance actors to explore scientific and research-based evidence, to consult scientific experts, and then to evaluate existing policies and plans using this newly acquired information. At the same time, scientific experts also learned to explore public policy issues, to consult planners and decision makers in government, and based on this knowledge to evaluate scientific evidence and revise the scope and goals of their research and analytical activities to better meet policy needs and demands. Coproductive capacities were built when various stakeholders jointly engaged in compilation and interpretation of evidence. Doing so helped legitimize the assessment process with positive feedback on both governance and science capacities. We also found evidence, however, of significant cultural and institutional constraints to designing and making better use of ecosystem services assessments. These constraints included insufficient resources for both knowledge making
Energy Technology Data Exchange (ETDEWEB)
Unknown
2003-01-01
Waste Processors Management, Inc. (WMPI), along with its subcontractors Texaco Power & Gasification (now ChevronTexaco), SASOL Technology Ltd., and Nexant Inc. entered into a Cooperative Agreement DE-FC26-00NT40693 with the U. S. Department of Energy (DOE), National Energy Technology Laboratory (NETL) to assess the technoeconomic viability of building an Early Entrance Co-Production Plant (EECP) in the United States to produce ultra clean Fischer-Tropsch (FT) transportation fuels with either power or steam as the major co-product. The EECP design includes recovery and gasification of low-cost coal waste (culm) from physical coal cleaning operations and will assess blends of the culm with coal or petroleum coke. The project has three phases. Phase I is the concept definition and engineering feasibility study to identify areas of technical, environmental and financial risk. Phase II is an experimental testing program designed to validate the coal waste mixture gasification performance. Phase III updates the original EECP design based on results from Phase II, to prepare a preliminary engineering design package and financial plan for obtaining private funding to build a 5,000 barrel per day (BPD) coal gasification/liquefaction plant next to an existing co-generation plant in Gilberton, Schuylkill County, Pennsylvania. The current report covers the period performance from July 1, 2002 through September 30, 2002.
Guo, J Y; Phillips, C E; Coffey, M T; Kim, S W
2015-11-01
The experiment investigated the effects of a supplemental candy coproduct (Chocolate Candy Feed [CCF]; International Ingredient Corp., St. Louis, MO), an alternative carbohydrate source to dietary lactose, on growth performance and on health status of nursery pigs. Crossbred pigs ( = 1,408; 21 d of age and 7.1 ± 0.3 kg BW; Smithfield Premium Genetics, Rose Hill, NC) were randomly assigned to 4 treatments (16 pens/treatment and 22 pigs/pen) in a randomized complete block design: 0, 15, 30, and 45% of lactose replaced by CCF based on equal amounts of total sugars. The experimental period was divided into 3 phases: phase I (1.8 kg diet/pig for 11 ± 1 d), phase II (6.8 kg diet/pig for 17 ± 2 d), and phase III (until 49 d after weaning). Pigs received a common phase III diet. The levels of lactose, supplied by whey permeate (79.3 ± 0.8% lactose), were 20, 8, and 0% in phase I, II, and III, respectively. All experimental diets contained the same levels of essential AA and energy (ME) for each phase. Fecal scores were observed on d 5, 7, and 9 after weaning. Blood samples were taken at the end of phase I and II to measure blood urea N. The duration of phase I tended to linearly decrease ( = 0.063) with increasing CCF. In phase I, the ADFI increased ( lactose on growth performance of nursery pigs. Blood urea N did not change in phase I but tended to linearly increase ( = 0.088) in phase II as CCF increased. There were no differences in fecal scores and mortality as CCF increased. However, increasing CCF tended to linearly decrease ( = 0.083) morbidity, which implies no adverse effects of a candy coproduct replacement on health status of nursery pigs. In conclusion, a candy coproduct can be used to replace up to 45% of dietary lactose for nursery pigs without negative effects on growth performance or health status. A candy coproduct could be an economical alternative to partly replace the use of lactose in swine production.
W.H. Voorberg (William); S.R. Jilke (Sebastian); L.G. Tummers (Lars); V.J.J.M. Bekkers (Victor)
2017-01-01
textabstractWestern governments are increasingly trying to stimulate citizens to ‘co-produce’ public services, among others, by offering them financial incentives. However, there are competing views on whether financial incentives stimulate co-production. While some argue it increases citizens’
Two human homeobox genes, c1 and c8: structure analysis and expression in embryonic development.
Simeone, A; Mavilio, F; Acampora, D; Giampaolo, A; Faiella, A; Zappavigna, V; D'Esposito, M; Pannese, M; Russo, G; Boncinelli, E
1987-07-01
Two human cDNA clones (HHO.c1.95 and HHO.c8.5111) containing a homeobox region have been characterized, and the respective genomic regions have been partially analyzed. Expression of the corresponding genes, termed c1 and c8, was evaluated in different organs and body parts during human embryonic/fetal development. HHO.c1.95 apparently encodes a 217-amino acid protein containing a class I homeodomain that shares 60 out of 61 amino acid residues with the Antennapedia homeodomain of Drosophila melanogaster. HHO.c8.5111 encodes a 153-amino acid protein containing a homeodomain identical to that of the frog AC1 gene. Clones HHO.c1 and HHO.c8 detect by blot-hydridization one and two specific polyadenylylated transcripts, respectively. These are differentially expressed in spinal cord, backbone rudiments, limb buds (or limbs), heart, and skin of human embryos and early fetuses in the 5- to 9-week postfertilization period, thus suggesting that the c1 and c8 genes play a key role in a variety of developmental processes. Together, the results of the embryonic/fetal expression of c1 and c8 and those of two previously analyzed genes (c10 and c13) indicate a coherent pattern of expression of these genes in early human ontogeny.
Two human homeobox genes, c1 and c8: structure analysis and expression in embryonic development
International Nuclear Information System (INIS)
Simeone, A.; Mavilio, F.; Acampora, D.
1987-01-01
Two human cDNA clones (HHO.c1.95 and HHO.c8.5111) containing a homeobox region have been characterized, and the respective genomic regions have been partially analyzed. Expression of the corresponding genes, termed c1 and c8, was evaluated in different organs and body parts during human embryonic/fetal development. HHO.c1.95 apparently encodes a 217-amino acid protein containing a class I homeodomain that shares 60 out of 61 amino acid residues with the Antennapedia homeodomain of Drosophila melanogaster. HHO.c8.5111 encodes a 153-amino acid protein containing a homeodomains identical to that of the frog AC1 gene. Clones HHO.c1 and HHO.c8 detect by blot-hybridization one and two specific polyadenylylated transcripts, respectively. These are differentially expressed in spinal cord, backbone rudiments, limb buds (or limbs), heart, and skin of human embryos and early fetuses in the 5- to 9-week postfertilization period, thus suggesting that the c1 and c8 genes play a key role in a variety of developmental processes. Together, the results of the embryonic/fetal expression of c1 and c8 and those of two previously analyzed genes (c10 and c13) indicate a coherent pattern of expression of these genes in early human ontogeny
Coproduct and star product in field theories on Lie-algebra noncommutative space-times
International Nuclear Information System (INIS)
Amelino-Camelia, Giovanni; Arzano, Michele
2002-01-01
We propose a new approach to field theory on κ-Minkowski noncommutative space-time, a popular example of Lie-algebra space-time. Our proposal is essentially based on the introduction of a star product, a technique which is proving to be very fruitful in analogous studies of canonical noncommutative space-times, such as the ones recently found to play a role in the description of certain string-theory backgrounds. We find to be incorrect the expectation, previously reported in the literature, that the lack of symmetry of the κ-Poincare coproduct should lead to interaction vertices that are not symmetric under exchanges of the momenta of identical particles entering the relevant processes. We show that in κ-Minkowski the coproduct and the star product must indeed treat momenta in a nonsymmetric way, but the overall structure of interaction vertices is symmetric under exchange of identical particles. We also show that in κ-Minkowski field theories it is convenient to introduce the concepts of 'planar' and 'nonplanar' Feynman loop diagrams, again in close analogy with the corresponding concepts previously introduced in the study of field theories in canonical noncommutative space-times
Bersaneti, Gabrielly Terassi; Pan, Nicole Caldas; Baldo, Cristiani; Celligoi, Maria Antonia Pedrine Colabone
2018-03-01
Fructooligosaccharides and levan have a wide range of applications in the food industry due to their physiological and functional properties. The enzymatic synthesis of these molecules exhibits great advantages when compared with microbial fermentation. In this study, the production of levansucrase from Bacillus subtilis natto and its utilization in fructooligosaccharides and levan syntheses using different reaction conditions were described. The best condition for levansucrase production was 420.7 g L -1 of sucrose at pH 7.0, which reached 23.9 U ml -1 of transfructosylation activity. In a bioreactor, the highest production of fructooligosaccharides was 41.3 g L -1 using a medium containing 350 g L -1 sucrose at 35 °C for 36 h. The enzymatic synthesis of levan resulted in 86.9 g L -1 when conditions similar to those used for fructooligosaccharides synthesis were applied. These results indicate that the levansucrase from B. subtilis natto could be applied for the co-production of fructooligosaccharides and levan, which are biomolecules that have health benefits and are used successfully in the food industry.
Energy Technology Data Exchange (ETDEWEB)
Zhen Fan
2006-05-30
Foster Wheeler has completed work under a U.S. Department of Energy cooperative agreement to develop a gasification equipment module that can serve as a building block for a variety of advanced, coal-fueled plants. When linked with other equipment blocks also under development, studies have shown that Foster Wheeler's gasification module can enable an electric generating plant to operate with an efficiency exceeding 60 percent (coal higher heating value basis) while producing near zero emissions of traditional stack gas pollutants. The heart of the equipment module is a pressurized circulating fluidized bed (PCFB) that is used to gasify the coal; it can operate with either air or oxygen and produces a coal-derived syngas without the formation of corrosive slag or sticky ash that can reduce plant availabilities. Rather than fuel a gas turbine for combined cycle power generation, the syngas can alternatively be processed to produce clean fuels and or chemicals. As a result, the study described herein was conducted to determine the performance and economics of using the syngas to produce hydrogen for sale to a nearby refinery in a hydrogen-electricity co-production plant setting. The plant is fueled with Pittsburgh No. 8 coal, produces 99.95 percent pure hydrogen at a rate of 260 tons per day and generates 255 MWe of power for sale. Based on an electricity sell price of $45/MWhr, the hydrogen has a 10-year levelized production cost of $6.75 per million Btu; this price is competitive with hydrogen produced by steam methane reforming at a natural gas price of $4/MMBtu. Hence, coal-fueled, PCFB gasifier-based plants appear to be a viable means for either high efficiency power generation or co-production of hydrogen and electricity. This report describes the PCFB gasifier-based plant, presents its performance and economics, and compares it to other coal-based and natural gas based hydrogen production technologies.
Fuel ethanol production from grains is mainly based on dry grind processing, during which phytate is concentrated about three fold in distillers dried grains with solubles (DDGS), a major co-product. For reducing phyate in DDGS, two industrial phytase preparations (Natuphos and Ronozyme) were used ...
International Nuclear Information System (INIS)
Gazquez, M.J.; Mantero, J.; Bolivar, J.P.; Garcia-Tenorio, R.; Vaca, F.
2011-01-01
The present study was conducted to characterize the raw materials (ilmenite and slag), waste (red gypsum) and several co-products (sulphate monohydrate and sulphate heptahydrated) form the titanium dioxide industry in relation to their elemental composition (major, minor and trace elements), granulometry, mineralogy, microscopic morphology, physical composition and radioactive content in order to apply this knowledge in the valorization of the co-products in the fields such a as construction, civil engineering, etc. In particular, the main properties of cements produced with different proportions of red gypsum were studied, and the obtained improvements, in relation to Ordinary Portland Cements (OPC) were evaluated. It was also demonstrated that the levels of pollutants and the radioactive content in the produced RG cements, remain within the regulated safety limits. (Author). 38 refs.
Davies, Julie; Sampson, Mark; Beesley, Frank; Smith, Debra; Baldwin, Victoria
2014-05-01
5 Boroughs Partnership NHS Foundation Trust, in the Northwest of England, has trained over 500 staff in the Knowledge and Understanding Framework, level 1 personality disorder awareness training. This is a 3-day nationally devised training programme delivered via an innovative co-production model (i.e. co-delivery and partnership working with service users who have lived experience). This paper provides quantitative and qualitative information on the effectiveness of training delivery and also serves to provide some insight into the impact of service-user involvement via such a co-production model. Information on 162 participants using the Knowledge and Understanding Framework bespoke questionnaire (Personality Disorder Knowledge, Attitudes and Skills Questionnaire) suggests that the training can be effectively delivered by and within a local NHS Mental Health Trust. Results immediately post-training suggest an improvement in levels of understanding and capability efficacy and a reduction in negative emotional reactions. Indications from a 3-month follow-up suggest that while understanding and emotional reaction remain improved, capability efficacy regresses back to pre-training levels, suggesting the need for ongoing supervision and/or support to consolidate skills. Discussion includes guidelines for the implementation of a truly integrated co-production model of training provision, as well as advice relating to the maximization of long-term benefits. Copyright © 2014 John Wiley & Sons, Ltd.
Erickson, Daniel Thomas
An innovative process to add value to a corn-to-ethanol co-product, Thin stillage, was studied for pilot-scale viability. A 1500L bioreactor was designed, operated, and optimized to cultivate Rhizopus microsporus var. oligosporus via submersed fermentation in Thin Stillage. The biomass was harvested and processed into a feed suitable for storage and ultimately for animal feeding trials. Characterization of the biomass and feed trials revealed that there is substantial potential as a nutrient dense feed supplement with 41.1% protein, 26.3% fat, and metabolizable energy on s dried basis. The amino acid profile is superior to that of DDGS, with most notably 1.7% Lys on dried basis. This process produces a significantly more nutrient dense product than DDGS, and could increase water-reclaimation in a dry-grind corn to ethanol plant. Industrially it would replace the energy intensive process of converting thin stillage into syrup that adds only $10-25/ton to DDG, while maintaining production of DDG. Using thin stillage as used a growth media for R. microsporus var. oligosporus, should not only lead to saving in energy costs, but also generate a high-value co-product which could lead to economic gains. Also there is still unexplored potential of enzymes, chitin, and co-culturing to further add value.
Feasibility of solid oxide fuel cell dynamic hydrogen coproduction to meet building demand
Shaffer, Brendan; Brouwer, Jacob
2014-02-01
A dynamic internal reforming-solid oxide fuel cell system model is developed and used to simulate the coproduction of electricity and hydrogen while meeting the measured dynamic load of a typical southern California commercial building. The simulated direct internal reforming-solid oxide fuel cell (DIR-SOFC) system is controlled to become an electrical load following device that well follows the measured building load data (3-s resolution). The feasibility of the DIR-SOFC system to meet the dynamic building demand while co-producing hydrogen is demonstrated. The resulting thermal responses of the system to the electrical load dynamics as well as those dynamics associated with the filling of a hydrogen collection tank are investigated. The DIR-SOFC system model also allows for resolution of the fuel cell species and temperature distributions during these dynamics since thermal gradients are a concern for DIR-SOFC.
Alcohol binding in the C1 (C1A + C1B) domain of protein kinase C epsilon
Pany, Satyabrata; Das, Joydip
2015-01-01
Background Alcohol regulates the expression and function of protein kinase C epsilon (PKCε). In a previous study we identified an alcohol binding site in the C1B, one of the twin C1 subdomains of PKCε. Methods In this study, we investigated alcohol binding in the entire C1 domain (combined C1A and C1B) of PKCε. Fluorescent phorbol ester, SAPD and fluorescent diacylglycerol (DAG) analog, dansyl-DAG were used to study the effect of ethanol, butanol, and octanol on the ligand binding using fluorescence resonance energy transfer (FRET). To identify alcohol binding site(s), PKCεC1 was photolabeled with 3-azibutanol and 3-azioctanol, and analyzed by mass spectrometry. The effects of alcohols and the azialcohols on PKCε were studied in NG108-15 cells. Results In the presence of alcohol, SAPD and dansyl-DAG showed different extent of FRET, indicating differential effects of alcohol on the C1A and C1B subdomains. Effects of alcohols and azialcohols on PKCε in NG108-15 cells were comparable. Azialcohols labeled Tyr-176 of C1A and Tyr-250 of C1B. Inspection of the model structure of PKCεC1 reveals that these residues are 40 Å apart from each other indicating that these residues form two different alcohol binding sites. Conclusions The present results provide evidence for the presence of multiple alcohol-binding sites on PKCε and underscore the importance of targeting this PKC isoform in developing alcohol antagonists. PMID:26210390
Scarpa, F. M.; Boillat, S. P.; Grove, J. M.
2015-12-01
The search for sustainability and resilience requires the integration of natural science with social science, as well as the joint production of knowledge and solutions by science and society. In this context, international science coordination initiatives, like Future Earth, have increasingly stressed the need to perform more integrated and more socially relevant research. This contribution has the objective to highlight the potential role of a research coordination initiative, the Global Land Programme (GLP), to provide guidance for more integrative research. The need to perform integrative research is particularly true for land systems, which include dynamic interactions among social and natural drivers that are often multifunctional. Thus, their governance and management is particularity complex and involve highly diverse stakeholders. A key aspect of integrative research is co-production of knowledge, understood as the interactive production of knowledge by both academics and non-academics, that leads to new forms of solutions-oriented knowledge. We relied on experiences of co-production of knowledge on land systems from the GLP network, and drove seven lessons learnt: 1) the importance of including several learning loops in the process, 2) the importance of long-term relationships, 3) the need to overcome the distinction between basic and applied science, 4) the opportunities offered by new communication technologies, 5) the need to train professionals in both breadth and depth, 6) the access to knowledge, and 7) the need to understand better the roles of scientists and decision-makers. These lessons were used to define action-research priorities for enhancing co-production of knowledge on land systems in GLP projects and working groups. As a conclusion, we argue that research coordination initiatives have the potential to provide analysis and guidance for more integrative research. This can be done by performing synthesis and self-reflection activities that
van der Molen, Franke; Puente Rodriguez, Daniel
2013-01-01
Governance practices are places where knowledge and power interconnect. In this paper, the stabilization of a governance practice concerning mussel fisheries in the Dutch Wadden Sea is described and analyzed in terms of the co-production of knowledge and power. In this governance practice,
The balancing act of transcription factors C-1-1 and Runx2 in articular cartilage development
International Nuclear Information System (INIS)
Iwamoto, Masahiro; Koyama, Eiki; Enomoto-Iwamoto, Motomi; Pacifici, Maurizio
2005-01-01
In previous studies we found that the ets transcription factor C-1-1 is involved in articular chondrocyte development, and we and others found that the transcription factor Runx2 is required for growth plate chondrocyte maturation and ossification. We determined here whether the two factors exert reciprocal influences on their expression and function and in so doing, steer chondrocyte developmental paths. Virally driven Runx2 over-expression in cultured chick chondrocytes did indeed lead to decreased C-1-1 expression, accompanied by decreased expression of articular cartilage marker tenascin-C, decreased proliferation, and increased expression of maturation marker collagen X. In good agreement, over-expression of a dominant-negative Runx2 form had opposite phenotypic consequences. When C-1-1 itself was over-expressed in chondrocytes already undergoing maturation, maturation was halted and the cells became small, rich in tenascin-C, and mitotically quite active. To extend these observations, we misexpressed C-1-1 in mouse cartilage and found that it caused a severe inhibition of chondrocyte maturation and widespread tenascin-C expression. In sum, C-1-1 and Runx2 do influence their respective expression patterns. The factors are powerful chondrocyte regulators and their functional interrelationships may be important for steering the cells toward alternative developmental paths
Papadimitriou, Vassileios C.; McGillen, Max R.; Smith, Shona C.; Jubb, Aaron M.; Portmann, Robert W.; Hall, Bradley D.; Fleming, Eric L.; Jackman, Charles H.; Burkholder, James B.
2013-01-01
The atmospheric processing of (E)- and (Z)-1,2-dichlorohexafluorocyclobutane (1,2-c-C4F6Cl2, R-316c) was examined in this work as the ozone depleting (ODP) and global warming (GWP) potentials of this proposed replacement compound are presently unknown. The predominant atmospheric loss processes and infrared absorption spectra of the R-316c isomers were measured to provide a basis to evaluate their atmospheric lifetimes and, thus, ODPs and GWPs. UV absorption spectra were measured between 184.95 to 230 nm at temperatures between 214 and 296 K and a parametrization for use in atmospheric modeling is presented. The Cl atom quantum yield in the 193 nm photolysis of R- 316c was measured to be 1.90 +/- 0.27. Hexafluorocyclobutene (c-C4F6) was determined to be a photolysis co-product with molar yields of 0.7 and 1.0 (+/-10%) for (E)- and (Z)-R-316c, respectively. The 296 K total rate coefficient for the O(1D) + R-316c reaction, i.e., O(1D) loss, was measured to be (1.56 +/- 0.11) × 10(exp -10)cu cm/ molecule/s and the reactive rate coefficient, i.e., R-316c loss, was measured to be (1.36 +/- 0.20) × 10(exp -10)cu cm/molecule/s corresponding to a approx. 88% reactive yield. Rate coefficient upper-limits for the OH and O3 reaction with R-316c were determined to be model to be 74.6 +/- 3 and 114.1 +/-10 years, respectively, where the estimated uncertainties are due solely to the uncertainty in the UV absorption spectra. Stratospheric photolysis is the predominant atmospheric loss process for both isomers with the O(1D) reaction making a minor, approx. 2% for the (E) isomer and 7% for the (Z) isomer, contribution to the total atmospheric loss. Ozone depletion potentials for (E)- and (Z)-R-316c were calculated using the 2-D model to be 0.46 and 0.54, respectively. Infrared absorption spectra for (E)- and (Z)-R-316c were measured at 296 K and used to estimate their radiative efficiencies (REs) and GWPs; 100-year time-horizon GWPs of 4160 and 5400 were obtained for (E)- and (Z
Pharmacogenetics of aldo-keto reductase 1C (AKR1C) enzymes.
Alshogran, Osama Y
2017-10-01
Genetic variation in metabolizing enzymes contributes to variable drug response and disease risk. Aldo-keto reductase type 1C (AKR1C) comprises a sub-family of reductase enzymes that play critical roles in the biotransformation of various drug substrates and endogenous compounds such as steroids. Several single nucleotide polymorphisms have been reported among AKR1C encoding genes, which may affect the functional expression of the enzymes. Areas covered: This review highlights and comprehensively discusses previous pharmacogenetic reports that have examined genetic variations in AKR1C and their association with disease development, drug disposition, and therapeutic outcomes. The article also provides information about the effect of AKR1C genetic variants on enzyme function in vitro. Expert opinion: The current evidence that links the effect of AKR1C gene polymorphisms to disease progression and development is inconsistent and needs further validation, despite of the tremendous knowledge available. Information about association of AKR1C genetic variants and drug efficacy, safety, and pharmacokinetics is limited, thus, future studies that advance our understanding about these relationships and their clinical relevance are needed. It is imperative to achieve consistent findings before the potential translation and adoption of AKR1C genetic variants in clinical practice.
Gelatin films plasticized with a simulated biodiesel coproduct stream
Directory of Open Access Journals (Sweden)
2009-04-01
Full Text Available In order to explore the possibility of substituting an unrefined biodiesel coproduct stream (BCS for refined glycerol as a polymer plasticizer we have prepared cast gelatin films plasticized with a simulated BCS, i.e., mixtures of glycerol and some of the typical components found in BCS (methyl linoleate, methyl oleate, linoleic acid, and oleic acid. We measured the tensile properties as a function of plasticizer composition, and analyzed the specific effect of each individual component on tensile properties. We found that it is the unrecovered alkyl esters that largely determine the tensile properties, and that BCS can be successfully used to plasticize cast gelatin films as long as the BCS contains 11 parts by weight, or less, of unrecovered alkyl esters per 100 parts glycerol.
Co-production of electricity and ethanol, process economics of value prior combustion
International Nuclear Information System (INIS)
Treasure, T.; Gonzalez, R.; Venditti, R.; Pu, Y.; Jameel, H.; Kelley, S.; Prestemon, Jeffrey
2012-01-01
Highlights: ► Economics of producing cellulosic ethanol and bio-power in the same facility using an autohydrolysis process. ► Feedstock considerably affect the economics of the biorefinery facility. ► Lower moisture content improves financial performance of the bio-power business. - Abstract: A process economic analysis of co-producing bioethanol and electricity (value prior to combustion) from mixed southern hardwood and southern yellow pine is presented. Bioethanol is produced by extracting carbohydrates from wood via autohydrolysis, membrane separation of byproducts, enzymatic hydrolysis of extracted oligomers and fermentation to ethanol. The residual solids after autohydrolysis are pressed and burned in a power boiler to generate steam and electricity. A base case scenario of biomass combustion to produce electricity is presented as a reference to understand the basics of bio-power generation economics. For the base case, minimum electricity revenue of $70–$96/MWh must be realized to achieve a 6–12% internal rate of return. In the alternative co-production cases, the ethanol facility is treated as a separate business entity that purchases power and steam from the biomass power plant. Minimum ethanol revenue required to achieve a 12% internal rate of return was estimated to be $0.84–$1.05/l for hardwood and $0.74–$0.85/l for softwood. Based on current market conditions and an assumed future ethanol selling price of $0.65/l, the co-production of cellulosic bioethanol and power does not produce financeable returns. A risk analysis indicates that there is a probability of 26.6% to achieve an internal rate of return equal or higher than 12%. It is suggested that focus be placed on improving yield and reducing CAPEX before this technology can be applied commercially. This modeling approach is a robust method to evaluate economic feasibility of integrated production of bio-power and other products based on extracted hemicellulose.
Development of the Advanced Technology Microwave Sounder (ATMS) for NPOESS C1
Brann, C.; Kunkee, D.
2008-12-01
The National Polar-orbiting Operational Environmental Satellite System's Advanced Technology Microwave Sounder (ATMS) is planned for flight on the first NPOESS mission (C1) in 2013. The C1 ATMS will be the second instrument of the ATMS series and will provide along with the companion Cross-track Infrared Sounder (CrIS), atmospheric temperature and moisture profiles for NPOESS. The first flight of the ATMS is scheduled in 2010 on the NPOESS Preparatory Project (NPP) satellite, which is an early instrument risk reduction component of the NPOESS mission. This poster will focus on the development of the ATMS for C1 including aspects of the sensor calibration, antenna beam and RF characteristics and scanning. New design aspects of the C1 ATMS, required primarily by parts obsolescence, will also be addressed in this poster.
Wu, Xiao-Yu
2016-09-26
In this article, we report a detailed study on co-production of H2 and syngas on La0.9Ca0.1FeO3−δ (LCF-91) membranes via water splitting and partial oxidation of methane, respectively. A permeation model shows that the surface reaction on the sweep side is the rate limiting step for this process on a 0.9 mm-thick dense membrane at 990°C. Hence, sweep side surface modifications such as adding a porous layer and nickel catalysts were applied; the hydrogen production rate from water thermolysis is enhanced by two orders of magnitude to 0.37 μmol/cm2•s compared with the results on the unmodified membrane. At the sweep side exit, syngas (H2/CO = 2) is produced and negligible solid carbon is found. Yet near the membrane surface on the sweep side, methane can decompose into solid carbon and hydrogen at the surface, or it may be oxidized into CO and CO2, depending on the oxygen permeation flux.
Action learning for health system governance: the reward and challenge of co-production.
Lehmann, Uta; Gilson, Lucy
2015-10-01
Health policy and systems research (HPSR) is centrally concerned with people, their relationships and the actions and practices they can implement towards better health systems. These concerns suggest that HPS researchers must work in direct engagement with the practitioners and practice central to the inquiry, acknowledging their tacit knowledge and drawing it into generating new insights into health system functioning. Social science perspectives are of particular importance in this field because health policies and health systems are themselves social and political constructs. However, how can social science methodologies such as action research and narrative and appreciative enquiry enable such research, and how can methodologies from different disciplines be woven together to construct and make meaning of evidence for 'this' field? This article seeks to present 'methodological musings' on these points, to prompt wider discussion on the practice of HPSR. It draws on one long-term collaborative action learning research project being undertaken in Cape Town, South Africa. The District Innovation and Action Learning for Health System Development project is an action research partnership between two South African academic institutions and two health authorities focused, ultimately, on strengthening governance in primary health care.Drawing on this experience, the article considers three interrelated issues: The diversity and complexities of practitioner and research actors involved in co-producing HPSR; The nature of co-production and the importance of providing space to grapple across different systems of meaning;The character of evidence and data in co-production. There is much to be learnt from research traditions outside the health sector, but HPSR must work out its own practices--through collaboration and innovation among researchers and practitioners. In this article, we provide one set of experiences to prompt wider reflection and stimulate engagement on the
Protein co-products and by-products of the biodiesel industry for ruminants feeding
Directory of Open Access Journals (Sweden)
Ricardo Andrés Botero Carrera
2012-05-01
Full Text Available The objective of the experiment was to classify 20 protein co-products and by-products of the biodiesel industry with potential to use in ruminant feeding. The meals evaluated were: cottonseed, canudo-de-pito, crambe, sunflower, castor-oil seeds detoxified with calcium, non-detoxified castor-oil seeds and soybean; and the cakes were: cottonseed, peanut, babassu, crambe, palm oil, sunflower, licuri, macauba seeds, non-detoxified castor-oil seeds, turnip and jatropha. The samples were quantified to determine dry matter (DM, organic matter (OM, crude protein (CP, ether extract (EE, neutral detergent fiber corrected for ash and protein (NDFap, non-fiber carbohydrates (NFC, acid detergent fiber corrected for ash and protein (ADFap, lignin, cutin and starch levels. The CP profile was characterized in fractions A, B1, B2, B3 and C. The in vitro dry matter digestibility (IVDMD, in vitro neutral detergent fiber digestibility (IVNDFD, rumen degradable and undegradable protein, intestinal digestibility, indigestible neutral detergent fiber and undegradable neutral detergent insoluble protein were evaluated. The OM, CP, EE, NDFap, NFC, ADFap, lignin, cutin and starch contents varied from 81.95 to 95.41%, 18.92 to 57.75%, 0.56 to 18.40%, 10.13 to 62.30%, 3.89 to 27.88%, 6.15 to 36.86%, 1.19 to 5.04%, 0 to 17.87% and 0.68 to 14.50%, respectively. The values of fractions A, B1, B2, B3 and C ranged from 5.40 to 43.31%, 0.08 to 37.63%, 16.75 to 79.39%, 1.86 to 59.15% and 0.60 to 11.47%, respectively. Concentrations of IVDMD, IVNDFD, rumen-degradable and undegradable protein, intestinal digestibility, indigestible NDF and undegradable neutral detergent insoluble protein ranged from 31.00 to 95.92%, 55.04 to 97.74%, 41.06 to 97.61%, 2.39 to 58.94, 9.27 to 94.26%, 1.05 to 40.80% and 0.29 to 2.92%, respectively. Some of these products can replace soybean meal, specially the Macauba seeds cake, cottonseed meal and peanut and turnip cakes based on digestive
Co-product generation in a biorefinery process is crucial to allow ethanol production from agricultural feedstocks to be economically viable. One feedstock that has underutilized potential in the U.S. is sweet sorghum. The stalks of sweet sorghum can be crushed to produce a juice rich in soluble sug...
Synthesis of the C1-C28 Portion of Spongistatin 1 (Altohyrtin A).
Claffey, Michelle M.; Hayes, Christopher J.; Heathcock, Clayton H.
1999-10-29
A synthetic approach was developed to the C1-C28 subunit of spongistatin 1 (altohyrtin A, 65). The key step was the coupling of the AB and CD spiroketal moieties via an anti-aldol reaction of aldehyde 62 and ethyl ketone 57. The development of a method for the construction of the AB spiroketal fragment is described and included the desymmetrization of C(2)-symmetric diketone 10 and the differentiation of the two primary alcohols of 16. Further elaboration of this advanced intermediate to the desired aldehyde 62 included an Evans' syn-aldol reaction and Tebbe olefination. The synthesis of the CD spiroketal fragment 56 involved the ketalization of a triol-dione, generated in situ by deprotection of 45, to provide a favorable ratio (6-7:1) of spiroketal isomers 46 and 47, respectively. The overall protecting group strategy, involving many selective manipulations of silyl protecting groups, was successfully developed to provide the desired C1-C28 subunit of spongistatin 1 (altohyrtin A) (65).
International Nuclear Information System (INIS)
Unknown
2001-01-01
Waste Processors Management, Inc. (WMPI), along with its subcontractors Texaco Power and Gasification, SASOL Technology Ltd., and Nexant Inc. entered into a Cooperative Agreement DE-FC26-00NT40693 with the US Department of Energy (DOE), National Energy Technology Laboratory (NETL) to assess the techno-economic viability of building an Early Entrance Co-Production Plant (EECP) in the US to produce ultra clean Fischer-Tropsch (FT) transportation fuels with either power or steam as the major co-product. The EECP designs emphasize on recovery and gasification of low-cost coal waste (culm) from coal clean operations and will assess blends of the culm and coal or petroleum coke as feedstocks. The project is being carried out in three phases. Phase I involves definition of concept and engineering feasibility study to identify areas of technical, environmental and financial risk. Phase II consists of an experimental testing program designed to validate the coal waste mixture gasification performance. Phase III involves updating the original EECP design, based on results from Phase II, to prepare a preliminary engineering design package and financial plan for obtaining private funding to build a 5,000 BPD coal gasification/liquefaction plant next to an existing co-generation plant in Gilberton, Schuylkill County, Pennsylvania
Energy Technology Data Exchange (ETDEWEB)
Unknown
2001-12-01
Waste Processors Management, Inc. (WMPI), along with its subcontractors Texaco Power & Gasification, SASOL Technology Ltd., and Nexant Inc. entered into a Cooperative Agreement DE-FC26-00NT40693 with the US Department of Energy (DOE), National Energy Technology Laboratory (NETL) to assess the techno-economic viability of building an Early Entrance Co-Production Plant (EECP) in the US to produce ultra clean Fischer-Tropsch (FT) transportation fuels with either power or steam as the major co-product. The EECP designs emphasize on recovery and gasification of low-cost coal waste (culm) from coal clean operations and will assess blends of the culm and coal or petroleum coke as feedstocks. The project is being carried out in three phases. Phase I involves definition of concept and engineering feasibility study to identify areas of technical, environmental and financial risk. Phase II consists of an experimental testing program designed to validate the coal waste mixture gasification performance. Phase III involves updating the original EECP design, based on results from Phase II, to prepare a preliminary engineering design package and financial plan for obtaining private funding to build a 5,000 BPD coal gasification/liquefaction plant next to an existing co-generation plant in Gilberton, Schuylkill County, Pennsylvania.
Development of a cysteine-deprived and C-terminally truncated GLP-1 receptor
DEFF Research Database (Denmark)
Underwood, Christina Rye; Knudsen, Lotte Bjerre; Garibay, Patrick W.
2013-01-01
The glucagon-like peptide-1 receptor (GLP-1R) belongs to family B of the G-protein coupled receptors (GPCRs), and has become a promising target for the treatment of type 2 diabetes. Here we describe the development and characterization of a fully functional cysteine-deprived and C......-terminally truncated GLP-1R. Single cysteines were initially substituted with alanine, and functionally redundant cysteines were subsequently changed simultaneously. Our results indicate that Cys174, Cys226, Cys296 and Cys403 are important for the GLP-1-mediated response, whereas Cys236, Cys329, Cys341, Cys347, Cys438...... that the membrane proximal part of the C-terminal is involved in receptor expression at the cell surface. The results show that seven cysteines and more than half of the C-terminal tail can be removed from GLP-1R without compromising GLP-1 binding or function....
Gnansounou, Edgard; Raman, Jegannathan Kenthorai
2018-04-24
Among the renewables, non-food and wastelands based biofuels are essential for the transport sector to achieve country's climate mitigation targets. With the growing interest in biorefineries, setting policy requirements for other coproducts along with biofuels is necessary to improve the products portfolio of biorefinery, increase the bioproducts perception by the consumers and push the technology forward. Towards this context, Claiming-Based allocation models were used in comparative life cycle assessment of multiple products from wheat straw biorefinery and vetiver biorefinery. Vetiver biorefinery shows promising Greenhouse gas emission savings (181-213%) compared to the common crop based lignocellulose (wheat straw) biorefinery. Assistance of Claiming-Based Allocation models favors to find out the affordable allocation limit (0-80%) among the coproducts in order to achieve the individual prospective policy targets. Such models show promising application in multiproduct life cycle assessment studies where appropriate allocation is challenging to achieve the individual products emission subject to policy targets. Copyright © 2018 Elsevier Ltd. All rights reserved.
Nutritive value of citrus co-products in rabbit feeding
Directory of Open Access Journals (Sweden)
J. Carlos de Blas
2018-03-01
Full Text Available Pulps from different citrus fruits are relevant agro-industrial co-products in the Mediterranean area in terms of amounts produced and availability. Moreover, part of the product is dehydrated, which increases its interest in monogastric species such as rabbits. Seventy eight samples from various Spanish producers using several types of fresh fruits (orange, tangerine, lemon and pomelo and different processing methods of orange and tangerine samples (either fresh or dried after adding Ca(OH2 were analysed for their chemical composition and in vitro digestibility. Average dry matter (DM contents of ash, neutral detergent fibre, acid detergent fibre, acid detergent lignin (ADL, soluble fibre, crude protein (CP, insoluble neutral and acid detergent CP, ether extract and gross energy were 49.0, 226, 139, 12.1, 213, 71.2, 13.1, 4.2, 30.5 g and 17.8 MJ/kg DM, respectively. Mean DM and CP in vitro digestibility were 86.7 and 95.6%, respectively. Digestible energy was estimated to be 15.1 MJ/kg DM. A high variability (coefficient of variation from 17% for CP to 60% for ADL was observed among the samples for most of the traits studied, which was partially explained by the effects of type of fruit and processing. Lemon pulps had on average higher ash and fibre but lower sugar contents than the other pulps. Dehydration processes increased ash content (almost double than for fresh pulp due to lime addition. As regards the current results, citrus pulp has potential for use in rabbit diets as a source of energy and soluble fibre.
Henshall, Catherine; Taylor, Beck; Goodwin, Laura; Farre, Albert; Jones, Miss Eleanor; Kenyon, Sara
2018-04-01
Women's planned place of birth is gaining increasing importance in the UK, however evidence suggests that there is variation in the content of community midwives' discussions with low risk women about their place of birth options. The objective of this study was to develop an intervention to improve the quality and content of place of birth discussions between midwives and low-risk women and to evaluate this intervention in practice. The study design comprised of three stages: (1) The first stage included focus groups with midwives to explore the barriers to carrying out place of birth discussions with women. (2) In the second stage, COM-B theory provided a structure for co-produced intervention development with midwives and women representatives; priority areas for change were agreed and the components of an intervention package to standardise the quality of these discussions were decided. (3) The third stage of the study adopted a mixed methods approach including questionnaires, focus groups and interviews with midwives to evaluate the implementation of the co-produced package in practice. A maternity NHS Trust in the West Midlands, UK. A total of 38 midwives took part in the first stage of the study. Intervention design (stage 2) included 58 midwives, and the evaluation (stage 3) involved 66 midwives. Four women were involved in the intervention design stage of the study in a Patient and Public Involvement role (not formally consented as participants). In the first study stage participants agreed that pragmatic, standardised information on the safety, intervention and transfer rates for each birth setting (obstetric unit, midwifery-led unit, home) was required. In the second stage of the study, co-production between researchers, women and midwives resulted in an intervention package designed to support the implementation of these changes and included an update session for midwives, a script, a leaflet, and ongoing support through a named lead midwife and regular
Coproduction as an Approach to Technology-Mediated Citizen Participation in Emergency Management
Directory of Open Access Journals (Sweden)
Paloma Díaz
2016-08-01
Full Text Available Social and mobile computing open up new possibilities for integrating citizens’ information, knowledge, and social capital in emergency management (EM. This participation can improve the capacity of local agencies to respond to unexpected events by involving citizens not only as first line informants, but also as first responders. This participation could contribute to build resilient communities aware of the risks they are threatened by and able to mobilize their social capital to cope with them and, in turn, decrease the impact of threats and hazards. However for this participation to be possible organizations in charge of EM need to realize that involving citizens does not interfere with their protocols and that citizens are a valuable asset that can contribute to the EM process with specific skills and capabilities. In this paper we discuss the design challenges of using social and mobile computing to move to a more participatory EM process that starts by empowering both citizens and organizations in a coproduction service envisioned as a partnership effort. As an example, we describe a case study of a participatory design approach that involved professional EM workers and decision makers in an effort to understand the challenges of using technology-based solutions to integrate citizen skills and capabilities in their operation protocols. The case study made it possible to identify specific roles that citizens might play in a crisis or disaster and to envision scenarios were technologies could be used to integrate their skills into the EM process. In this way the paper contributes to the roles and the scenarios of theory-building about coproduction in EM services.
The plant for co-production of synfuel and electricity with reduced CO{sub 2} emissions
Energy Technology Data Exchange (ETDEWEB)
Kler, A.M.; Tyurina, E.A.; Mednikov, A.S. [Russian Academy of Sciences, Irkutsk (Russian Federation). Energy Systems Inst.
2013-07-01
Consideration is given to the prospective technologies for combined production of synthetic fuel (SF) and electricity. The mathematical models of plant for co-production of synfuel and electricity (PCSE) intended for combined production of electricity and synthesis of methanol and dimethyl ether or membrane-based hydrogen production from coal were developed. They were used in the optimization studies on the installations. As a result of the studies, the design characteristics for the plant elements, the relationships between the SF and electricity productions, etc. were determined. These data were used to identify the ranges of SF price for various prices of fuel, electricity and equipment, and estimate the profitability of SF production. Special attention is paid to modeling of CO{sub 2} removal system as part of PCSE and studies on PCSE optimization. The account is taken of additional capital investments and power consumption in the systems.
DEFF Research Database (Denmark)
Bager, Ann
2013-01-01
The article elaborates on a theoretical understanding of dialogue as a means for the co-production of knowledge in and on leadership communicative practices through ongoing research collaboration that involves leaders, researchers and master students at Aalborg University. Dialogue is viewed from...
Käyhkö, Jukka; Horstkotte, Tim; Vehmas, Jarmo; Forbes, Bruce
2017-04-01
The area allocated for reindeer husbandry in Finland, Sweden and Norway covers approximately 40 % of each country. As the livelihood requires large, relatively unfragmented territories while being marginal in terms of direct income, land-use conflicts between various livelihoods and activities, such as forestry, agriculture, mining, energy production, tourism, and nature protection are common phenomena in the region. Simultaneously, rapid societal change, urban exodus and fading traditions as well as climate warming and subsequent ecosystem change may put the livelihood at stake. We have probed potential futures of reindeer husbandry in Northern Fennoscandia using the Social-Ecological System (SES) approach, knowledge co-production in stakeholder-scientist workshops in all three countries, and scenario building based on quantitative data and narratives. Regarding the future of the livelihood, we have identified some crucial components in the SES that are influential in determining the direction of development. We produced four potential pathways of future development and demonstrate that important factors controlling the direction of development include governance and actor relations. Governance is often considered distant and opaque by local stakeholders, fostering conflicts in land allocation, while unclear regulations at local level reinforce emerging conflict situations leading to distrust and restrained communication between the actors. Regionally, these conflicts may lead to decreased resilience and threaten the future of the livelihood altogether. Therefore, research should focus on supporting the reform process of institutional arrangements and governance mechanisms, and fostering co-design and co-production processes that ease distrust and improve resilience of the livelihood in multifunctional landscapes.
Directory of Open Access Journals (Sweden)
Diego Cabral Barreiros
2010-06-01
Full Text Available The objective in this work was to evaluate the fermentation kinetic; chemical composition and “in vitro” dry matter digestibility (IVDMD of co-product silage from the extraction of peyibaye palmetto. The experimental treatments utilized were co-product extraction of peyibaye palmetto: in nature, with 10% of cassava meal, with 10% of corn meal, with 10% of palm kernel cake, with 1% of urea and wilted. The silos were opened after 1; 3; 5; 7, 14, 28 and 56 days. The experimental design utilized was a completely randomized design with factorial 6 x 7 (treatments and days after silage, with two repetitions. The pH ranged from 3.78 to 3.93. The silage with cassava or corn meal had less concentration of neutral detergent fiber, acid detergent fiber, cellulose and lignin. The content of crude protein of the silage with urea was greater than the other treatments. The additions of cassava or corn meal result in increase of IVDMD percentage. The silages showed appropriate values of ammonia nitrogen. The co-product silage of peyibaye palmetto extraction has conservation potential in silage form, and the addition of 10% of cassava meal improved its quality.Objetivou-se com este trabalho avaliar a dinâmica de fermentação, a composição química e a digestibilidade in vitro da matéria seca (DIVMS das silagens do coproduto da pupunha. Os tratamentos constituíram-se no coproduto da pupunha: in natura, emurchecido, com 10% de farelo de mandioca, com 10% de fubá de milho, com 10% de torta de dendê e com 1% de uréia. Os silos experimentais foram abertos com 1; 3; 5; 7; 14; 28 e 56 dias. O delineamento experimental foi o inteiramente casualizado em esquema fatorial 6 x 7 (tratamentos e períodos de fermentação com duas repetições. O pH variou de 3,78 a 3,93. As silagens com farelo de mandioca ou fubá de milho apresentaram menores concentrações de fibra detergente neutro, fibra detergente ácido, celulose e lignina. Houve redução nos teores de
C1 Chemistry for the Production of Ultra-Clean Liquid Transportation Fuels and Hydrogen
Energy Technology Data Exchange (ETDEWEB)
Gerald P. Huffman
2006-03-30
Professors and graduate students from five universities--the University of Kentucky, University of Pittsburgh, University of Utah, West Virginia University, and Auburn University--are collaborating in a research program to develop C1 chemistry processes to produce ultra-clean liquid transportation fuels and hydrogen, the zero-emissions transportation fuel of the future. The feedstocks contain one carbon atom per molecular unit. They include synthesis gas (syngas), a mixture of carbon monoxide and hydrogen produced by coal gasification or reforming of natural gas, methane, methanol, carbon dioxide, and carbon monoxide. An important objective is to develop C1 technology for the production of liquid transportation fuel and hydrogen from domestically plentiful resources such as coal, coalbed methane, and hydrocarbon gases and liquids produced from coal. An Advisory Board with representatives from Chevron-Texaco, Eastman Chemical, Conoco-Phillips, the Air Force Research Laboratory, the U.S. Army National Automotive Center, and Tier Associates provides guidance on the practicality of the research. The current report summarizes the results obtained in this program during the period October 1, 2002 through March 31, 2006. The results are presented in detailed reports on 16 research projects headed by professors at each of the five CFFS Universities and an Executive Summary. Some of the highlights from these results are: (1) Small ({approx}1%) additions of acetylene or other alkynes to the Fischer-Tropsch (F-T) reaction increases its yield, causes chain initiation, and promotes oxygenate formation. (2) The addition of Mo to Fe-Cu-K/AC F-T catalysts improves catalyst lifetime and activity. (3) The use of gas phase deposition to place highly dispersed metal catalysts on silica or ceria aerogels offers promise for both the F-T and the water-gas shift WGS reactions. (4) Improved activity and selectivity are exhibited by Co F-T catalysts in supercritical hexane. (5) Binary Fe
CHARACTERIZATION OF CO-PRODUCTS OF THE PILOT DIGESTERS TO ANIMAL BIOMASS IN TUNISIA
Directory of Open Access Journals (Sweden)
Y. M’Sadak
2015-05-01
Full Text Available This work consists in evaluating the Co-products of the biomethanisation applied to the animal biomass on the level of various types of digesters (experimental I, II, III and IV, rural and industrial.This work made it possible to arise certain number of observations: The energy performances are more interesting in the case of the digesters powered with the avicolous droppings; the reduction of the polluting load as of SM is more important in the case of the industrial digester, whereas for the BDO5, it is in favor of the experimental digester II; The agronomic use of the secondary by-products proves very encouraging and powerful.
Sun, Caiyu; Hao, Ping; Qin, Bida; Wang, Bing; Di, Xueying; Li, Yongfeng
2016-01-01
An upflow anaerobic sludge bed (UASB) system with sludge immobilized on granular activated carbon was developed for fermentative hydrogen production continuously from herbal medicine wastewater at various organic loading rates (8-40 g chemical oxygen demand (COD) L(-1) d(-1)). The maximum hydrogen production rate reached 10.0 (±0.17) mmol L(-1) hr(-1) at organic loading rate of 24 g COD L(-1) d(-1), which was 19.9% higher than that of suspended sludge system. The effluents of hydrogen fermentation were used for continuous methane production in the subsequent UASB system. At hydraulic retention time of 15 h, the maximum methane production rate of 5.49 (±0.03) mmol L(-1) hr(-1) was obtained. The total energy recovery rate by co-production of hydrogen and methane was evaluated to be 7.26 kJ L(-1) hr(-1).
Baer, Zachary C; Bormann, Sebastian; Sreekumar, Sanil; Grippo, Adam; Toste, F Dean; Blanch, Harvey W; Clark, Douglas S
2016-10-01
The fermentation of simple sugars to ethanol has been the most successful biofuel process to displace fossil fuel consumption worldwide thus far. However, the physical properties of ethanol and automotive components limit its application in most cases to 10-15 vol% blends with conventional gasoline. Fermentative co-production of ethanol and acetone coupled with a catalytic alkylation reaction could enable the production of gasoline blendstocks enriched in higher-chain oxygenates. Here we demonstrate a synthetic pathway for the production of acetone through the mevalonate precursor hydroxymethylglutaryl-CoA. Expression of this pathway in various strains of Escherichia coli resulted in the co-production of acetone and ethanol. Metabolic engineering and control of the environmental conditions for microbial growth resulted in controllable acetone and ethanol production with ethanol:acetone molar ratios ranging from 0.7:1 to 10.0:1. Specifically, use of gluconic acid as a substrate increased production of acetone and balanced the redox state of the system, predictively reducing the molar ethanol:acetone ratio. Increases in ethanol production and the molar ethanol:acetone ratio were achieved by co-expression of the aldehyde/alcohol dehydrogenase (AdhE) from E. coli MG1655 and by co-expression of pyruvate decarboxylase (Pdc) and alcohol dehydrogenase (AdhB) from Z. mobilis. Controlling the fermentation aeration rate and pH in a bioreactor raised the acetone titer to 5.1 g L(-1) , similar to that obtained with wild-type Clostridium acetobutylicum. Optimizing the metabolic pathway, the selection of host strain, and the physiological conditions employed for host growth together improved acetone titers over 35-fold (0.14-5.1 g/L). Finally, chemical catalysis was used to upgrade the co-produced ethanol and acetone at both low and high molar ratios to higher-chain oxygenates for gasoline and jet fuel applications. Biotechnol. Bioeng. 2016;113: 2079-2087. © 2016 Wiley
A New Process for Co-production of Ammonia and Methanol
International Nuclear Information System (INIS)
Soliman, A.
2004-01-01
A new process for co-production of ammonia and methanol is proposed. The process involves the production of synthesis gas by oxygen blown auto thermal reformer (ATR) at a pressure of 40-100 bars, a methanol synthesis loop at a pressure of 50-100 bars and an ammonia synthesis loop at a pressure of 200-300 bars. The oxygen required for the ATR is supplied by an air separation plant. The synthesis gases from the ATR are cooled and compressed, in a first stage compression, to the required methanol loop pressure. The purge stream from the methanol loop is sent to an intermediate temperature shift converter ITSC followed by a physical solvent CO 2 removal unit and them purified in a pressure Swing Adsorber (PSA). The purified hydrogen from the PSA together with the almost pure nitrogen from the air separation plant are re compressed, in a second stage compression
Chen, Gong; Wang, Jun; Xu, Xiaoqun; Wu, Xiangfu; Piao, Ruihan; Siu, Chi-Hung
2013-06-01
Cell-cell adhesion plays crucial roles in cell differentiation and morphogenesis during development of Dictyostelium discoideum. The heterophilic adhesion protein TgrC1 (Tgr is transmembrane, IPT, IG, E-set, repeat protein) is expressed during cell aggregation, and disruption of the tgrC1 gene results in the arrest of development at the loose aggregate stage. We have used far-Western blotting coupled with MS to identify TgrB1 as the heterophilic binding partner of TgrC1. Co-immunoprecipitation and pull-down studies showed that TgrB1 and TgrC1 are capable of binding with each other in solution. TgrB1 and TgrC1 are encoded by a pair of adjacent genes which share a common promoter. Both TgrB1 and TgrC1 are type I transmembrane proteins, which contain three extracellular IPT/TIG (immunoglobulin, plexin, transcription factor-like/transcription factor immunoglobulin) domains. Antibodies raised against TgrB1 inhibit cell reassociation at the post-aggregation stage of development and block fruiting body formation. Ectopic expression of TgrB1 and TgrC1 driven by the actin15 promoter leads to heterotypic cell aggregation of vegetative cells. Using recombinant proteins that cover different portions of TgrB1 and TgrC1 in binding assays, we have mapped the cell-binding regions in these two proteins to Lys(537)-Ala(783) in TgrB1 and Ile(336)-Val(360) in TgrC1, corresponding to their respective TIG3 and TIG2 domain.
Additives effect on chemical composition and quality of sisal co-product silage
Directory of Open Access Journals (Sweden)
Luiz Gustavo Neves Brandão
2013-12-01
Full Text Available Fermentation profile and nutritional value of sisal co-product silage (SC subjected to seven treatments (additives, were evaluated. The SC was ensiled in natura and added with: soy meal, urea, wheat meal, palm kernel cake, A. sisalana dust, licuri cake and cottonseed cake. Experimental silos with capacity for approximately 15 kg of silage, were used. The silos were opened 60 days after ensilage process. It was used a completely randomized design with three replications. The SC in natura present low values of dry mater (DM 12.3% and the additives increased dry matter silages, exception for urea. The SC silage additivated with soybean meal (pH 4.9 and palm kernel cake (butyric acid = 0.07% DM differed, respectively, for pH and butyric acid, compared with in natura SC silage (pH = 4.1 and butyric acid = 0.03% DM. The addition of soybean meal, urea, cottonseed meal, wheat bran and palm kernel, increased crude protein (CP of in natura SC silage. The NDF in silage increased with addition of cottonseed meal or palm kernel cake (60.1 and 66.2% DM in relation in natura SC silage (42.9% DM. The in natura and additivated silages of SC were considered as good or excellent quality.
Matsunaga, Toshiyuki; Hojo, Aki; Yamane, Yumi; Endo, Satoshi; El-Kabbani, Ossama; Hara, Akira
2013-02-25
Cisplatin (cis-diamminedichloroplatinum, CDDP) is widely used for treatment of patients with solid tumors formed in various organs including the lung, prostate and cervix, but is much less sensitive in colon and breast cancers. One major factor implicated in the ineffectiveness has been suggested to be acquisition of the CDDP resistance. Here, we established the CDDP-resistant phenotypes of human colon HCT15 cells by continuously exposing them to incremental concentrations of the drug, and monitored expressions of aldo-keto reductases (AKRs) 1A1, 1B1, 1B10, 1C1, 1C2 and 1C3. Among the six AKRs, AKR1C1 and AKR1C3 are highly induced with the CDDP resistance. The resistance lowered the sensitivity toward cellular damages evoked by oxidative stress-derived aldehydes, 4-hydroxy-2-nonenal and 4-oxo-2-nonenal that are detoxified by AKR1C1 and AKR1C3. Overexpression of AKR1C1 or AKR1C3 in the parental HCT15 cells mitigated the cytotoxicity of the aldehydes and CDDP. Knockdown of both AKR1C1 and AKR1C3 in the resistant cells or treatment of the cells with specific inhibitors of the AKRs increased the sensitivity to CDDP toxicity. Thus, the two AKRs participate in the mechanism underlying the CDDP resistance probably via detoxification of the aldehydes resulting from enhanced oxidative stress. The resistant cells also showed an enhancement in proteolytic activity of proteasome accompanied by overexpression of its catalytic subunits (PSMβ9 and PSMβ10). Pretreatment of the resistant cells with a potent proteasome inhibitor Z-Leu-Leu-Leu-al augmented the CDDP sensitization elicited by the AKR inhibitors. Additionally, the treatment of the cells with Z-Leu-Leu-Leu-al and the AKR inhibitors induced the expressions of the two AKRs and proteasome subunits. Collectively, these results suggest the involvement of up-regulated AKR1C1, AKR1C3 and proteasome in CDDP resistance of colon cancers and support a chemotherapeutic role for their inhibitors. Copyright © 2012 Elsevier Ireland
Hydrogen co-production from subcritical water-cooled nuclear power plants in Canada
Energy Technology Data Exchange (ETDEWEB)
Gnanapragasam, N.; Ryland, D.; Suppiah, S., E-mail: gnanapragasamn@aecl.ca [Atomic Energy of Canada Limited, Chalk River, Ontario (Canada)
2013-06-15
Subcritical water-cooled nuclear reactors (Sub-WCR) operate in several countries including Canada providing electricity to the civilian population. The high-temperature-steam-electrolysis process (HTSEP) is a feasible and laboratory-demonstrated large-scale hydrogen-production process. The thermal and electrical integration of the HTSEP with Sub-WCR-based nuclear-power plants (NPPs) is compared for best integration point, HTSEP operating condition and hydrogen production rate based on thermal energy efficiency. Analysis on integrated thermal efficiency suggests that the Sub-WCR NPP is ideal for hydrogen co-production with a combined efficiency of 36%. HTSEP operation analysis suggests that higher product hydrogen pressure reduces hydrogen and integrated efficiencies. The best integration point for the HTSEP with Sub-WCR NPP is upstream of the high-pressure turbine. (author)
Minimum variance and variance of outgoing quality limit MDS-1(c1, c2) plans
Raju, C.; Vidya, R.
2016-06-01
In this article, the outgoing quality (OQ) and total inspection (TI) of multiple deferred state sampling plans MDS-1(c1,c2) are studied. It is assumed that the inspection is rejection rectification. Procedures for designing MDS-1(c1,c2) sampling plans with minimum variance of OQ and TI are developed. A procedure for obtaining a plan for a designated upper limit for the variance of the OQ (VOQL) is outlined.
Peering into the secrets of food and agricultural co-products
Wood, Delilah; Williams, Tina; Glenn, Gregory; Pan, Zhongli; Orts, William; McHugh, Tara
2010-06-01
Scanning electron microscopy is a useful tool for understanding food contamination and directing product development of food and industrial products. The current trend in food research is to produce foods that are fast to prepare and/or ready to eat. At the same time, these processed foods must be safe, high quality and maintain all or most of the nutritional value of the original whole foods. Minimally processed foods, is the phrase used to characterize these "new" foods. New techniques are needed which take advantage of minimal processing or processing which enhances the fresh properties and characteristics of whole foods while spending less time on food preparation. The added benefit coupled to less cooking time in an individual kitchen translates to an overall energy savings and reduces the carbon emissions to the environment. Food processing changes the microstructure, and therefore, the quality, texture and flavor, of the resulting food product. Additionally, there is the need to reduce waste, transportation costs and product loss during transportation and storage. Unlike food processing, structural changes are desirable in co-products as function follows form for food packaging films and boxes as well as for building materials and other industrial products. Thus, the standard materials testing procedures are coupled with SEM to provide direction in the development of products from agricultural residues or what would otherwise be considered waste materials. The use of agricultural residues reduces waste and adds value to a currently underutilized or unutilized product. The product might be biodegradable or compostable, thus reducing landfill requirements. Manufacturing industrial and packaging products from biological materials also reduces the amount of petroleum products currently standard in the industry.
How to Manage Inputs from Co-production Processes in Emergy Accounting
DEFF Research Database (Denmark)
Kamp, Andreas; Østergård, Hanne
2012-01-01
In life cycle assessments it is a challenge to allocate resource use and environmental impact in processes with multiple outputs. This is especially the case when systems include agricultural products that in their production cannot be separated from each other. For emergy accounting, Bastianoni...... with systems that do not depend on joint production processes is still lacking. As a consequence, a product relying on inputs from joint production processes appears to compete poorly with a similar product that does not have to account for co-products appearing upstream. This is counter to perceived benefits...... and Marchettini (2000) suggested how to calculate transformities and other indices for joint production systems. Their proposals however, do not include how to manage inputs from joint production systems. Thus a practical method for making systems with inputs from joint production processes comparable...
Chen, Sun-Yang; Lee, Yuan-Pern
2010-03-01
A step-scan Fourier-transform infrared spectrometer coupled with a multipass absorption cell was utilized to monitor the transient species produced in gaseous reactions of CH3CO and O2; IR absorption spectra of CH3C(O)OO and α-lactone were observed. Absorption bands with origins at 1851±1, 1372±2, 1169±6, and 1102±3 cm-1 are attributed to t-CH3C(O)OO, and those at 1862±3, 1142±4, and 1078±6 cm-1 are assigned to c-CH3C(O)OO. A weak band near 1960 cm-1 is assigned to α-lactone, cyc-CH2C(O)O, a coproduct of OH. These observed rotational contours agree satisfactorily with simulated bands based on predicted rotational parameters and dipole derivatives, and observed vibrational wavenumbers agree with harmonic vibrational wavenumbers predicted with B3LYP/aug-cc-pVDZ density-functional theory. The observed relative intensities indicate that t-CH3C(O)OO is more stable than c-CH3C(O)OO by 3±2 kJ mol-1. Based on these observations, the branching ratio for the OH+α-lactone channel of the CH3CO+O2 reaction is estimated to be 0.04±0.01 under 100 Torr of O2 at 298 K. A simple kinetic model is employed to account for the decay of CH3C(O)OO.
Chen, Sun-Yang; Lee, Yuan-Pern
2010-03-21
A step-scan Fourier-transform infrared spectrometer coupled with a multipass absorption cell was utilized to monitor the transient species produced in gaseous reactions of CH(3)CO and O(2); IR absorption spectra of CH(3)C(O)OO and alpha-lactone were observed. Absorption bands with origins at 1851+/-1, 1372+/-2, 1169+/-6, and 1102+/-3 cm(-1) are attributed to t-CH(3)C(O)OO, and those at 1862+/-3, 1142+/-4, and 1078+/-6 cm(-1) are assigned to c-CH(3)C(O)OO. A weak band near 1960 cm(-1) is assigned to alpha-lactone, cyc-CH(2)C(=O)O, a coproduct of OH. These observed rotational contours agree satisfactorily with simulated bands based on predicted rotational parameters and dipole derivatives, and observed vibrational wavenumbers agree with harmonic vibrational wavenumbers predicted with B3LYP/aug-cc-pVDZ density-functional theory. The observed relative intensities indicate that t-CH(3)C(O)OO is more stable than c-CH(3)C(O)OO by 3+/-2 kJ mol(-1). Based on these observations, the branching ratio for the OH+alpha-lactone channel of the CH(3)CO+O(2) reaction is estimated to be 0.04+/-0.01 under 100 Torr of O(2) at 298 K. A simple kinetic model is employed to account for the decay of CH(3)C(O)OO.
Directory of Open Access Journals (Sweden)
Anna V Wiese
Full Text Available C5a regulates the development of maladaptive immune responses in allergic asthma mainly through the activation of C5a receptor 1 (C5aR1. Yet, the cell types and the mechanisms underlying this regulation are ill-defined. Recently, we described increased C5aR1 expression in lung tissue eosinophils but decreased expression in airway and pulmonary macrophages as well as in pulmonary CD11b+ conventional dendritic cells (cDCs and monocyte-derived DCs (moDCs during the allergic effector phase using a floxed green fluorescent protein (GFP-C5aR1 knock-in mouse. Here, we determined the role of C5aR1 signaling in neutrophils, moDCs and macrophages for the pulmonary recruitment of such cells and the importance of C5aR1-mediated activation of LysM-expressing cells for the development of allergic asthma. We used LysM-C5aR1 KO mice with a specific deletion of C5aR1 in LysMCre-expressing cells and confirmed the specific deletion of C5aR1 in neutrophils, macrophages and moDCs in the airways and/or the lung tissue. We found that alveolar macrophage numbers were significantly increased in LysM-C5aR1 KO mice. Induction of ovalbumin (OVA-driven experimental allergic asthma in GFP-C5aR1fl/fl and LysM-C5aR1 KO mice resulted in strong but similar airway resistance, mucus production and Th2/Th17 cytokine production. In contrast, the number of airway but not of pulmonary neutrophils was lower in LysM-C5aR1 KO as compared with GFP-C5aR1fl/fl mice. The recruitment of macrophages, cDCs, moDCs, T cells and type 2 innate lymphoid cells was not altered in LysM-C5aR1 KO mice. Our findings demonstrate that C5aR1 is critical for steady state control of alveolar macrophage numbers and the transition of neutrophils from the lung into the airways in OVA-driven allergic asthma. However, C5aR1 activation of LysM-expressing cells plays a surprisingly minor role in the recruitment and activation of such cells and the development of the allergic phenotype in OVA-driven experimental
Energy Technology Data Exchange (ETDEWEB)
Parimi, Naga Sirisha; Singh, Manjinder; Kastner, James R.; Das, Keshav C., E-mail: kdas@engr.uga.edu [College of Engineering, The University of Georgia, Athens, GA (United States); Forsberg, Lennart S.; Azadi, Parastoo [Complex Carbohydrate Research Center, The University of Georgia, Athens, GA (United States)
2015-06-23
The current work reports protein extraction from Spirulina platensis cyanobacterial biomass in order to simultaneously generate a potential co-product and a biofuel feedstock with reduced nitrogen content. S. platensis cells were subjected to cell disruption by high-pressure homogenization and subsequent protein isolation by solubilization at alkaline pH followed by precipitation at acidic pH. Response surface methodology was used to optimize the process parameters – pH, extraction (solubilization/precipitation) time and biomass concentration for obtaining maximum protein yield. The optimized process conditions were found to be pH 11.38, solubilization time of 35 min and biomass concentration of 3.6% (w/w) solids for the solubilization step, and pH 4.01 and precipitation time of 60 min for the precipitation step. At the optimized conditions, a high protein yield of 60.7% (w/w) was obtained. The protein isolate (co-product) had a higher protein content [80.6% (w/w)], lower ash [1.9% (w/w)] and mineral content and was enriched in essential amino acids, the nutritious γ-linolenic acid and other high-value unsaturated fatty acids compared to the original biomass. The residual biomass obtained after protein extraction had lower nitrogen content and higher total non-protein content than the original biomass. The loss of about 50% of the total lipids from this fraction did not impact its composition significantly owing to the low lipid content of S. platensis (8.03%).
International Nuclear Information System (INIS)
Parimi, Naga Sirisha; Singh, Manjinder; Kastner, James R.; Das, Keshav C.; Forsberg, Lennart S.; Azadi, Parastoo
2015-01-01
The current work reports protein extraction from Spirulina platensis cyanobacterial biomass in order to simultaneously generate a potential co-product and a biofuel feedstock with reduced nitrogen content. S. platensis cells were subjected to cell disruption by high-pressure homogenization and subsequent protein isolation by solubilization at alkaline pH followed by precipitation at acidic pH. Response surface methodology was used to optimize the process parameters – pH, extraction (solubilization/precipitation) time and biomass concentration for obtaining maximum protein yield. The optimized process conditions were found to be pH 11.38, solubilization time of 35 min and biomass concentration of 3.6% (w/w) solids for the solubilization step, and pH 4.01 and precipitation time of 60 min for the precipitation step. At the optimized conditions, a high protein yield of 60.7% (w/w) was obtained. The protein isolate (co-product) had a higher protein content [80.6% (w/w)], lower ash [1.9% (w/w)] and mineral content and was enriched in essential amino acids, the nutritious γ-linolenic acid and other high-value unsaturated fatty acids compared to the original biomass. The residual biomass obtained after protein extraction had lower nitrogen content and higher total non-protein content than the original biomass. The loss of about 50% of the total lipids from this fraction did not impact its composition significantly owing to the low lipid content of S. platensis (8.03%).
Cole, Charlotte F; Lee, June H; Bucuvalas, Abigail; Sırali, Yasemin
2018-03-01
Children's media have the capacity to prepare young learners to develop the knowledge, attitudes, and skills they need to contribute to a more peaceful world. Research suggests international coproductions of Sesame Street and other children's media efforts are linked to positive impact on how viewers perceive themselves and their own cultures, as well as how they perceive others. Creating such media, however, relies on a commitment to a complex development process where the educational needs of children are considered alongside intra- and intergroup dynamics and political realities. This paper presents a practitioners' perspective on the essential components of children's media programs for peacebuilding and, in so doing, recommends a way forward for producing children's media in this domain. © 2018 Wiley Periodicals, Inc.
Śliwińska, Anna; Burchart-Korol, Dorota; Smoliński, Adam
2017-01-01
This paper presents a life cycle assessment (LCA) of greenhouse gas emissions generated through methanol and electricity co-production system based on coal gasification technology. The analysis focuses on polygeneration technologies from which two products are produced, and thus, issues related to an allocation procedure for LCA are addressed in this paper. In the LCA, two methods were used: a 'system expansion' method based on two approaches, the 'avoided burdens approach' and 'direct system enlargement' methods and an 'allocation' method involving proportional partitioning based on physical relationships in a technological process. Cause-effect relationships in the analysed production process were identified, allowing for the identification of allocation factors. The 'system expansion' method involved expanding the analysis to include five additional variants of electricity production technologies in Poland (alternative technologies). This method revealed environmental consequences of implementation for the analysed technologies. It was found that the LCA of polygeneration technologies based on the 'system expansion' method generated a more complete source of information on environmental consequences than the 'allocation' method. The analysis shows that alternative technologies chosen for generating LCA results are crucial. Life cycle assessment was performed for the analysed, reference and variant alternative technologies. Comparative analysis was performed between the analysed technologies of methanol and electricity co-production from coal gasification as well as a reference technology of methanol production from the natural gas reforming process. Copyright © 2016 Elsevier B.V. All rights reserved.
J. Morgan Grove; Rinku Roy Chowdhury; Daniel Childers
2015-01-01
To promote sustainability and resilience, the role of co-design, co-production, and dissemination of social-ecological knowledge is of growing interest and importance. Although the antecedents for this approach are decades old, the integration of science and practice to advance sustainability and resilience is different from earlier approaches in several ways. In this...
Cheng, Xi-Yu; Liu, Chun-Zhao
2012-01-01
A three-stage anaerobic fermentation process including H(2) fermentation I, H(2) fermentation II, methane fermentation was developed for the coproduction of hydrogen and methane from cornstalks. Hydrogen production from cornstalks using direct microbial conversion by Clostridium thermocellum 7072 was markedly enhanced in the two-stage thermophilic hydrogen fermentation process integrated with alkaline treatment. The highest total hydrogen yield from cornstalks in the two-stage fermentation process reached 74.4 mL/g-cornstalk. The hydrogen fermentation effluents and alkaline hydrolyzate were further used for methane fermentation by anaerobic granular sludge, and the total methane yield reached 205.8 mL/g-cornstalk. The total energy recovery in the three-stage anaerobic fermentation process integrated with alkaline hydrolysis reached 70.0%. Copyright © 2011 Elsevier Ltd. All rights reserved.
Dicty_cDB: Contig-U15146-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available us BAC clone RP24-129G21 from chromosom... 38 1.7 4 ( FG066604 ) dlbw0_003512 cDNA library... of cambium of Betula pl... 40 2.6 2 ( FG065202 ) dlbw0_000186 cDNA library of cambium of Betul...0 2 ( FG065344 ) dlbw0_000454 cDNA library of cambium of Betula pl... 40 3.1 2 ( FG067998 ) dlbw0_005638 cDNA library...vus cDNA 3', mRNA ... 34 3.7 2 ( BU836156 ) T083C10 Populus apical shoot cDNA library Popul... 1 ( BU572652 ) PA__Ea0001H21f Almond developing seed Prunus dulc... 48 0.25 1 ( BQ641167 ) EST290 almond cDNA library Prunus dul
An Evaluation of the Argentinean Basic Trainer Aircraft Domestic Development Project
2012-03-01
Martin, 1996). In the case the offset agreements like countertrade , technology transfer, licensed production and / or coproduction they can benefit...Defence Procurement and Countertrade . University of York, UK, Harwood. Matthews, R., Maharani, C. (2008). Beyond the RMA: Survival Strategies for
International Nuclear Information System (INIS)
Nguyen, Thu Lan T.; Hermansen, John E.
2012-01-01
Highlights: → A challenging issue in LCA is how to account for co-products' environmental burdens. → The two most commonly used procedures are system expansion and allocation. → System expansion appears to be more appropriate than allocation. → Indirect land use change is a consequence of diverting molasses from feed to fuel. → The inclusion of land use change worsens the GHG balance of molasses ethanol. -- Abstract: This study aims to establish a procedure for handling co-products in life cycle assessment (LCA) of a typical sugar cane system. The procedure is essential for environmental assessment of ethanol from molasses, a co-product of sugar which has long been used mainly for feed. We compare system expansion and two allocation procedures for estimating greenhouse gas (GHG) emissions of molasses ethanol. As seen from our results, system expansion yields the highest estimate among the three. However, no matter which procedure is used, a significant reduction of emissions from the fuel stage in the abatement scenario, which assumes implementation of substituting bioenergy for fossil-based energy to reduce GHG emissions, combined with a negligible level of emissions from the use stage, keeps the estimate of ethanol life cycle GHG emissions below that of gasoline. Pointing out that indirect land use change (ILUC) is a consequence of diverting molasses from feed to fuel, system expansion is the most adequate method when the purpose of the LCA is to support decision makers in weighing the options and consequences. As shown in the sensitivity analysis, an addition of carbon emissions from ILUC worsens the GHG balance of ethanol, with deforestation being a worst-case scenario where the fuel is no longer a net carbon saver but carbon emitter.
Yu, Peiqiang; Damiran, Daalkhaijav; Azarfar, Arash; Niu, Zhiyuan
2011-01-01
The objective of this study was to use DRIFT spectroscopy with uni- and multivariate molecular spectral analyses as a novel approach to detect molecular features of spectra mainly associated with carbohydrate in the co-products (wheat DDGS, corn DDGS, blend DDGS) from bioethanol processing in comparison with original feedstock (wheat (Triticum), corn (Zea mays)). The carbohydrates related molecular spectral bands included: A_Cell (structural carbohydrates, peaks area region and baseline: ca. 1485–1188 cm−1), A_1240 (structural carbohydrates, peak area centered at ca. 1240 cm−1 with region and baseline: ca. 1292–1198 cm−1), A_CHO (total carbohydrates, peaks region and baseline: ca. 1187–950 cm−1), A_928 (non-structural carbohydrates, peak area centered at ca. 928 cm−1 with region and baseline: ca. 952–910 cm−1), A_860 (non-structural carbohydrates, peak area centered at ca. 860 cm−1 with region and baseline: ca. 880–827 cm−1), H_1415 (structural carbohydrate, peak height centered at ca. 1415 cm−1 with baseline: ca. 1485–1188 cm−1), H_1370 (structural carbohydrate, peak height at ca. 1370 cm−1 with a baseline: ca. 1485–1188 cm−1). The study shows that the grains had lower spectral intensity (KM Unit) of the cellulosic compounds of A_1240 (8.5 vs. 36.6, P carbohydrate of A_928 (17.3 vs. 2.0) and A_860 (20.7 vs. 7.6) than their co-products from bioethanol processing. There were no differences (P > 0.05) in the peak area intensities of A_Cell (structural CHO) at 1292–1198 cm−1 and A_CHO (total CHO) at 1187–950 cm−1 with average molecular infrared intensity KM unit of 226.8 and 508.1, respectively. There were no differences (P > 0.05) in the peak height intensities of H_1415 and H_1370 (structural CHOs) with average intensities 1.35 and 1.15, respectively. The multivariate molecular spectral analyses were able to discriminate and classify between the corn and corn DDGS molecular spectra, but not wheat and wheat DDGS. This
Coproduction of transportation fuels in advanced IGCCs via coal and biomass mixtures
International Nuclear Information System (INIS)
Chen, Qin; Rao, Ashok; Samuelsen, Scott
2015-01-01
Highlights: • Coproduction of electricity and transportation fuels with carbon capture. • Switchgrass biomass is cofed with bituminous coal or lignite. • Cost of Fischer–Tropsch liquids is comparable to longer term price projections of crude oil. • Ethanol costs more than gasoline but greenhouse gas emissions will be lower. • Cost of hydrogen is lower than the DoE announced goal of $3/kg. - Abstract: Converting abundant fossil resources of coal to alternative transportation fuels is a promising option for countries heavily dependent on petroleum imports if plants are equipped with carbon capture for sequestration and cofed with biomass (30% by weight of the total feed on a dry basis), an essentially carbon neutral fuel, without penalizing the process economics excessively. A potential exists to improve both thermal efficiency and economics of such plants by taking advantage of the synergies of coproducing electricity using advanced technologies under development. Three types of transportation fuels are considered. Fischer–Tropsch (F–T) liquids consisting predominantly of waxes could be processed in existing refineries while displacing petroleum and the refined products introduced into the market place at the present time or in the near term without requiring changes to the existing infrastructure. Ethanol could potentially serve in the not so distant future (or phased in by blending with conventional liquid fuels). Hydrogen which could play a dominant role in the more distant future being especially suitable to the fuel cell hybrid vehicle (FCHV). Two types of coal along with biomass cofeed are evaluated; bituminous coal at $42.0/dry tonne, lignite at $12.0/dry tonne, and switchgrass at $99.0/dry tonne. The calculated cost for F–T liquids ranged from $77.8/bbl to $86.6/bbl (or $0.0177 to 0.0197/MJ LHV) depending on the feedstock, which is comparable to the projected longer term market price of crude oil at ∼$80/bbl when supply and demand reach a
International Nuclear Information System (INIS)
Narayan, R.; Chang, C-j.
1982-01-01
[2- 13 C, 2- 14 C]2-Aminoethanol hydrochloride was prepared in good yield from Na*CN in a two step sequence by first converting the Na*CN to OHCH 2 *CN and then reducing the nitrile directly with a solution of borane-tetrahydrofuran complex. The reaction procedure was simple and the pure product could be obtained readily. Using this specifically labelled precursor, the synthesis of [1- 13 C, 1- 14 C]2-chloroethylamine hydrochloride, N-([1- 13 C, 1- 14 C]2-chloroethyl)-N-nitrosourea(CNU) and N,N'-bis([1- 13 C, 1- 14 C]2-chloroethyl)-N-nitrosourea(BCNU) in good yield without isotope scrambling was also reported. (author)
Sun, Xianhua; Xue, Xianli; Li, Mengzhu; Gao, Fei; Hao, Zhenzhen; Huang, Huoqing; Luo, Huiying; Qin, Lina; Yao, Bin; Su, Xiaoyun
2017-12-20
Cellulase and mannanase are both important enzyme additives in animal feeds. Expressing the two enzymes simultaneously within one microbial host could potentially lead to cost reductions in the feeding of animals. For this purpose, we codon-optimized the Aspergillus niger Man5A gene to the codon-usage bias of Trichoderma reesei. By comparing the free energies and the local structures of the nucleotide sequences, one optimized sequence was finally selected and transformed into the T. reesei pyridine-auxotrophic strain TU-6. The codon-optimized gene was expressed to a higher level than the original one. Further expressing the codon-optimized gene in a mutated T. reesei strain through fed-batch cultivation resulted in coproduction of cellulase and mannanase up to 1376 U·mL -1 and 1204 U·mL -1 , respectively.
Ray, A. J.; Barsugli, J. J.; Guinotte, J. M.; Livneh, B.; Dewes, C.; Rangwala, I.; Heldmyer, A.; Torbit, S.
2017-12-01
This presentation will describe the efforts of climate scientists to work with the US Fish and Wildlife Service (FWS) to provide analysis of future snow persistence to support a Species Status Assessment (SSA) for the American wolverine (Gulo gulo), under the Endangered Species Act (ESA). The project has been a research to application (R2A) study, aimed directly at the FWS needs, and in regular collaboration with FWS Region 6 personnel to discuss and agree on the choice downscaled projections to represent a range of plausible futures, and other methodological choices including use of high resolution (250m) physical hydrology modeling. FWS sought improved information on which to base a court-ordered re-evaluation of the conclusions of a previous SSA, due in 12 months, necessitating a quick turn-around for the snow research. The goal was to improve upon the the previous evaluation of snow persistence, both in understanding of the range of uncertainty and by using new snow modeling at spatial scales intended to be more relevant to both physical snowpack processes and to making inferences about potential wolverine denning opportunity. This project was embedded both in a specific legal/regulatory process and also in a broader FWS interest in building body of science for snow-dependent species that might support other ESA processes. Results of the co-production included new scientific questions and analytic approaches that arose from the interaction between climate scientists and ecologists. The fine spatial scales of the analysis compared to previous work allowed new hypotheses to be articulated, but also led to significant issues in the interpretation of the snow model output. This presentation will discuss key issues that arose in the collaboration between scientists and the managers developing the SSA, including the managing the independence of the science while remaining in a co-production mode, the challenges of the rapid time frame, and the challenges
Xin, Fengxue; Dong, Weiliang; Jiang, Yujia; Ma, Jiangfeng; Zhang, Wenming; Wu, Hao; Zhang, Min; Jiang, Min
2018-06-01
Butanol is an important bulk chemical and has been regarded as an advanced biofuel. Large-scale production of butanol has been applied for more than 100 years, but its production through acetone-butanol-ethanol (ABE) fermentation process by solventogenic Clostridium species is still not economically viable due to the low butanol titer and yield caused by the toxicity of butanol and a by-product, such as acetone. Renewed interest in biobutanol as a biofuel has spurred technological advances to strain modification and fermentation process design. Especially, with the development of interdisciplinary processes, the sole product or even the mixture of ABE produced through ABE fermentation process can be further used as platform chemicals for high value added product production through enzymatic or chemical catalysis. This review aims to comprehensively summarize the most recent advances on the conversion of acetone, butanol and ABE mixture into various products, such as isopropanol, butyl-butyrate and higher-molecular mass alkanes. Additionally, co-production of other value added products with ABE was also discussed.
Co-production of hydrogen and ethanol by Escherichia coli SS1 and its recombinant
Directory of Open Access Journals (Sweden)
Chiu-Shyan Soo
2017-11-01
Conclusions: HybC could improve glycerol consumption rate and ethanol productivity of E. coli despite lower hydrogen and ethanol yields. Higher glycerol consumption rate of recombinant hybC could be an advantage for bioconversion of glycerol into biofuels. This study could serve as a useful guidance for dissecting the role of hydrogenase in glycerol metabolism and future development of effective strain for biofuels production.
Patel, Rakhee; Robertson, Claire; Gallagher, Jennifer E
2017-11-23
In recent years, the value of co-production has become embedded in the social care agenda. Care home residents are at significantly higher risk of dental diseases and often rely on the care team for support. It is therefore vital that staff are trained and confident in delivering evidence based oral care to their clients. Three London care homes co-produced a pilot oral health training programme, informed by in-depth interviews and group discussions. The initiative was evaluated using pre/post-questionnaires of carers and semi-structured interviews of managers and the dental teams. Two care homes were available for delivery of the programme, which resulted in training of 64% (n = 87) of care staff. The training programme involved videos and resources and was delivered flexibly with the support of an oral health educator and a dental therapist. There was an improvement in knowledge and self-reported confidence post-training; however, only 54% (n = 45) completed the post-training questionnaire. This study suggests that co-production of an oral care training package for care home staff, is possible and welcome, but challenging in this complex and changing environment. Further work is needed to explore the feasibility, sustainability and impact of doing so. © The Author 2017. Published by Oxford University Press on behalf of Faculty of Public Health. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com
APC/C-Cdh1 coordinates neurogenesis and cortical size during development
Delgado-Esteban, Maria; García-Higuera, Irene; Maestre, Carolina; Moreno, Sergio; Almeida, Angeles
2013-12-01
The morphology of the adult brain is the result of a delicate balance between neural progenitor proliferation and the initiation of neurogenesis in the embryonic period. Here we assessed whether the anaphase-promoting complex/cyclosome (APC/C) cofactor, Cdh1—which regulates mitosis exit and G1-phase length in dividing cells—regulates neurogenesis in vivo. We use an embryo-restricted Cdh1 knockout mouse model and show that functional APC/C-Cdh1 ubiquitin ligase activity is required for both terminal differentiation of cortical neurons in vitro and neurogenesis in vivo. Further, genetic ablation of Cdh1 impairs the ability of APC/C to promote neurogenesis by delaying the exit of the progenitor cells from the cell cycle. This causes replicative stress and p53-mediated apoptotic death resulting in decreased number of cortical neurons and cortex size. These results demonstrate that APC/C-Cdh1 coordinates cortical neurogenesis and size, thus posing Cdh1 in the molecular pathogenesis of congenital neurodevelopmental disorders, such as microcephaly.
Dicty_cDB: Contig-U01276-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available developm... 42 0.032 2 ( CX071007 ) UCRCS08_1C07_b Parent Washington Navel Orange Cal... 42 0.032 2 ( CX6381... Citrus reshni cDNA clone... 42 0.032 2 ( CX071008 ) UCRCS08_1C07_g Parent Washington Navel Orange Cal... 42...A09 Developing fruit flavedo at 80 DAF... 42 0.032 2 ( CX075462 ) UCRCS08_45A05_b Parent Washington Navel Or...lla cDNA cl... 42 0.032 2 ( CX075463 ) UCRCS08_45A05_g Parent Washington Navel Orange Ca... 42 0.032 2 ( CX2...30 ) C05811C09SK FerrChloR1 Citrus sinensis x Poncirus... 42 0.032 2 ( DN619505 ) UCRCS11_04A09_r Parent
Coproduction of detergent compatible bacterial enzymes and stain removal evaluation.
Niyonzima, Francois N; More, Sunil S
2015-10-01
Most of the detergents that are presently produced contain the detergent compatible enzymes to improve and accelerate the washing performance by removing tough stains. The process is environment friendly as the use of enzymes in the detergent formulation reduces the utilization of toxic detergent constituents. The current trend is to use the detergent compatible enzymes that are active at low and ambient temperature in order to save energy and maintain fabric quality. As the detergent compatible bacterial enzymes are used together in the detergent formulation, it is important to co-produce the detergent enzymes in a single fermentation medium as the enzyme stability is assured, and production cost gets reduced enormously. The review reports on the production, purification, characterization and application of detergent compatible amylases, lipases, and proteases are available. However, there is no specific review or minireview on the concomitant production of detergent compatible amylases, lipases, and proteases. In this minireview, the coproduction of detergent compatible enzymes by bacterial species, enzyme stability towards detergents and detergent components, and stain release analysis were discussed. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Co-production of knowledge: recipe for success in land-based climate change adaptation?
Coninx, Ingrid; Swart, Rob
2015-04-01
After multiple failures of scientists to trigger policymakers and other relevant actors to take action when communicating research findings, the request for co-production (or co-creation) of knowledge and stakeholder involvement in climate change adaptation efforts has rapidly increased over the past few years. In particular for land-based adaptation, on-the-ground action is often met by societal resistance towards solutions proposed by scientists, by a misfit of potential solutions with the local context, leading to misunderstanding and even rejection of scientific recommendations. A fully integrative co-creation process in which both scientists and practitioners discuss climate vulnerability and possible responses, exploring perspectives and designing adaptation measures based on their own knowledge, is expected to prevent the adaptation deadlock. The apparent conviction that co-creation processes result in successful adaptation, has not yet been unambiguously empirically demonstrated, but has resulted in co-creation being one of basic principles in many new research and policy programmes. But is co-creation that brings knowledge of scientists and practitioners together always the best recipe for success in climate change adaptation? Assessing a number of actual cases, the authors have serious doubts. The paper proposes additional considerations for adaptively managing the environment that should be taken into account in the design of participatory knowledge development in which climate scientists play a role. These include the nature of the problem at stake; the values, interests and perceptions of the actors involved; the methods used to build trust, strengthen alignment and develop reciprocal relationships among scientists and practitioners; and the concreteness of the co-creation output.
Directory of Open Access Journals (Sweden)
Rigita Tijūnaitienė
2011-02-01
Full Text Available
This article analyses customer’s level of participation in co-production of service. A client’s, known as a co-producer’s involvement is a pretty new conception of participation in creation of service where customers participate in projects, in direct, all-round and not only physical ways, together with professional representatives of service providers. A customer’s activity is becoming an important factor in order to achieve the results of effective creation of service, considering that client’s level while participating plays an essential role in the creation of service. To accomplish an empirical investigation, two quality methods were selected (observation and interview, which were performed in the company, which provides the services of furniture design. Theoretical literature analyses showed that there are three levels of customer’s participation: low, average and high, which usually appear in creation of co-productive service. Empirical investigation reve-aled that while co-producing services of furniture design customer’s level of participation can be: low, average, average high and high. This shows that “pure” level of participation in co-production of furniture design service appears rarely, while intermediate (“impure” level of participation can be observed more frequently. It is established that customer’s personality, temper, stress, lack of designer’s attention, preliminary decisions, and goods peculiarities determine causes of customer’s involvement/ devolvement. It is established that it is hard to elucidate and reveal customer’s needs, wishes and motives when the level of participation in co-production of furniture design service is low, and, as a result of that, a chance that the results of a service could not correspond to all customers expectations, rises. It is
Adams, Richard D; Dhull, Poonam; Tedder, Jonathan D
2018-06-14
The reaction of Re 2 (CO) 8 (μ-C 6 H 5 )(μ-H) (1) with thiophene in CH 2 Cl 2 at 40 °C yielded the new compound Re 2 (CO) 8 (μ-η 2 -SC 4 H 3 )(μ-H) (2), which contains a bridging σ-π-coordinated thienyl ligand formed by the activation of the C-H bond at the 2 position of the thiophene. Compound 2 exhibits dynamical activity on the NMR time scale involving rearrangements of the bridging thienyl ligand. The reaction of compound 2 with a second 1 equiv of 1 at 45 °C yielded the doubly metalated product [Re 2 (CO) 8 (μ-H)] 2 (μ-η 2 -2,3-μ-η 2 -4,5-C 4 H 2 S) (3), formed by the activation of the C-H bond at the 5 position of the thienyl ligand in 2. Heating 3 in a hexane solvent to reflux transformed it into the ring-opened compound Re(CO) 4 [μ-η 5 -η 2 -SCC(H)C(H)C(H)][Re(CO) 3 ][Re 2 (CO) 8 (μ-H)] (4) by the loss of one CO ligand. Compound 4 contains a doubly metalated 1-thiapentadienyl ligand formed by the cleavage of one of the C-S bonds. When heated to reflux (125 °C) in an octane solvent in the presence of H 2 O, the new compound Re(CO) 4 [η 5 -μ-η 2 -SC(H)C(H)C(H)C(H)]Re(CO) 3 (5) was obtained by cleavage of the Re 2 (CO) 8 (μ-H) group from 4 with formation of the known coproduct [Re(CO) 3 (μ 3 -OH)] 4 . All new products were characterized by single-crystal X-ray diffraction analyses.
Paraman, Ilankovan; Moeller, Lorena; Scott, M Paul; Wang, Kan; Glatz, Charles E; Johnson, Lawrence A
2010-10-13
Protein-lean fractions of corn (maize) containing recombinant (r) pharmaceutical proteins were evaluated as a potential feedstock to produce fuel ethanol. The levels of residual r-proteins in the coproduct, distillers dry grains with solubles (DDGS), were determined. Transgenic corn lines containing recombinant green fluorescence protein (r-GFP) and a recombinant subunit vaccine of Escherichia coli enterotoxin (r-LTB), primarily expressed in endosperm, and another two corn lines containing recombinant human collagen (r-CIα1) and r-GFP, primarily expressed in germ, were used as model systems. The kernels were either ground and used for fermentation or dry fractionated to recover germ-rich fractions prior to grinding for fermentation. The finished beers of whole ground kernels and r-protein-spent endosperm solids contained 127-139 and 138-155 g/L ethanol concentrations, respectively. The ethanol levels did not differ among transgenic and normal corn feedstocks, indicating the residual r-proteins did not negatively affect ethanol production. r-Protein extraction and germ removal also did not negatively affect fermentation of the remaining mass. Most r-proteins were inactivated during the mashing process used to prepare corn for fermentation. No functionally active r-GFP or r-LTB proteins were found after fermentation of the r-protein-spent solids; however, a small quantity of residual r-CIα1 was detected in DDGS, indicating that the safety of DDGS produced from transgenic grain for r-protein production needs to be evaluated for each event. Protease treatment during fermentation completely hydrolyzed the residual r-CIα1, and no residual r-proteins were detectable in DDGS.
Work-based Assessment and Co-production in Postgraduate Medical Training
Directory of Open Access Journals (Sweden)
Holmboe, Eric S.
2017-11-01
Full Text Available Assessment has always been an essential component of postgraduate medical education and for many years focused predominantly on various types of examinations. While examinations of medical knowledge and more recently of clinical skills with standardized patients can assess learner capability in controlled settings and provide a level of assurance for the public, persistent and growing concerns regarding quality of care and patient safety worldwide has raised the importance and need for better work-based assessments. Work-based assessments, when done effectively, can more authentically capture the abilities of learners to actually provide safe, effective, patient-centered care. Furthermore, we have entered the era of interprofessional care where effective teamwork among multiple health care professionals is now paramount. Work-based assessment methods are now essential in an interprofessional healthcare world.To better prepare learners for these newer competencies and the ever-growing complexity of healthcare, many post-graduate medical education systems across the globe have turned to outcomes-based models of education, codified through competency frameworks. This commentary provides a brief overview on key methods of work-based assessment such as direct observation, multisource feedback, patient experience surveys and performance measures that are needed in a competency-based world that places a premium on educational and clinical outcomes. However, the full potential of work-based assessments will only be realized if post-graduate learners play an active role in their own assessment program. This will require a substantial culture change, and culture change only occurs through actions and changed behaviors. Co-production offers a practical and philosophical approach to engaging postgraduate learners to be active, intrinsically motivated agents for their own professional development, help to change learning culture and contribute to improving
Shaw, Deborah
2016-01-01
Latin American women’s filmmaking has an unprecedented international profile thanks to the filmsof the Peruvian director Claudia Llosa, and the Argentine directors Lucía Puenzo and Lucrecia Martel. What is frequently unacknowledged when discussing the work of these award-winning filmmakers is the fact that all of their films are co-productions with Europe, and that programmes such as Cinéfondation, a programme aligned with the Cannes film festival, the Hubert Bals Fund,the World Cinema Fund a...
Latif, Asam; Tariq, Sana; Abbasi, Nasa; Mandane, Baguiasri
2018-01-27
With an aging population, the appropriate, effective and safe use of medicines is a global health priority. However, "'medically under-served" patients continue to experience significant inequalities around access to healthcare services. This study forms part of a wider project to co-develop and evaluate a digital educational intervention for community pharmacy. The aim of this paper is to explore the medicine needs of patients from marginalized communities and suggest practical way on how services could be better tailored to their requirements. Following ethical approval, qualitative data was gathered from: (1) workshops with patients and professionals ( n = 57 attendees); and (2) qualitative semi-structured interviews (10 patients and 10 pharmacists). Our findings revealed that patients from marginalized communities reported poor management of their medical conditions and significant problems with adherence to prescribed medicines. Their experience of pharmacy services was found to be variable with many experiencing discrimination or disadvantage as a result of their status. This study highlights the plight of medically under-served communities and the need for policy makers to tailor services to an individual's needs and circumstances. Furthermore, patients and professionals can work in collaboration using a co-production approach to develop educational interventions for pharmacy service improvements.
Scholten, R.H.J.; Rijnen, M.M.J.A.; Schrama, J.W.; Boer, H.; Peet-Schwering, van der C.M.C.; Hartog, den L.A.; Vesseur, P.C.
2001-01-01
The effects of a 6-day storage period on changes in pH, acid-binding capacity, level of organic acids and ethanol of three liquid coproducts [liquid wheat starch (LWS), mashed potato steam peel (PSP) and cheese whey (CW)] and two liquid compound diets [liquid grower diet (LGD) and liquid finisher
Directory of Open Access Journals (Sweden)
Barna János
2012-11-01
Full Text Available Abstract Background Temperature affects virtually all cellular processes. A quick increase in temperature challenges the cells to undergo a heat shock response to maintain cellular homeostasis. Heat shock factor-1 (HSF-1 functions as a major player in this response as it activates the transcription of genes coding for molecular chaperones (also called heat shock proteins that maintain structural integrity of proteins. However, the mechanisms by which HSF-1 adjusts fundamental cellular processes such as growth, proliferation, differentiation and aging to the ambient temperature remain largely unknown. Results We demonstrate here that in Caenorhabditis elegans HSF-1 represses the expression of daf-7 encoding a TGF-β (transforming growth factor-beta ligand, to induce young larvae to enter the dauer stage, a developmentally arrested, non-feeding, highly stress-resistant, long-lived larval form triggered by crowding and starvation. Under favorable conditions, HSF-1 is inhibited by crowding pheromone-sensitive guanylate cyclase/cGMP (cyclic guanosine monophosphate and systemic nutrient-sensing insulin/IGF-1 (insulin-like growth factor-1 signaling; loss of HSF-1 activity allows DAF-7 to promote reproductive growth. Thus, HSF-1 interconnects the insulin/IGF-1, TGF-β and cGMP neuroendocrine systems to control development and longevity in response to diverse environmental stimuli. Furthermore, HSF-1 upregulates another TGF-β pathway-interacting gene, daf-9/cytochrome P450, thereby fine-tuning the decision between normal growth and dauer formation. Conclusion Together, these results provide mechanistic insight into how temperature, nutrient availability and population density coordinately influence development, lifespan, behavior and stress response through HSF-1.
Rajabi, Mohsen; Struble, Evi; Zhou, Zhaohua; Karnaukhova, Elena
2012-01-01
Human C1-esterase inhibitor (C1-INH) is a multifunctional plasma protein with a wide range of inhibitory and non-inhibitory properties, mainly recognized as a key down-regulator of the complement and contact cascades. The potentiation of C1-INH by heparin and other glycosaminoglycans (GAGs) regulates a broad spectrum of C1-INH activities in vivo both in normal and disease states. SCOPE OF RESEARCH: We have studied the potentiation of human C1-INH by heparin using Surface Plasmon Resonance (SPR), circular dichroism (CD) and a functional assay. To advance a SPR for multiple-unit interaction studies of C1-INH we have developed a novel (consecutive double capture) approach exploring different immobilization and layout. Our SPR experiments conducted in three different design versions showed marked acceleration in C1-INH interactions with complement protease C1s as a result of potentiation of C1-INH by heparin (from 5- to 11-fold increase of the association rate). Far-UV CD studies suggested that heparin binding did not alter C1-INH secondary structure. Functional assay using chromogenic substrate confirmed that heparin does not affect the amidolytic activity of C1s, but does accelerate its consumption due to C1-INH potentiation. This is the first report that directly demonstrates a significant acceleration of the C1-INH interactions with C1s due to heparin by using a consecutive double capture SPR approach. The results of this study may be useful for further C-INH therapeutic development, ultimately for the enhancement of current C1-INH replacement therapies. Published by Elsevier B.V.
Pollakis, Georgios; Abebe, Almaz; Kliphuis, Aletta; Rinke de Wit, Tobias F.; Fisseha, Bitew; Tegbaru, Belete; Tesfaye, Girma; Negassa, Hailu; Mengistu, Yohannes; Fontanet, Arnaud L.; Cornelissen, Marion; Goudsmit, Jaap
2003-01-01
The magnitude and complexity of the HIV-1 genetic diversity are major challenges for vaccine development. Investigation of the genotypes circulating in areas of high incidence, as well as their interactions, will be a milestone in the development of an efficacious vaccine. Because HIV-1 subtype C
Nutritive value of co-products derived from olivecake in rabbit feeding
Directory of Open Access Journals (Sweden)
J.C. de Blas
2015-12-01
Full Text Available Olive cake is one of the main agro-industrial co-products in the Mediterranean area of Spain, with high availability almost all year round. In addition, most of the product is dehydrated, which increases its interest in monogastric species such as rabbits. Nineteen samples from various Spanish oil mills using different processing methods were analysed for their chemical composition and in vitro digestibility. The average composition was [in dry matter (DM basis]: ash (9.64%, neutral detergent fibre (52.0%, acid detergent fibre (36.8%, acid detergent lignin (19.1%, crude protein (CP (11.3%, insoluble neutral (8.0% and acid detergent crude protein (5.15%, ether extract (10.9% and gross energy (21.9 MJ/kg. DM and CP in vitro digestibility were, on av., 53.4 and 41.4% respectively. High variability was observed among the samples for most of the traits studied. Fibrous fractions were highly correlated among them and negatively with ether extract content, whereas CP was little related to other feed components. A stepwise regression analysis allowed us to determine regression equations to predict DM and CP in vitro digestibilities from chemical composition (R2=0.80 and 0.91, respectively. As regards the current results, olive cake has potential use for rabbits as a source of insoluble fibre and lignin. Crude samples (not oil extracted combined with sieving to retain the smaller particles have an additional interest, because of their higher energy value and significant supply of high quality fat.
Hemoglobin A1C: Past, present and future
International Nuclear Information System (INIS)
Aldasouqi, Saleh A.; Gossain, Ved V.
2008-01-01
Hemoglobin A1C (HbA1C) has been used for decades to monitor the controlof glycemia in diabetes. Although HbA1Cis currently undergoing a reassessmentand major developments have been underway in recent years, HbA1C is notrecommended at present for diabetes screening or diagnosis. The object ofthis review is to summarize the recent developments and to review a potentialdiagnostic role for HbA1C .Implementation of changes in HbA1C results andunits of measurements have been suggested for the purpose of teststandardization. These include lower reference ranges (by about 1.5-2 points)and measurement units expressed in percentage (%), as mg/dL (mmol/L) ormmol/mol (or a combination of these units). In diabetes screening anddiagnosis, the current diagnostic guidelines use measurement of plasmaglucose either fasting or after glucose load. These diagnostic methods haveshortcomings warranting a potential diagnostic role for HbA1C. While recentdevelopments in HbA1C methodologies are acknowledged, it is not yet knownwhich changes will be implemented and how soon. Given the recent literaturesupporting HbA1C diagnostic abilities and given the shortcomings of thecurrent guidelines, globally. Very recently, the first of suchrecommendations has been proposed by an expert panel as announced by the USEndocrine Society. (author)
Directory of Open Access Journals (Sweden)
Ivy Shiue
2014-11-01
Full Text Available Effective integration in science and knowledge co-production is a challenge that crosses research boundaries, climate regions, languages and cultures. Early career scientists are crucial in the identification of, and engagement with, obstacles and opportunities in the development of innovative solutions to complex and interconnected problems. On 25–31 May 2014, International Council for Science and International Social Science Council, in collaboration with the International Network of Next-Generation Ecologists and Institute for New Economic Thinking: Young Scholars Initiative, assembled a group of early career researchers with diverse backgrounds and research perspectives to reflect on and debate relevant issues around ecosystems and human wellbeing in the transition towards green economy, funded by the German Research Foundation, at Villa Vigoni, Italy. As a group of young scientists, we have come to a consensus that collaboration and communication among a diverse group of peers from different geographic regions could break down the barriers to multi-disciplinary research designed to solve complex global-scale problems. We also propose to establish a global systematic thinking to monitor global socio-ecological systems and to develop criteria for a “good” anthropocene. Finally, we aim to bridge gaps among research, the media, and education from a governance perspective linking with “sustainable development goals”.
Volatility study of [C1C1im][NTf2] and [C2C3im][NTf2] ionic liquids
International Nuclear Information System (INIS)
Rocha, Marisa A.A.; Ribeiro, Filipe M.S.; Schröder, Bernd; Coutinho, João A.P.; Santos, Luís M.N.B.F.
2014-01-01
Highlights: • Vapor pressures of [C 1 C 1 im][NTf 2 ] and [C 2 C 3 im][NTf 2 ] ionic liquids are reported. • [C 1 C 1 im][NTf 2 ] presents higher enthalpy and entropy of vaporization than expected. • The high volatility of [C 2 C 3 im][NTf 2 ] is a result from its asymmetric character. -- Abstract: Vapor pressures of 1,3-dimethylimidazolium bis(trifluoromethylsulfonyl)imide, ([C 1 C 1 im][NTf 2 ]) and 1-ethyl-3-propylimidazolium bis(trifluoromethylsulfonyl)imide, ([C 2 C 3 im][NTf 2 ]) ionic liquids were measured as a function of temperature using a Knudsen effusion apparatus combined with a quartz crystal microbalance. Enthalpies and entropies of vaporization were derived from the fitting of vapor pressure and temperature results to the Clarke and Glew equation. [C 1 C 1 im][NTf 2 ] presents a higher enthalpy and entropy of vaporization than the neighboring members of the series. The enthalpy of vaporization of [C 2 C 3 im][NTf 2 ] lies in between the asymmetric and symmetric ionic liquid series, reflecting a decrease in the electrostatic interactions due to a decrease of the charge accessibility between the ionic pairs when the methyl group is replaced by an ethyl group. The obtained higher volatility of [C 2 C 3 im][NTf 2 ] arises from its asymmetric character, leading to an higher entropic contribution that compensates the enthalpic penalty. The border conditions ([C 1 C 1 im][NTf 2 ], [C 2 C 1 im][NTf 2 ] and [C 2 C 2 im][NTf 2 ]), topology ([C 2 C 3 im][NTf 2 ]) and symmetry/asymmetry of the ILs effect were evaluated and rationalized based on a comparative analysis of the thermodynamic properties, enthalpies and entropies of vaporization
DEFF Research Database (Denmark)
Amano, Mariane T; Ferriani, Virgínia P L; Florido, Marlene P C
2008-01-01
Deficiencies of complement proteins of the classical pathway are strongly associated with the development of autoimmune diseases. Deficiency of C1r has been observed to occur concomitantly with deficiency in C1s and 9 out of 15 reported cases presented systemic lupus erythematosus (SLE). Here, we...... describe a family in which all four children are deficient in C1s but only two of them developed SLE. Hemolytic activity mediated by the alternative and the lectin pathways were normal, but classical pathway activation was absent in all children's sera. C1s was undetectable, while in the parents' sera...
Directory of Open Access Journals (Sweden)
Katarzyna Smykał-Jankowiak
2009-09-01
Full Text Available Complement plays an important role in the immune system. Three different pathways of complement activation are known: the classical, alternative, and lectin dependent. They involve more than 30 serum peptides. C1q is the first subcomponent of the classical pathway of complement activation. It is composed of three types of chains, A, B, and C, which form a molecule containing 18 peptides. Each of the chains has a short amino-terminal region followed by a collagen-like region (playing a role in the activation of C1r2C1s2 and a carboxy-terminal head, which binds to immune complexes. Recent studies have shown a great number of ligands for C1q, including aggregated IgG, IgM, human T-cell lymphotropic virus-I (HTLV-I, gp21 peptide, human immunodeficiency virus-1 (HIV-1 gp21 peptide, β-amyloid, fragments of bacterial walls, apoptotic cells, and many others. However, the role of C1q is not only associated with complement activation. It also helps in the removal of immune complexes and necrotic cells, stimulates the production of some cytokines, and modulates the function of lymphocytes. Complete C1q deficiency is a rare genetic disorder. The C1q gene is located on the short arm of chromosome 1. So far, only a few mutations in C1q gene have been reported. The presence of these mutations is strongly associated with recurrent bacterial infections and the development of systemic lupus erythematosus (SLE. Recent clinical studies point to the significance of anti-C1q antibodies in the diagnosis and assessment of lupus nephritis activity.
Directory of Open Access Journals (Sweden)
Nutakki Tirumala Uday Kumar
2017-04-01
Full Text Available Water is the most desirable and sparse resource in Gulf cooperation council (GCC region. Utilization of point-of-use (POU water treatment devices has been gaining huge market recently due to increase in knowledge of urban population on health related issues over contaminants in decentralized water distribution networks. However, there is no foolproof way of knowing whether the treated water is free of contaminants harmful for drinking and hence reliance on certified bottled water has increased worldwide. The bottling process right from treatment to delivery is highly unsustainable due to huge energy demand along the supply chain. As a step towards sustainability, we investigated various ways of coupling of membrane distillation (MD process with solar domestic heaters for co-production of domestic heat and pure water. Performance dynamics of various integration techniques have been evaluated and appropriate configuration has been identified for real scale application. A solar combi MD (SCMD system is experimentally tested for single household application for production 20 L/day of pure water and 250 L/day of hot water simultaneously without any auxiliary heating device. The efficiency of co-production system is compared with individual operation of solar heaters and solar membrane distillation.
Dioxin modulates expression of receptor for activated C kinase (RACK-1) in developing neurons
Energy Technology Data Exchange (ETDEWEB)
Yang, J.H.; Kim, S.Y.; Lee, H.G.; Kim, M.Y.; Lee, J.H.; Chae, W.G. [Catholic Univ. of Daegu, Dept. of Pharmacology/Toxicology, Daegu (Korea)
2004-09-15
TCDD is sensitive to the central nerve system of the developing brain. The TCDD-induced neurodevelopmental deficits include the cognitive disability and motor dysfunction. While TCDD may lead to neurodevelopmental and neurobehavioral deficit, it is not known which molecular substances are intracellular targets for TCDD. Since TCDD accumulates in brain and the brain contains the Ah receptor, it is possible that TCDD may act at the target site such as cerebellum, which is responsible for cognitive abilities and motor function. A recent in vitro studies using cerebellar granule cells demonstrated a translocation of PKC-{alpha} and {epsilon} following the TCDD or PCB exposure. One of the most pivotal second messenger molecules involved in neuronal function and development is protein kinase C (PKC). PKC signaling pathways have been implicated as an important factor in learning and memory processes. PKC signaling events are optimized by the adaptor proteins, which organize PKCs near their selective substrates and away from others. RACK-1(receptor for activated C-kinase) is one of adaptor proteins that anchor the activated PKC at the site of translocation 6. RACKs bind PKC only in the presence of PKC activators. RACKs are 30- and 36-kDa proteins located in cytoskeletal compartment and play a key role in PKC activation and in membrane amchoring. Since different PKC isoforms translocate to distinct subcellular sites on activation, it is suggested that isoform-specific RACK may be present. Activation of certain PKC isoforms (PKC-a and {beta}II) is preferentially associated with RACK-1. While TCDD modulates PKC signaling pathway, role of RACK-1 on TCDD-mediated signaling pathway is not known. To identify the intracellular target for TCDD and understand a mechanism of signaling pathway in the developing brain, the present study attempted to analyze effects of RACK-1 in the cerebellar granule cells following TCDD exposure.
Bio-Carbon Accounting for Bio-Oil Co-Processing: 14C and 13C/12C
Energy Technology Data Exchange (ETDEWEB)
Mora, Claudia I. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Li, Zhenghua [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Vance, Zachary [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)
2016-06-21
This is a powerpoint presentation on bio-carbon accounting for bio-oil co-processing. Because of the overlapping range in the stable C isotope compositions of fossil oils and biooils from C3-type feedstocks, it is widely thought that stable isotopes are not useful to track renewable carbon during co-production. In contrast, our study demonstrates the utility of stable isotopes to: • capture a record of renewable carbon allocation between FCC products of co-processing • record changes in carbon apportionments due to changes in reactor or feed temperature Stable isotope trends as a function of percent bio-oil in the feed are more pronounced when the δ13C of the bio-oil endmember differs greatly from the VGO (i.e., it has a C4 biomass source–corn stover, switch grass, Miscanthus, sugarcane– versus a C3 biomass source– pine, wheat, rice, potato), but trends on the latter case are significant for endmember differences of just a few permil. The correlation between measured 14C and δ13C may be useful as an alternative to carbon accounting, but the relationship must first be established for different bio-oil sources.
International Nuclear Information System (INIS)
Tosi, M.; Duponchel, C.; Meo, T.; Julier, C.
1987-01-01
Overlapping molecular clones encoding the complement subcomponent C1s were isolated from a human liver cDNA library. The nucleotide sequence reconstructed from these clones spans about 85% of the length of the liver C1s messenger RNAs, which occur in three distinct size classes around 3 kilobases in length. Comparisons with the sequence of C1r, the other enzymatic subcomponent of C1, reveal 40% amino acid identity and conservation of all the cysteine residues. Beside the serine protease domain, the following sequence motifs, previously described in C1r, were also found in C1s: (a) two repeats of the type found in the Ba fragment of complement factor B and in several other complement but also noncomplement proteins, (b) a cysteine-rich segment homologous to the repeats of epidermal growth factor precursor, and (c) a duplicated segment found only in C1r and C1s. Differences in each of these structural motifs provide significant clues for the interpretation of the functional divergence of these interacting serine protease zymogens. Hybridizations of C1r and C1s probes to restriction endonuclease fragments of genomic DNA demonstrate close physical linkage of the corresponding genes. The implications of this finding are discussed with respect to the evolution of C1r and C1s after their origin by tandem gene duplication and to the previously observed combined hereditary deficiencies of Clr and Cls
Barré, Tangui; Perignon, Marlène; Gazan, Rozenn; Vieux, Florent; Micard, Valérie; Amiot, Marie-Josèphe; Darmon, Nicole
2018-01-01
NEB diets for women (80% and 78% for men), whereas it only decreased by 27% in NEB-CP diets (38% for men). The share of energy and proteins of animal origin was similar for the 3 modeled diets (approximately 1/5 of total energy, and 1/2 of protein) and lower than in OBS diet (approximately 1/3 of total energy, and 2/3 of protein). Decreasing meat content was strictly needed to achieve more sustainable diets for French adults, but the reduction was less severe when nutrient bioavailability and co-production links were taken into account.
Gazan, Rozenn; Vieux, Florent; Micard, Valérie; Amiot, Marie-Josèphe; Darmon, Nicole
2018-01-01
meat quantity dropped severely by 84% and 87% in NE and NEB diets for women (80% and 78% for men), whereas it only decreased by 27% in NEB-CP diets (38% for men). The share of energy and proteins of animal origin was similar for the 3 modeled diets (approximately 1/5 of total energy, and 1/2 of protein) and lower than in OBS diet (approximately 1/3 of total energy, and 2/3 of protein). Conclusions Decreasing meat content was strictly needed to achieve more sustainable diets for French adults, but the reduction was less severe when nutrient bioavailability and co-production links were taken into account. PMID:29444098
Directory of Open Access Journals (Sweden)
Tangui Barré
and NEB diets for women (80% and 78% for men, whereas it only decreased by 27% in NEB-CP diets (38% for men. The share of energy and proteins of animal origin was similar for the 3 modeled diets (approximately 1/5 of total energy, and 1/2 of protein and lower than in OBS diet (approximately 1/3 of total energy, and 2/3 of protein.Decreasing meat content was strictly needed to achieve more sustainable diets for French adults, but the reduction was less severe when nutrient bioavailability and co-production links were taken into account.
Almack, Kathryn; Simpson, Paul; Billings, Barbara; Mall, Naresh
2018-01-01
Background: Older lesbian, gay, bisexual and trans (LGBT) residents are often invisible in long-term care settings. This article presents findings from a community-based action research project, which attempted to address this invisibility through co-produced research with LGBT community members. Particular Question: What conditions enable co-produced research to emerge in long-term residential care settings for older people? Aims of Project: To analyse outcomes and challenges of action-oriented, co-produced research in the given context. In particular, we explore how co-production as a collaborative approach to action-orientated research can emerge during the research/fieldwork process; and reflect critically on the ethics and effectiveness of this approach in advancing inclusion in context. Methods: The project was implemented across six residential care homes in England. Reflections are based on qualitative evaluation data gathered pre- and post-project, which includes 37 interviews with care home staff, managers and community advisors (two of whom are co-authors). Results and Conclusions: We discuss how the co-production turn emerged during research and evaluate how the politics of this approach helped advance inclusion—itself crucial to well-being. We argue for the value of co-produced research in instigating organizational change in older people’s care environments and of non-didactic storytelling in LGBT awareness-raising amongst staff. PMID:29642460
Willis, Paul; Almack, Kathryn; Hafford-Letchfield, Trish; Simpson, Paul; Billings, Barbara; Mall, Naresh
2018-04-07
Background : Older lesbian, gay, bisexual and trans (LGBT) residents are often invisible in long-term care settings. This article presents findings from a community-based action research project, which attempted to address this invisibility through co-produced research with LGBT community members. Particular Question: What conditions enable co-produced research to emerge in long-term residential care settings for older people? Aims of Project: To analyse outcomes and challenges of action-oriented, co-produced research in the given context. In particular, we explore how co-production as a collaborative approach to action-orientated research can emerge during the research/fieldwork process; and reflect critically on the ethics and effectiveness of this approach in advancing inclusion in context. The project was implemented across six residential care homes in England. Reflections are based on qualitative evaluation data gathered pre- and post-project, which includes 37 interviews with care home staff, managers and community advisors (two of whom are co-authors) . Results and Conclusions: We discuss how the co-production turn emerged during research and evaluate how the politics of this approach helped advance inclusion-itself crucial to well-being. We argue for the value of co-produced research in instigating organizational change in older people's care environments and of non-didactic storytelling in LGBT awareness-raising amongst staff.
Directory of Open Access Journals (Sweden)
Paul Willis
2018-04-01
Full Text Available Background: Older lesbian, gay, bisexual and trans (LGBT residents are often invisible in long-term care settings. This article presents findings from a community-based action research project, which attempted to address this invisibility through co-produced research with LGBT community members. Particular Question: What conditions enable co-produced research to emerge in long-term residential care settings for older people? Aims of Project: To analyse outcomes and challenges of action-oriented, co-produced research in the given context. In particular, we explore how co-production as a collaborative approach to action-orientated research can emerge during the research/fieldwork process; and reflect critically on the ethics and effectiveness of this approach in advancing inclusion in context. Methods: The project was implemented across six residential care homes in England. Reflections are based on qualitative evaluation data gathered pre- and post-project, which includes 37 interviews with care home staff, managers and community advisors (two of whom are co-authors. Results and Conclusions: We discuss how the co-production turn emerged during research and evaluate how the politics of this approach helped advance inclusion—itself crucial to well-being. We argue for the value of co-produced research in instigating organizational change in older people’s care environments and of non-didactic storytelling in LGBT awareness-raising amongst staff.
Bloomgarden, Zachary
2017-12-01
considerations, HbA1c may be more limited than generally recognized as a surrogate marker of optimal diabetes treatment, leading the European Medicines Agency to consider relying less on this measure, with the implication that novel approaches will be required for clinical practice and for clinical trials in developing future medicines. In surveys performed by a market research company (dQ&A Market Research, San Francisco, CA, USA) and reported at the Bethesda meeting, among >3000 people with type 1 (T1D) or type 2 (T2D) diabetes both receiving and not receiving insulin, the majority reported a sense that their diabetes care is not very successful and that too much of their time was spent outside the 70-180 mg/dL (3.9-10.0 mEq/L) range. Although self-monitoring of capillary blood glucose (SMBG) is an important tool for patients to use in understanding glycemic excursions, CGM offers a far superior technology in this regard and can avoid the erroneous conclusions often accompanying the use of the inherently indirect measurement of HbA1c. Duration and severity of hypoglycemia may come to be considered important medication efficacy measures, rather than just being considered safety outcomes. Glucose cut-off levels suggested at the meeting may be: 180 mg/dL (10.0 mEq/L) for high blood glucose levels, and >240 mg/dL (13.3 mEq/L) for serious high blood glucose levels. An important part of both SMBG and CGM technologies will be the development of data transmission and storage modalities to better provide feedback to people with diabetes and health care providers in adjusting a variety of treatments, as well as their growing use in insulin dose adjustment algorithms; important in such approaches will be the integration of SMBG with CGM to recognize potential measurement errors and to improve the accuracy and assurance of patients and providers that the CGM results are accurate, a particular concern for readings in the hypoglycemia range, but remaining an issue throughout the
J. Gupta (Joyeeta); C.J.M. Arts (Karin)
2017-01-01
textabstractAchieving the 1.5 C objective of the Paris Agreement on Climate Change in a just manner requires equitably sharing the responsibilities and rights that relate to this objective. This paper examines how international law concerning the Right to Promote (Sustainable) Development can
Synthesis of 1-13C-1-indanone and 2-13C-1,2,3,4-tetrahydroquinoline
International Nuclear Information System (INIS)
Pickering, R.E.; Wysocki, M.A.; Eisenbraun, E.J.
1985-01-01
The synthesis of 2- 13 C-1,2,3,4-tetrahydroquinoline (5) via 1- 13 C-3-phenylpropanoic acid (1), 1- 13 C-1-indanone (2), 1- 13 C-1-indanone hydrazone (3) and 2- 13 C-3,4-dihydro-2(1H)-quinolinone (4) proceeded in 78, 96, 95, 79, and 85% individual yields respectively for 1, 2, 3, 4, 5 and 61% overall yield of the latter from 1. (author)
Laursen, Scott; Puniwai, Noelani; Genz, Ayesha S; Nash, Sarah A B; Canale, Lisa K; Ziegler-Chong, Sharon
2018-05-30
Complex socio-ecological issues, such as climate change have historically been addressed through technical problem solving methods. Yet today, climate science approaches are increasingly accounting for the roles of diverse social perceptions, experiences, cultural norms, and worldviews. In support of this shift, we developed a research program on Hawai'i Island that utilizes knowledge coproduction to integrate the diverse worldviews of natural and cultural resource managers, policy professionals, and researchers within actionable science products. Through their work, local field managers regularly experience discrete land and waterscapes. Additionally, in highly interconnected rural communities, such as Hawai'i Island, managers often participate in the social norms and values of communities that utilize these ecosystems. Such local manager networks offer powerful frameworks within which to co-develop and implement actionable science. We interviewed a diverse set of local managers with the aim of incorporating their perspectives into the development of a collaborative climate change research agenda that builds upon existing professional networks utilized by managers and scientists while developing new research products. We report our manager needs assessment, the development process of our climate change program, our interactive forums, and our ongoing research products. Our needs assessment showed that the managers' primary source of information were other professional colleagues, and our in-person forums informed us that local managers are very interested in interacting with a wider range of networks to build upon their management capacities. Our initial programmatic progress suggests that co-created research products and in-person forums strengthen the capacities of local managers to adapt to change.
International Nuclear Information System (INIS)
Kurishita, H.; Matsuo, S.; Arakawa, H.; Sakamoto, T.; Kobayashi, S.; Nakai, K.; Takida, T.; Kato, M.; Kawai, M.; Yoshida, N.
2010-01-01
Ultra-fine grained (UFG) W-TiC compacts fabricated by powder metallurgical methods utilizing mechanical alloying (MA) are very promising for use in irradiation environments. However, the assurance of room-temperature ductility and enhancement in surface resistances to low-energy hydrogen irradiation are unsettled issues. As an approach to solution to these, microstructural modification by hot plastic working has been applied to UFG W-TiC processed by MA in a purified Ar or H 2 atmosphere and hot isostatic pressing (HIP). Hot plastically worked compacts have been subjected to 3-point bend tests at room temperature and TEM microstructural examinations. It is found that the microstructural modification allows us to convert UFG W-1.1%TiC to compacts exhibiting a very high fracture strength and appreciable ductility at room temperature. The compacts of W-1.1%TiC/Ar (MA atmosphere: Ar) and W-1.1%TiC/H 2 (MA atmosphere: H 2 ) exhibit re-crystallized structures with approximately 0.5 and 1.5 μm in grain size, respectively. It is shown that the enhancement of fracture resistance by microstructural modifications is attributed to significant strengthening of weak grain boundaries in the re-crystallized state. As a result the modified compacts exhibit superior surface resistance to low-energy deuteron irradiation.
International Nuclear Information System (INIS)
Porwoll, J.P.; Leete, E.
1985-01-01
Potential advanced intermediates in the biosynthesis of delta 9 -tetrahydrocannabinol, the major psychoactive principle of marijuana, have been synthesized labeled with two contiguous 13 C atoms and 14 C. Methyl [5,6- 13 C 2 , 1- 14 C]olivetolate was prepared from lithium [ 13 C 2 ]acetylide and dimethyl [2- 14 C]malonate. Reaction with geranyl bromide afforded methyl [5,6- 13 C 2 , 1- 14 C]cannabigerolate, and hydrolysis of these methyl esters with lithium propyl mercaptide yielded the corresponding labeled acids. The 13 C- 13 C couplings observable in the 13 C NMR spectra of these 13 C-enriched compounds and their synthetic precursors are recorded. Methyl [1'- 14 C]olivetolate was prepared from 13 CO 2 to confirm assignments of the 13 C chemical shifts in the pentyl side chain of these compounds. (author)
Energy Technology Data Exchange (ETDEWEB)
Drown, D.P.; Brown, W.R.; Heydorn, E.C.; Moore, R.B.; Schaub, E.S.; Brown, D.M.; Jones, W.C.; Kornosky, R.M.
1997-12-31
The Liquid Phase Methanol (LPMEOH{trademark}) process uses a slurry bubble column reactor to convert syngas (primarily a mixture of carbon monoxide and hydrogen) to methanol. Because of its superior heat management, the process is able to be designed to directly handle the carbon monoxide (CO)-rich syngas characteristic of the gasification of coal, petroleum coke, residual oil, wastes, or of other hydrocarbon feedstocks. When added to an integrated gasification combined cycle (IGCC) power plant, the LPMEOH{trademark} process converts a portion of the CO-rich syngas produced by the gasifier to methanol, and the remainder of the unconverted gas is used to fuel the gas turbine combined-cycle power plant. The LPMEOH{trademark} process has the flexibility to operate in a daily electricity demand load-following manner. Coproduction of power and methanol via IGCC and the LPMEOH{trademark} process provides opportunities for energy storage for electrical demand peak shaving, clean fuel for export, and/or chemical methanol sales.
COOPERATIVE RESEARCH IN C1 CHEMISTRY
Energy Technology Data Exchange (ETDEWEB)
Gerald P. Huffman
2001-04-30
Faculty and students from five universities (Kentucky, West Virginia, Utah, Pittsburgh and Auburn) are collaborating on a basic research program to develop novel C1 chemistry processes for the production of clean, high quality transportation fuel. An Industrial Advisory Board (IAB) with members from Chevron, Eastman Chemical, Energy International, Teir Associates, and the Department of Defense has been formed to provide practical guidance to the program. The program has two principal objectives. (1) Develop technology for conversion of C1 source materials (natural gas, synthesis gas, carbon dioxide and monoxide, and methanol) into clean, high efficiency transportation fuel. (2) Develop novel processes for producing hydrogen from natural gas and other hydrocarbons. Some of the principal accomplishments of the program in its first two years are: (1) The addition of acetylenic compounds in Fischer-Tropsch synthesis is found to produce significant amounts of oxygenated products in FT diesel fuels. Such oxygenated products should decrease particulate matter (PM) emissions. (2) Nanoscale, binary, Fe-based catalysts supported on alumina have been shown to have significant activity for the decomposition of methane into pure hydrogen and potentially valuable multi-walled carbon nanotubes. (3) Catalytic synthesis processes have been developed for synthesis of diethyl carbonate, higher ethers, and higher alcohols from C1 source materials. Testing of the effect of adding these oxygenates to diesel fuel on PM emissions has begun using a well-equipped small diesel engine test facility. (4) Supercritical fluid (SCF) FT synthesis has been conducted under SCF hexane using both Fe and Co catalysts. There is a marked effect on the hydrocarbon product distribution, with a shift to higher carbon number products. These and other results are summarized.
Summary of breakout Session C1: C1, chemical countermeasures; dispersants
International Nuclear Information System (INIS)
Anon.
1992-01-01
The discussions in breakout session C1 are summarized. The topics discussed include the pros and cons of dispersant use. Many of the positions which have been heard for the last twenty years were restated. Neither group convinced the other of the advisability of easing the use of dispersants. There was better agreement on the need for research and development programs to get a better handle on some of the questions being raised. The R ampersand D needs on which the participants could agree are summarized
Energy Technology Data Exchange (ETDEWEB)
Kurishita, H., E-mail: kurishi@imr.tohoku.ac.j [International Research Center for Nuclear Materials Science, IMR, Tohoku University, Oarai, Ibaraki 311-1313 (Japan); Matsuo, S.; Arakawa, H. [International Research Center for Nuclear Materials Science, IMR, Tohoku University, Oarai, Ibaraki 311-1313 (Japan); Sakamoto, T.; Kobayashi, S.; Nakai, K. [Department of Materials Science and Biotechnology, Ehime University, Matsuyama 790-8577 (Japan); Takida, T.; Kato, M. [A.L.M.T. Corp., Toyama 931-8543 (Japan); Kawai, M. [Institute of Material Structure Science, High Energy Accelerator Research Organization (KEK), Tsukuba 305-0801 (Japan); Yoshida, N. [Institute for Applied Mechanics, Kyushu University, Kasuga, Fukuoka 816-8580 (Japan)
2010-03-15
Ultra-fine grained (UFG) W-TiC compacts fabricated by powder metallurgical methods utilizing mechanical alloying (MA) are very promising for use in irradiation environments. However, the assurance of room-temperature ductility and enhancement in surface resistances to low-energy hydrogen irradiation are unsettled issues. As an approach to solution to these, microstructural modification by hot plastic working has been applied to UFG W-TiC processed by MA in a purified Ar or H{sub 2} atmosphere and hot isostatic pressing (HIP). Hot plastically worked compacts have been subjected to 3-point bend tests at room temperature and TEM microstructural examinations. It is found that the microstructural modification allows us to convert UFG W-1.1%TiC to compacts exhibiting a very high fracture strength and appreciable ductility at room temperature. The compacts of W-1.1%TiC/Ar (MA atmosphere: Ar) and W-1.1%TiC/H{sub 2} (MA atmosphere: H{sub 2}) exhibit re-crystallized structures with approximately 0.5 and 1.5 mum in grain size, respectively. It is shown that the enhancement of fracture resistance by microstructural modifications is attributed to significant strengthening of weak grain boundaries in the re-crystallized state. As a result the modified compacts exhibit superior surface resistance to low-energy deuteron irradiation.
Co-Production of Electricity and Hydrogen Using a Novel Iron-based Catalyst
Energy Technology Data Exchange (ETDEWEB)
Hilaly, Ahmad; Georgas, Adam; Leboreiro, Jose; Arora, Salil; Head, Megann; Trembly, Jason; Turk, Brian; Gupta, Raghubir
2011-09-30
The primary objective of this project was to develop a hydrogen production technology for gasification applications based on a circulating fluid-bed reactor and an attrition resistant iron catalyst. The work towards achieving this objective consisted of three key activities: Development of an iron-based catalyst suitable for a circulating fluid-bed reactor; Design, construction, and operation of a bench-scale circulating fluid-bed reactor system for hydrogen production; Techno-economic analysis of the steam-iron and the pressure swing adsorption hydrogen production processes. This report describes the work completed in each of these activities during this project. The catalyst development and testing program prepared and iron-based catalysts using different support and promoters to identify catalysts that had sufficient activity for cyclic reduction with syngas and steam oxidation and attrition resistance to enable use in a circulating fluid-bed reactor system. The best performing catalyst from this catalyst development program was produced by a commercial catalyst toll manufacturer to support the bench-scale testing activities. The reactor testing systems used during material development evaluated catalysts in a single fluid-bed reactor by cycling between reduction with syngas and oxidation with steam. The prototype SIP reactor system (PSRS) consisted of two circulating fluid-bed reactors with the iron catalyst being transferred between the two reactors. This design enabled demonstration of the technical feasibility of the combination of the circulating fluid-bed reactor system and the iron-based catalyst for commercial hydrogen production. The specific activities associated with this bench-scale circulating fluid-bed reactor systems that were completed in this project included design, construction, commissioning, and operation. The experimental portion of this project focused on technical demonstration of the performance of an iron-based catalyst and a
Hemoglobin A1c (HbA1c) Test: MedlinePlus Lab Test Information
... page: https://medlineplus.gov/labtests/hemoglobina1chba1ctest.html Hemoglobin A1c (HbA1c) Test To use the sharing features on this page, please enable JavaScript. What is a hemoglobin A1c (HbA1c) test? A hemoglobin A1c (HbA1c) test measures ...
Dumesic, James A.; Martin Alonso, David; Luterbacher, Jeremy Scott
2016-06-07
Described is a method of processing biomass to separate it into a liquid fraction enriched in solubilized C5-sugar-containing oligomers and C-5 sugar monomers and a solid fraction enriched in substantially insoluble cellulose and C6-sugar-containing oligomers. The method includes the steps of reacting biomass with a solvent system comprising water, at least one lactone, or at least one furan, or at least one cyclic ether, and at least one acid, for a time and at a temperature to yield the liquid and solid fractions. The liquid and solid fractions may then be separated. Gamma-valeroloactone is a preferred lactone for use in the solvent system. Tetrahydrofuran is a preferred furan species for use in the solvent system.
Directory of Open Access Journals (Sweden)
Nhuan P. Nghiem
2018-02-01
Full Text Available Grain sorghum is a potential feedstock for fuel ethanol production due to its high starch content, which is equivalent to that of corn, and has been successfully used in several commercial corn ethanol plants in the United States. Some sorghum grain varieties contain significant levels of surface wax, which may interact with enzymes and make them less efficient toward starch hydrolysis. On the other hand, wax can be recovered as a valuable co-product and as such may help improve the overall process economics. Sorghum grains also contain lignocellulosic materials in the hulls, which can be converted to additional ethanol. An integrated process was developed, consisting of the following steps: 1. Extraction of wax with boiling ethanol, which is the final product of the proposed process; 2. Pretreatment of the dewaxed grains with dilute sulfuric acid; 3. Mashing and fermenting of the pretreated grains to produce ethanol. During the fermentation, commercial cellulase was also added to release fermentable sugars from the hulls, which then were converted to additional ethanol. The advantages of the developed process were illustrated with the following results: (1 Wax extracted (determined by weight loss: ~0.3 wt % of total mass. (2 Final ethanol concentration at 25 wt % solid using raw grains: 86.1 g/L. (3 Final ethanol concentration at 25 wt % solid using dewaxed grains: 106.2 g/L (23.3% improvement. (4 Final ethanol concentration at 25 wt % solid using dewaxed and acid-treated grains (1 wt % H2SO4 plus cellulase (CTec2: 117.8 g/L (36.8% improvement.
Biorefinery and Carbon Cycling Research Project
Energy Technology Data Exchange (ETDEWEB)
Das, K. C., Adams; Thomas, T; Eiteman, Mark A; Kastner, James R; Mani, Sudhagar; Adolphson, Ryan
2012-06-08
In this project we focused on several aspects of technology development that advances the formation of an integrated biorefinery. These focus areas include: [ 1] pretreatment of biomass to enhance quality of products from thermochemical conversion; [2] characterization of and development of coproduct uses; [3] advancement in fermentation of lignocellulosics and particularly C5 and C6 sugars simultaneously, and [ 4] development of algal biomass as a potential substrate for the biorefinery. These advancements are intended to provide a diverse set of product choices within the biorefinery, thus improving the cost effectiveness of the system. Technical effectiveness was demonstrated in the thermochemical product quality in the form of lower tar production, simultaneous of use of multiple sugars in fermentation, use ofbiochar in environmental (ammonia adsorption) and agricultural applications, and production of algal biomass in wastewaters. Economic feasibility of algal biomass production systems seems attractive, relative to the other options. However, further optimization in all paths, and testing/demonstration at larger scales are required to fully understand the economic viabilities. The coproducts provide a clear picture that multiple streams of value can be generated within an integrated biorefinery, and these include fuels and products.
Cytochrome c and c1 heme lyases are essential in Plasmodium berghei.
Posayapisit, Navaporn; Songsungthong, Warangkhana; Koonyosying, Pongpisid; Falade, Mofolusho O; Uthaipibull, Chairat; Yuthavong, Yongyuth; Shaw, Philip J; Kamchonwongpaisan, Sumalee
Malaria parasites possess a de novo heme synthetic pathway. Interestingly, this pathway is dispensable during the blood stages of development in mammalian hosts. The assembly of the two most important hemeproteins, cytochromes c and c1, is mediated by cytochrome heme lyase enzymes. Plasmodium spp. possess two cytochrome heme lyases encoded by separate genes. Given the redundancy of heme synthesis, we sought to determine if heme lyase function also exhibits redundancy. To answer this question, we performed gene knockout experiments. We found that the PBANKA_143950 and PBANKA_0602600 Plasmodium berghei genes encoding cytochrome c (Pbcchl) and cytochrome c1 (Pbcc 1 hl) heme lyases, respectively, can only be disrupted when a complementary gene is present. In contrast, four genes in the de novo heme synthesis pathway can be disrupted without complementation. This work provides evidence that Pbcchl and Pbcc 1 hl are both essential and thus may be antimalarial targets. Copyright © 2016 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Ioki, Kimihiro; Onozuka, Masanori; Ikeda, Takeshi; Akiba, Masato.
1994-01-01
Unidirectional C/C composite named 'MFC-1' with high conductivity was developed, and full-scale armor tiles were fabricated. The thermal conductivity in the direction perpendicular to the plasma-side surface is more than 300-500 W/m·degC, which is higher than those of other C/C composites ever made, even superior to that of pyrolytic carbon. It was shown by high heat load tests done using an electron beam test facility that the unidirectional C/C composite was very resistant against both surface erosion as well as severe thermal shock. The 'MFC-1' was successfully brazed to copper substrate, and its high thermal shock resistance was observed in heat load tests (20 MW/m 2 , 3s, not cooled). A functionally gradient material has been also developed as compliant layer for the MFC-1 bonded to copper. (author)
Search engine imaginary: Visions and values in the co-production of search technology and Europe.
Mager, Astrid
2017-04-01
This article discusses the co-production of search technology and a European identity in the context of the EU data protection reform. The negotiations of the EU data protection legislation ran from 2012 until 2015 and resulted in a unified data protection legislation directly binding for all European member states. I employ a discourse analysis to examine EU policy documents and Austrian media materials related to the reform process. Using the concept 'sociotechnical imaginary', I show how a European imaginary of search engines is forming in the EU policy domain, how a European identity is constructed in the envisioned politics of control, and how national specificities contribute to the making and unmaking of a European identity. I discuss the roles that national technopolitical identities play in shaping both search technology and Europe, taking as an example Austria, a small country with a long history in data protection and a tradition of restrained technology politics.
Use of Fructosyl Peptide Oxidase for HbA1c Assay
Yonehara, Satoshi; Inamura, Norio; Fukuda, Miho; Sugiyama, Koji
2015-01-01
ARKRAY, Inc developed the world’s first automatic glycohemoglobin analyzer based on HPLC (1981). After that, ARKRAY developed enzymatic HbA1c assay “CinQ HbA1c” with the spread and diversification of HbA1c measurement (2007). CinQ HbA1c is the kit of Clinical Chemistry Analyzer, which uses fructosyl peptide oxidase (FPOX) for a measurement reaction. This report mainly indicates the developmental background, measurement principle, and future of the enzymatic method HbA1c reagent. PMID:25633966
Hull, Claire M; Loveridge, E Joel; Donnison, Iain S; Kelly, Diane E; Kelly, Steven L
2014-01-01
Microbial biotechnology and biotransformations promise to diversify the scope of the biorefinery approach for the production of high-value products and biofuels from industrial, rural and municipal waste feedstocks. In addition to bio-based chemicals and metabolites, microbial biomass itself constitutes an obvious but overlooked by-product of existing biofermentation systems which warrants fuller attention. The probiotic yeast Saccharomyces boulardii is used to treat gastrointestinal disorders and marketed as a human health supplement. Despite its relatedness to S. cerevisiae that is employed widely in biotechnology, food and biofuel industries, the alternative applications of S. boulardii are not well studied. Using a biorefinery approach, we compared the bioethanol and biomass yields attainable from agriculturally-sourced grass juice using probiotic S. boulardii (strain MYA-769) and a commercial S. cerevisiae brewing strain (Turbo yeast). Maximum product yields for MYA-769 (39.18 [±2.42] mg ethanol mL(-1) and 4.96 [±0.15] g dry weight L(-1)) compared closely to those of Turbo (37.43 [±1.99] mg mL(-1) and 4.78 [±0.10] g L(-1), respectively). Co-production, marketing and/or on-site utilisation of probiotic yeast biomass as a direct-fed microbial to improve livestock health represents a novel and viable prospect for rural biorefineries. Given emergent evidence to suggest that dietary yeast supplementations might also mitigate ruminant enteric methane emissions, the administration of probiotic yeast biomass could also offer an economically feasible way of reducing atmospheric CH4.
Mumm, Rita H; Goldsmith, Peter D; Rausch, Kent D; Stein, Hans H
2014-01-01
Although the system for producing yellow corn grain is well established in the US, its role among other biofeedstock alternatives to petroleum-based energy sources has to be balanced with its predominant purpose for food and feed as well as economics, land use, and environmental stewardship. We model land usage attributed to corn ethanol production in the US to evaluate the effects of anticipated technological change in corn grain production, ethanol processing, and livestock feeding through a multi-disciplinary approach. Seven scenarios are evaluated: four considering the impact of technological advances on corn grain production, two focused on improved efficiencies in ethanol processing, and one reflecting greater use of ethanol co-products (that is, distillers dried grains with solubles) in diets for dairy cattle, pigs, and poultry. For each scenario, land area attributed to corn ethanol production is estimated for three time horizons: 2011 (current), the time period at which the 15 billion gallon cap for corn ethanol as per the Renewable Fuel Standard is achieved, and 2026 (15 years out). Although 40.5% of corn grain was channeled to ethanol processing in 2011, only 25% of US corn acreage was attributable to ethanol when accounting for feed co-product utilization. By 2026, land area attributed to corn ethanol production is reduced to 11% to 19% depending on the corn grain yield level associated with the four corn production scenarios, considering oil replacement associated with the soybean meal substituted in livestock diets with distillers dried grains with solubles. Efficiencies in ethanol processing, although producing more ethanol per bushel of processed corn, result in less co-products and therefore less offset of corn acreage. Shifting the use of distillers dried grains with solubles in feed to dairy cattle, pigs, and poultry substantially reduces land area attributed to corn ethanol production. However, because distillers dried grains with solubles
Du, Lanxing; Wang, Jinwu; Zhang, Yang; Qi, Chusheng; Wolcott, Michael P; Yu, Zhiming
2017-08-01
This study demonstrated the technical potential for the large-scale co-production of sugars, lignosulfonates, cellulose, and cellulose nanocrystals. Ball-milled woods with two particle sizes were prepared by ball milling for 80min or 120min (BMW 80 , BMW 120 ) and then enzymatically hydrolyzed. 78.3% cellulose conversion of BMW 120 was achieved, which was three times as high as the conversion of BMW 80 . The hydrolyzed residues (HRs) were neutrally sulfonated cooking. 57.72g/L and 88.16g/L lignosulfonate concentration, respectively, were harvested from HR 80 and HR 120 , and 42.6±0.5% lignin were removed. The subsequent solid residuals were purified to produce cellulose and then this material was acid-hydrolyzed to produce cellulose nanocrystals. The BMW 120 maintained smaller particle size and aspect ratio during each step of during the multiple processes, while the average aspect ratio of its cellulose nanocrystals was larger. The crystallinity of both materials increased with each step of wet processing, reaching to 74% for the cellulose. Copyright © 2017 Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Ioki, Kimihiro (Mitsubishi Atomic Power Industries, Inc., Tokyo (Japan)); Onozuka, Masanori; Ikeda, Takeshi; Akiba, Masato
1994-03-01
Unidirectional C/C composite named 'MFC-1' with high conductivity was developed, and full-scale armor tiles were fabricated. The thermal conductivity in the direction perpendicular to the plasma-side surface is more than 300-500 W/m[center dot]degC, which is higher than those of other C/C composites ever made, even superior to that of pyrolytic carbon. It was shown by high heat load tests done using an electron beam test facility that the unidirectional C/C composite was very resistant against both surface erosion as well as severe thermal shock. The 'MFC-1' was successfully brazed to copper substrate, and its high thermal shock resistance was observed in heat load tests (20 MW/m[sup 2], 3s, not cooled). A functionally gradient material has been also developed as compliant layer for the MFC-1 bonded to copper. (author).
Development of an advanced continuous mild gasification process for the production of coproducts
Energy Technology Data Exchange (ETDEWEB)
Merriam, N.W.; Jha, M.C.
1991-11-01
This report is a final brief summary of development of a mild-gasification and char conversion process. Morgantown Energy Technology Center developed a concept called mild gasification. In this concept, devolatilization of coal under nonoxidizing and relatively mild temperature and pressure conditions can yield three marketable products: (1) a high-heating-value gas, (2) a high-aromatic coal liquid, and (3) a high-carbon char. The objective of this program is to develop an advanced, continuous, mild-gasification process to produce products that will make the concept economically and environmentally viable. (VC)
Microstructure Development During Sintering of TiC-Ni3A1 Cermets
International Nuclear Information System (INIS)
Tiegs, T.N.
2001-01-01
TiC-Ni(sub 3)Al cermets are under development for application in diesel engines because of desirable physical properties and wear resistance. Powder compacts with binder contents from 30-50 vol.% were fabricated by pressureless sintering under vacuum followed by low gas pressure isostatic pressing. Increasing the Ni(sub 3)Al content improved densification when using prealloyed powders as expected. However, when the Ni(sub 3)Al was formed by in-situ reaction synthesis of Ni and NiAl, densification decreased with higher binder contents. The final microstructure consisted of a ''core-rim'' structure with TiC cores surrounded by (Ti,W)C rims. In some cases, Ni and Al were also observed in the peripheral region of the rim structure. Grain sizes of the TiC increased with binder content and temperature. Preferred orientation of the Ni(sub 3)Al binder phase was observed due to very large grain sizes on the order of millimeters
Development of doxorubicin-induced chronic cardiotoxicity in the B6C3F{sub 1} mouse model
Energy Technology Data Exchange (ETDEWEB)
Desai, Varsha G., E-mail: varsha.desai@fda.hhs.gov [Personalized Medicine Branch, Division of Systems Biology, National Center for Toxicological Research, U.S. Food and Drug Administration, Jefferson, AR 72079 (United States); Herman, Eugene H. [Division of Drug Safety Research, Center for Drug Evaluation and Research, U.S. Food and Drug Administration, Silver Spring, MD 20993 (United States); Moland, Carrie L.; Branham, William S. [Personalized Medicine Branch, Division of Systems Biology, National Center for Toxicological Research, U.S. Food and Drug Administration, Jefferson, AR 72079 (United States); Lewis, Sherry M. [Office of Scientific Coordination, National Center for Toxicological Research, U.S. Food and Drug Administration, Jefferson, AR 72079 (United States); Davis, Kelly J. [Toxicologic Pathology Associates, National Center for Toxicological Research, Jefferson, AR 72079 (United States); George, Nysia I. [Division Bioinformatics and Biostatistics, National Center for Toxicological Research, U.S. Food and Drug Administration, Jefferson, AR 72079 (United States); Lee, Taewon [Department of Information and Mathematics, Korea University, Jochiwon, Chungnam 339-700 (Korea, Republic of); Kerr, Susan [Arkansas Heart Hospital, Little Rock, AR 72211 (United States); Fuscoe, James C. [Personalized Medicine Branch, Division of Systems Biology, National Center for Toxicological Research, U.S. Food and Drug Administration, Jefferson, AR 72079 (United States)
2013-01-01
Serum levels of cardiac troponins serve as biomarkers of myocardial injury. However, troponins are released into the serum only after damage to cardiac tissue has occurred. Here, we report development of a mouse model of doxorubicin (DOX)-induced chronic cardiotoxicity to aid in the identification of predictive biomarkers of early events of cardiac tissue injury. Male B6C3F{sub 1} mice were administered intravenous DOX at 3 mg/kg body weight, or an equivalent volume of saline, once a week for 4, 6, 8, 10, 12, and 14 weeks, resulting in cumulative DOX doses of 12, 18, 24, 30, 36, and 42 mg/kg, respectively. Mice were sacrificed a week following the last dose. A significant reduction in body weight gain was observed in mice following exposure to a weekly DOX dose for 1 week and longer compared to saline-treated controls. DOX treatment also resulted in declines in red blood cell count, hemoglobin level, and hematocrit compared to saline-treated controls after the 2nd weekly dose until the 8th and 9th doses, followed by a modest recovery. All DOX-treated mice had significant elevations in cardiac troponin T concentrations in plasma compared to saline-treated controls, indicating cardiac tissue injury. Also, a dose-related increase in the severity of cardiac lesions was seen in mice exposed to 24 mg/kg DOX and higher cumulative doses. Mice treated with cumulative DOX doses of 30 mg/kg and higher showed a significant decline in heart rate, suggesting drug-induced cardiac dysfunction. Altogether, these findings demonstrate the development of DOX-induced chronic cardiotoxicity in B6C3F{sub 1} mice. -- Highlights: ► 24 mg/kg was a cumulative cardiotoxic dose of doxorubicin in male B6C3F{sub 1} mice. ► Doxorubicin-induced hematological toxicity was in association with splenomegaly. ► Doxorubicin induced severe testicular toxicity in B6C3F{sub 1} male mice.
[About the HbA1c in the elderly].
Farcet, Anaïs; Delalande, Géraldine; Oliver, Charles; Retornaz, Frédérique
2016-03-01
HbA1c product of non enzymatic glycation of HbA increases in relation with the mean blood glucose level during the former 2-3 months. HbA1c levels are correlated with the development of diabetic complications and HbA1c assessment is now the gold standard for evaluation of diabetes control. HbA1c level should not be higher than 7% to avoid these complications. However, in aged peoples, the objectives of diabetes control vary according to their health status. It must be good with HbA1c lower than 7-7.5% in healthy subjects and more relax in subjects with symptoms of frailty and risks of non perceived and self corrected hypoglycemia. Under these conditions, HbA1c values lower than 8 to 9% are advised. Nevertheless, hypoglycemia episodes may occur in patients with high HbA1c and capillary glucose follow-up is necessary for detection of such complications.
2013-01-01
Background The study presented here has used the commercial flow sheeting program Aspen Plus™ to evaluate techno-economic aspects of large-scale hemp-based processes for producing transportation fuels. The co-production of biogas, district heat and power from chopped and steam-pretreated hemp, and the co-production of ethanol, biogas, heat and power from steam-pretreated hemp were analysed. The analyses include assessments of heat demand, energy efficiency and process economics in terms of annual cash flows and minimum biogas and ethanol selling prices (MBSP and MESP). Results Producing biogas, heat and power from chopped hemp has the highest overall energy efficiency, 84% of the theoretical maximum (based on lower heating values), providing that the maximum capacity of district heat is delivered. The combined production of ethanol, biogas, heat and power has the highest energy efficiency (49%) if district heat is not produced. Neither the inclusion of steam pretreatment nor co-production with ethanol has a large impact on the MBSP. Ethanol is more expensive to produce than biogas is, but this is compensated for by its higher market price. None of the scenarios examined are economically viable, since the MBSP (EUR 103–128 per MWh) is higher than the market price of biogas (EUR 67 per MWh). The largest contribution to the cost is the cost of feedstock. Decreasing the retention time in the biogas process for low solids streams by partly replacing continuous stirred tank reactors by high-rate bioreactors decreases the MBSP. Also, recycling part of the liquid from the effluent from anaerobic digestion decreases the MBSP. The production and prices of methane and ethanol influence the process economics more than the production and prices of electricity and district heat. Conclusions To reduce the production cost of ethanol and biogas from biomass, the use of feedstocks that are cheaper than hemp, give higher output of ethanol and biogas, or combined production with
DEFF Research Database (Denmark)
Schaer, Caroline; Hahonou, Eric Komlavi
2017-01-01
Disastrous and recurring floods have impacted West African urban centres over the last decade, accentuating already existing vulnerabilities in poor neighbourhoods. Climate change-induced changing weather patterns and more extreme weather events are only part of the explanation for this situation......, as large segments of the urban population in West Africa are not offered the public services, infrastructure and protective regulations needed in order to respond to floods. Through an empirically grounded approach, the article shows that the ability to respond to floods is formed largely outside the realm....... The article concludes that weak state capacity is not equivalent to non-existent of ungoverned collective services linked to floods. While flood response service delivery through co-production, may constitute the best available options in a context of poor resources, because of the negotiated character...
Learn Objective-C for Java Developers
Bucanek, James
2009-01-01
Learn Objective-C for Java Developers will guide experienced Java developers into the world of Objective-C. It will show them how to take their existing language knowledge and design patterns and transfer that experience to Objective-C and the Cocoa runtime library. This is the express train to productivity for every Java developer who dreamt of developing for Mac OS X or iPhone, but felt that Objective-C was too intimidating. So hop on and enjoy the ride!
Learn C++ for game development
Sutherland, Bruce
2014-01-01
An Apress entry on C++ skills accumulation book for Game developers. Retail/Trade sales potential exists in addition to the more likely sales to come from books as database engines as both C++ and Game Development are relevant terms. Charles River Media book out of print or no longer supported directly by the Publisher/sold direct by Publisher on Amazon anymore. This Apress book takes its place at least. Author is an expert game developer/programmer. C++ is still the primary programming language that the majority of game applications/apps rely upon in today's market.
Current Status of HbA1c Biosensors
Lin, Hua; Yi, Jun
2017-01-01
Glycated hemoglobin (HbA1c) is formed via non-enzymatic glycosylation reactions at the α–amino group of βVal1 residues in the tetrameric Hb, and it can reflect the ambient glycemic level over the past two to three months. A variety of HbA1c detection methods, including chromatography, immunoassay, enzymatic measurement, electrochemical sensor and capillary electrophoresis have been developed and used in research laboratories and in clinics as well. In this review, we summarize the current status of HbA1c biosensors based on the recognition of the sugar moiety on the protein and also their applications in the whole blood sample measurements. PMID:28777351
Taher, Fadi; Bokums, Kristaps; Aichmair, Alexander; Hughes, Alexander P
2014-05-01
An exact understanding of patient vertebral artery anatomy is essential to safely place screws at the atlanto-axial level in posterior arthrodesis. We aim to report a case of erosion of the left vertebral artery into the C1-C2 facet complex with resultant rotatory and lateral listhesis presenting with severe occipital headache. This represents a novel etiology for this diagnosis and our report illustrates technical considerations when instrumenting the C1-C2 segment. We report a case of severe occipital headache due to C1-C2 instability with resultant left C2 nerve compression in the setting of erosion of the vertebral artery into the C1-C2 facet complex. A 68-year-old woman presented with a 12-month history of progressively debilitating headache and neck pain with atlanto-axial instability. Computed tomography (CT) angiography demonstrated erosion of the left vertebral artery into the left C1-C2 facet complex. In addition, the tortuous vertebral arteries had eroded into the C2 pedicles, eliminating the possibility for posterior pedicle screw placement. The patient underwent posterior arthrodesis of C1-C2 utilizing bilateral lateral mass fixation into C1 and bilateral trans-laminar fixation into C2 with resolution of all preoperative complaints. This study constitutes the first report of a tortuous vertebral artery causing the partial destruction of a C1-C2 facet complex, as well as instability, with the clinical presentation of severe occipital headache. It hereby presents a novel etiology for both the development of C1-C2 segment instability as well as the development of occipital headache. Careful evaluation of such lesions utilizing CT angiography is important when formulating a surgical plan.
Dicty_cDB: Contig-U14038-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available hophyton rubrum cDNA library 8 Tric... 54 0.006 1 ( DW708366 ) EST031847 Tric...hophyton rubrum cDNA library 8 Tric... 54 0.006 1 ( DW693636 ) EST017117 Trichophyton rubrum cDNA library 3 Tric...... 54 0.006 1 ( DW688891 ) EST012372 Trichophyton rubrum cDNA library 2 Tric... 54 0.006 1 ( DW688872 ) EST012353 Tric...hophyton rubrum cDNA library 2 Tric... 54 0.006 1 ( DW686711 ) EST010192 Tric...hophyton rubrum cDNA library 1 Tric... 54 0.006 1 ( DW685118 ) EST008599 Trichophyton rubrum cDNA library 1 Tric
χ_{c1} and χ_{c2} Resonance Parameters with the Decays χ_{c1,c2}→J/ψμ^{+}μ^{-}.
Aaij, R; Adeva, B; Adinolfi, M; Ajaltouni, Z; Akar, S; Albrecht, J; Alessio, F; Alexander, M; Alfonso Albero, A; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves, A A; Amato, S; Amerio, S; Amhis, Y; An, L; Anderlini, L; Andreassi, G; Andreotti, M; Andrews, J E; Appleby, R B; Archilli, F; d'Argent, P; Arnau Romeu, J; Artamonov, A; Artuso, M; Aslanides, E; Atzeni, M; Auriemma, G; Baalouch, M; Babuschkin, I; Bachmann, S; Back, J J; Badalov, A; Baesso, C; Baker, S; Balagura, V; Baldini, W; Baranov, A; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Baryshnikov, F; Batozskaya, V; Battista, V; Bay, A; Beaucourt, L; Beddow, J; Bedeschi, F; Bediaga, I; Beiter, A; Bel, L J; Beliy, N; Bellee, V; Belloli, N; Belous, K; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Beranek, S; Berezhnoy, A; Bernet, R; Berninghoff, D; Bertholet, E; Bertolin, A; Betancourt, C; Betti, F; Bettler, M-O; van Beuzekom, M; Bezshyiko, Ia; Bifani, S; Billoir, P; Birnkraut, A; Bizzeti, A; Bjørn, M; Blake, T; Blanc, F; Blusk, S; Bocci, V; Boettcher, T; Bondar, A; Bondar, N; Bordyuzhin, I; Borghi, S; Borisyak, M; Borsato, M; Bossu, F; Boubdir, M; Bowcock, T J V; Bowen, E; Bozzi, C; Braun, S; Britton, T; Brodzicka, J; Brundu, D; Buchanan, E; Burr, C; Bursche, A; Buytaert, J; Byczynski, W; Cadeddu, S; Cai, H; Calabrese, R; Calladine, R; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D H; Capriotti, L; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carniti, P; Carson, L; Carvalho Akiba, K; Casse, G; Cassina, L; Cattaneo, M; Cavallero, G; Cenci, R; Chamont, D; Chapman, M G; Charles, M; Charpentier, Ph; Chatzikonstantinidis, G; Chefdeville, M; Chen, S; Cheung, S F; Chitic, S-G; Chobanova, V; Chrzaszcz, M; Chubykin, A; Ciambrone, P; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Cogan, J; Cogneras, E; Cogoni, V; Cojocariu, L; Collins, P; Colombo, T; Comerma-Montells, A; Contu, A; Cook, A; Coombs, G; Coquereau, S; Corti, G; Corvo, M; Costa Sobral, C M; Couturier, B; Cowan, G A; Craik, D C; Crocombe, A; Cruz Torres, M; Currie, R; D'Ambrosio, C; Da Cunha Marinho, F; Dall'Occo, E; Dalseno, J; Davis, A; De Aguiar Francisco, O; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Serio, M; De Simone, P; Dean, C T; Decamp, D; Del Buono, L; Dembinski, H-P; Demmer, M; Dendek, A; Derkach, D; Deschamps, O; Dettori, F; Dey, B; Di Canto, A; Di Nezza, P; Dijkstra, H; Dordei, F; Dorigo, M; Dosil Suárez, A; Douglas, L; Dovbnya, A; Dreimanis, K; Dufour, L; Dujany, G; Durante, P; Dzhelyadin, R; Dziewiecki, M; Dziurda, A; Dzyuba, A; Easo, S; Ebert, M; Egede, U; Egorychev, V; Eidelman, S; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; Ely, S; Esen, S; Evans, H M; Evans, T; Falabella, A; Farley, N; Farry, S; Fazzini, D; Federici, L; Ferguson, D; Fernandez, G; Fernandez Declara, P; Fernandez Prieto, A; Ferrari, F; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fini, R A; Fiorini, M; Firlej, M; Fitzpatrick, C; Fiutowski, T; Fleuret, F; Fohl, K; Fontana, M; Fontanelli, F; Forshaw, D C; Forty, R; Franco Lima, V; Frank, M; Frei, C; Fu, J; Funk, W; Furfaro, E; Färber, C; Gabriel, E; Gallas Torreira, A; Galli, D; Gallorini, S; Gambetta, S; Gandelman, M; Gandini, P; Gao, Y; Garcia Martin, L M; García Pardiñas, J; Garra Tico, J; Garrido, L; Garsed, P J; Gascon, D; Gaspar, C; Gavardi, L; Gazzoni, G; Gerick, D; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gianì, S; Gibson, V; Girard, O G; Giubega, L; Gizdov, K; Gligorov, V V; Golubkov, D; Golutvin, A; Gomes, A; Gorelov, I V; Gotti, C; Govorkova, E; Grabowski, J P; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graverini, E; Graziani, G; Grecu, A; Greim, R; Griffith, P; Grillo, L; Gruber, L; Gruberg Cazon, B R; Grünberg, O; Gushchin, E; Guz, Yu; Gys, T; Göbel, C; Hadavizadeh, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hamilton, B; Han, X; Hancock, T H; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Hasse, C; Hatch, M; He, J; Hecker, M; Heinicke, K; Heister, A; Hennessy, K; Henrard, P; Henry, L; van Herwijnen, E; Heß, M; Hicheur, A; Hill, D; Hombach, C; Hopchev, P H; Hu, W; Huard, Z C; Hulsbergen, W; Humair, T; Hushchyn, M; Hutchcroft, D; Ibis, P; Idzik, M; Ilten, P; Jacobsson, R; Jalocha, J; Jans, E; Jawahery, A; Jiang, F; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Jurik, N; Kandybei, S; Karacson, M; Kariuki, J M; Karodia, S; Kazeev, N; Kecke, M; Keizer, F; Kelsey, M; Kenzie, M; Ketel, T; Khairullin, E; Khanji, B; Khurewathanakul, C; Kirn, T; Klaver, S; Klimaszewski, K; Klimkovich, T; Koliiev, S; Kolpin, M; Kopecna, R; Koppenburg, P; Kosmyntseva, A; Kotriakhova, S; Kozeiha, M; Kravchuk, L; Kreps, M; Kress, F; Krokovny, P; Kruse, F; Krzemien, W; Kucewicz, W; Kucharczyk, M; Kudryavtsev, V; Kuonen, A K; Kvaratskheliya, T; Lacarrere, D; Lafferty, G; Lai, A; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; Leflat, A; Lefrançois, J; Lefèvre, R; Lemaitre, F; Lemos Cid, E; Leroy, O; Lesiak, T; Leverington, B; Li, P-R; Li, T; Li, Y; Li, Z; Likhomanenko, T; Lindner, R; Lionetto, F; Lisovskyi, V; Liu, X; Loh, D; Loi, A; Longstaff, I; Lopes, J H; Lucchesi, D; Luchinsky, A; Lucio Martinez, M; Luo, H; Lupato, A; Luppi, E; Lupton, O; Lusiani, A; Lyu, X; Machefert, F; Maciuc, F; Macko, V; Mackowiak, P; Maddrell-Mander, S; Maev, O; Maguire, K; Maisuzenko, D; Majewski, M W; Malde, S; Malecki, B; Malinin, A; Maltsev, T; Manca, G; Mancinelli, G; Marangotto, D; Maratas, J; Marchand, J F; Marconi, U; Marin Benito, C; Marinangeli, M; Marino, P; Marks, J; Martellotti, G; Martin, M; Martinelli, M; Martinez Santos, D; Martinez Vidal, F; Massacrier, L M; Massafferri, A; Matev, R; Mathad, A; Mathe, Z; Matteuzzi, C; Mauri, A; Maurice, E; Maurin, B; Mazurov, A; McCann, M; McNab, A; McNulty, R; Mead, J V; Meadows, B; Meaux, C; Meier, F; Meinert, N; Melnychuk, D; Merk, M; Merli, A; Michielin, E; Milanes, D A; Millard, E; Minard, M-N; Minzoni, L; Mitzel, D S; Mogini, A; Molina Rodriguez, J; Mombächer, T; Monroy, I A; Monteil, S; Morandin, M; Morello, M J; Morgunova, O; Moron, J; Morris, A B; Mountain, R; Muheim, F; Mulder, M; Müller, D; Müller, J; Müller, K; Müller, V; Naik, P; Nakada, T; Nandakumar, R; Nandi, A; Nasteva, I; Needham, M; Neri, N; Neubert, S; Neufeld, N; Neuner, M; Nguyen, T D; Nguyen-Mau, C; Nieswand, S; Niet, R; Nikitin, N; Nikodem, T; Nogay, A; O'Hanlon, D P; Oblakowska-Mucha, A; Obraztsov, V; Ogilvy, S; Oldeman, R; Onderwater, C J G; Ossowska, A; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pais, P R; Palano, A; Palutan, M; Papanestis, A; Pappagallo, M; Pappalardo, L L; Parker, W; Parkes, C; Passaleva, G; Pastore, A; Patel, M; Patrignani, C; Pearce, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perret, P; Pescatore, L; Petridis, K; Petrolini, A; Petrov, A; Petruzzo, M; Picatoste Olloqui, E; Pietrzyk, B; Pikies, M; Pinci, D; Pisani, F; Pistone, A; Piucci, A; Placinta, V; Playfer, S; Plo Casasus, M; Polci, F; Poli Lener, M; Poluektov, A; Polyakov, I; Polycarpo, E; Pomery, G J; Ponce, S; Popov, A; Popov, D; Poslavskii, S; Potterat, C; Price, E; Prisciandaro, J; Prouve, C; Pugatch, V; Puig Navarro, A; Pullen, H; Punzi, G; Qian, W; Quagliani, R; Quintana, B; Rachwal, B; Rademacker, J H; Rama, M; Ramos Pernas, M; Rangel, M S; Raniuk, I; Ratnikov, F; Raven, G; Ravonel Salzgeber, M; Reboud, M; Redi, F; Reichert, S; Dos Reis, A C; Remon Alepuz, C; Renaudin, V; Ricciardi, S; Richards, S; Rihl, M; Rinnert, K; Rives Molina, V; Robbe, P; Robert, A; Rodrigues, A B; Rodrigues, E; Rodriguez Lopez, J A; Rogozhnikov, A; Roiser, S; Rollings, A; Romanovskiy, V; Romero Vidal, A; Ronayne, J W; Rotondo, M; Rudolph, M S; Ruf, T; Ruiz Valls, P; Ruiz Vidal, J; Saborido Silva, J J; Sadykhov, E; Sagidova, N; Saitta, B; Salustino Guimaraes, V; Sanchez Mayordomo, C; Sanmartin Sedes, B; Santacesaria, R; Santamarina Rios, C; Santimaria, M; Santovetti, E; Sarpis, G; Sarti, A; Satriano, C; Satta, A; Saunders, D M; Savrina, D; Schael, S; Schellenberg, M; Schiller, M; Schindler, H; Schmelling, M; Schmelzer, T; Schmidt, B; Schneider, O; Schopper, A; Schreiner, H F; Schubiger, M; Schune, M-H; Schwemmer, R; Sciascia, B; Sciubba, A; Semennikov, A; Sepulveda, E S; Sergi, A; Serra, N; Serrano, J; Sestini, L; Seyfert, P; Shapkin, M; Shapoval, I; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, V; Siddi, B G; Silva Coutinho, R; Silva de Oliveira, L; Simi, G; Simone, S; Sirendi, M; Skidmore, N; Skwarnicki, T; Smith, E; Smith, I T; Smith, J; Smith, M; Soares Lavra, L; Sokoloff, M D; Soler, F J P; Souza De Paula, B; Spaan, B; Spradlin, P; Sridharan, S; Stagni, F; Stahl, M; Stahl, S; Stefko, P; Stefkova, S; Steinkamp, O; Stemmle, S; Stenyakin, O; Stepanova, M; Stevens, H; Stone, S; Storaci, B; Stracka, S; Stramaglia, M E; Straticiuc, M; Straumann, U; Sun, J; Sun, L; Sutcliffe, W; Swientek, K; Syropoulos, V; Szumlak, T; Szymanski, M; T'Jampens, S; Tayduganov, A; Tekampe, T; Tellarini, G; Teubert, F; Thomas, E; van Tilburg, J; Tilley, M J; Tisserand, V; Tobin, M; Tolk, S; Tomassetti, L; Tonelli, D; Toriello, F; Tourinho Jadallah Aoude, R; Tournefier, E; Traill, M; Tran, M T; Tresch, M; Trisovic, A; Tsaregorodtsev, A; Tsopelas, P; Tully, A; Tuning, N; Ukleja, A; Usachov, A; Ustyuzhanin, A; Uwer, U; Vacca, C; Vagner, A; Vagnoni, V; Valassi, A; Valat, S; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; van Veghel, M; Velthuis, J J; Veltri, M; Veneziano, G; Venkateswaran, A; Verlage, T A; Vernet, M; Vesterinen, M; Viana Barbosa, J V; Viaud, B; Vieira, D; Vieites Diaz, M; Viemann, H; Vilasis-Cardona, X; Vitti, M; Volkov, V; Vollhardt, A; Voneki, B; Vorobyev, A; Vorobyev, V; Voß, C; de Vries, J A; Vázquez Sierra, C; Waldi, R; Wallace, C; Wallace, R; Walsh, J; Wang, J; Ward, D R; Wark, H M; Watson, N K; Websdale, D; Weiden, A; Weisser, C; Whitehead, M; Wicht, J; Wilkinson, G; Wilkinson, M; Williams, M; Williams, M P; Williams, M; Williams, T; Wilson, F F; Wimberley, J; Winn, M; Wishahi, J; Wislicki, W; Witek, M; Wormser, G; Wotton, S A; Wraight, K; Wyllie, K; Xie, Y; Xu, M; Xu, Z; Yang, Z; Yang, Z; Yao, Y; Yin, H; Yu, J; Yuan, X; Yushchenko, O; Zarebski, K A; Zavertyaev, M; Zhang, L; Zhang, Y; Zhelezov, A; Zheng, Y; Zhu, X; Zhukov, V; Zonneveld, J B; Zucchelli, S
2017-12-01
The decays χ_{c1}→J/ψμ^{+}μ^{-} and χ_{c2}→J/ψμ^{+}μ^{-} are observed and used to study the resonance parameters of the χ_{c1} and χ_{c2} mesons. The masses of these states are measured to be m(χ_{c1})=3510.71±0.04(stat)±0.09(syst) MeV and m(χ_{c2})=3556.10±0.06(stat)±0.11(syst) MeV, where the knowledge of the momentum scale for charged particles dominates the systematic uncertainty. The momentum-scale uncertainties largely cancel in the mass difference m(χ_{c2})-m(χ_{c1})=45.39±0.07(stat)±0.03(syst) MeV. The natural width of the χ_{c2} meson is measured to be Γ(χ_{c2})=2.10±0.20(stat)±0.02(syst) MeV. These results are in good agreement with and have comparable precision to the current world averages.
26 CFR 1.381(c)(5)-1 - Inventories.
2010-04-01
... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Inventories. 1.381(c)(5)-1 Section 1.381(c)(5)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Insolvency Reorganizations § 1.381(c)(5)-1 Inventories. (a) Carryover requirement—(1...
76 FR 42119 - 36(b)(1) Arms Sales Notification
2011-07-18
... Forward Looking Infrared (FLIR) constitutes a target acquisition system which, when operated with other tank systems, gives the tank crew a substantial advantage over a potential threat. The TIS provides the... Consideration for Purchase: 125 M1A1 Abrams tank kits for co-production, 125 M256 Armament Systems, 125 M2 .50...
Going beyond the flood insurance rate map: insights from flood hazard map co-production
Luke, Adam; Sanders, Brett F.; Goodrich, Kristen A.; Feldman, David L.; Boudreau, Danielle; Eguiarte, Ana; Serrano, Kimberly; Reyes, Abigail; Schubert, Jochen E.; AghaKouchak, Amir; Basolo, Victoria; Matthew, Richard A.
2018-04-01
Flood hazard mapping in the United States (US) is deeply tied to the National Flood Insurance Program (NFIP). Consequently, publicly available flood maps provide essential information for insurance purposes, but they do not necessarily provide relevant information for non-insurance aspects of flood risk management (FRM) such as public education and emergency planning. Recent calls for flood hazard maps that support a wider variety of FRM tasks highlight the need to deepen our understanding about the factors that make flood maps useful and understandable for local end users. In this study, social scientists and engineers explore opportunities for improving the utility and relevance of flood hazard maps through the co-production of maps responsive to end users' FRM needs. Specifically, two-dimensional flood modeling produced a set of baseline hazard maps for stakeholders of the Tijuana River valley, US, and Los Laureles Canyon in Tijuana, Mexico. Focus groups with natural resource managers, city planners, emergency managers, academia, non-profit, and community leaders refined the baseline hazard maps by triggering additional modeling scenarios and map revisions. Several important end user preferences emerged, such as (1) legends that frame flood intensity both qualitatively and quantitatively, and (2) flood scenario descriptions that report flood magnitude in terms of rainfall, streamflow, and its relation to an historic event. Regarding desired hazard map content, end users' requests revealed general consistency with mapping needs reported in European studies and guidelines published in Australia. However, requested map content that is not commonly produced included (1) standing water depths following the flood, (2) the erosive potential of flowing water, and (3) pluvial flood hazards, or flooding caused directly by rainfall. We conclude that the relevance and utility of commonly produced flood hazard maps can be most improved by illustrating pluvial flood hazards
DEFF Research Database (Denmark)
Thiel, S; Petersen, Steen Vang; Vorup-Jensen, T
2000-01-01
. There is controversy as to whether MBL can utilize C1r and C1s or, inversely, whether C1q can utilize MASP-1 and 2. Serum deficient in C1r produced no complement activation in IgG-coated microwells, whereas activation was seen in mannan-coated microwells. In serum, C1r and C1s were found to be associated only with C1q...
1983-01-01
Grumman OV-1C in flight. This OV-1C Mohawk, serial #67-15932, was used in a joint NASA/US Army Aviation Engineering Flight Activity (USAAEFA) program to study a stall-speed warning system in the early 1980s. NASA designed and built an automated stall-speed warning system which presented both airspeed and stall speed to the pilot. Visual indication of impending stall would be displayed to the pilot as a cursor or pointer located on a conventional airspeed indicator. In addition, an aural warning at predetermined stall margins was presented to the pilot through a voice synthesizer. The Mohawk was developed by Grumman Aircraft as a photo observation and reconnaissance aircraft for the US Marines and the US Army. The OV-1 entered production in October 1959 and served the US Army in Europe, Korea, the Viet Nam War, Central and South America, Alaska, and during Desert Shield/Desert Storm in the Middle East. The Mohawk was retired from service in September 1996. 133 OV-1Cs were built, the 'C' designating the model which used an IR (infrared) imaging system to provide reconnaissance.
C3a Enhances the Formation of Intestinal Organoids through C3aR1
Directory of Open Access Journals (Sweden)
Naoya Matsumoto
2017-09-01
Full Text Available C3a is important in the regulation of the immune response as well as in the development of organ inflammation and injury. Furthermore, C3a contributes to liver regeneration but its role in intestinal stem cell function has not been studied. We hypothesized that C3a is important for intestinal repair and regeneration. Intestinal organoid formation, a measure of stem cell capacity, was significantly limited in C3-deficient and C3a receptor (C3aR 1-deficient mice while C3a promoted the growth of organoids from normal mice by supporting Wnt-signaling but not from C3aR1-deficient mice. Similarly, the presence of C3a in media enhanced the expression of the intestinal stem cell marker leucine-rich repeat G-protein-coupled receptor 5 (Lgr5 and of the cell proliferation marker Ki67 in organoids formed from C3-deficient but not from C3aR1-deficient mice. Using Lgr5.egfp mice we showed significant expression of C3 in Lgr5+ intestinal stem cells whereas C3aR1 was expressed on the surface of various intestinal cells. C3 and C3aR1 expression was induced in intestinal crypts in response to ischemia/reperfusion injury. Finally, C3aR1-deficient mice displayed ischemia/reperfusion injury comparable to control mice. These data suggest that C3a through interaction with C3aR1 enhances stem cell expansion and organoid formation and as such may have a role in intestinal regeneration.
Dicty_cDB: Contig-U04547-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available XABT132097.b1 Gateway compatible cien cDNA librar... 46 1.5 1 ( FG287351 ) 1108770738534 New World Screwworm... Egg 9261 ESTs C... 46 1.5 1 ( FG282842 ) 1108383360865 New World Screwworm Egg 9261 ESTs C... 46 1.5 1 ( FF..... 44 5.8 1 ( BB930387 ) Trifolium pratense cDNA clone:RCC02026. 44 5.8 1 ( FG296422 ) 1108793252569 New World... Screwworm Larvae 9387 EST... 44 5.8 1 ( FG284529 ) 1108770671713 New World Screwworm Egg 9261 ESTs C... 4
Dicty_cDB: Contig-U15176-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available m... 52 0.039 1 ( CX098067 ) EHAHG37TR E. histolytica Normalized cDNA library ... 52 0.039 1 ( CX097486 ) EHAH754TR E. histolytic...a Normalized cDNA library ... 52 0.039 1 ( CX097433 ) EHAH676TR E. histolytica Normalized cDNA library... ... 52 0.039 1 ( CX097412 ) EHAH643TR E. histolytica Normalized cDNA library... ... 52 0.039 1 ( CX097231 ) EHAH379TR E. histolytica Normalized cDNA library ... 52 0.039 1 ( CX...096775 ) EHAGX23TR E. histolytica Normalized cDNA library ... 52 0.039 1 ( CX096109 ) EHAGN19TR E. histolytica Normalized cDNA librar
Dicty_cDB: Contig-U03072-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available verselong Onychiurus arcticus d... 38 0.010 2 ( CF439672 ) EST676017 normalized cDNA library of ...ornis cDN... 68 8e-07 1 ( BU884919 ) R017H10 Populus root cDNA library Populus tremula... 68 8e-07 1 ( ...us dormant bud cDNA library Populus ... 60 2e-04 1 ( CK110478 ) N067A08 Populus bark cDNA library Populus tremul...04 1 ( BU887484 ) R062A08 Populus root cDNA library Populus tremula... 60 2e-04 1 ( BU880608 ) UM52TC12 Populus flower cDNA library...us tremula cambium cDNA library Po... 60 2e-04 1 ( BU819297 ) UA42BPA08 Populus tremula cambium cDNA library
The C. elegans VAPB homolog VPR-1 is a permissive signal for gonad development.
Cottee, Pauline A; Cole, Tim; Schultz, Jessica; Hoang, Hieu D; Vibbert, Jack; Han, Sung Min; Miller, Michael A
2017-06-15
VAMP/synaptobrevin-associated proteins (VAPs) contain an N-terminal major sperm protein domain (MSPd) that is associated with amyotrophic lateral sclerosis. VAPs have an intracellular housekeeping function, as well as an extracellular signaling function mediated by the secreted MSPd. Here we show that the C. elegans VAP homolog VPR-1 is essential for gonad development. vpr-1 null mutants are maternal effect sterile due to arrested gonadogenesis following embryo hatching. Somatic gonadal precursor cells and germ cells fail to proliferate fully and complete their respective differentiation programs. Maternal or zygotic vpr-1 expression is sufficient to induce gonadogenesis and fertility. Genetic mosaic and cell type-specific expression studies indicate that vpr-1 activity is important in the nervous system, germ line and intestine. VPR-1 acts in parallel to Notch signaling, a key regulator of germline stem cell proliferation and differentiation. Neuronal vpr-1 expression is sufficient for gonadogenesis induction during a limited time period shortly after hatching. These results support the model that the secreted VPR-1 MSPd acts at least in part on gonadal sheath cell precursors in L1 to early L2 stage hermaphrodites to permit gonadogenesis. © 2017. Published by The Company of Biologists Ltd.
Biofuels from pyrolysis in perspective: trade-offs between energy yields and soil-carbon additions.
Woolf, Dominic; Lehmann, Johannes; Fisher, Elizabeth M; Angenent, Largus T
2014-06-03
Coproduction of biofuels with biochar (the carbon-rich solid formed during biomass pyrolysis) can provide carbon-negative bioenergy if the biochar is sequestered in soil, where it can improve fertility and thus simultaneously address issues of food security, soil degradation, energy production, and climate change. However, increasing biochar production entails a reduction in bioenergy obtainable per unit biomass feedstock. Quantification of this trade-off for specific biochar-biofuel pathways has been hampered by lack of an accurate-yet-simple model for predicting yields, product compositions, and energy balances from biomass slow pyrolysis. An empirical model of biomass slow pyrolysis was developed and applied to several pathways for biochar coproduction with gaseous and liquid biofuels. Here, we show that biochar production reduces liquid biofuel yield by at least 21 GJ Mg(-1) C (biofuel energy sacrificed per unit mass of biochar C), with methanol synthesis giving this lowest energy penalty. For gaseous-biofuel production, the minimum energy penalty for biochar production is 33 GJ Mg(-1) C. These substitution rates correspond to a wide range of Pareto-optimal system configurations, implying considerable latitude to choose pyrolysis conditions to optimize for desired biochar properties or to modulate energy versus biochar yields in response to fluctuating price differentials for the two commodities.
Sabadosa, Kathryn A; Batalden, Paul B
2014-04-01
A quality healthcare system is coproduced by patients, families and healthcare professionals working interdependently to cocreate and codeliver care. Cystic fibrosis (CF) patients and families rely on healthcare professionals to provide the best possible care and timely, accurate information. They know that the care at home and in clinical settings needs to be seamless, using shared information and decisions. A parent's journey of better care begins with her son's diagnosis and moves to her involvement to improve the systems and processes of care for others. She reflects on this work and identifies five elements that contributed to the coproduction of improved care: (1) mental and emotional readiness to engage; (2) curiosity and the search for insight; (3) reframe challenges into opportunities for improvement; (4) listen and learn from everyone, bringing home what is relevant; and (5) personal participation. Joined with the reflections of an improvement scientist, they note that chronic care relies on informed, activated patients and prepared, proactive healthcare professionals working together and that it is more than 'patient-centric'. They propose a model for the coimprovement of systems of care.
A complex of cardiac cytochrome c1 and cytochrome c.
Chiang, Y L; Kaminsky, L S; King, T E
1976-01-10
The interactions of cytochrome c1 and cytochrome c from bovine cardiac mitochondria were investigated. Cytochrome c1 and cytochrome c formed a 1:1 molecular complex in aqueous solutions of low ionic strength. The complex was stable to Sephadex G-75 chromatography. The formation and stability of the complex were independent of the oxidation state of the cytochrome components as far as those reactions studied were concerned. The complex was dissociated in solutions of ionic strength higher than 0.07 or pH exceeding 10 and only partially dissociated in 8 M urea. No complexation occurred when cytochrome c was acetylated on 64% of its lysine residues or photooxidized on its 2 methionine residues. Complexes with molecular ratios of less than 1:1 (i.e. more cytochrome c) were obtained when polymerized cytochrome c, or cytochrome c with all lysine residues guanidinated, or a "1-65 heme peptide" from cyanogen bromide cleavage of cytochrome c was used. These results were interpreted to imply that the complex was predominantly maintained by ionic interactions probably involving some of the lysine residues of cytochrome c but with major stabilization dependent on the native conformations of both cytochromes. The reduced complex was autooxidizable with biphasic kinetics with first order rate constants of 6 X 10(-5) and 5 X U0(-5) s-1 but did not react with carbon monoxide. The complex reacted with cyanide and was reduced by ascorbate at about 32% and 40% respectively, of the rates of reaction with cytochrome c alone. The complex was less photoreducible than cytochrome c1 alone. The complex exhibited remarkably different circular dichroic behavior from that of the summation of cytochrome c1 plus cytochrome c. We concluded that when cytochromes c1 and c interacted they underwent dramatic conformational changes resulting in weakening of their heme crevices. All results available would indicate that in the complex cytochrome c1 was bound at the entrance to the heme crevice of
Directory of Open Access Journals (Sweden)
Miguel Ángel Alarcón García
2015-06-01
Full Text Available Fruit agribusinesses generate large amounts of byproductswith diverse characteristics that are inherent to the fruitsfrom which they come, which are a source of great use potentialbecause their compositions include molecules that are currentlyof high interest (antioxidants and dietary fiber. It is clear that,without correct handling and disposal, theses fruits present aproblem due to the environmental pollution that large quantitiesof residues can generate. Although there are varied uses for agroindustrialco-products, this review focused on the potential usesthat co-products could have in different processed food matrices.In this sense, this paper led to the revelation that one of theprincipal objectives of the reviewed research was to conditionco-products for use in processed foods in an attempt to takeadvantage of the bio-active compounds they contain, principallythe natural antioxidant activity, which especially enjoys acceptanceby consumers of processed foods.
Dicty_cDB: Contig-U16006-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ne 01 Psig64s-55C regio... 50 0.22 1 ( EU648429 ) Psiguria umbrosa clone 05 Psig6...4s-55C region geno... 50 0.22 1 ( EU648428 ) Psiguria umbrosa clone 04 Psig64s-55C region geno... 50 0.22 1 ( EU648427 ) Psiguri...a umbrosa clone 03 Psig64s-55C region geno... 50 0.22 1 ( EU648426 ) Psiguria umbrosa cl...one 02 Psig64s-55C region geno... 50 0.22 1 ( EU648425 ) Psiguria umbrosa clone 0...1 Psig64s-55C region geno... 50 0.22 1 ( EU648423 ) Psiguria pedata clone 07 Psig64s-55C region genom... 50
Dicty_cDB: Contig-U04737-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available se I (COI) gen... 44 5.8 1 ( AY225873 ) Lasius austriacus isolate Laus5COI cytoch...rome c o... 44 5.8 1 ( AY225872 ) Lasius austriacus isolate Laus4COI cytochrome c o... 44 5.8 1 ( AY225871 ) Lasius austria...cus isolate Laus3COI cytochrome c o... 44 5.8 1 ( AY225870 ) Lasius austriacus isolate Laus2C...OI cytochrome c o... 44 5.8 1 ( AY225869 ) Lasius austriacus isolate Laus1COI cytochrome c o... 44 5.8 1 ( A...9 ) Prenolepis imparis mitochondrial COI gene for cyt... 44 5.8 1 ( AB371009 ) Lasius austriacus mitochondri
Development of ASTM Standard for SiC-SiC Joint Testing Final Scientific/Technical Report
Energy Technology Data Exchange (ETDEWEB)
Jacobsen, George [General Atomics, San Diego, CA (United States); Back, Christina [General Atomics, San Diego, CA (United States)
2015-10-30
As the nuclear industry moves to advanced ceramic based materials for cladding and core structural materials for a variety of advanced reactors, new standards and test methods are required for material development and licensing purposes. For example, General Atomics (GA) is actively developing silicon carbide (SiC) based composite cladding (SiC-SiC) for its Energy Multiplier Module (EM2), a high efficiency gas cooled fast reactor. Through DOE funding via the advanced reactor concept program, GA developed a new test method for the nominal joint strength of an endplug sealed to advanced ceramic tubes, Fig. 1-1, at ambient and elevated temperatures called the endplug pushout (EPPO) test. This test utilizes widely available universal mechanical testers coupled with clam shell heaters, and specimen size is relatively small, making it a viable post irradiation test method. The culmination of this effort was a draft of an ASTM test standard that will be submitted for approval to the ASTM C28 ceramic committee. Once the standard has been vetted by the ceramics test community, an industry wide standard methodology to test joined tubular ceramic components will be available for the entire nuclear materials community.
Dicty_cDB: Contig-U15762-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 9 Root cold Pinus taeda cDNA c... 46 6.7 1 ( CO166910 ) FLD1_65_A02.g1_A029 Root flood...ed Pinus taeda cDNA... 46 6.7 1 ( CO161061 ) FLD1_26_H12.b1_A029 Root flooded Pinus taeda cDNA... 46 6.
Dicty_cDB: Contig-U14319-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ium discoideum cDNA clone:dda24i16, 3' ... 299 2e-77 1 ( DR934252 ) EST1125791 Aquilegia cDNA library Aquile...1.5 1 ( EB527188 ) 301633 Pigtailed macaque ovary library Macaca nem... 44 1.5 1 ( DY755095 ) 177840 Pigtailed macaque ovary library... Macaca nem... 44 1.5 1 ( DY753779 ) 179483 Pigtailed macaque ovary library Macaca n... anubis cDN... 44 1.5 1 ( EY285509 ) 1106514291549 03BABOON-C-01-1-3KB Papio anubis cD... 44 1.5 1 ( EU795295 ) Unculture...ve search space used: 26623730980 Neighboring words threshold: 12 Window for multiple hits: 40
Recent Developments of C-Aryl Glucoside SGLT2 Inhibitors.
Zhang, Yang; Liu, Zhao-Peng
2016-01-01
Sodium-glucose cotransporter 2 (SGLT2) is almost exclusively expressed in the proximal renal tubules. It is responsible for about 90% of the glucose reabsorption from tubular fluid. Selective inhibition of SGLT2 is expected to favor in the normalization of plasma glucose levels in T2DM patients through the prevention of renal glucose reabsorption and the promotion of glucose excretion from urine. Selective SGLT2 inhibitors have the merits to minimize the gastrointestinal side effects associated with SGLT1 inhibition, and selective SGLT2 inhibition may have a low risk of hypoglycemia. Since the C-aryl glucosides are metabolically more stable than the O-glucosides, numerous efforts have been made in the development of potent and selective C-aryl glucoside SGLT2 inhibitors, and a number of them are now used as anti-diabetes drugs in clinic or at various stages of clinical developments. Based on their structural features, in this review, these SGLT2 inhibitors are classified as three types: the phenyl/arylmethylphenyl C-glucosides, with an emphasis on the modifications on the proximal and/or the distal phenyl ring, and the spacer; the heteroarylmethylphenyl Cglucosides, with a replacement of the distal phenyl ring by a heterocycle like pyridazine, pyrimidine, thiophene and benzothiophene, thiazole, 1,3,4-thiadiazole, and triazolopyridinone; and the glucose-modified Caryl glucosides, including the glucose C-1 derived O-spiroketals, C-4 gem-difluoro analogues, C-5 and C-6 modified derivatives, dioxa-bicyclo[3.2.1]octane bridged ketals, the thioglucosides, and carbasugars. The structure-activity relationships (SARs) of each type along with their inhibitory potency against human SGLT2 and selectivity over human SGLT1 are discussed.
Dicty_cDB: Contig-U14913-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available FLD1_53_G01.g1_A029 Root flooded Pinus taeda cDNA... 50 0.16 1 ( CO165241 ) FLD1_53_G01.b1_A029 Root flooded... Pinus taeda cDNA... 50 0.16 1 ( CO163000 ) FLD1_38_G07.g1_A029 Root flooded Pinus taeda cDNA... 50 0.16 1 (... CO162917 ) FLD1_38_G07.b1_A029 Root flooded Pinus taeda cDNA... 50 0.16 1 ( CO15...9866 ) FLD1_16_B12.g1_A029 Root flooded Pinus taeda cDNA... 50 0.16 1 ( CO158395 ) FLD1_6_D06.g1_A029 Root flood
Dicty_cDB: Contig-U03890-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Mouse 10kb plasmid UUGC1M library Mus ... 42 1.9 2 ( CJ499454 ) Triticum aestivum cDNA clone whfl33j15 5', ...8 1 ( CC656540 ) OGWEY73TH ZM_0.7_1.5_KB Zea mays genomic clone ZM... 46 2.8 1 ( DW710040 ) EST033521 Trichophyton rubrum cDNA librar...y 8 Tric... 46 2.8 1 ( DW703138 ) EST026619 Trichophyton rubrum cDNA library... 7 Tric... 46 2.8 1 ( DW697470 ) EST020951 Trichophyton rubrum cDNA library 6 Tric... 46... 2.8 1 ( DW697281 ) EST020762 Trichophyton rubrum cDNA library 6 Tric... 46 2.8 1 ( DW691333 ) EST014814 Trichophyton rubrum cDNA lib
Dicty_cDB: Contig-U13418-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available cDNA 5', m... 44 1.5 1 ( EU795096 ) Uncultured bacterium ARCTIC31_H_08 genomic sequence. 44 1.5 1 ( CT57298...ited... 44 1.5 1 ( CF450667 ) EST687012 normalized cDNA library of onion Allium... 44 ...1.5 1 ( CF446303 ) EST682648 normalized cDNA library of onion Allium... 44 1.5 1 ( CF442290 ) EST678635 normalized cDNA library... of onion Allium... 44 1.5 1 ( CF441532 ) EST677877 normalized cDNA library..... 46 0.38 1 ( FH288047 ) CHO_OF4201xl16r1.ab1 CHO_OF4 Nicotiana tabacum ge... 46 0.38 1 ( DX581105 ) SBA003_M05.f Sugar beet BAC lib
Preparation of no-carrier-added [1-11C]ethylene and [1-11C]1,2-dibromoethane as new labelling agents
International Nuclear Information System (INIS)
Shah, F.; Pike, V.W.; Dowsett, K.
1997-01-01
A method is described for the preparation of NCA [1- 11 C] ethylene based on the passage of [1- 11 C]ethanol over heated (550 o C) quartz glass in a stainless steel tube (in preference to dehydration by catalysis on γ-alumina or pyrolysis). The [1- 11 C]ethanol is prepared from cyclotron-produced NCA [ 11 C]carbon dioxide by 11 C-carboxylation of methylmagnesium bromide, freshly prepared in dibutyl ether, and reduction of the adduct with lithium aluminium hydride in diglyme. The use of involatile solvents avoids the formation of carrier ethylene and radioactive and stable diethyl ether by cracking processes over the heated catalyst. The preparation takes 21 min from the end of radionuclide production and has a radiochemical yield of 44%, decay-corrected from [ 11 C]carbon dioxide. NCA [1- 11 C] ethylene is converted quantitatively into [1- 11 C]1,2-dibromoethane when collected in a solution of bromine in carbon tetrachloride. The NCA [1- 11 C]ethylene and [1- 11 C]1,2-dibromoethane may serve as new and useful labelling agents. (Author)
Dicty_cDB: Contig-U15640-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available -15 3 ( EX266810 ) 1447411_5_I01_007 PY06 Carica papaya cDNA, mRNA s... 86 4e-15 3 ( EX123475 ) BR107305 mature green leaf cDNA libra....2 1 ( CN487418 ) EST2064 Puccinellia tenuiflora cDNA library Pucci... 48 1.2 1 ( CJ870341 ) Triticu...m cDNA, RIKEN fu... 44 2.2 2 ( CB283146 ) BT1417 Blomia tropicalis cDNA library Blomia trop... 40 2.4 2 ( AB174436 ) Macaca fascicul...malized ... 62 1e-08 2 ( CK265529 ) EST711607 potato abiotic stress cDNA library Sola... 62 1e-08 2 ( DV6022...45C09.g Maize Endosperm cDNA Library Zea ... 56 2e-07 4 ( CK259915 ) EST705993 potato abiotic stress cDNA library
Directory of Open Access Journals (Sweden)
Katri Kantojärvi
Full Text Available Genetic variants in CACNA1C (calcium voltage-gated channel subunit alpha1 C are associated with bipolar disorder and schizophrenia where sleep disturbances are common. In an experimental model, Cacna1c has been found to modulate the electrophysiological architecture of sleep. There are strong genetic influences for consolidation of sleep in infancy, but only a few studies have thus far researched the genetic factors underlying the process. We hypothesized that genetic variants in CACNA1C affect the regulation of sleep in early development. Seven variants that were earlier associated (genome-wide significantly with psychiatric disorders at CACNA1C were selected for analyses. The study sample consists of 1086 infants (520 girls and 566 boys from the Finnish CHILD-SLEEP birth cohort (genotyped by Illumina Infinium PsychArray BeadChip. Sleep length, latency, and nightly awakenings were reported by the parents of the infants with a home-delivered questionnaire at 8 months of age. The genetic influence of CACNA1C variants on sleep in infants was examined by using PLINK software. Three of the examined CACNA1C variants, rs4765913, rs4765914, and rs2239063, were associated with sleep latency (permuted P<0.05. There was no significant association between studied variants and night awakenings or sleep duration. CACNA1C variants for psychiatric disorders were found to be associated with long sleep latency among 8-month-old infants. It remains to be clarified whether the findings refer to defective regulation of sleep, or to distractibility of sleep under external influences.
Dicty_cDB: Contig-U05633-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ) PUHQF14TD ZM_0.6_1.0_KB Zea mays genomic clone ZM... 46 1.9 1 ( EC770709 ) EST 7205 Guarana fruits cDNA library Paullinia cu...o... 44 7.7 1 ( BM027318 ) GIT0000656 Root-induced cDNA library from Glomus ... 44 7.7 1 ( BJ427410 ) Dic...ble cien cDNA librar... 50 0.12 1 ( EW965375 ) BRHL_03_O01_T7 Headlice composite library... DN564657 ) 90838967 Sea Urchin primary mesenchyme cell cDNA ... 46 1.9 1 ( CN845958 ) PG07006A08 Ginseng cDNA library from MeJA tre... BF648097 ) NF044C02EC1F1017 Elicited cell culture Medicago t... 44 7.7 1 ( BF646377 ) NF071B12EC1F1096 Elicited cell culture Medic
Dicty_cDB: Contig-U03814-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available G289388 ) 1108793297216 New World Screwworm Egg 9261 ESTs C... 48 0.73 1 ( FG288537 ) 1108793272303 New World... Screwworm Egg 9261 ESTs C... 48 0.73 1 ( FG286738 ) 1108770726045 New World Screwworm Egg 9261 ESTs C... 4...8 0.73 1 ( FG286433 ) 1108770714983 New World Screwworm Egg 9261 ESTs C... 48 0.73 1 ( FG285121 ) 1108770693863 New World... Screwworm Egg 9261 ESTs C... 48 0.73 1 ( FG284171 ) 1108770658410 New World
Dicty_cDB: Contig-U16464-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available cl... 50 0.24 1 ( EB271624 ) CNSN27-F-039516-501 Normalized CNS library (adult... 50 0.24 1 ( DV670546 ) Ss_...375 ) EHAHZ40TR E. histolytica Normalized cDNA library ... 50 0.24 1 ( CX099243 ) EHAHX28TR E. histolytica Normalized cDNA library... ... 50 0.24 1 ( CX099239 ) EHAHX24TR E. histolytica Normalized cDNA library ... 50 0....24 1 ( CX099231 ) EHAHX14TR E. histolytica Normalized cDNA library ... 50 0.24 1 ( CX099215 ) EHAHW92TR E. histolytic...a Normalized cDNA library ... 50 0.24 1 ( CX099052 ) EHAHU47TR E. histolytica Normalized cDNA lib
Dicty_cDB: Contig-U01201-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available DT573931 ) EST1084571 GH_TMO Gossypium hirsutum cDNA, mRNA s... 46 2.3 1 ( DR026249 ) Osmo00116 F. cylindrus osmotic stress library...67 ) Glycine max cDNA clone: GMFL01-28-N10, 3'end. 44 9.0 1 ( BU869818 ) Q004H08 Populus flower cDNA library Populus tric...Lib... 46 2.3 1 ( DU120744 ) KBrH113B12F Brassica rapa BAC library KBrH Brassi......... 46 2.3 1 ( CB285041 ) DF1898 Dermatophagoides farinae cDNA library Derm... 46 2.3 1 ( C25513 ) Dic...rary Ictalurus... 44 9.0 1 ( CF230535 ) PtaC0009E5E0509 Poplar cDNA library from ca
A1c Gear: Laboratory quality HbA1c measurement at the point of care.
Ejilemele, Adetoun; Unabia, Jamie; Ju, Hyunsu; Petersen, John R
2015-05-20
HbA1c is an important part of assessing the diabetic control and since the use of point-of-care devices for monitoring HbA1c is increasing, it is important to determine how these devices compare to the central laboratory. One hundred and twenty patient samples were analyzed on the Bio-Rad Variant™II and one POC analyzer (Sakae A1c Gear). Three patient sample pools containing ~5%, ~7%, and ~10% HbA1c levels were run over 20 days. Three reagent lots and three instruments were evaluated for the A1c Gear. The 120 patient samples showed strong correlation (R(2)>0.989) when compared to the Variant™II with means=8.06% and 7.81%, for Variant IIand A1c Gear, respectively. Changing reagent lots or instruments had no impact for the A1c Gear. The ~5%, ~7%, and ~10% pools within-run and between-run imprecision was between 0.87-1.33% and 1.03-1.32%, and 1.41-2.35% and 1.24-1.89% with total imprecision of 1.67-2.35% and 1.61-2.31% for the A1c Gear and Variant II, respectively. The A1c Gear showed a small negative bias (0.25% HbA1c) across HbA1c measurement ranges of Gear meets the criteria of total CV Gear can give results as precise as the laboratory at the POC. Copyright © 2015. Published by Elsevier B.V.
Dicty_cDB: Contig-U06251-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ary KHOS Bras... 44 6.6 1 ( EX125160 ) BR108990 mature green leaf cDNA library KHLM... Bras... 44 6.6 1 ( EX125065 ) BR108895 mature green leaf cDNA library KHLM Bras...... 44 6.6 1 ( EX124775 ) BR108605 mature green leaf cDNA library KHLM Bras... 44 6.6 1 ( EX124282 ) BR108112 mature gre...en leaf cDNA library KHLM Bras... 44 6.6 1 ( EX124178 ) BR108008 mature green leaf cDNA library K...HLM Bras... 44 6.6 1 ( EX124044 ) BR107874 mature green leaf cDNA library KHLM Br
Cai, Yitian; Teo, Boon Heng Dennis; Yeo, Joo Guan; Lu, Jinhua
2015-09-11
In infection, complement C1q recognizes pathogen-congregated antibodies and elicits complement activation. Among endogenous ligands, C1q binds to DNA and apoptotic cells, but whether C1q binds to nuclear DNA in apoptotic cells remains to be investigated. With UV irradiation-induced apoptosis, C1q initially bound to peripheral cellular regions in early apoptotic cells. By 6 h, binding concentrated in the nuclei to the nucleolus but not the chromatins. When nucleoli were isolated from non-apoptotic cells, C1q also bound to these structures. In vivo, C1q exists as the C1 complex (C1qC1r2C1s2), and C1q binding to ligands activates the C1r/C1s proteases. Incubation of nucleoli with C1 caused degradation of the nucleolar proteins nucleolin and nucleophosmin 1. This was inhibited by the C1 inhibitor. The nucleoli are abundant with autoantigens. C1q binding and C1r/C1s degradation of nucleolar antigens during cell apoptosis potentially reduces autoimmunity. These findings help us to understand why genetic C1q and C1r/C1s deficiencies cause systemic lupus erythematosus. © 2015 by The American Society for Biochemistry and Molecular Biology, Inc.
Energy Technology Data Exchange (ETDEWEB)
Chevrot, A [Service de Radiologie B, Hopital Cochin, 75 - Paris (France); Cermakova, E [Service de Radiologie B, Hopital Cochin, 75 - Paris (France); Vallee, C [Service de Radiologie B, Hopital Cochin, 75 - Paris (France); Chancelier, M D [Service de Radiologie B, Hopital Cochin, 75 - Paris (France); Chemla, N [Service de Radiologie B, Hopital Cochin, 75 - Paris (France); Rousselin, B [Service de Radiologie B, Hopital Cochin, 75 - Paris (France); Langer-Cherbit, A [Service de Radiologie B, Hopital Cochin, 75 - Paris (France)
1995-08-01
One hundred patients with the following conditions were studied: cervical pain or neuralgia without radiographic changes, osteoarthritis, rheumatoid arthritis, ankylosing spondylarthritis and diverse conditions. The technique consists of lateral puncture of the posterior aspect of the C1-2 joint with a 20-gauge needle under fluoroscopic control, arthrography using 1 ml contrast medium, and a 1-ml long-acting steroid injection subsequently. The articular cavity has an anterior and a posterior recess. Sometimes the posterior recess is large. In 18% of cases the contralateral joint also opacifies. C1-2 arthrography appears to be an efficient and safe technique for the treatment of upper cervical pain due to C1-2 articular disorders. (orig.)
International Nuclear Information System (INIS)
Chevrot, A.; Cermakova, E.; Vallee, C.; Chancelier, M.D.; Chemla, N.; Rousselin, B.; Langer-Cherbit, A.
1995-01-01
One hundred patients with the following conditions were studied: cervical pain or neuralgia without radiographic changes, osteoarthritis, rheumatoid arthritis, ankylosing spondylarthritis and diverse conditions. The technique consists of lateral puncture of the posterior aspect of the C1-2 joint with a 20-gauge needle under fluoroscopic control, arthrography using 1 ml contrast medium, and a 1-ml long-acting steroid injection subsequently. The articular cavity has an anterior and a posterior recess. Sometimes the posterior recess is large. In 18% of cases the contralateral joint also opacifies. C1-2 arthrography appears to be an efficient and safe technique for the treatment of upper cervical pain due to C1-2 articular disorders. (orig.)
Dicty_cDB: Contig-U04605-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available . 46 2.2 1 ( DB766622 ) Apis mellifera head cDNA, RIKEN full-length enric... 46 2.2 1 ( FG291142 ) 1108793330728 New World... Screwworm Egg 9261 ESTs C... 46 2.2 1 ( FG290464 ) 1108793321772 New World... Screwworm Egg 9261 ESTs C... 46 2.2 1 ( FG288754 ) 1108793276247 New World Screwworm Egg 9261 ESTs ...C... 46 2.2 1 ( FG285961 ) 1108770710727 New World Screwworm Egg 9261 ESTs C... 46 2.2 1 ( CT030663 ) Mouse ..._142_D08_3APR2008_058 BN18DYSC Brassic... 44 8.7 1 ( FG286796 ) 1108770726415 New World
1983-01-01
Grumman OV-1C in the hangar used at the time by the Army at Edwards Air Force Base. This OV-1C Mohawk, serial #67-15932, was used in a joint NASA/US Army Aviation Engineering Flight Activity (USAAEFA) program to study a stall-speed warning system in the early 1980s. NASA designed and built an automated stall-speed warning system which presented both airspeed and stall speed to the pilot. Visual indication of impending stall would be displayed to the pilot as a cursor or pointer located on a conventional airspeed indicator. In addition, an aural warning at predetermined stall margins was presented to the pilot through a voice synthesizer. The Mohawk was developed by Grumman Aircraft as a photo observation and electronic reconnaissance aircraft for the US Marines and the US Army. The OV-1 entered production in October 1959 and served the US Army in Europe, Korea, the Viet Nam War, Central and South America, Alaska, and during Desert Shield/Desert Storm in the Middle East. The Mohawk was retired from service in September 1996. 133 OV-1Cs were built, the 'C' designating the model which used an IR (infrared) imaging system to provide reconnaissance.
Dicty_cDB: Contig-U01290-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available e-04 1 ( BM029238 ) IpSkn00175 Skin cDNA library Ictalurus punctatus ... 56 7e-04 1 ( BI666490 ) 603288778F1 NCI_CGAP_Mam6 Mus muscul...16950 ) AUF_IpInt_55_a23 Intestine cDNA library Ictalurus... 58 2e-04 1 ( CJ376167 ) Molgula tecti...6460 ) AUF_IpInt_52_l18 Intestine cDNA library Ictalurus... 56 7e-04 1 ( CK414496 ) AUF_IpGil_08_d16 Ictalurus punctatu..... 60 4e-05 1 ( CK425973 ) AUF_IpTes_23_o24 Testis cDNA library Ictalurus pu... 6...us pun... 56 7e-04 1 ( CK418081 ) AUF_IpInt_58_c01 Intestine cDNA library Ictalurus... 56 7e-04 1 ( CK41
Dicty_cDB: Contig-U04444-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 5004 ) sat05c04.y1 Gm-c1036 Glycine max cDNA clone SOYBE... 52 0.025 1 ( BU894001 ) P085G03 Populus petioles cDNA library Popul...s cDNA, RIKEN full-l... 52 0.025 1 ( CF870513 ) tric023xm17.b1 T.reesei mycelial culture, Versio...n... 52 0.025 1 ( CF869757 ) tric020xf11.b1 T.reesei mycelial culture, Version... 52 0.025 1 ( CF867854 ) tric012xm19.b1 T.re...esei mycelial culture, Version... 52 0.025 1 ( CF867232 ) tric010xg18.b1 T.re...esei mycelial culture, Version 3 ... 52 0.025 1 ( CB899903 ) tric020xf11 T.reesei mycelial culture
Incontro, Salvatore; Ciruela, Francisco; Ziff, Edward; Hofmann, Franz; Sánchez-Prieto, José; Torres, Magdalena
2014-01-01
Trafficking of α-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid receptors (AMPARs) is regulated by specific interactions with other proteins and by post-translational mechanisms, such as phosphorylation. We have found that the type II cGMP-dependent protein kinase (cGKII) phosphorylates GluA1 (formerly GluR1) at S845, augmenting the surface expression of AMPARs at both synaptic and extrasynaptic sites. Activation of cGKII by 8-Br-cGMP enhances the surface expression of GluA1, whereas its inhibition or suppression effectively diminished the expression of this protein at the cell surface. In granule cells, NMDA receptor activation (NMDAR) stimulates nitric oxide and cGMP production, which in turn activates cGKII and induces the phosphorylation of GluA1, promoting its accumulation in the plasma membrane. GluA1 is mainly incorporated into calcium permeable AMPARs as exposure to 8-Br-cGMP or NMDA activation enhanced AMPA-elicited calcium responses that are sensitive to NASPM inhibition. We summarize evidence for an increase of calcium permeable AMPA receptors downstream of NMDA receptor activation that might be relevant for granule cell development and plasticity. PMID:23545413
Dicty_cDB: Contig-U03055-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available -67 2 ( FG284490 ) 1108770671670 New World Screwworm Egg 9261 ESTs C... 143 7e-67... 3 ( FG286862 ) 1108770727001 New World Screwworm Egg 9261 ESTs C... 143 9e-67 3 ( FG284489 ) 1108770671669 New World...ld Screwworm Egg 9261 ESTs C... 143 1e-66 3 ( FG286245 ) 1108770714398 New World... Screwworm Egg 9261 ESTs C... 143 1e-66 3 ( FG290225 ) 1108793315348 New World Screw...T1 Hydractinia echinata cD... 147 1e-64 4 ( FG285211 ) 1108770694495 New World Screwworm Egg 9261 ESTs C...
Development of SiC/SiC composite for fusion application
International Nuclear Information System (INIS)
Kohyama, A.; Katoh, Y.; Snead, L.L.; Jones, R.H.
2001-01-01
The recent efforts to develop SiC/SiC composite materials for fusion application under the collaboration with Japan and the USA are provided, where material performance with and without radiation damage has been greatly improved. One of the accomplishments is development of the high performance reaction sintering process. Mechanical and thermal conductivity are improved extensively by process modification and optimization with inexpensive fabrication process. The major efforts to make SiC matrix by CVI, PIP and RS methods are introduced together with the representing baseline properties. The resent results on mechanical properties of SiC/SiC under neutron irradiation are quite positive. The composites with new SiC fibers, Hi-Nicalon Type-S, did not exhibit mechanical property degradation up to 10 dpa. Based on the materials data recently obtained, a very preliminary design window is provided and the future prospects of SiC/SiC technology integration is provided. (author)
Energy Technology Data Exchange (ETDEWEB)
Dagle, Robert A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Dagle, Vanessa [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Bearden, Mark D. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Holladay, Jamelyn D. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Krause, Theodore R. [Argonne National Lab. (ANL), Argonne, IL (United States); Ahmed, Shabbir [Argonne National Lab. (ANL), Argonne, IL (United States)
2017-11-16
This report was prepared in response to the U.S. Department of Energy Fuel Cell Technologies Office Congressional Appropriation language to support research on carbon-free production of hydrogen using new chemical processes that utilize natural gas to produce solid carbon and hydrogen. The U.S. produces 9-10 million tons of hydrogen annually with more than 95% of the hydrogen produced by steam-methane reforming (SMR) of natural gas. SMR is attractive because of its high hydrogen yield; but it also converts the carbon to carbon dioxide. Non-oxidative thermal decomposition of methane to carbon and hydrogen is an alternative to SMR and produces CO2-free hydrogen. The produced carbon can be sold as a co-product, thus providing economic credit that reduces the delivered net cost of hydrogen. The combination of producing hydrogen with potentially valuable carbon byproducts has market value in that this allows greater flexibility to match the market prices of hydrogen and carbon. That is, the higher value product can subsidize the other in pricing decisions. In this report we highlight the relevant technologies reported in the literature—primarily thermochemical and plasma conversion processes—and recent research progress and commercial activities. Longstanding technical challenges include the high energetic requirements (e.g., high temperatures and/or electricity requirements) necessary for methane activation and, for some catalytic processes, the separation of solid carbon product from the spent catalyst. We assess current and new carbon product markets that could be served given technological advances, and we discuss technical barriers and potential areas of research to address these needs. We provide preliminary economic analysis for these processes and compare to other emerging (e.g., electrolysis) and conventional (e.g., SMR) processes for hydrogen production. The overarching conclusion of this study is that the cost of hydrogen can be potentially
Dicty_cDB: Contig-U16461-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available c... 50 0.22 1 ( FG297572 ) 1108793288739 New World Screwworm Larvae 9387 EST... 50 0.22 1 ( FG296279 ) 1108770747330 New World... Screwworm Larvae 9387 EST... 50 0.22 1 ( FG290052 ) 1108793314234 New World Screwworm Eg...g 9261 ESTs C... 50 0.22 1 ( FG289324 ) 1108793295697 New World Screwworm Egg 926...1 ESTs C... 50 0.22 1 ( FG287245 ) 1108770736013 New World Screwworm Egg 9261 ESTs C... 50 0.22 1 ( FG284095 ) 1108770655912 New Worl...JBVS8_S9... 38 4.2 2 ( FG286198 ) 1108770714057 New World Screwworm Egg 9261 ESTs C... 40 4.3 2 ( DQ249178 )
Vargas-Alarcón, Gilberto; Cruz-López, Miguel; Valladares, Adán; Álvarez-León, Edith; Juárez-Cedillo, Teresa; Pérez-Méndez, Óscar; de-la-Peña, Jorge Escobedo; Escobedo, Galileo; Fragoso, Jose Manuel
2015-11-01
Silent myocardial ischemia (SMI) is a multifactorial and polygenic disorder that results from an excessive inflammatory response. Considering the prominent role of IL-1β, IL-1F10 and IL-1RN as regulators of the inflammatory process and vascular physiology, the aim of the present study was to analyze whether IL-1β, IL-1F10 and IL-1RN single nucleotide polymorphisms (SNPs) are associated with SMI. One polymorphism was associated with risk of SMI. Under co-dominant, recessive and additive models, the IL-1β-511 T>C polymorphism was associated with increased risk of SMI when compared to healthy controls (OR=4.68, 95%CI=2.21-9.92, pCCo-dom=0.0048; OR=3.97, 95%CI=1.97-7.99, pCRec=0.0024; OR=2.02, 95%CI=1.41-2.90, pCAdd=0.0024, respectively). All models were adjusted for gender, age and smoking. Linkage disequilibrium analysis showed four haplotypes (CTCC, CCTC, CCCT and CTCC) with increased frequency in SMI patients when compared to healthy controls (OR=2.53, 95%CI=1.47-4.36, pC=0.0009, OR=2.34, 95%CI=1.15-4.74, pC=0.02, OR=2.44, 95%CI=1.14-5.18, pC=0.02, OR=5.11, 95%CI=1.37-19.05, pC=0.01, respectively). In summary, our data suggest that the IL-1β-511 T>C polymorphism plays an important role in the development of SMI in diabetic patients. In addition, in our study was possible to distinguish one protective and four risk haplotypes for development of SMI. Copyright © 2015 Elsevier B.V. All rights reserved.
Dicty_cDB: Contig-U12612-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ... 50 2e-14 5 ( DW406140 ) EST000561 Trichophyton rubrum cDNA library Tricho... 50 2e-14 5 ( C... CAPH Naegleria gruberi amoeba stage ... 48 2e-15 6 ( DW703626 ) EST027107 Trichophyton rubrum cDNA library 7 Tric...... 50 7e-15 5 ( DW405704 ) EST000125 Trichophyton rubrum cDNA library Tric...ho... 50 1e-14 5 ( DW683765 ) EST007246 Trichophyton rubrum cDNA library 1 Tric... 50 1e-14 5 ( DW678803 ) EST002284 Tric...hophyton rubrum cDNA library 0 Tric... 50 1e-14 5 ( DW697736 ) EST021217 Trichophyton rubrum cDNA library 6 Tric
Dicty_cDB: Contig-U05935-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available MOF-029C10, gen... 42 5.6 1 ( CT497775 ) A BAC library has been constructed from cultivar ... 42 5.6 1 ( CC2...... 42 5.6 1 ( CK278923 ) EST725001 potato abiotic stress cDNA library Sola... 42... 5.6 1 ( CK276546 ) EST722624 potato abiotic stress cDNA library Sola... 42 5.6 1 ( CK256717 ) EST740354 potato callus cDNA library...14 ) GR_Sa0007H24.b1 Gossypium raimondii WGS library G... 42 5.6 1 ( DU663768 ) OG_ABa0072K07.r OG_ABa Oryza granulata genomic...) Macropus eugenii clone ME_KBa-598C23, WORKING DRA... 42 5.6 1 ( AY714860 ) Unculture
Presence and biological activity of antibiotics used in fuel ethanol and corn co-product production.
Compart, D M Paulus; Carlson, A M; Crawford, G I; Fink, R C; Diez-Gonzalez, F; Dicostanzo, A; Shurson, G C
2013-05-01
Antibiotics are used in ethanol production to control bacteria from competing with yeast for nutrients during starch fermentation. However, there is no published scientific information on whether antibiotic residues are present in distillers grains (DG), co-products from ethanol production, or whether they retain their biological activity. Therefore, the objectives of this study were to quantify concentrations of various antibiotic residues in DG and determine whether residues were biologically active. Twenty distillers wet grains and 20 distillers dried grains samples were collected quarterly from 9 states and 43 ethanol plants in the United States. Samples were analyzed for DM, CP, NDF, crude fat, S, P, and pH to describe the nutritional characteristics of the samples evaluated. Samples were also analyzed for the presence of erythromycin, penicillin G, tetracycline, tylosin, and virginiamycin M1, using liquid chromatography and mass spectrometry. Additionally, virginiamycin residues were determined, using a U.S. Food and Drug Administration-approved bioassay method. Samples were extracted and further analyzed for biological activity by exposing the sample extracts to 10(4) to 10(7) CFU/mL concentrations of sentinel bacterial strains Escherichia coli ATCC 8739 and Listeria monocytogenes ATCC 19115. Extracts that inhibited bacterial growth were considered to have biological activity. Physiochemical characteristics varied among samples but were consistent with previous findings. Thirteen percent of all samples contained low (≤1.12 mg/kg) antibiotic concentrations. Only 1 sample extract inhibited growth of Escherichia coli at 10(4) CFU/mL, but this sample contained no detectable concentrations of antibiotic residues. No extracts inhibited Listeria monocytogenes growth. These data indicate that the likelihood of detectable concentrations of antibiotic residues in DG is low; and if detected, they are found in very low concentrations. The inhibition in only 1 DG
Directory of Open Access Journals (Sweden)
Weiya ZHANG,Wei WEI,Yuanyuan ZHAO,Shuhong ZHAO,Xinyun LI
2015-12-01
Full Text Available Previous studies indicated that miR-29c is important for muscle development in mice and human, but its role in pigs is unknown. In this study, we detected the expression of miR-29c in Meishan longissimus lumborum (LL muscle. The results showed that miR-29c was gradually upregulated during development of skeletal muscle in pig. Moreover, the expression of YY1 and Akt3 genes, which were confirmed to be targeted by miR-29c in mice, was decreased along with muscle development. Furthermore, the expression level of miR-29c was significantly higher in adult Meishan pigs than Large White pigs, while the expression of YY1 and Akt3 genes was significantly lower in Meishan pigs. These results indicated that the expression pattern of miR-29c was opposite to that of YY1 and Akt3 genes in pigs. Also, the luciferase assay indicated that miR-29s can target the YY1 gene in pigs. In addition, we identified a T to C mutation in the primary transcript of miR-29c, which was associated with the postmortem muscle pH in pigs. Based on these results, we concluded that miR-29c is also important in skeletal muscle development of pigs.
Dicty_cDB: Contig-U12014-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 4 1 ( CB395139 ) OSTR149E1_1 AD-wrmcDNA Caenorhabditis elegans cDN... 60 3e-04 1 ( DY584025 ) C017-D11 Acropora millepora presettleme...nt library... 58 0.001 1 ( CJ336144 ) Molgula tectiformis cDNA, embryo just before
Redmile-Gordon, Marc A.; Evershed, Richard P.; Kuhl, Alison; Armenise, Elena; White, Rodger P.; Hirsch, Penny R.; Goulding, Keith W.T.; Brookes, Philip C.
2015-01-01
Biodiesel Co-Product (BCP) is a complex organic material formed during the transesterification of lipids. We investigated the effect of BCP on the extracellular microbial matrix or ‘extracellular polymeric substance’ (EPS) in soil which is suspected to be a highly influential fraction of soil organic matter (SOM). It was hypothesised that more N would be transferred to EPS in soil given BCP compared to soil given glycerol. An arable soil was amended with BCP produced from either 1) waste vegetable oils or 2) pure oilseed rape oil, and compared with soil amended with 99% pure glycerol; all were provided with 15N labelled KNO3. We compared transfer of microbially assimilated 15N into the extracellular amino acid pool, and measured concomitant production of exopolysaccharide. Following incubation, the 15N enrichment of total hydrolysable amino acids (THAAs) indicated that intracellular anabolic products had incorporated the labelled N primarily as glutamine and glutamate. A greater proportion of the amino acids in EPS were found to contain 15N than those in the THAA pool, indicating that the increase in EPS was comprised of bioproducts synthesised de novo. Moreover, BCP had increased the EPS production efficiency of the soil microbial community (μg EPS per unit ATP) up to approximately double that of glycerol, and caused transfer of 21% more 15N from soil solution into EPS-amino acids. Given the suspected value of EPS in agricultural soils, the use of BCP to stimulate exudation is an interesting tool to consider in the theme of delivering sustainable intensification. PMID:26635420
Dicty_cDB: Contig-U16238-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 5I14R Mouse 10kb plasmid UUGC2M library Mus ... 46 2.0 1 ( AZ954756 ) 2M0220N05R Mouse 10kb plasmid UUGC2M library...... 46 2.0 1 ( DT769112 ) EST1202962 Aquilegia cDNA library Aqui...legia formo... 46 2.0 1 ( DT765721 ) EST1199570 Aquilegia cDNA library Aquilegia formo... 46 2.0 1 ( DT76040...9 ) EST1194258 Aquilegia cDNA library Aquilegia formo... 46 2.0 1 ( DT753653 ) EST1187502 Aquilegia cDNA library... Aquilegia formo... 46 2.0 1 ( DR922919 ) EST1114458 Aquilegia cDNA library Aquilegia formo... 46 2.0 1
Dicty_cDB: Contig-U05908-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available uilegia formo... 44 4.4 1 ( DR944473 ) EST1136012 Aquilegia cDNA library Aquilegia formo... 44 4.4 1 >( AU261433 ) Dic...i strain CBS... 46 4e-04 AM114193_389( AM114193 |pid:none) Uncultured methanogenic archaeon... 46 5e-04 CP00... SP6 en... 44 4.4 1 ( DT754699 ) EST1188548 Aquilegia cDNA library Aquilegia formo... 44 4.4 1 ( DT748890 ) ...EST1182739 Aquilegia cDNA library Aquilegia formo... 44 4.4 1 ( DT743646 ) EST1177495 Aquilegia cDNA library... Aquilegia formo... 44 4.4 1 ( DT742533 ) EST1176382 Aquilegia cDNA library Aquil
Energy Technology Data Exchange (ETDEWEB)
Porwoll, J P; Leete, E [Minnesota Univ., Minneapolis (USA). Dept. of Chemistry
1985-03-01
Potential advanced intermediates in the biosynthesis of delta/sup 9/-tetrahydrocannabinol, the major psychoactive principle of marijuana, have been synthesized labeled with two contiguous /sup 13/C atoms and /sup 14/C. Methyl (5,6-/sup 13/C/sub 2/, 1-/sup 14/C)olivetolate was prepared from lithium (/sup 13/C/sub 2/)acetylide and dimethyl (2-/sup 14/C)malonate. Reaction with geranyl bromide afforded methyl (5,6-/sup 13/C/sub 2/, 1-/sup 14/C)cannabigerolate, and hydrolysis of these methyl esters with lithium propyl mercaptide yielded the corresponding labeled acids. The /sup 13/C-/sup 13/C couplings observable in the /sup 13/C NMR spectra of these /sup 13/C-enriched compounds and their synthetic precursors are recorded. Methyl (1'-/sup 14/C)olivetolate was prepared from /sup 13/CO/sub 2/ to confirm assignments of the /sup 13/C chemical shifts in the pentyl side chain of these compounds.
Beyond toxicity: a regulatory role for mitochondrial cyanide.
García, Irene; Gotor, Cecilia; Romero, Luis C
2014-01-01
In non-cyanogenic plants, cyanide is a co-product of ethylene and camalexin biosynthesis. To maintain cyanide at non-toxic levels, Arabidopsis plants express the mitochondrial β-cyanoalanine synthase CYS-C1. CYS-C1 knockout leads to an increased level of cyanide in the roots and leaves and a severe defect in root hair morphogenesis, suggesting that cyanide acts as a signaling factor in root development. During compatible and incompatible plant-bacteria interactions, cyanide accumulation and CYS-C1 gene expression are negatively correlated. Moreover, CYS-C1 mutation increases both plant tolerance to biotrophic pathogens and their susceptibility to necrotrophic fungi, indicating that cyanide could stimulate the salicylic acid-dependent signaling pathway of the plant immune system. We hypothesize that CYS-C1 is essential for maintaining non-toxic concentrations of cyanide in the mitochondria to facilitate cyanide's role in signaling.
Dicty_cDB: Contig-U12697-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ebrafish DNA sequence from clone BUSM1-21A14 in ... 40 1.7 3 ( AY781284 ) Human rotavirus C strain V460 nons...tructural prote... 46 1.9 1 ( AY781283 ) Human rotavirus C strain V966 nonstructural prote... 46 1.9 1 ( AY770979 ) Human rotavirus... C strain v508 nonstructural prote... 46 1.9 1 ( AJ132205 ) Human rotavirus
Masloff, S; Pöggeler, S; Kück, U
1999-05-01
During sexual morphogenesis, the filamentous ascomycete Sordaria macrospora differentiates into multicellular fruiting bodies called perithecia. Previously it has been shown that this developmental process is under polygenic control. To further understand the molecular mechanisms involved in fruiting body formation, we generated the protoperithecia forming mutant pro1, in which the normal development of protoperithecia into perithecia has been disrupted. We succeeded in isolating a cosmid clone from an indexed cosmid library, which was able to complement the pro1(-) mutation. Deletion analysis, followed by DNA sequencing, subsequently demonstrated that fertility was restored to the pro1 mutant by an open reading frame encoding a 689-amino-acid polypeptide, which we named PRO1. A region from this polypeptide shares significant homology with the DNA-binding domains found in fungal C6 zinc finger transcription factors, such as the GAL4 protein from yeast. However, other typical regions of C6 zinc finger proteins, such as dimerization elements, are absent in PRO1. The involvement of the pro1(+) gene in fruiting body development was further confirmed by trying to complement the mutant phenotype with in vitro mutagenized and truncated versions of the pro1 open reading frame. Southern hybridization experiments also indicated that pro1(+) homologues are present in other sexually propagating filamentous ascomycetes.
Cheirsilp, Benjamas; Suksawang, Suwannee; Yeesang, Jarucha; Boonsawang, Piyarat
2018-01-01
Kefiran is a functional exopolysaccharide produced by Lactobacillus kefiranofaciens originated from kefir, traditional fermented milk in the Caucasian Mountains, Russia. Kefiran is attractive as thickeners, stabilizers, emulsifiers, gelling agents and also has antimicrobial and antitumor activity. However, the production costs of kefiran are still high mainly due to high cost of carbon and nitrogen sources. This study aimed to produce kefiran and its co-product, lactic acid, from low-cost industrial byproducts. Among the sources tested, whey lactose (at 2% sugar concentration) and spent yeast cells hydrolysate (at 6 g-nitrogen/L) gave the highest kefiran of 480 ± 21 mg/L along with lactic acid of 20.1 ± 0.2 g/L. The combination of these two sources and initial pH were optimized through Response Surface Methodology. With the optimized medium, L. kefiranofaciens produced more kefiran and lactic acid up to 635 ± 7 mg/L and 32.9 ± 0.7 g/L, respectively. When the pH was controlled to alleviate the inhibition from acidic pH, L. kefiranofaciens could consume all sugars and produced kefiran and lactic acid up to 1693 ± 29 mg/L and 87.49 ± 0.23 g/L, respectively. Moreover, the fed-batch fermentation with intermittent adding of whey lactose improved kefiran and lactic acid productions up to 2514 ± 93 mg/L and 135 ± 1.75 g/L, respectively. These results indicate the promising approach to economically produce kefiran and lactic acid from low-cost nutrient sources.
Dicty_cDB: Contig-U05100-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 8e04... 44 5.3 1 ( FG291968 ) 1108383360231 New World Screwworm Larvae 9387 EST... 44 5.3 1 ( FG291314 ) 1108793338924 New World... Screwworm Egg 9261 ESTs C... 44 5.3 1 ( FG287905 ) 1108793257010 New World Screwworm Eg...g 9261 ESTs C... 44 5.3 1 ( FG287011 ) 1108770728126 New World Screwworm Egg 9261... ESTs C... 44 5.3 1 ( FG284935 ) 1108770687631 New World Screwworm Egg 9261 ESTs C... 44 5.3 1 ( FG284257 ) 1108770663787 New World
Dicty_cDB: Contig-U05079-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ideum chromosome 2 map 4559693... 30 1.6 8 ( FG289956 ) 1108793312383 New World Screwworm Egg 9261 ESTs C...... 32 1.7 3 ( FG282923 ) 1108383360957 New World Screwworm Egg 9261 ESTs C... 32 1....... 36 1.7 7 ( FG290085 ) 1108793314272 New World Screwworm Egg 9261 ESTs C... 32...osum chromosome 5 clone RH044A21, **... 40 1.7 6 ( FG288205 ) 1108793264454 New World Screwworm Egg 9261 EST...00 com... 46 1.8 1 ( FG291788 ) 1108793372449 New World Screwworm Egg 9261 ESTs C... 32 1.8 3 ( FG295040 ) 1108770722162 New World
DEFF Research Database (Denmark)
Vandamme, Julien; Buchhorn, Gaëlle Lettier; Sidoli, Simone
2012-01-01
specific for H3K27me2/3. We demonstrate that utx-1 is an essential gene that is required for correct embryonic and postembryonic development. Consistent with its homology to UTX, UTX-1 regulates global levels of H3K27me2/3 in C. elegans. Surprisingly, we found that the catalytic activity is not required......Epigenetic modifications influence gene expression and provide a unique mechanism for fine-tuning cellular differentiation and development in multicellular organisms. Here we report on the biological functions of UTX-1, the Caenorhabditis elegans homologue of mammalian UTX, a histone demethylase...
Stable Sheave Moduli of Rank 2 with Chern Classes c 1 = -1; c2 = 2; c3 = 0 on Q3
Directory of Open Access Journals (Sweden)
A. D. Uvarov
2012-01-01
Full Text Available In this paper we consider the scheme MQ( 2;¡1; 2; 0 of stable torsion free sheaves of rank 2 with Chern classes c1 = -1, c2 = 2, c3 = 0 on a smooth 3-dimensional projective quadric Q. The manifold MQ(-1; 2 of moduli bundles of rank 2 with Chern classes c1 = -1, c2 = 2 on Q was studied by Ottaviani and Szurek in 1994. In 2007 the author described the closure MQ (-1; 2 in the scheme MQ(2;¡1; 2; 0. In this paper we prove that in MQ(2;¡1; 2; 0 there exists a unique irreducible component diferent from MQ (¡1; 2 which is a rational variety of dimension 10.
Gou, Chenyu; Liu, Xiangzhen; Shi, Xiaomei; Chai, Hanjing; He, Zhi-Ming; Huang, Xuan; Fang, Qun
2017-10-01
CDKN1C and KCNQ1OT1 are imprinted genes that might be potential regulators of placental development. This study investigated placental expressions of CDKN1C and KCNQ1OT1 in monozygotic twins with and without selective intrauterine growth restriction (sIUGR). Seventeen sIUGR and fifteen normal monozygotic(MZ) twin pairs were examined. Placental mRNA expressions of CDKN1C and KCNQ1OT1 were detected by real-time fluorescent quantitative PCR. CDKN1C protein expression was detected by immunohistochemical assay and Western-blotting. In the sIUGR group, smaller fetuses had a smaller share of the placenta, and CDKN1C protein expression was significantly increased while KCNQ1OT1 mRNA expression was significantly decreased. The CDKN1C/KCNQ1OT1 mRNA ratio was lower in the larger fetus than in the smaller fetus (p < .05). In the control group, CDKN1C protein expression showed no difference between larger and smaller fetuses, while KCNQ1OT1 mRNA expression was significantly lower in the larger fetus, and the CDKN1C/KCNQ1OT1 mRNA ratio was higher in the larger fetus than in the smaller fetus (p < .05). Our findings showed that pathogenesis of sIUGR may be related to the co-effect of the up-regulated protein expression of CDKN1C and down-regulated mRNA expression of KCNQ1OT1 in the placenta.
26 CFR 1.381(c)(13)-1 - Involuntary conversions.
2010-04-01
... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Involuntary conversions. 1.381(c)(13)-1 Section 1.381(c)(13)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Insolvency Reorganizations § 1.381(c)(13)-1 Involuntary conversions...
Dicty_cDB: Contig-U08256-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ssue Salmo s... 46 1.4 1 ( CK883072 ) SGP147785 Atlantic salmon Heart cDNA library...osome UNKNOWN clone CH276-288O1... 50 0.093 1 ( DV034449 ) XLTCR221 Cornea-lens transdifferentiation library...a strain T4 cDNA library. 34 3.8 2 ( AL111360 ) Botrytis cinerea strain T4 cDNA library. 34 3.8 2 ( AL113092 ) Botryti...s cinerea strain T4 cDNA library. 34 3.8 2 ( AL112940 ) Botrytis cinere...a strain T4 cDNA library. 34 3.8 2 ( AL112382 ) Botrytis cinerea strain T4 cDNA library. 34 3.8 2 (
Dicty_cDB: Contig-U15577-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 1 ( DX391817 ) GE__Sa0055E06.b1 Gossypium exiguum WGS library Go... 46 6.0 1 ( DU796002 ) APKH661.g2 HF770_12-21-03 unculture...m low-mole... 40 0.46 3 ( BQ608181 ) BRY_4083 wheat EST endosperm library Triticum aes... 40 0.49 2 ( B...( BQ606727 ) BRY_2596 wheat EST endosperm library Triticum aes... 40 0.58 2 ( EA234432 ) Sequence 98747 from...60 2 ( BQ608481 ) BRY_4386 wheat EST endosperm library Triticum aes... 40 0.60 2 ( BJ235142 ) Triticum aesti...eat developing grains cDNA li... 40 0.60 2 ( BQ609229 ) BRY_5153 wheat EST endosperm library Triticu
Dicty_cDB: Contig-U06890-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 2 ) CLLX1301.b1_J13.ab1 CLL(XYZ) lettuce saligna Lact... 38 0.056 2 ( CX084866 ) EHABX22TR E. histolytica Normalized cDNA library...4-storage roo... 50 0.071 1 ( CX089593 ) EHAE127TR E. histolytica Normalized cDNA library...09.T7.185889.ab1 non-sporulating culture o... 54 0.005 1 ( EL926280 ) NY4ThAmp1_1...EST2947 Zea mays sperm cell cDNA library Zea mays... 38 0.21 2 ( BG320461 ) Zm03_10d10_A Zm03_AAFC_ECORC_cold_stre... ( AI438501 ) 486006A05.x4 486 - leaf primordia cDNA library fr... 38 0.21 2 ( AI861145 ) 603012G11.x1 603 - stressed root cDNA libra
Dicty_cDB: Contig-U15349-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available us petioles cDNA library Populus tre... 38 0.58 2 ( AP006852 ) Candida albicans genomic ...CT049626 ) Sus scrofa genomic clone PigE-217H19, genomic sur... 48 0.79 1 ( EG687952 ) RCRBD08TO Castor bean cDNA library...V246458 ) A2FO395TO Aedes aegypti full length cDNA library,... 48 0.79 1 ( DV246174 ) A2FMO77TV Aedes aegypti full length cDNA librar...y,... 48 0.79 1 ( DV231005 ) A1FL491TO Aedes aegypti full length cDNA library,... 4.... 50 0.20 1 ( AZ428968 ) 1M0212M05R Mouse 10kb plasmid UUGC1M library Mus ... 50 0.20 1 ( CR123377 ) Reverse strand re
26 CFR 1.381(c)(8)-1 - Installment method.
2010-04-01
... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Installment method. 1.381(c)(8)-1 Section 1.381(c)(8)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Insolvency Reorganizations § 1.381(c)(8)-1 Installment method. (a) Carryover...
Directory of Open Access Journals (Sweden)
V I Skvortsova
2012-01-01
Full Text Available The impact of -5T/C polymorphism in the GP1BA gene on the risk of ischemic stroke (IS was studied in patients younger than 50 years of age. Ninety-two patients (73 men and 19 women; mean age 42.6+6.7years with atherothrombotic, lacunar, and cryptogenic IS were examined on days 1—21 after its development. All the patients underwent brain magnetic resonance imaging or computed tomography, brachiocephalic artery duplex scanning, echocardiography, and laboratory studies (antiphospholipid antibodies, coagulogram and platelet aggregation, homocysteine, clinical and biochemical blood analyses, rheumatic tests, determination of -5T/C polymorphism in the GP1BA gene. An increased risk for IS was found in the young males versus the controls (healthy individuals; p = 0.03; OR 2.7; CI 1.14; 6.47. This association was not found in the women. Analysis of pathogenetic types ascertained that the lacunar IS men with CC and CT genotypes had a higher risk for stroke than the healthy individuals (p = 0.04, OR 3.5, CI 1.1; 10.9. In other subtypes of stroke, there was no association with this polymorphism. A group of patients with IS caused by thrombosis of the great arteries of the brain. In this group, the patients had CC and CT genotypes significantly more frequently than the controls (p = 0.003; OR 6.7; CI 2.0; 21.8, as well as C allele (p = 0.0008; OR 5.1; CI 1.97; 13.3. The -5T/C polymorphism in the GP1BA gene was associated with the development of IS in young males. The -5C allele and -5T/C and -5C/C genotypes are increased risk factors for lacunar and arterial thrombosis-induced IS in men.
Dicty_cDB: Contig-U01127-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ( BJ076721 ) Xenopus laevis cDNA clone:XL058i17, 3' end, singl... 44 5.9 1 ( FG291907 ) 1108800220021 New World... Screwworm Egg 9261 ESTs C... 44 5.9 1 ( FG291539 ) 1108793348396 New World Sc...rewworm Egg 9261 ESTs C... 44 5.9 1 ( FG286660 ) 1108770723740 New World Screwworm Egg 9261 ESTs C... 44 5.9
Pro Unity game development with C#
Thorn, Alan
2014-01-01
The only professional-level book on Unity development with C# Covers in-depth aspects of C# development using Unity Readers will create a full-featured first person shooter and gain the knowledge to build their own professional-quality games.
DEFF Research Database (Denmark)
Stage, Tore B; Christensen, Mette M H; Feddersen, Søren
2013-01-01
OBJECTIVE: The aim of this study was to examine the effect of single nucleotide polymorphisms in CYP2C8, LPIN1, PPARGC1A and PPARγ on rosiglitazone's (i) trough steady-state plasma concentration (C(ss,min)), (ii) on glycosylated haemoglobin A1c (HbA1c) and (iii) the risk of developing adverse eve...
Energy Technology Data Exchange (ETDEWEB)
Gazquez, M.J.; Mantero, J.; Bolivar, J.P.; Garcia-Tenorio, R.; Vaca, F.
2011-07-01
The present study was conducted to characterize the raw materials (ilmenite and slag), waste (red gypsum) and several co-products (sulphate monohydrate and sulphate heptahydrated) form the titanum dioxide industry in relation to their elemental composition (major, minor and trace elements), granulometry, mineralogy, microscopic morphology, physical composition and radioactive content in order to apply this knowledge in the valorization of the co-products in the fields sucha as construction, civil engineering, etc. In particular, the main properties of cements produced with different proportions of red gypsum were studied, and the obtained improvements, in relation to Ordinary Portland Cements (OPC) were evaluated. It was also demonstrated that the levels of pollutants and the radioactive content in the produced RG cements, remain within the regulated safety limits. (Author). 38 refs.
Energy Technology Data Exchange (ETDEWEB)
Gazquez, M.J.; Mantero, J.; Bolivar, J.P.; Garcia-Tenorio, R.; Vaca, F.
2011-07-01
The present study was conducted to characterize the raw materials (ilmenite and slag), waste (red gypsum) and several co-products (sulphate monohydrate and sulphate heptahydrated) form the titanium dioxide industry in relation to their elemental composition (major, minor and trace elements), granulometry, mineralogy, microscopic morphology, physical composition and radioactive content in order to apply this knowledge in the valorization of the co-products in the fields such a as construction, civil engineering, etc. In particular, the main properties of cements produced with different proportions of red gypsum were studied, and the obtained improvements, in relation to Ordinary Portland Cements (OPC) were evaluated. It was also demonstrated that the levels of pollutants and the radioactive content in the produced RG cements, remain within the regulated safety limits. (Author). 38 refs.
Dicty_cDB: Contig-U05261-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available DN828913 ) KUCD01_04_F02_T3 WSWR cDNA library Triticum aesti... 48 0.49 1 ( DB872994 ) Lipochromis sp. 'matu...berosum cDNA, ... 50 0.13 1 ( CK261371 ) EST707449 potato abiotic stress cDNA library Sola... 50 0.13 1 ( BQ...pergillus niger mRNA for hypothetical protein, ... 44 7.7 1 ( AL111181 ) Botrytis cinerea strain T4 cDNA library...) Batrachochytrium dendrobatidis strain JAM059 vari... 48 0.49 1 ( AL112706 ) Botrytis cinerea strain T4 cDNA library...3 ) GH_MBb0070I15f GH_MBb Gossypium hirsutum genomic ... 48 0.49 1 ( AL424547 ) T3 end of clone XAZ0AA001A10 of library
Takao, Toshiko; Suka, Machi; Yanagisawa, Hiroyuki; Matsuyama, Yutaka; Iwamoto, Yasuhiko
2017-06-01
We explored whether visit-to-visit variability in both glycated hemoglobin (HbA1c) and systolic blood pressure (SBP) simultaneously predicted the development of microalbuminuria and retinopathy, and whether the predictive ability of these measurements changed according to mean HbA1c and SBP levels in people with type 2 diabetes. A retrospective observational cohort study was conducted on 243 type 2 diabetes patients with normoalbuminuria and 486 without retinopathy at the first visit and within 1year thereafter. The two cohorts were followed up from 1995 until 2012. Multivariate and stratified analyses were performed using Cox proportional hazard models. Microalbuminuria developed in 84 patients and retinopathy in 108. Hazard ratios (HRs) for the development of microalbuminuria associated with the coefficient of variation (CV) and variation independent of mean (VIM) of both HbA1c and SBP significantly increased. In participants with a mean SBP HbA1c were abruptly elevated and significant compared with those with a mean SBP ≥130mmHg. Visit-to-visit variability in both HbA1c and SBP simultaneously predict the development of microalbuminuria. HbA1c variability may predict the development of retinopathy when the mean SBP is normal (<130mmHg). Copyright © 2017 Elsevier B.V. All rights reserved.
Dicty_cDB: Contig-U02054-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 0.080 1 ( DT656898 ) pgr1n.UA001.227 Normalized chicken reproductive t... 50 0.080 1 ( AJ454996 ) Gallus gallus EST, clone library...90810 XtSt10-30 Xenopus (Silurana) t... 36 0.17 2 ( DV037739 ) BRS3230 storage root cDNA library Ipomoea bat..... 44 4.9 1 ( BM959958 ) cihA1L9S Ascidian hemocytes cDNA library Ciona in... 44 4.9 1 ( BM230365 ) K0294C12-3 NIA Mouse Unferti...... 36 0.010 3 ( EY189411 ) LLAE1039S Spider Loxosceles laeta cDNA library Lo... ... riken1, clone 4e... 50 0.080 1 ( AJ453299 ) Gallus gallus EST, clone library riken1,
Dicty_cDB: Contig-U15582-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ) EST1120673 Aquilegia cDNA library Aquilegia formo... 36 0.36 3 ( AC115612 ) Dictyostelium discoideum chrom... cDNA clone ... 46 4.1 1 ( BX858993 ) AGENAE Rainbow trout normalized testis library (t... 46 4.1 1 ( BF0889...discoideum chromosome 2 map 2567470... 40 0.11 12 ( AL844509 ) Plasmodium falciparum chromosome 13. 38 0.15 17 ( EU016597 ) Unculture...EST1196545 Aquilegia cDNA library Aquilegia formo... 36 0.28 3 ( DT766291 ) EST1200140 Aquilegia cDNA libr...ary Aquilegia formo... 36 0.29 3 ( DT729293 ) EST1163143 Aquilegia cDNA library Aqu
... Diagnosis The A1C Test & Diabetes The A1C Test & Diabetes On this page: What is the A1C test? ... the A1C test used to diagnose type 2 diabetes and prediabetes? Health care professionals can use the ...
Trimester-specific reference intervals for haemoglobin A(1c) (HbA(1c)) in pregnancy.
LENUS (Irish Health Repository)
O'Connor, Catherine
2011-11-26
Abstract Background: Diabetes in pregnancy imposes additional risks to both mother and infant. These increased risks are considered to be primarily related to glycaemic control which is monitored by means of glycated haemoglobin (HbA(1c)). The correlation of HbA(1c) with clinical outcomes emphasises the need to measure HbA(1c) accurately, precisely and for correct interpretation, comparison to appropriately defined reference intervals. Since July 2010, the HbA(1c) assay in Irish laboratories is fully metrologically traceable to the IFCC standard. The objective was to establish trimester-specific reference intervals in pregnancy for IFCC standardised HbA(1c) in non-diabetic Caucasian women. Methods: The authors recruited 311 non-diabetic Caucasian pregnant (n=246) and non-pregnant women (n=65). A selective screening based on risk factors for gestational diabetes was employed. All subjects had a random plasma glucose <7.7 mmol\\/L and normal haemoglobin level. Pregnancy trimester was defined as trimester 1 (T1, n=40) up to 12 weeks +6 days, trimester 2 (T2, n=106) 13-27 weeks +6 days, trimester 3 (T3, n=100) >28 weeks to term. Results: The normal HbA(1c) reference interval for Caucasian non-pregnant women was 29-37 mmol\\/mol (Diabetes Control and Complications Trial; DCCT: 4.8%-5.5%), T1: 24-36 mmol\\/mol (DCCT: 4.3%-5.4%), T2: 25-35 mmol\\/mol (DCCT: 4.4%-5.4%) and T3: 28-39 mmol\\/mol (DCCT: 4.7%-5.7%). HbA(1c) was significantly decreased in trimesters 1 and 2 compared to non-pregnant women. Conclusions: HbA(1c) trimester-specific reference intervals are required to better inform the management of pregnancies complicated by diabetes.
Smith, P; Linscott, L L; Vadivelu, S; Zhang, B; Leach, J L
2016-05-01
Widening of the occipital condyle-C1 interval is the most specific and sensitive means of detecting atlanto-occipital dislocation. Recent studies attempting to define normal measurements of the condyle-C1 interval in children have varied substantially. This study was performed to test the null hypothesis that condyle-C1 interval morphology and joint measurements do not change as a function of age. Imaging review of subjects undergoing CT of the upper cervical spine for reasons unrelated to trauma or developmental abnormality was performed. Four equidistant measurements were obtained for each bilateral condyle-C1 interval on sagittal and coronal images. The cohort was divided into 7 age groups to calculate the mean, SD, and 95% CIs for the average condyle-C1 interval in both planes. The prevalence of a medial occipital condyle notch was calculated. Two hundred forty-eight joints were measured in 124 subjects with an age range of 2 days to 22 years. The condyle-C1 interval varies substantially by age. Average coronal measurements are larger and more variable than sagittal measurements. The medial occipital condyle notch is most prevalent from 1 to 12 years and is uncommon in older adolescents and young adults. The condyle-C1 interval increases during the first several years of life, is largest in the 2- to 4-year age range, and then decreases through late childhood and adolescence. A single threshold value to detect atlanto-occipital dissociation may not be sensitive and specific for all age groups. Application of this normative data to documented cases of atlanto-occipital injury is needed to determine clinical utility. © 2016 by American Journal of Neuroradiology.
Energy Technology Data Exchange (ETDEWEB)
Porwoll, J.P.; Leete, E. (Minnesota Univ., Minneapolis (USA). Dept. of Chemistry)
1985-03-01
Potential advanced intermediates in the biosynthesis of delta/sup 9/-tetrahydrocannabinol, the major psychoactive principle of marijuana, have been synthesized labeled with two contiguous /sup 13/C atoms and /sup 14/C. Methyl (5,6-/sup 13/C/sub 2/, 1-/sup 14/C)olivetolate was prepared from lithium (/sup 13/C/sub 2/)acetylide and dimethyl (2-/sup 14/C)malonate. Reaction with geranyl bromide afforded methyl (5,6-/sup 13/C/sub 2/, 1-/sup 14/C)cannabigerolate, and hydrolysis of these methyl esters with lithium propyl mercaptide yielded the corresponding labeled acids. The /sup 13/C-/sup 13/C couplings observable in the /sup 13/C NMR spectra of these /sup 13/C-enriched compounds and their synthetic precursors are recorded. Methyl (1'-/sup 14/C)olivetolate was prepared from /sup 13/CO/sub 2/ to confirm assignments of the /sup 13/C chemical shifts in the pentyl side chain of these compounds.
Brookes, Ian; Archibald, Sylvia; McInnes, Kerry; Cross, Beth; Daniel, Brigid; Johnson, Fiona
2012-01-01
Although co-production of research with people who access support services is increasingly common, details about how people who access support services can take more of an assertive role in developing research proposals and method design remains sketchy. This article reflects on the development of a research project on adult protection practice in…
Dicty_cDB: Contig-U05090-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 0 crog_evp Caligus rogercressey... 46 2.0 1 ( FG296496 ) 1108793252963 New World Screwworm Larvae 9387 EST...... 46 2.0 1 ( FG289486 ) 1108793302230 New World Screwworm Egg 9261 ESTs C... 46 2.0 1 ( FG288459 ) 1108793271734 New World...tis elegans EST, clone B03_ce5.trans.... 44 7.8 1 ( FG291463 ) 1108793341690 New World Screwworm Egg 9261 ES...Ts C... 44 7.8 1 ( FG290886 ) 1108793327637 New World Screwworm Egg 9261 ESTs C...... 44 7.8 1 ( FG288468 ) 1108793271746 New World Screwworm Egg 9261 ESTs C... 44 7.8 1 ( FG286882 ) 1108770727022 New World
Energy Technology Data Exchange (ETDEWEB)
Cherubini, F.; Jungmeier, G.; Mandl, M. (Joanneum Research, Graz (Austria)) (and others)
2010-07-01
This report has been developed by the members of IEA Bioenergy Task 42 on Biorefinery: Co-production of Fuels, Chemicals, Power and Materials from Biomass (www.biorefinery.nl/ieabioenergy-task42). IEA Bioenergy is a collaborative network under the auspices of the International Energy Agency (IEA) to improve international cooperation and information exchange between national bioenergy RD and D programs. IEA Bioenergy Task 42 on Biorefinery covers a new and very broad biomass-related field, with a very large application potential, and deals with a variety of market sectors with many interested stakeholders, a large number of biomass conversion technologies, and integrated concepts of both biochemical and thermochemical processes. This report contains an overview of the biomass, bioenergy and biorefinery situation, and activities, in the Task 42 member countries: Austria, Canada, Denmark, France, Germany, Ireland, and the Netherlands. The overview includes: national bioenergy production, non-energetic biomass use, bioenergy related policy goals, national oil refineries, biofuels capacity for transport purposes, existing biorefinery industries, pilot and demo plants, and other activities of research and development (such as main national projects and stakeholders). Data are provided by National Task Leaders (NTLs), whose contact details are listed at the end of the report. (author)
Dicty_cDB: Contig-U05312-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 246 ) PDUts1124F05 Porcine testis cDNA library I Sus sc... 48 0.32 1 ( CT631096 ) Danio rerio EST, clone ZF_mu... 46 1.2 1 ( CV877151 ) PDUts1160G12 Porcine testis cDNA library I Sus sc... 46 1.2 1 ( CT729188 ) Danio rerio EST, clone ZF_mu... 44 4.9 1 ( CV865498 ) PDUts1018G06 Porcine testis cDNA library I Sus sc... 44 4.9 1 ( CT735187 ) Danio rerio EST, clone ZF_mu...774433 ) McClintock41_B07.ab1 Homarus EST library project ... 54 0.005 1 ( AU269391 ) Dictyostelium discoideum vegetati...1 3'. 46 1.2 1 ( CK415565 ) AUF_IpPit_32_p21 Pituitary cDNA library Ictalurus...
Dicty_cDB: Contig-U03961-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 11761 ) Cm_mx0_73c09_SP6 Green Shore Crab Multiple Tissue... 44 3.8 1 ( DT748983 ) EST1182832 Aquilegia cDNA library....5 2 ( DT740690 ) EST1174539 Aquilegia cDNA library Aquilegia formo... 32 6.6 2 ( AC179512 ) Strongylocentrotus purpuratu..... 46 0.95 1 ( DT735794 ) EST1169643 Aquilegia cDNA library Aquilegia formo... 46 0.95 1 ( AU060865 ) Dictyo...ne ... 46 0.95 1 ( CN914822 ) 030115ABNB002055HT (ABNB) Braeburn cultured fruit... 46 0.95 1 ( CJ977926 ) Bursaphelenchus mucronatu... Grape Berry pSPORT1 Library Vitis ... 44 3.8 1 ( CF118211 ) fs326.z1 fs 103-105d fetal sheep skin library
PDE1C deficiency antagonizes pathological cardiac remodeling and dysfunction
Knight, Walter E.; Chen, Si; Zhang, Yishuai; Oikawa, Masayoshi; Wu, Meiping; Zhou, Qian; Miller, Clint L.; Cai, Yujun; Mickelsen, Deanne M.; Moravec, Christine; Small, Eric M.; Abe, Junichi; Yan, Chen
2016-01-01
Cyclic nucleotide phosphodiesterase 1C (PDE1C) represents a major phosphodiesterase activity in human myocardium, but its function in the heart remains unknown. Using genetic and pharmacological approaches, we studied the expression, regulation, function, and underlying mechanisms of PDE1C in the pathogenesis of cardiac remodeling and dysfunction. PDE1C expression is up-regulated in mouse and human failing hearts and is highly expressed in cardiac myocytes but not in fibroblasts. In adult mouse cardiac myocytes, PDE1C deficiency or inhibition attenuated myocyte death and apoptosis, which was largely dependent on cyclic AMP/PKA and PI3K/AKT signaling. PDE1C deficiency also attenuated cardiac myocyte hypertrophy in a PKA-dependent manner. Conditioned medium taken from PDE1C-deficient cardiac myocytes attenuated TGF-β–stimulated cardiac fibroblast activation through a mechanism involving the crosstalk between cardiac myocytes and fibroblasts. In vivo, cardiac remodeling and dysfunction induced by transverse aortic constriction, including myocardial hypertrophy, apoptosis, cardiac fibrosis, and loss of contractile function, were significantly attenuated in PDE1C-knockout mice relative to wild-type mice. These results indicate that PDE1C activation plays a causative role in pathological cardiac remodeling and dysfunction. Given the continued development of highly specific PDE1 inhibitors and the high expression level of PDE1C in the human heart, our findings could have considerable therapeutic significance. PMID:27791092
Dicty_cDB: Contig-U02963-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 3 ( CK246139 ) EST729776 potato callus cDNA library, normalized ... 36 0.066 2 ( CK260957 ) EST707035 potato abiotic stress cDNA libr...ary Sola... 36 0.066 2 ( CK264509 ) EST710587 potato abiotic stress cDNA library So...la... 36 0.066 2 ( CK270438 ) EST716516 potato abiotic stress cDNA library Sola.....e-12 3 ( FD432325 ) Atr01b_127_E02_C010.g1 FGP Male Amborella trichop... 50 4e-09 2 ( CF450348 ) EST686693 normalized cDNA library...GE498851 ) CCFT1427.b1_E22.ab1 CCF(STU) sunflower Helianthus... 42 0.005 2 ( DV105288 ) chiou01187 Subtractive cDNA library
Dicty_cDB: Contig-U01505-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available y1 Gm-c1004 Glycine max cDNA clone GENOME... 32 3.7 2 ( DV211690 ) 0089P0160Z_H09_T7 Mimulus guttatus library 2 Mimu...38TG Tetrahymena thermophila EST library str... 38 2.5 2 ( AC177658 ) Strongylocentrotus purpuratus clone R3...6 1.4 1 ( BG041778 ) saa41a04.y1 Gm-c1059 Glycine soja cDNA clone GENO... 46 1.4 1 ( BF645094 ) NF034E10EC1F1082 Elicited cell cultur...e Medicago t... 46 1.4 1 ( BF644741 ) NF014E01EC1F1005 Elicited cell culture Medica...a oleracea var. alboglabra EST, clone AAF... 44 5.4 1 ( CN828044 ) EL2662R Brassica embryo library (EL) Brassic
An APC/C-Cdh1 Biosensor Reveals the Dynamics of Cdh1 Inactivation at the G1/S Transition.
Ondracka, Andrej; Robbins, Jonathan A; Cross, Frederick R
2016-01-01
B-type cyclin-dependent kinase activity must be turned off for mitotic exit and G1 stabilization. B-type cyclin degradation is mediated by the anaphase-promoting complex/cyclosome (APC/C); during and after mitotic exit, APC/C is dependent on Cdh1. Cdh1 is in turn phosphorylated and inactivated by cyclin-CDK at the Start transition of the new cell cycle. We developed a biosensor to assess the cell cycle dynamics of APC/C-Cdh1. Nuclear exit of the G1 transcriptional repressor Whi5 is a known marker of Start; APC/C-Cdh1 is inactivated 12 min after Whi5 nuclear exit with little measurable cell-to-cell timing variability. Multiple phosphorylation sites on Cdh1 act in a redundant manner to repress its activity. Reducing the number of phosphorylation sites on Cdh1 can to some extent be tolerated for cell viability, but it increases variability in timing of APC/C-Cdh1 inactivation. Mutants with minimal subsets of phosphorylation sites required for viability exhibit striking stochasticity in multiple responses including budding, nuclear division, and APC/C-Cdh1 activity itself. Multiple cyclin-CDK complexes, as well as the stoichiometric inhibitor Acm1, contribute to APC/C-Cdh1 inactivation; this redundant control is likely to promote rapid and reliable APC/C-Cdh1 inactivation immediately following the Start transition.
Dicty_cDB: Contig-U00601-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available e:dda23b14, 5' ... 452 e-122 1 ( FG289858 ) 1108793308037 New World Screwworm Egg... 9261 ESTs C... 58 6e-14 3 ( FG283439 ) 1108770613896 New World Screwworm Egg 9261 ESTs C... 58 7e-14 3 ( FG...290424 ) 1108793318269 New World Screwworm Egg 9261 ESTs C... 58 8e-14 3 ( FG284161 ) 1108770655999 New World... Screwworm Egg 9261 ESTs C... 58 1e-12 3 ( FG290204 ) 1108793315322 New World Sc...e-05 3 ( FG288148 ) 1108793263397 New World Screwworm Egg 9261 ESTs C... 58 1e-04 2 ( EW760907 ) sb_009_12G1
Detection of biosurfactants in Bacillus species: genes and products identification.
Płaza, G; Chojniak, J; Rudnicka, K; Paraszkiewicz, K; Bernat, P
2015-10-01
To screen environmental Bacillus strains for detection of genes encoding the enzymes involved in biosurfactant synthesis and to evaluate their products e.g. surfactin, iturin and fengycin. The taxonomic identification of isolated from the environment Bacillus strains was performed by Microgene ID Bacillus panel and GEN III Biolog system. The polymerase chain reaction (PCR) strategy for screening of genes in Bacillus strains was set up. Liquid chromatography-mass spectrometry (LC-MS/MS) method was used for the identification of lipopeptides (LPs). All studied strains exhibited the presence of srfAA gene and produced surfactin mostly as four homologues (C13 to C16). Moreover, in 2 strains (KP7, T'-1) simultaneous co-production of 3 biosurfactants: surfactin, iturin and fengycin was observed. Additionally, it was found out that isolate identified as Bacillus subtilis ssp. subtilis (KP7), beside LPs co-production, synthesizes surfactin with the efficiency much higher than other studied strains (40·2 mg l(-1) ) and with the yield ranging from 0·8 to 8·3 mg l(-1) . We showed that the combined methodology based on PCR and LC-MS/MS technique is an optimal tool for the detection of genes encoding enzymes involved in biosurfactant synthesis as well as their products, e.g. surfactin, iturin and fengycin. This approach improves the screening and the identification of environmental Bacillus co-producing biosurfactants-stimulating and facilitating the development of this area of science. The findings of this work will help to improve screening of biosurfactant producers. Discovery of novel biosurfactants and biosurfactants co-production ability has shed light on their new application fields and for the understanding of their interactions and properties. © 2015 The Society for Applied Microbiology.
Directory of Open Access Journals (Sweden)
Wenxian Wu
Full Text Available C3HC4-type RING finger proteins constitute a large family in the plant kingdom and play important roles in various physiological processes of plant life. In this study, a C3HC4-type zinc finger gene was isolated from Nicotiana benthamiana. Sequence analysis indicated that the gene encodes a 24-kDa protein with 191 amino acids containing one typical C3HC4-type zinc finger domain; this gene was named NbZFP1. Transient expression of pGDG-NbZFP1 demonstrated that NbZFP1 was localized to the chloroplast, especially in the chloroplasts of cells surrounding leaf stomata. Virus-induced gene silencing (VIGS analysis indicated that silencing of NbZFP1 hampered fruit development, although the height of the plants was normal. An overexpression construct was then designed and transferred into Nicotiana benthamiana, and PCR and Southern blot showed that the NbZFP1 gene was successfully integrated into the Nicotiana benthamiana genome. The transgenic lines showed typical compactness, with a short internode length and sturdy stems. This is the first report describing the function of a C3HC4-type RING finger protein in tobacco.
Daykin, Norma; Mansfield, Louise; Payne, Annette; Kay, Tess; Meads, Catherine; D'Innocenzo, Giorgia; Burnett, Adele; Dolan, Paul; Julier, Guy; Longworth, Louise; Tomlinson, Alan; Testoni, Stefano; Victor, Christina
2017-09-01
There is a growing recognition of the ways in which culture and sport can contribute to wellbeing. A strong evidence base is needed to support innovative service development and a 3-year research programme is being undertaken to capture best evidence of wellbeing impacts and outcomes of cultural and sporting activities in order to inform UK policy and practice. This article provides an overview of methods and findings from an initial coproduction process with key stakeholders that sought to explore and agree principles and parameters of the evidence review for culture, sport and wellbeing (CSW). A two-stage DELPHI process was conducted with a purposeful sample of 57 stakeholders between August and December 2015. Participants were drawn from a range of culture and sport organisations and included commissioners and managers, policy makers, representatives of service delivery organisations (SDOs) and scholars. The DELPHI 1 questionnaire was developed from extensive consultation in July and August 2015. It explored definitions of wellbeing, the role of evidence, quality assessment, and the culture and sport populations, settings and interventions that are most likely to deliver wellbeing outcomes. Following further consultation, the results, presented as a series of ranked statements, were sent back to participants (DELPHI 2), which allowed them to reflect on and, if they wished, express agreement or disagreement with the emerging consensus. A total of 40 stakeholders (70.02%) responded to the DELPHI questionnaires. DELPHI 1 mapped areas of agreement and disagreement, confirmed in DELPHI 2. The exercise drew together the key priorities for the CSW evidence review. The DELPHI process, in combination with face-to-face deliberation, enabled stakeholders to engage in complex discussion and express nuanced priorities while also allowing the group to come to an overall consensus and agree outcomes. The results will inform the CSW evidence review programme until its
Dicty_cDB: Contig-U03338-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ) 486099E06.x1 486 - leaf primordia cDNA library fr... 155 1e-33 1 ( FL885969 ) CCGN6504.b1 CCGN Panicum virgatum eti...( CF272843 ) EST3049 Zea mays sperm cell cDNA library Zea mays... 105 1e-18 1 ( FE623651 ) CBYY4925.g1 CBYY Panicum virgatu...22B2F04.f1 BG01 - normalized library Leymus ... 266 1e-90 2 ( EX580446 ) HDP26H23w HDP Hordeum vulgare subsp. vulgare... 2 ( EX571824 ) HDP35N10T HDP Hordeum vulgare subsp. vulgare cDNA... 287 5e-90 2 ( CV056143 ) BNEL14D8 Barley EST endosperm library... rachis EST library... 161 2e-35 1 ( AU173547 ) Oryza sativa Japonica Group cDNA, parti
Dicty_cDB: Contig-U05011-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 4 1.0 3 ( FG289817 ) 1108793307980 New World Screwworm Egg 9261 ESTs C... 38 1.3 3 ( AC176252 ) Strongylocen...trotus purpuratus clone R3-3060I22, W... 40 1.3 4 ( FG290522 ) 1108793323765 New World... Screwworm Egg 9261 ESTs C... 38 1.4 3 ( FG286635 ) 1108770723708 New World Screwworm Egg 9261 ESTs C..
Dicty_cDB: Contig-U01510-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available .4 1 ( BE248608 ) NF021H01DT1F1013 Drought Medicago truncatula cDNA... 42 6.4 1 ( BE205651 ) AOB130 Onion seedling leaf cDNA library...-41B2_Sp6.1 CH216 Xenopus (Silurana) tropica... 42 6.4 1 ( CG770475 ) TcB41.2_F05_SP6 Tribolium BAC library ...ed ... 44 1.6 1 ( CK424003 ) AUF_IpSto_10_c04 Stomach cDNA library Ictalurus p........ 42 6.4 1 ( EI465423 ) PV_GBa0071A02.f PV_GBa Phaseolus vulgaris genomic... 42 6.4 1 ( ED568449 ) SBA034_G14.f Sugar beet BAC libra...ago trunca... 42 6.4 1 ( BF650883 ) NF097E12EC1F1097 Elicited cell culture Medicago t... 42 6.4 1 (
Porous SiC/SiC composites development for industrial application
International Nuclear Information System (INIS)
Maeta, S.; Hinoki, T.
2014-01-01
Silicon carbide (SiC) is promising structural materials in nuclear fields due to an excellent irradiation resistance and low activation characteristics. Conventional SiC fibers reinforced SiC matrix (SiC/SiC composites) fabricated by liquid phase sintering (LPS-SiC/SiC composites) have been required high cost and long processing time. And microstructure and mechanical property data of finally obtained LPS-SiC/SiC composites are easily scattered, because quality of the composites depend on personal skill. Thus, conventional LPS-SiC/SiC composites are inadequate for industrial use. In order to overcome these issues, the novel “porous SiC/SiC composites” have been developed by means of liquid phase sintering fabrication process. The composites consist of porous SiC matrix and SiC fibers without conventional carbon interfacial layer. The composites don’t have concerns of the degradation interfacial layer at the severe accident. Porous SiC/SiC composites preform was prepared with a thin sheet shape of SiC, sintering additives and carbon powder mixture by tape casting process which was adopted because of productive and high yielding rate fabrication process. The preform was stacked with SiC fibers and sintered in hot-press at the high temperature in argon environment. The sintered preform was decarburized obtain porous matrix structure by heat-treatment in air. Moreover, mechanical property data scattering of the obtained porous SiC/SiC composites decreased. In the flexural test, the porous SiC/SiC composites showed pseudo-ductile behavior with sufficient strength even after heat treatment at high temperature in air. From these conclusions, it was proven that porous SiC/SiC composites were reliable material at severe environment such as high temperature in air, by introducing tape casting fabrication process that could produce reproducible materials with low cost and simple way. Therefore development of porous SiC/SiC composites for industrial application was
Dicty_cDB: Contig-U03161-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 1 v1 Meloidog... 44 1.6 1 ( FG284560 ) 1108770677796 New World Screwworm Egg 9261 ESTs C... 44 1.6 1 ( FG284...300 ) 1108770663835 New World Screwworm Egg 9261 ESTs C... 44 1.6 1 ( CP000123 ) Mycoplasma capricolum subsp
Directory of Open Access Journals (Sweden)
Kazuaki Tokodai
2014-01-01
Full Text Available Aims. To evaluate the predictive power of pretransplant HbA1c for new-onset diabetes after transplantation (NODAT in kidney transplant candidates, who had several predispositions for fluctuated HbA1c levels. Methods. We performed a retrospective study of 119 patients without diabetes who received kidney transplantation between March 2000 and January 2012. Univariate and multivariate logistic regression analyses were used to investigate the association of several parameters with NODAT. Predictive discrimination of HbA1c was assessed using a receiver-operating characteristic curve. Results. Seventeen patients (14.3% developed NODAT within 1 year of transplantation. Univariate logistic regression analysis revealed that recipient age, gender, and HbA1c were predictors of NODAT. In the multivariate analysis, the association between pretransplant HbA1c and NODAT development did not reach statistical significance (P=0.07. To avoid the strong influence of high-dose erythropoietin on HbA1c levels, we performed subgroup analyses on 85 patients receiving no or low-dose (≤6000 IU/week erythropoietin. HbA1c was again an independent predictor for NODAT. Receiver-operating characteristic analysis revealed a cut-off value of 5.2% with an optimal sensitivity of 64% and specificity of 78% for predicting NODAT. Conclusions. Our results reveal that the pretransplant HbA1c level is a useful predictor for NODAT in patients receiving no or low-dose erythropoietin.
Dicty_cDB: Contig-U03977-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available UENCIN... 46 0.54 1 ( EJ262742 ) 1095349052134 Global-Ocean-Sampling_GS-27-01-01-1... 46 0.54 1 ( FG292901 ) 1108770646510 New World... 44 2.1 1 ( FG289260 ) 1108793295624 New World Screwworm Egg 9261 ESTs C... 44 2.1 1 ( FG284108 ) 1108770655932 New World... Screwworm Egg 9261 ESTs C... 44 2.1 1 ( FG283637 ) 1108770632294 New World Screwworm Egg 9261 ...romosome 2 clone T32F12 ma... 38 7.0 2 ( FG284740 ) 1108770680364 New World Screwworm Egg 9261 ESTs C... 38
Wherton, Joseph; Sugarhood, Paul; Procter, Rob; Hinder, Sue; Greenhalgh, Trisha
2015-05-26
The low uptake of telecare and telehealth services by older people may be explained by the limited involvement of users in the design. If the ambition of 'care closer to home' is to be realised, then industry, health and social care providers must evolve ways to work with older people to co-produce useful and useable solutions. We conducted 10 co-design workshops with users of telehealth and telecare, their carers, service providers and technology suppliers. Using vignettes developed from in-depth ethnographic case studies, we explored participants' perspectives on the design features of technologies and services to enable and facilitate the co-production of new care solutions. Workshop discussions were audio recorded, transcribed and analysed thematically. Analysis revealed four main themes. First, there is a need to raise awareness and provide information to potential users of assisted living technologies (ALTs). Second, technologies must be highly customisable and adaptable to accommodate the multiple and changing needs of different users. Third, the service must align closely with the individual's wider social support network. Finally, the service must support a high degree of information sharing and coordination. The case vignettes within inclusive and democratic co-design workshops provided a powerful means for ALT users and their carers to contribute, along with other stakeholders, to technology and service design. The workshops identified a need to focus attention on supporting the social processes that facilitate the collective efforts of formal and informal care networks in ALT delivery and use.
Dicty_cDB: Contig-U04201-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ( CN212621 ) 26120 Suspension culture Solanum tuberosum cDNA, ... 58 6e-04 1 ( BU880962 ) UM57TA10 Populus flower cDNA library...m cD... 58 6e-08 2 ( EX067768 ) BR052412 pollen cDNA library KBPL Brassica rapa s... 48 8e-08 3 ( EX122995 ) BR106825 mature gre...2 ( EX137140 ) BR120970 root cDNA library KHRT Brassica rapa sub... 48 1e-07 3 ( EX124319 ) BR108149 matur...5', mRNA ... 48 2e-07 2 ( BU822514 ) UB38BPG02 Populus tremula cambium cDNA library Po... 58 4e-07 2 ( EX032...U359299_1( EU359299 |pid:none) Rickettsia helvetica isolate 73-3-... 171 3e-41 EU543436_1( EU543436 |pid:none) Uncultured Ric
More efficient redox biocatalysis by utilising 1,4-butanediol as a ‘smart cosubstrate’
Kara, S.; Spickermann, D.; Schrittwieser, J.H.; Leggewie, C.; Van Berkel, W.J.H.; Arendsa, I.W.C.E.; Hollmann, F.
2012-01-01
1,4-Butanediol is shown to be an efficient cosubstrate to promote NAD(P)H-dependent redox biocatalysis. The thermodynamically and kinetically inert lactone coproduct makes the regeneration reaction irreversible. Thereby not only the molar surplus of cosubstrate is dramatically reduced but also
More efficient redox biocatalysis by utilizing 1,4-butanediol as a ‘smart cosubstrate'
Kara, S.; Spickermann, D.; Schrittwieser, J.H.; Leggewie, C.; Berkel, van W.J.H.; Arends, I.W.C.E.; Hollmann, F.
2013-01-01
1,4-Butanediol is shown to be an efficient cosubstrate to promote NAD(P)H-dependent redox biocatalysis. The thermodynamically and kinetically inert lactone coproduct makes the regeneration reaction irreversible. Thereby not only the molar surplus of cosubstrate is dramatically reduced but also
Going beyond the flood insurance rate map: insights from flood hazard map co-production
Directory of Open Access Journals (Sweden)
A. Luke
2018-04-01
Full Text Available Flood hazard mapping in the United States (US is deeply tied to the National Flood Insurance Program (NFIP. Consequently, publicly available flood maps provide essential information for insurance purposes, but they do not necessarily provide relevant information for non-insurance aspects of flood risk management (FRM such as public education and emergency planning. Recent calls for flood hazard maps that support a wider variety of FRM tasks highlight the need to deepen our understanding about the factors that make flood maps useful and understandable for local end users. In this study, social scientists and engineers explore opportunities for improving the utility and relevance of flood hazard maps through the co-production of maps responsive to end users' FRM needs. Specifically, two-dimensional flood modeling produced a set of baseline hazard maps for stakeholders of the Tijuana River valley, US, and Los Laureles Canyon in Tijuana, Mexico. Focus groups with natural resource managers, city planners, emergency managers, academia, non-profit, and community leaders refined the baseline hazard maps by triggering additional modeling scenarios and map revisions. Several important end user preferences emerged, such as (1 legends that frame flood intensity both qualitatively and quantitatively, and (2 flood scenario descriptions that report flood magnitude in terms of rainfall, streamflow, and its relation to an historic event. Regarding desired hazard map content, end users' requests revealed general consistency with mapping needs reported in European studies and guidelines published in Australia. However, requested map content that is not commonly produced included (1 standing water depths following the flood, (2 the erosive potential of flowing water, and (3 pluvial flood hazards, or flooding caused directly by rainfall. We conclude that the relevance and utility of commonly produced flood hazard maps can be most improved by illustrating
Enzymes of the AKR1B and AKR1C subfamilies and uterine diseases
Directory of Open Access Journals (Sweden)
Tea eLanisnik Rizner
2012-03-01
Full Text Available Endometrial and cervical cancers, uterine myoma, and endometriosis are very common uterine diseases. Worldwide, more than 800,000 women are affected annually by gynecological cancers, as a result of which, more than 360,000 die. During their reproductive age, about 70% of women develop uterine myomas, 10% to 15% suffer from endometriosis, and 35% to 50% from infertility associated with endometriosis. Uterine diseases are associated with aberrant inflammatory responses and concomitant increased production of prostaglandins (PG. They are also related to decreased differentiation, due to low levels of protective progesterone and retinoic acid, and to enhanced proliferation, due to high local concentrations of estrogens. The pathogenesis of these diseases can thus be attributed to disturbed PG, estrogen and retinoid metabolism and actions. Five human members of the aldo-keto reductase 1B (AKR1B and 1C (AKR1C superfamilies, i.e., AKR1B1, AKR1B10, AKR1C1, AKR1C2 and AKR1C3, have roles in these processes and can thus be implicated in uterine diseases. AKR1B1 and AKR1C3 catalyze the formation of PGF2alpha which stimulates cell proliferation. AKR1C3 converts PGD2 to 9alpha,11beta-PGF2, and thus counteracts the formation of 15deoxy-PGJ2, which can activate pro-apoptotic peroxisome-proliferator-activated receptor beta. AKR1B10 catalyzes the reduction of retinal to retinol, and in thus lessens the formation of retinoic acid, with potential pro-differentiating actions. The AKR1C1-AKR1C3 enzymes also act as 17-keto- and 20-ketosteroid reductases to varying extents, and are implicated in increased estradiol and decreased progesterone levels. This review comprises a short introduction to uterine diseases, followed by an overview of the current literature on the AKR1B and AKR1C expression in the uterus and in uterine diseases. The potential implications of the AKR1B and AKR1C enzymes and their pathophysiologies are then discussed, followed by conclusions and
26 CFR 1.1402(c)-1 - Trade or business.
2010-04-01
... 26 Internal Revenue 12 2010-04-01 2010-04-01 false Trade or business. 1.1402(c)-1 Section 1.1402(c... (CONTINUED) INCOME TAXES Tax on Self-Employment Income § 1.1402(c)-1 Trade or business. In order for an individual to have net earnings from self-employment, he must carry on a trade or business, either as an...
Hydrogen-induced metallization on Ge(1 1 1) c(2 x 8)
International Nuclear Information System (INIS)
Razado, I.C.; Zhang, H.M.; Hansson, G.V.; Uhrberg, R.I.G.
2006-01-01
We have studied hydrogen adsorption on the Ge(1 1 1) c(2 x 8) surface using scanning tunneling microscopy (STM) and angle-resolved photoelectron spectroscopy (ARPES). We find that atomic hydrogen preferentially adsorbs on rest atom sites. The neighbouring adatoms appear higher in STM images, which clearly indicates a charge transfer from the rest atom states to the adatom states. The surface states near the Fermi-level have been followed by ARPES as function of H exposure. Initially, there is strong emission from the rest atom states but no emission at the Fermi-level which confirms the semiconducting character of the c(2 x 8) surface. With increasing H exposure a structure develops in the close vicinity of the Fermi-level. The energy position clearly indicates a metallic character of the H-adsorbed surface. Since the only change in the STM images is the increased brightness of the adatoms neighbouring a H-terminated rest atom, we identify the emission at the Fermi-level with these adatom states
HbA1c for diagnosis and prognosis of gestational diabetes mellitus.
Kwon, Soon Sung; Kwon, Ja-Young; Park, Yong-Won; Kim, Young-Han; Lim, Jong-Baeck
2015-10-01
HbA1c is a widely used marker in diagnosing type 2 diabetes mellitus (DM), but its clinical utility in diagnosing gestational diabetes mellitus (GDM) is not established. Here, we evaluated the clinical usefulness of HbA1c in diagnosing GDM and predicting the risk of future type 2 DM development among GDM patients. This retrospective, cross-sectional study included 321 subjects who underwent 100-g oral glucose tolerance tests (OGTT) during pregnancy. HbA1c and other variables were analyzed to evaluate their diagnostic performance for GDM. To evaluate the clinical usefulness of HbA1c in predicting future type 2 DM development, we classified GDM subjects who had more than 3 months of follow-up data into two subgroups: those who developed postpartum type 2 DM (PDM) and those who did not. HbA1c was significantly higher in the GDM group than in the normal control group. With the 100-g OGTT as reference, HbA1c showed 91.3% sensitivity and 62% specificity at a cut-off value of 5.05% (32 mmol/mol) for GDM diagnosis. At a cut-off value of 5.25% (34 mmol/mol), sensitivity was 73.6% and specificity was 77.2%. HbA1c levels during pregnancy were higher in those with PDM than in those without PDM (5.91 [41 mmol/mol] vs. 5.44% [36 mmol/mol], p<0.001). The prognostic value of HbA1c for PDM was evaluated by ROC curve analysis, with sensitivity of 78.6% and specificity of 72.5% at a cut-off value of 5.55% (37 mmol/mol). HbA1c showed high sensitivity with relatively low specificity for diagnosis of GDM in pregnant women and was a potential predictor of PDM. HbA1c may be able to be used as a simple and less invasive alternative screening test for OGTT in GDM patients. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.
Dicty_cDB: Contig-U04925-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available RT0512 Chinese cabbage root library Brassica rapa... 46 2.3 1 ( CT736909 ) Danio rerio EST, clone ZF_mu...S30TF EI_10_12_KB Entamoeba invadens genomic ... 44 8.9 1 ( ES277776 ) PQ028A01.XT7 non-sporulating culture ...202 ) 1095462295981 Global-Ocean-Sampling_GS-31-01-01-1... 48 0.57 1 ( CV871352 ) PDUts1090D04 Porcine testis cDNA library...clone:VS... 46 2.3 1 ( CX056831 ) PDUts2007A02 Porcine testis cDNA library II Sus s... 46 2.3 1 ( CV432331 )...a tectiformis cDNA, cleaving embryo clone:m... 40 5.1 2 ( CV874903 ) PDUts1132F08 Porcine testis cDNA library
Abulencia, A; Adelman, J; Affolder, T; Akimoto, T; Albrow, M G; Ambrose, D; Amerio, S; Amidei, D; Anastassov, A; Anikeev, K; Annovi, A; Antos, J; Aoki, M; Apollinari, G; Arguin, J-F; Arisawa, T; Artikov, A; Ashmanskas, W; Attal, A; Azfar, F; Azzi-Bacchetta, P; Azzurri, P; Bacchetta, N; Badgett, W; Barbaro-Galtieri, A; Barnes, V E; Barnett, B A; Baroiant, S; Bartsch, V; Bauer, G; Bedeschi, F; Behari, S; Belforte, S; Bellettini, G; Bellinger, J; Belloni, A; Benjamin, D; Beretvas, A; Beringer, J; Berry, T; Bhatti, A; Binkley, M; Bisello, D; Blair, R E; Blocker, C; Blumenfeld, B; Bocci, A; Bodek, A; Boisvert, V; Bolla, G; Bolshov, A; Bortoletto, D; Boudreau, J; Boveia, A; Brau, B; Brigliadori, L; Bromberg, C; Brubaker, E; Budagov, J; Budd, H S; Budd, S; Budroni, S; Burkett, K; Busetto, G; Bussey, P; Byrum, K L; Cabrera, S; Campanelli, M; Campbell, M; Canelli, F; Canepa, A; Carillo, S; Carlsmith, D; Carosi, R; Carron, S; Casarsa, M; Castro, A; Catastini, P; Cauz, D; Cavalli-Sforza, M; Cerri, A; Cerrito, L; Chang, S H; Chen, Y C; Chertok, M; Chiarelli, G; Chlachidze, G; Chlebana, F; Cho, I; Cho, K; Chokheli, D; Chou, J P; Choudalakis, G; Chuang, S H; Chung, K; Chung, W H; Chung, Y S; Ciljak, M; Ciobanu, C I; Ciocci, M A; Clark, A; Clark, D; Coca, M; Compostella, G; Convery, M E; Conway, J; Cooper, B; Copic, K; Cordelli, M; Cortiana, G; Crescioli, F; Cuenca Almenar, C; Cuevas, J; Culbertson, R; Cully, J C; Cyr, D; DaRonco, S; Datta, M; D'Auria, S; Davies, T; D'Onofrio, M; Dagenhart, D; de Barbaro, P; De Cecco, S; Deisher, A; De Lentdecker, G; Dell'Orso, M; Delli Paoli, F; Demortier, L; Deng, J; Deninno, M; De Pedis, D; Derwent, P F; Di Giovanni, G P; Dionisi, C; Di Ruzza, B; Dittmann, J R; DiTuro, P; Dörr, C; Donati, S; Donega, M; Dong, P; Donini, J; Dorigo, T; Dube, S; Efron, J; Erbacher, R; Errede, D; Errede, S; Eusebi, R; Fang, H C; Farrington, S; Fedorko, I; Fedorko, W T; Feild, R G; Feindt, M; Fernandez, J P; Field, R; Flanagan, G; Foland, A; Forrester, S; Foster, G W; Franklin, M; Freeman, J C; Furic, I; Gallinaro, M; Galyardt, J; Garcia, J E; Garberson, F; Garfinkel, A F; Gay, C; Gerberich, H; Gerdes, D; Giagu, S; Giannetti, P; Gibson, A; Gibson, K; Gimmell, J L; Ginsburg, C; Giokaris, N; Giordani, M; Giromini, P; Giunta, M; Giurgiu, G; Glagolev, V; Glenzinski, D; Gold, M; Goldschmidt, N; Goldstein, J; Golossanov, A; Gomez, G; Gomez-Ceballos, G; Goncharov, M; González, O; Gorelov, I; Goshaw, A T; Goulianos, K; Gresele, A; Griffiths, M; Grinstein, S; Grosso-Pilcher, C; Group, R C; Grundler, U; Guimaraes da Costa, J; Gunay-Unalan, Z; Haber, C; Hahn, K; Hahn, S R; Halkiadakis, E; Hamilton, A; Han, B-Y; Han, J Y; Handler, R; Happacher, F; Hara, K; Hare, M; Harper, S; Harr, R F; Harris, R M; Hartz, M; Hatakeyama, K; Hauser, J; Heijboer, A; Heinemann, B; Heinrich, J; Henderson, C; Herndon, M; Heuser, J; Hidas, D; Hill, C S; Hirschbuehl, D; Hocker, A; Holloway, A; Hou, S; Houlden, M; Hsu, S-C; Huffman, B T; Hughes, R E; Husemann, U; Huston, J; Incandela, J; Introzzi, G; Iori, M; Ishizawa, Y; Ivanov, A; Iyutin, B; James, E; Jang, D; Jayatilaka, B; Jeans, D; Jensen, H; Jeon, E J; Jindariani, S; Jones, M; Joo, K K; Jun, S Y; Jung, J E; Junk, T R; Kamon, T; Karchin, P E; Kato, Y; Kemp, Y; Kephart, R; Kerzel, U; Khotilovich, V; Kilminster, B; Kim, D H; Kim, H S; Kim, J E; Kim, M J; Kim, S B; Kim, S H; Kim, Y K; Kimura, N; Kirsch, L; Klimenko, S; Klute, M; Knuteson, B; Ko, B R; Kondo, K; Kong, D J; Konigsberg, J; Korytov, A; Kotwal, A V; Kovalev, A; Kraan, A C; Kraus, J; Kravchenko, I; Kreps, M; Kroll, J; Krumnack, N; Kruse, M; Krutelyov, V; Kubo, T; Kuhlmann, S E; Kuhr, T; Kusakabe, Y; Kwang, S; Laasanen, A T; Lai, S; Lami, S; Lammel, S; Lancaster, M; Lander, R L; Lannon, K; Lath, A; Latino, G; Lazzizzera, I; LeCompte, T; Lee, J; Lee, J; Lee, Y J; Lee, S W; Lefèvre, R; Leonardo, N; Leone, S; Levy, S; Lewis, J D; Lin, C; Lin, C S; Lindgren, M; Lipeles, E; Lister, A; Litvintsev, D O; Liu, T; Lockyer, N S; Loginov, A; Loreti, M; Loverre, P; Lu, R-S; Lucchesi, D; Lujan, P; Lukens, P; Lungu, G; Lyons, L; Lys, J; Lysak, R; Lytken, E; Mack, P; MacQueen, D; Madrak, R; Maeshima, K; Makhoul, K; Maki, T; Maksimovic, P; Malde, S; Manca, G; Margaroli, F; Marginean, R; Marino, C; Marino, C P; Martin, A; Martin, M; Martin, V; Martínez, M; Maruyama, T; Mastrandrea, P; Masubuchi, T; Matsunaga, H; Mattson, M E; Mazini, R; Mazzanti, P; McFarland, K S; McIntyre, P; McNulty, R; Mehta, A; Mehtala, P; Menzemer, S; Menzione, A; Merkel, P; Mesropian, C; Messina, A; Miao, T; Miladinovic, N; Miles, J; Miller, R; Mills, C; Milnik, M; Mitra, A; Mitselmakher, G; Miyamoto, A; Moed, S; Moggi, N; Mohr, B; Moore, R; Morello, M; Movilla Fernandez, P; Mülmenstädt, J; Mukherjee, A; Muller, Th; Mumford, R; Murat, P; Nachtman, J; Nagano, A; Naganoma, J; Nakano, I; Napier, A; Necula, V; Neu, C; Neubauer, M S; Nielsen, J; Nigmanov, T; Nodulman, L; Norniella, O; Nurse, E; Oh, S H; Oh, Y D; Oksuzian, I; Okusawa, T; Oldeman, R; Orava, R; Osterberg, K; Pagliarone, C; Palencia, E; Papadimitriou, V; Paramonov, A A; Parks, B; Pashapour, S; Patrick, J; Pauletta, G; Paulini, M; Paus, C; Pellett, D E; Penzo, A; Phillips, T J; Piacentino, G; Piedra, J; Pinera, L; Pitts, K; Plager, C; Pondrom, L; Portell, X; Poukhov, O; Pounder, N; Prakoshyn, F; Pronko, A; Proudfoot, J; Ptohos, F; Punzi, G; Pursley, J; Rademacker, J; Rahaman, A; Ranjan, N; Rappoccio, S; Reisert, B; Rekovic, V; Renton, P; Rescigno, M; Richter, S; Rimondi, F; Ristori, L; Robson, A; Rodrigo, T; Rogers, E; Rolli, S; Roser, R; Rossi, M; Rossin, R; Ruiz, A; Russ, J; Rusu, V; Saarikko, H; Sabik, S; Safonov, A; Sakumoto, W K; Salamanna, G; Saltó, O; Saltzberg, D; Sánchez, C; Santi, L; Sarkar, S; Sartori, L; Sato, K; Savard, P; Savoy-Navarro, A; Scheidle, T; Schlabach, P; Schmidt, E E; Schmidt, M P; Schmitt, M; Schwarz, T; Scodellaro, L; Scott, A L; Scribano, A; Scuri, F; Sedov, A; Seidel, S; Seiya, Y; Semenov, A; Sexton-Kennedy, L; Sfyrla, A; Shapiro, M D; Shears, T; Shepard, P F; Sherman, D; Shimojima, M; Shochet, M; Shon, Y; Shreyber, I; Sidoti, A; Sinervo, P; Sisakyan, A; Sjolin, J; Slaughter, A J; Slaunwhite, J; Sliwa, K; Smith, J R; Snider, F D; Snihur, R; Soderberg, M; Soha, A; Somalwar, S; Sorin, V; Spalding, J; Spinella, F; Spreitzer, T; Squillacioti, P; Stanitzki, M; Staveris-Polykalas, A; St Denis, R; Stelzer, B; Stelzer-Chilton, O; Stentz, D; Strologas, J; Stuart, D; Suh, J S; Sukhanov, A; Sun, H; Suzuki, T; Taffard, A; Takashima, R; Takeuchi, Y; Takikawa, K; Tanaka, M; Tanaka, R; Tecchio, M; Teng, P K; Terashi, K; Thom, J; Thompson, A S; Thomson, E; Tipton, P; Tiwari, V; Tkaczyk, S; Toback, D; Tokar, S; Tollefson, K; Tomura, T; Tonelli, D; Torre, S; Torretta, D; Tourneur, S; Trischuk, W; Tsuchiya, R; Tsuno, S; Turini, N; Ukegawa, F; Unverhau, T; Uozumi, S; Usynin, D; Vallecorsa, S; van Remortel, N; Varganov, A; Vataga, E; Vázquez, F; Velev, G; Veramendi, G; Veszpremi, V; Vidal, R; Vila, I; Vilar, R; Vine, T; Vollrath, I; Volobouev, I; Volpi, G; Würthwein, F; Wagner, P; Wagner, R G; Wagner, R L; Wagner, J; Wagner, W; Wallny, R; Wang, S M; Warburton, A; Waschke, S; Waters, D; Weinberger, M; Wester, W C; Whitehouse, B; Whiteson, D; Wicklund, A B; Wicklund, E; Williams, G; Williams, H H; Wilson, P; Winer, B L; Wittich, P; Wolbers, S; Wolfe, C; Wright, T; Wu, X; Wynne, S M; Yagil, A; Yamamoto, K; Yamaoka, J; Yamashita, T; Yang, C; Yang, U K; Yang, Y C; Yao, W M; Yeh, G P; Yoh, J; Yorita, K; Yoshida, T; Yu, G B; Yu, I; Yu, S S; Yun, J C; Zanello, L; Zanetti, A; Zaw, I; Zhang, X; Zhou, J; Zucchelli, S
2007-06-08
We measure the ratio of cross section times branching fraction, Rp=sigma chi c2 B(chi c2-->J/psi gamma)/sigma chi c1 B(chi c1-->J/psi gamma), in 1.1 fb(-1) of pp collisions at square root s=1.96 TeV. This measurement covers the kinematic range pT(J/psi)>4.0 GeV/c, |eta(J/psi)1.0 GeV/c. For events due to prompt processes, we find Rp=0.395+/-0.016(stat)+/-0.015(syst). This result represents a significant improvement in precision over previous measurements of prompt chi c1,2 hadro production.
Dicty_cDB: Contig-U05360-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ent library ... 74 1e-08 1 ( DY584577 ) C014-F9 Acropora millepora presettlement li...-08 1 ( EK287310 ) 1095462317178 Global-Ocean-Sampling_GS-31-01-01-1... 74 1e-08 1 ( DY585529 ) C009-D1 Acropora millepora presettlem
International Nuclear Information System (INIS)
Wuest, F.; Zessin, J.
2002-01-01
A novel method for a 11 C-C bond formation was developed, employing a cross-coupling reaction between a terminal acetylene and [ 11 C]methyl iodide. The method was used for the synthesis of 17α-([ 11 C]prop-1-ynyl)-3-methoxy-3,17β-estadiol. (orig.)
Dicty_cDB: Contig-U04975-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 6227.fwd CAWX Helobdella robusta Primary Ear... 34 3.5 2 ( DY542495 ) HPO-N-S01-0370-LF Hematopoietic cDNA library...0.95 2 ( DT742604 ) EST1176453 Aquilegia cDNA library Aquilegia formo... 36 0.95 2 ( AC178959 ) Strongylocentrotus purpuratu...43 ) EST1164393 Aquilegia cDNA library Aquilegia formo... 48 0.037 2 ( AC115684 ) Dictyostelium discoideum c...36815 ) MM2_2_4_C09 Sugar beet 10-week GH root cDNA Beta ... 50 0.087 1 ( CF886656 ) tric084xc11.b1 T.reesei mycelial culture..., Version... 50 0.087 1 ( CB907997 ) tric084xc11 T.reesei mycelial culture
Status and prospects for SiC-SiC composite materials development for fusion applications
International Nuclear Information System (INIS)
Sharafat, S.; Jones, R.H.; Kohyama, A.; Fenici, P.
1995-01-01
Silicon carbide (SiC) composites are very attractive for fusion applications because of their low afterheat and low activation characteristics coupled with excellent high temperature properties. These composites are relatively new materials that will require material development as well as evaluation of hermiticity, thermal conductivity, radiation stability, high temperature strength, fatigue, thermal shock, and joining techniques. The radiation stability of SiC-SiC composites is a critical aspect of their application as fusion components and recent results will be reported. Many of the non-fusion specific issues are under evaluation by other ceramic composite development programs, such as the US national continuous fiber ceramic composites.The current development status of various SiC-SiC composites research and development efforts is given. Effect of neutron irradiation on the properties of SiC-SiC composite between 500 and 1200 C are reported. Novel high temperature properties specific to ceramic matrix composite (CMC) materials are discussed. The chemical stability of SiC is reviewed briefly. Ongoing research and development efforts for joining CMC materials including SiC-SiC composites are described. In conclusion, ongoing research and development efforts show extremely promising properties and behavior for SiC-SiC composites for fusion applications. (orig.)
Dicty_cDB: Contig-U00509-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ajus EST, clone 018_5_01_j09. 46 2.5 1 ( FG297665 ) 1108793291434 New World Screw...worm Larvae 9387 EST... 46 2.5 1 ( FG290520 ) 1108793323763 New World Screwworm Egg 9261 ESTs C... 46 2.5 1 ...( FG290010 ) 1108793313314 New World Screwworm Egg 9261 ESTs C... 46 2.5 1 ( FG288325 ) 1108793266235 New World... Screwworm Egg 9261 ESTs C... 46 2.5 1 ( FG287243 ) 1108770736009 New World Sc
Integration of C1 and C2 Metabolism in Trees
Jardine, Kolby J.; Fernandes de Souza, Vinicius; Oikawa, Patty; Higuchi, Niro; Bill, Markus; Porras, Rachel; Niinemets, Ülo; Chambers, Jeffrey Q.
2017-01-01
C1 metabolism in plants is known to be involved in photorespiration, nitrogen and amino acid metabolism, as well as methylation and biosynthesis of metabolites and biopolymers. Although the flux of carbon through the C1 pathway is thought to be large, its intermediates are difficult to measure and relatively little is known about this potentially ubiquitous pathway. In this study, we evaluated the C1 pathway and its integration with the central metabolism using aqueous solutions of 13C-labele...
Damodara, Vijaya; Chen, Daniel H; Lou, Helen H; Rasel, Kader M A; Richmond, Peyton; Wang, Anan; Li, Xianchang
2017-05-01
Emissions from flares constitute unburned hydrocarbons, carbon monoxide (CO), soot, and other partially burned and altered hydrocarbons along with carbon dioxide (CO 2 ) and water. Soot or visible smoke is of particular concern for flare operators/regulatory agencies. The goal of the study is to develop a computational fluid dynamics (CFD) model capable of predicting flare combustion efficiency (CE) and soot emission. Since detailed combustion mechanisms are too complicated for (CFD) application, a 50-species reduced mechanism, LU 3.0.1, was developed. LU 3.0.1 is capable of handling C 4 hydrocarbons and soot precursor species (C 2 H 2 , C 2 H 4 , C 6 H 6 ). The new reduced mechanism LU 3.0.1 was first validated against experimental performance indicators: laminar flame speed, adiabatic flame temperature, and ignition delay. Further, CFD simulations using LU 3.0.1 were run to predict soot emission and CE of air-assisted flare tests conducted in 2010 in Tulsa, Oklahoma, using ANSYS Fluent software. Results of non-premixed probability density function (PDF) model and eddy dissipation concept (EDC) model are discussed. It is also noteworthy that when used in conjunction with the EDC turbulence-chemistry model, LU 3.0.1 can reasonably predict volatile organic compound (VOC) emissions as well. A reduced combustion mechanism containing 50 C 1 -C 4 species and soot precursors has been developed and validated against experimental data. The combustion mechanism is then employed in the computational fluid dynamics (CFD) of modeling of soot emission and combustion efficiency (CE) of controlled flares for which experimental soot and CE data are available. The validated CFD modeling tools are useful for oil, gas, and chemical industries to comply with U.S. Environmental Protection Agency's (EPA) mandate to achieve smokeless flaring with a high CE.
Synthesis of C3/C1-Substituted Tetrahydroisoquinolines
Directory of Open Access Journals (Sweden)
Mohamed Mihoubi
2015-08-01
Full Text Available A broad biological screening of the natural alkaloid N-methylisosalsoline (2 extracted from Hammada scoparia leaves against a panel of human and parasitic proteases revealed an interesting activity profile of 2 towards human 20S proteasome. This outcome suggests that the 1,2,3,4-tetrahydroisoquinoline skeleton may be exploited as a template for the development of novel anticancer agents. In this article, we report the synthesis and chemical characterization of a new series of isosalsoline-type alkaloids (10–11 with variations at N2 and C3 positions with respect to the natural Compound 2, obtained by a synthetic strategy that involves the Bischler-Napieralski cyclization. The substrate for the condensation to the tetrahydroisoquinoline system, i.e., a functionalized β-arylethyl amine, was obtained through an original double reduction of nitroalkene. The synthetic strategy can be directed to the construction of highly substituted and functionalized 1,2,3,4-tetrahydroisoquinolines.
Energy Technology Data Exchange (ETDEWEB)
Merriam, N.W.; Jha, M.C.
1991-11-01
This report is a final brief summary of development of a mild-gasification and char conversion process. Morgantown Energy Technology Center developed a concept called mild gasification. In this concept, devolatilization of coal under nonoxidizing and relatively mild temperature and pressure conditions can yield three marketable products: (1) a high-heating-value gas, (2) a high-aromatic coal liquid, and (3) a high-carbon char. The objective of this program is to develop an advanced, continuous, mild-gasification process to produce products that will make the concept economically and environmentally viable. (VC)
Ottinger, Elizabeth A.; Kao, Mark L.; Carrillo-Carrasco, Nuria; Yanjanin, Nicole; Shankar, Roopa Kanakatti; Janssen, Marjo; Brewster, Marcus; Scott, Ilona; Xu, Xin; Cradock, Jim; Terse, Pramod; Dehdashti, Seameen; Marugan, Juan; Zheng, Wei; Portilla, Lili; Hubbs, Alan; Pavan, William J.; Heiss, John; Vite, Charles H.; Walkley, Steven U.; Ory, Daniel S.; Silber, Steven A.; Porter, Forbes D.; Austin, Christopher P.; McKew, John C.
2014-01-01
In 2010, the National Institutes of Health (NIH) established the Therapeutics for Rare and Neglected Diseases (TRND) program within the National Center for Advancing Translational Science (NCATS), which was created to stimulate drug discovery and development for rare and neglected tropical diseases through a collaborative model between the NIH, academic scientists, nonprofit organizations, and pharmaceutical and biotechnology companies. This paper describes one of the first TRND programs, the development of 2-hydroxypropyl-β-cyclodextrin (HP-β-CD) for the treatment of Niemann-Pick disease type C1 (NPC1). NPC is a neurodegenerative, autosomal recessive rare disease caused by a mutation in either the NPC1 (about 95% of cases) or the NPC2 gene (about 5% of cases). These mutations affect the intracellular trafficking of cholesterol and other lipids, which leads to a progressive accumulation of unesterified cholesterol and glycosphingolipids in the CNS and visceral organs. Affected individuals typically exhibit ataxia, swallowing problems, seizures, and progressive impairment of motor and intellectual function in early childhood, and usually die in adolescence. There is no disease modifying therapy currently approved for NPC1 in the US. A collaborative drug development program has been established between TRND, public and private partners that has completed the pre-clinical development of HP-β-CD through IND filing for the current Phase I clinical trial that is underway. Here we discuss how this collaborative effort helped to overcome scientific, clinical and financial challenges facing the development of new drug treatments for rare and neglected diseases, and how it will incentivize the commercialization of HP-β-CD for the benefit of the NPC patient community. PMID:24283970
Targeting MUC1-C suppresses BCL2A1 in triple-negative breast cancer.
Hiraki, Masayuki; Maeda, Takahiro; Mehrotra, Neha; Jin, Caining; Alam, Maroof; Bouillez, Audrey; Hata, Tsuyoshi; Tagde, Ashujit; Keating, Amy; Kharbanda, Surender; Singh, Harpal; Kufe, Donald
2018-01-01
B-cell lymphoma 2-related protein A1 (BCL2A1) is a member of the BCL-2 family of anti-apoptotic proteins that confers resistance to treatment with anti-cancer drugs; however, there are presently no agents that target BCL2A1. The MUC1-C oncoprotein is aberrantly expressed in triple-negative breast cancer (TNBC) cells, induces the epithelial-mesenchymal transition (EMT) and promotes anti-cancer drug resistance. The present study demonstrates that targeting MUC1-C genetically and pharmacologically in TNBC cells results in the downregulation of BCL2A1 expression. The results show that MUC1-C activates the BCL2A1 gene by an NF-κB p65-mediated mechanism, linking this pathway with the induction of EMT. The MCL-1 anti-apoptotic protein is also of importance for the survival of TNBC cells and is an attractive target for drug development. We found that inhibiting MCL-1 with the highly specific MS1 peptide results in the activation of the MUC1-C→NF-κB→BCL2A1 pathway. In addition, selection of TNBC cells for resistance to ABT-737, which inhibits BCL-2, BCL-xL and BCL-W but not MCL-1 or BCL2A1, is associated with the upregulation of MUC1-C and BCL2A1 expression. Targeting MUC1-C in ABT-737-resistant TNBC cells suppresses BCL2A1 and induces death, which is of potential therapeutic importance. These findings indicate that MUC1-C is a target for the treatment of TNBCs unresponsive to agents that inhibit anti-apoptotic members of the BCL-2 family.
Dicty_cDB: Contig-U03328-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available aria DNA, clone: DAB1-004E12.F.fa, ... 48 0.16 1 ( EC770709 ) EST 7205 Guarana fruits cDNA library Paul...... 44 2.4 1 ( EI726036 ) 2B421023C20TR BAC library from breast tumor sampl... 44...s sativus) mature stigma l... 44 2.4 1 ( EV118860 ) 0124172 Brassica napus Root lib...rary Brassica napu... 44 2.4 1 ( ES560299 ) B79 Ascochyta rabiei induced library Cicer arieti..... 50 0.040 1 ( BM027318 ) GIT0000656 Root-induced cDNA library from Glomus ... 50 0.040 1 ( BI505723 ) BB17
Bosmans, Guy; Young, Jami F.; Hankin, Benjamin L.
2018-01-01
We examined the prediction that the interaction between Glucocorticoid Receptor Gene ("NR3C1") methylation, stress, and experienced maternal support predicts anxious and avoidant attachment development. This was tested in a general population sample of 487 children and adolescents (44% boys, M[subscript age] = 11.84, SD[subscript age] =…
Dicty_cDB: Contig-U16300-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 632 ) 95999.1 Cold Sweetening C Solanum tuberosum cDNA ... 62 2e-14 3 ( CK280013 ) EST726091 potato abiotic stress cDNA library...(Normalize... 72 6e-18 4 ( CK277106 ) EST723184 potato abiotic stress cDNA library Sola... 56 7e-18 4 ( CK25...na cDNA 5', ... 74 5e-14 4 ( CX082679 ) EHAB017TR E. histolytica Normalized cDNA library ... 52...( CX089904 ) EHAE563TR E. histolytica Normalized cDNA library ... 52 7e-14 4 ( EB...a strain T4 cDNA library. 56 1e-12 4 ( AB077052 ) Nicotiana tabacum NtCK2a3 mRNA for casein kina
Gautam, Kirti Amresh; Pooja, Singh; Sankhwar, Satya Narayan; Sankhwar, Pushp Lata; Goel, Apul; Rajender, Singh
2015-10-01
TGF-β1 is a pleiotropic cytokine, which plays a dual role in tumor development. In the early stages, it inhibits the growth of tumor while in the late stages of carcinoma, it promotes tumor growth. The purpose of this study was to analyze the distribution of the TGFB1 gene polymorphisms between cases and controls so as to assess their correlation with bladder cancer risk. This study included 237 cases of urinary bladder cancer and 290 age matched controls from the same ethnic background. Three polymorphisms in the TGFB1 gene, c.29C>T (rs-1800470), c.74G>C (rs-1800471) and +140A>G (rs-13447341), were analyzed by direct DNA sequencing. Statistical analyses revealed no significant differences in the demographical data, except that the frequencies of smokers and non-vegetarians were higher in the cases. Eighty percent of the bladder cancer patients had superficial transitional cell carcinoma, and 53.16% and 26.31% of the patients were in grade I and grade II, respectively. We found that c.29C>T substitution increased the risk of bladder cancer significantly and recessive model of analysis was the best fitted model (p=0.004; OR=1.72 95% CI 1.18-2.50). A significantly higher risk in the recessive form was also suggested by co-dominant analysis showing that the homozygous form (TT) was a significant risk factor in comparison to CC and CT genotypes. The other two polymorphisms, c.74G>C (p=0.18, OR=0.67 95% CI 0.37-1.21) and +140A>G (p=0.416, OR=0.77 95% CI 0.41-1.45) did not affect the risk of urinary bladder cancer. In conclusion, we found that the TGFB1 c.29C>T substitution increases the risk of bladder cancer significantly while c.74G>C and +140A>G polymorphisms do not affect the risk. Copyright © 2015 Elsevier Ltd. All rights reserved.
Pierobon, Francesca; Eastin, Ivan L; Ganguly, Indroneil
2018-01-01
Bio-jet fuels are emerging as a valuable alternative to petroleum-based fuels for their potential for reducing greenhouse gas emissions and fossil fuel dependence. In this study, residual woody biomass from slash piles in the U.S. Pacific Northwest is used as a feedstock to produce iso-paraffinic kerosene, through the production of sugar and subsequent patented proprietary fermentation and upgrading. To enhance the economic viability and reduce the environmental impacts of iso-paraffinic kerosene, two co-products, activated carbon and lignosulfonate, are simultaneously produced within the same bio-refinery. A cradle-to-grave life cycle assessment (LCA) is performed for the residual woody biomass-based bio-jet fuel and compared against the cradle-to-grave LCA of petroleum-based jet fuel. This paper also discusses the differences in the environmental impacts of the residual biomass-based bio-jet fuel using two different approaches, mass allocation and system expansion, to partition the impacts between the bio-fuel and the co-products, which are produced in the bio-refinery. The environmental assessment of biomass-based bio-jet fuel reveals an improvement along most critical environmental criteria, as compared to its petroleum-based counterpart. However, the results present significant differences in the environmental impact of biomass-based bio-jet fuel, based on the partitioning method adopted. The mass allocation approach shows a greater improvement along most of the environmental criteria, as compared to the system expansion approach. However, independent of the partitioning approach, the results of this study reveal that more than the EISA mandated 60% reduction in the global warming potential could be achieved by substituting petroleum-based jet fuel with residual woody biomass-based jet fuel. Converting residual woody biomass from slash piles into bio-jet fuel presents the additional benefit of avoiding the impacts of slash pile burning in the forest, which
Dicty_cDB: Contig-U03464-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available alar cDNA c... 46 2.8 1 ( GE530226 ) CCHS17029.b1_J09.ab1 CCHS Espina Barnadesia spino... 46 2.8 1 ( FK723110 ) av02122j19r1.1 Symbio...tic sea anemone (Anemonia vi... 46 2.8 1 ( FG396350 ) 000320KSFA001919HT (KSFA) A.
Dicty_cDB: Contig-U03730-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available us... 38 0.002 3 ( DC237378 ) Hodotermopsis sjoestedti cDNA clone: MY0684BHsMg_... 38 0.002 2 ( FD625418 ) s... 40 0.007 2 ( EJ329051 ) 1092963417437 Global-Ocean-Sampling_GS-28-01-01-1... 42 0.007 2 ( DA728805 ) Homo sapie... AGENCOURT_13629201 NIH_MGC_148 Homo sapiens cDNA ... 40 0.007 2 ( EK209959 ) 1095460095251 Global-Ocean-Sampli...8746 ) ox66e02.s1 Soares_NhHMPu_S1 Homo sapiens cDNA clo... 40 0.007 2 ( EJ828039 ) 1093017568475 Global-Ocean-Sampli...136358 ) 1092343604888 Global-Ocean-Sampling_GS-27-01-01-1... 54 0.008 1 ( BU801459 ) SJF2DDD09 SJF Schistosoma japonicum cDNA sim
Tak, Vijay; Purohit, Ajay; Pardasani, Deepak; Goud, D Raghavender; Jain, Rajeev; Dubey, D K
2014-11-28
Environmental markers of chemical warfare agents (CWAs) comprise millions of chemical structures. The simultaneous detection and identification of these environmental markers poses difficulty due to their diverse chemical properties. In this work, by using ultra-high performance liquid chromatography-quadrupole time-of-flight mass spectrometry (UHPLC-QTOF), a generic analytical method for the detection and identification of wide range of environmental markers of CWAs (including precursors, degradation and co-products of nerve agents and sesqui-mustards) in drinking water, was developed. The chromatographic analysis of 55 environmental markers of CWAs including isomeric and isobaric compounds was accomplished within 20 min, using 1.8 μm particle size column. Subsequent identification of the compounds was achieved by the accurate mass measurement of either protonated molecule [M+H](+) or ammonium adduct [M+NH4](+) and fragment ions. Isomeric and isobaric compounds were distinguished by chromatographic retention time, characteristic fragment ions generated by both in-source collision induced dissociation (CID) and CID in the collision cell by MS/MS experiments. The exact mass measurement errors for all ions were observed less than 3 ppm with internal calibration. The method limits of detection (LODs) and limits of quantification (LOQs) were determined in drinking water and found to be 1-50 ng mL(-1) and 5-125 ng mL(-1), respectively. Applicability of the proposed method was proved by determining the environmental markers of CWAs in aqueous samples provided by Organization for the Prohibition of Chemical Weapons during 34th official proficiency test. Copyright © 2014 Elsevier B.V. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Eric Larson; Robert Williams; Thomas Kreutz; Ilkka Hannula; Andrea Lanzini; Guangjian Liu
2012-03-11
The overall objective of this project was to quantify the energy, environmental, and economic performance of industrial facilities that would coproduce electricity and transportation fuels or chemicals from a mixture of coal and biomass via co-gasification in a single pressurized, oxygen-blown, entrained-flow gasifier, with capture and storage of CO{sub 2} (CCS). The work sought to identify plant designs with promising (Nth plant) economics, superior environmental footprints, and the potential to be deployed at scale as a means for simultaneously achieving enhanced energy security and deep reductions in U.S. GHG emissions in the coming decades. Designs included systems using primarily already-commercialized component technologies, which may have the potential for near-term deployment at scale, as well as systems incorporating some advanced technologies at various stages of R&D. All of the coproduction designs have the common attribute of producing some electricity and also of capturing CO{sub 2} for storage. For each of the co-product pairs detailed process mass and energy simulations (using Aspen Plus software) were developed for a set of alternative process configurations, on the basis of which lifecycle greenhouse gas emissions, Nth plant economic performance, and other characteristics were evaluated for each configuration. In developing each set of process configurations, focused attention was given to understanding the influence of biomass input fraction and electricity output fraction. Self-consistent evaluations were also carried out for gasification-based reference systems producing only electricity from coal, including integrated gasification combined cycle (IGCC) and integrated gasification solid-oxide fuel cell (IGFC) systems. The reason biomass is considered as a co-feed with coal in cases when gasoline or olefins are co-produced with electricity is to help reduce lifecycle greenhouse gas (GHG) emissions for these systems. Storing biomass-derived CO
Dicty_cDB: Contig-U16414-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ( CB282081 ) BT0047 Blomia tropicalis cDNA library Blomia trop... 52 9e-19 4 ( EX370580 ) GQ03219.B7_O07 GQ032 - Shoot ti...on of useful proteins deri... 72 1e-29 5 ( DR930447 ) EST1121986 Aquilegia cDNA library...63 ) EST1191412 Aquilegia cDNA library Aquilegia formo... 88 5e-26 2 ( DB657321 ) Saccharomyces cere... 64 1e-21 4 ( DT739515 ) EST1173364 Aquilegia cDNA library Aquilegia formo... 70 1e-21 3 ( CF609239 ) INFIO01_000017 Grape Inflore... ( DT733254 ) EST1167104 Aquilegia cDNA library Aquilegia formo... 68 8e-21 5 ( FF717444 ) XABT35772.fwd Gateway compati
Evaluation report on CCTF Core-I reflood tests C1-5 (Run 14), C1-7 (Run 16) and C1-14 (Run 23)
International Nuclear Information System (INIS)
Sugimoto, Jun; Muurao, Yoshio
1983-02-01
The present report describes the effects of the initial clad temperature on the reflood phenomena observed in the Cylindrical Core Test Facility (CCTF) at Japan Atomic Energy Research Institute. The evaluation is based on the data of tests C1-5, C1-7 and C1-14 of the CCTF-Core I test series. Nominal initial peak clad temperatures in these tests are 600 0 C, 700 0 C and 800 0 C, respectively. With the higher initial clad temperature, the higher loop mass flow rate and the lower water accumulation in the core and the upper plenum were obtained in an early reflood transient. However, the core inlet flow conditions, which is sensitive to the core cooling, were not much affected by the higher initial clad temperature. The slower quench front propagation was observed with the higher initial clad temperature. However, the heat transfer coefficient was almost identical with each other before the turnaround time, which resulted in the lower temperature rise with the highest initial clad temperature. This qualitatively agreed with the results of the forced feed FLECHT experiment. (author)
Dicty_cDB: Contig-U00886-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available clone XX-231B7, co... 44 8.7 1 ( FJ393927 ) Schistocerca cancellata isolate C2J 12S ribosomal... 44 8.7 1 ( ...FJ393926 ) Schistocerca cancellata isolate C1J 12S ribosomal... 44 8.7 1 ( CP000372 ) Drosophila melanogaste
Dicty_cDB: Contig-U16424-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available -05 8 ( FK751038 ) av02129i18r1.1 Symbiotic sea anemone (Anemonia vi... 60 9e-05 3 ( FE230988 ) CAPG10114.fw... primary mesenchyme cell cDNA ... 60 0.001 1 ( FK740079 ) av02058c02r1.1 Symbiotic sea anemone (Anemonia vi.
DEFF Research Database (Denmark)
Scheel, Troels Kasper Høyer; Gottwein, Judith Margarete; Jensen, Tina Birk
2008-01-01
in serial passages. Sequence analysis of recovered viruses and subsequent reverse genetic studies revealed a vital dependence on one or two NS2 mutations, depending on the 4a/2a junction. Infectivity of ED43/JFH1 viruses was CD81 dependent. The genotype 4 cell culture systems permit functional analyses...... as well as drug and vaccine research on an increasingly important genotype in the Middle East, Africa, and Europe. We also developed genotype 1a intergenotypic recombinants from H77C with vital mutations in NS3. Using H77C/JFH1 and ED43/JFH1 viruses, we demonstrated high homologous neutralizing antibody...... titers in 1a and 4a patient sera, respectively. Furthermore, availability of JFH1 viruses with envelope proteins of the six major HCV genotypes permitted cross-neutralization studies; 1a and 4a serum cross-neutralized 1a, 4a, 5a, and 6a but not 2a and 3a viruses. Thus, the JFH1 intergenotypic...
Cell Death in C. elegans Development.
Malin, Jennifer Zuckerman; Shaham, Shai
2015-01-01
Cell death is a common and important feature of animal development, and cell death defects underlie many human disease states. The nematode Caenorhabditis elegans has proven fertile ground for uncovering molecular and cellular processes controlling programmed cell death. A core pathway consisting of the conserved proteins EGL-1/BH3-only, CED-9/BCL2, CED-4/APAF1, and CED-3/caspase promotes most cell death in the nematode, and a conserved set of proteins ensures the engulfment and degradation of dying cells. Multiple regulatory pathways control cell death onset in C. elegans, and many reveal similarities with tumor formation pathways in mammals, supporting the idea that cell death plays key roles in malignant progression. Nonetheless, a number of observations suggest that our understanding of developmental cell death in C. elegans is incomplete. The interaction between dying and engulfing cells seems to be more complex than originally appreciated, and it appears that key aspects of cell death initiation are not fully understood. It has also become apparent that the conserved apoptotic pathway is dispensable for the demise of the C. elegans linker cell, leading to the discovery of a previously unexplored gene program promoting cell death. Here, we review studies that formed the foundation of cell death research in C. elegans and describe new observations that expand, and in some cases remodel, this edifice. We raise the possibility that, in some cells, more than one death program may be needed to ensure cell death fidelity. © 2015 Elsevier Inc. All rights reserved.
(Benzyl isocyanide-κC1chlorido(2-chloro-3-dimethylamino-1-phenylprop-1-en-1-yl-κ2C1,Npalladium(II
Directory of Open Access Journals (Sweden)
Ana C. Mafud
2013-01-01
Full Text Available In the title compound, [Pd(C11H13ClNCl(C8H7N], which crystallized in the chiral space group P212121, the PdII atom is coordinated by two C atoms, a Csp2 atom of the 2-chloro-3-dimethylamino-1-phenylprop-1-en-1-yl ligand and a Csp atom from the benzyl isocyanide ligand, as well as an N atom of the ligand and a Cl atom, in a square-planar geometry. In the complex, there is a short C—H...Cl hydrogen bond and a C—H...π interaction. In the crystal, molecules are linked via C—H...Cl hydrogen bonds, forming chains along the a-axis direction.
... Why Are Hemoglobin A1c Tests Done? When a child has diabetes, hemoglobin A1c levels are followed to see how well medicines are working. If a child with diabetes has a high hemoglobin A1c level, it may ...
26 CFR 1.381(c)(2)-1 - Earnings and profits.
2010-04-01
... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Earnings and profits. 1.381(c)(2)-1 Section 1.381(c)(2)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Insolvency Reorganizations § 1.381(c)(2)-1 Earnings and profits. (a) In...
26 CFR 1.381(c)(3)-1 - Capital loss carryovers.
2010-04-01
... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Capital loss carryovers. 1.381(c)(3)-1 Section 1.381(c)(3)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Insolvency Reorganizations § 1.381(c)(3)-1 Capital loss carryovers. (a...
Dicty_cDB: Contig-U04009-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 7 ) Le_emtis_210C02_M13R29 Little skate (Leucoraja er... 46 1.5 1 ( FK750322 ) av02087c17r1.1 Symbiotic sea ...anemone (Anemonia vi... 46 1.5 1 ( FK745011 ) av01018o18r1.1 Symbiotic sea anemone (Anemonia vi... 46 1.5 1 ...( FK732517 ) av01041d03r1.1 Symbiotic sea anemone (Anemonia vi... 46 1.5 1 ( EY42
Guyenet, Patrice G; Stornetta, Ruth L; Bochorishvili, Genrieta; Depuy, Seth D; Burke, Peter G R; Abbott, Stephen B G
2013-08-01
The C1 neurons reside in the rostral and intermediate portions of the ventrolateral medulla (RVLM, IVLM). They use glutamate as a fast transmitter and synthesize catecholamines plus various neuropeptides. These neurons regulate the hypothalamic pituitary axis via direct projections to the paraventricular nucleus and regulate the autonomic nervous system via projections to sympathetic and parasympathetic preganglionic neurons. The presympathetic C1 cells, located in the RVLM, are probably organized in a roughly viscerotopic manner and most of them regulate the circulation. C1 cells are variously activated by hypoglycemia, infection or inflammation, hypoxia, nociception, and hypotension and contribute to most glucoprivic responses. C1 cells also stimulate breathing and activate brain stem noradrenergic neurons including the locus coeruleus. Based on the various effects attributed to the C1 cells, their axonal projections and what is currently known of their synaptic inputs, subsets of C1 cells appear to be differentially recruited by pain, hypoxia, infection/inflammation, hemorrhage, and hypoglycemia to produce a repertoire of stereotyped autonomic, metabolic, and neuroendocrine responses that help the organism survive physical injury and its associated cohort of acute infection, hypoxia, hypotension, and blood loss. C1 cells may also contribute to glucose and cardiovascular homeostasis in the absence of such physical stresses, and C1 cell hyperactivity may contribute to the increase in sympathetic nerve activity associated with diseases such as hypertension.
Stornetta, Ruth L.; Bochorishvili, Genrieta; DePuy, Seth D.; Burke, Peter G. R.; Abbott, Stephen B. G.
2013-01-01
The C1 neurons reside in the rostral and intermediate portions of the ventrolateral medulla (RVLM, IVLM). They use glutamate as a fast transmitter and synthesize catecholamines plus various neuropeptides. These neurons regulate the hypothalamic pituitary axis via direct projections to the paraventricular nucleus and regulate the autonomic nervous system via projections to sympathetic and parasympathetic preganglionic neurons. The presympathetic C1 cells, located in the RVLM, are probably organized in a roughly viscerotopic manner and most of them regulate the circulation. C1 cells are variously activated by hypoglycemia, infection or inflammation, hypoxia, nociception, and hypotension and contribute to most glucoprivic responses. C1 cells also stimulate breathing and activate brain stem noradrenergic neurons including the locus coeruleus. Based on the various effects attributed to the C1 cells, their axonal projections and what is currently known of their synaptic inputs, subsets of C1 cells appear to be differentially recruited by pain, hypoxia, infection/inflammation, hemorrhage, and hypoglycemia to produce a repertoire of stereotyped autonomic, metabolic, and neuroendocrine responses that help the organism survive physical injury and its associated cohort of acute infection, hypoxia, hypotension, and blood loss. C1 cells may also contribute to glucose and cardiovascular homeostasis in the absence of such physical stresses, and C1 cell hyperactivity may contribute to the increase in sympathetic nerve activity associated with diseases such as hypertension. PMID:23697799
Dicty_cDB: Contig-U03778-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available DY679985 ) TTDA465TO Tetrahymena thermophila EST library str... 62 7e-09 3 ( CJ948566 ) Triticum aestivum cDNA clone:whchul...spotted knapweed Cen... 42 1e-07 4 ( EX126122 ) BR109952 etiolated mature leaf cDNA library KHLW ... 52 1e-0...cDNA cl... 48 2e-07 2 ( EG402891 ) BG01043A2F03.f1 BG01 - normalized library Leymus ... 48 2e-07 2 ( CJ650115 ) Triticum aesti...NA, gonad clone:mtgd004b03,... 60 4e-09 2 ( EX123216 ) BR107046 mature green leaf cDNA library...... 64 3e-21 5 ( CK272276 ) EST718354 potato abiotic stress cDNA library Sola... 44 2e-20 6 ( AM910992
Energy Technology Data Exchange (ETDEWEB)
Imazono, Takashi [Quantum Beam Science Center, Japan Atomic Energy Agency, 8-1-7, Umemidai, Kizugawa, Kyoto 619-0216 (Japan)
2016-07-27
To develop a flat-field spectrometer with coverage of the 1–3.5 keV range, a wideband Ni/C multilayer grating was invented. The multilayer consists of two kinds of layer structures. One is a conventional periodic multilayer of thickness D{sub 1} = 5.6 nm, Ni thickness ratio to the multilayer period γ{sub 1} = 0.5 and the number of layers N{sub 1} = 79. Both the first and last layers are Ni. The other is a C/Ni bilayer of D{sub 2} = 8.4 nm, γ{sub 2} = 0.53 and N{sub 2} = 2. The first layer is C and then Ni. The aperiodic multilayer from the topmost C/Ni bilayer was coated on a laminar-type grating having an effective grating constant of 1/2400 mm, groove depth of 2.8 nm, and duty ratio (land width/groove period) of 0.5. In a preliminary experiment, the diffraction efficiency was in excess of 0.8% in the energy range of 2.1-3.3 keV and the maximum of 5.4% at 3.1 keV at a constant angle of incidence of 88.54°, which is considerably higher than that of an Au-coated grating before deposition of the multilayer.
Dicty_cDB: Contig-U06875-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available . 44 3.6 1 ( DW405755 ) EST000176 Trichophyton rubrum cDNA library Tricho... 44 3.6 1 ( AU269367 ) Dictyostelium discoideum vegetati...5aa06.g2 hhd Oryza coarctata genomic clone ... 46 0.91 1 ( EV115075 ) 0120387 Brassica napus Root library Brassic...ES Homo sapiens cDNA 5', mRNA ... 46 0.91 1 ( CF872366 ) tric002xo14.b11 T.reesei mycelial culture...4 3.6 1 ( ES282448 ) PQ037G01.XT7 non-sporulating culture of P. brassi... 44 3.6 1 ( EL772758 ) Plate_11b_G10 Hibernati...ng 13-lined squirrel brain... 44 3.6 1 ( EC618786 ) S_F11_a1_093.ab1 Rabbit heart cDNA library Or
Synthesis of ethanol {sup 14}C-1; Synthese d'ethanol {sup 14}C-1
Energy Technology Data Exchange (ETDEWEB)
Wolff, R E; Pichat, L [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1958-07-01
The direct reduction by LiAlH{sub 4}, of a suspension of anhydrous sodium acetate in tetra-hydro-furfuryl-oxy-tetra-hydro-pyran is described. This study has shown that the ethanol thus obtained is impure and that the yields are erratic. On the contrary the reduction of acetyl chloride 1-{sup 14}C by LiAlH{sub 4}, in 'diethyl carbitol' leads to ethanol 1-{sup 14}C of satisfactory purity with a yield of about 71 percent. (author) [French] Une etude de la reduction directe par LiAlH{sub 4}, de l'acetate de soude anhydre en suspension dans le tetrahydrofurfuryloxytetrahydropyrane est decrite. Cette etude a montre que l'on obtient de l'ethanol souille d'impuretes, avec un rendement variable. Par contre, la reduction du chlorure d'acetyle {sup 14}C-1 par LiAlH{sub 4}, dans le 'diethyl carbitol' conduit a l'ethanol {sup 14}C-1 de purete convenable avec un rendement de l'ordre de 71 pour cent. (auteur)
Dicty_cDB: Contig-U04229-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 9 ) HAE00002983 Home-made, regular (lib1_ha) Histiona... 44 0.001 2 ( CK888692 ) SGP160684 Atlantic salmon Liver cDNA library...2 ( DE224908 ) Trifolium pratense DNA, clone:RCG16896. 42 4e-04 2 ( CK888010 ) SGP149211 Atlantic salmon Liver cDNA library...A for TCP1 protein. 46 6e-04 2 ( CK887535 ) SGP164401 Atlantic salmon Kidney cDNA library Sal... 44 6e-04 2 ...mo salar cDNA, mRNA sequence. 44 0.001 2 ( CK889382 ) SGP161400 Atlantic salmon Liver cDNA library Salm... 4... salmon Liver cDNA library Salm... 44 0.001 2 ( CK888710 ) SGP160704 Atlantic salmon Liver cDNA library
Dicty_cDB: Contig-U00762-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available s nodule library 5 and... 42 0.012 2 ( BI417355 ) LjNEST38c2r Lotus japonicus nodule library...KT7B.103O19F.060124T7 KT7 Nicotiana tabacum cDNA ... 36 0.012 2 ( CK417989 ) AUF_IpInt_57_n24 Intestine cDNA library Ictalur...3' end. 42 0.012 2 ( FG637668 ) TT-33_B14 Samsun trichome library Nicotiana tabac... 36 0.012 2 ( CX557480 ) yda37e04.y2 Sea ur...( CX552206 ) ydb21c02.y2 Sea urchin EST Lib1 Strongylocentrotu... 42 9e-04 2 ( DN149991 ) 5218_B03_C06 Switchgrass callus cDNA librar...10F Mouse 10kb plasmid UUGC1M library Mus ... 42 0.003 2 ( BQ858872 ) QGC11H15.yg.ab1 QG_ABCDI lettuce salinas Lactu
Kwok, Chau-To; Vogelaar, Ingrid P; van Zelst-Stams, Wendy A; Mensenkamp, Arjen R; Ligtenberg, Marjolijn J; Rapkins, Robert W; Ward, Robyn L; Chun, Nicolette; Ford, James M; Ladabaum, Uri; McKinnon, Wendy C; Greenblatt, Marc S; Hitchins, Megan P
2014-05-01
Germline mutations of the DNA mismatch repair genes MLH1, MSH2, MSH6 or PMS2, and deletions affecting the EPCAM gene adjacent to MSH2, underlie Lynch syndrome by predisposing to early-onset colorectal, endometrial and other cancers. An alternative but rare cause of Lynch syndrome is constitutional epimutation of MLH1, whereby promoter methylation and transcriptional silencing of one allele occurs throughout normal tissues. A dominantly transmitted constitutional MLH1 epimutation has been linked to an MLH1 haplotype bearing two single-nucleotide variants, NM_000249.2: c.-27C>A and c.85G>T, in a Caucasian family with Lynch syndrome from Western Australia. Subsequently, a second seemingly unrelated Caucasian Australian case with the same MLH1 haplotype and concomitant epimutation was reported. We now describe three additional, ostensibly unrelated, cancer-affected families of European heritage with this MLH1 haplotype in association with constitutional epimutation, bringing the number of index cases reported to five. Array-based genotyping in four of these families revealed shared haplotypes between individual families that extended across ≤2.6-≤6.4 megabase regions of chromosome 3p, indicating common ancestry. A minimal ≤2.6 megabase founder haplotype common to all four families was identified, which encompassed MLH1 and additional flanking genes and segregated with the MLH1 epimutation in each family. Our findings indicate that the MLH1 c.-27C>A and c.85G>T variants are borne on a European ancestral haplotype and provide conclusive evidence for its pathogenicity via a mechanism of epigenetic silencing of MLH1 within normal tissues. Additional descendants bearing this founder haplotype may exist who are also at high risk of developing Lynch syndrome-related cancers.
Transcriptional factor PU.1 regulates decidual C1q expression in early pregnancy in human
Directory of Open Access Journals (Sweden)
Priyaa Madhukaran Raj
2015-02-01
Full Text Available C1q is the first recognition subcomponent of the complement classical pathway, which in addition to being synthesized in the liver, is also expressed by macrophages and dendritic cells. Trophoblast invasion during early placentation results in accumulation of debris that triggers the complement system. Hence, both early and late components of the classical pathway are widely distributed in the placenta and decidua. In addition, C1q has recently been shown to significantly contribute to feto-maternal tolerance, trophoblast migration, and spiral artery remodeling, although the exact mechanism remains unknown. Pregnancy in mice, genetically deficient in C1q, mirrors symptoms similar to that of human preeclampsia. Thus, regulated complement activation has been proposed as an essential requirement for normal successful pregnancy. Little is known about the molecular pathways that regulate C1q expression in pregnancy. PU.1, an Ets-family transcription factor, is required for the development of hematopoietic myeloid lineage immune cells, and its expression is tissue- specific. Recently, PU.1 has been shown to regulate C1q gene expression in dendritic cells and macrophages. Here, we have examined if PU.1 transcription factor regulates decidual C1q expression. We used immune-histochemical analysis, PCR and immunostaining to localize and study the gene expression of PU.1 transcription factor in early human decidua. PU.1 was highly expressed at gene and protein level in early human decidual cells including trophoblast and stromal cells. Surprisingly, nuclear as well as cytoplasmic PU.1 expression was observed. Decidual cells with predominantly nuclear PU.1 expression had higher C1q expression. It is likely that nuclear and cytoplasmic PU.1 localization has a role to play in early pregnancy via regulating C1q expression in the decidua during implantation.
Applying Enzymatic Cascades for ISCPR in ω-transaminase Systems
DEFF Research Database (Denmark)
Janes, Kresimir; Woodley, John; Tufvesson, Pär
, esterases, ketoreductases and proteases and many more emerging biocatalysts such are monoamine oxidases, transaminases and P450 monooxygenases to name a few. The focus of this thesis is the biocatalytic synthesis of small molecule pharmaceuticals (Mw... in an industrial process context have thus not been considered properly. In this research lactate dehydrogenase (LDH) (E.C. 1.1.1.27), alanine dehydrogenase (E.C. 1.4.1.1) (AlaDH) and yeast alcohol dehydrogenase (E.C. 1.1.1.1) (YADH) have been researched as co-product degrading enzymes and glucose dehydrogenase...
Dicty_cDB: Contig-U04515-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available _L3A_SL1 Nippo... 46 0.008 2 ( FG287049 ) 1108770728167 New World Screwworm Egg 9261 ESTs C... 46 0.009 2 ( ...FG294927 ) 1108770721339 New World Screwworm Larvae 9387 EST... 46 0.009 2 ( FG28...9781 ) 1108793305302 New World Screwworm Egg 9261 ESTs C... 46 0.009 2 ( CK096156 ) UA48BPF09.3pR Populus do...09 1 ( BU819882 ) UA48BPF09 Populus tremula cambium cDNA library Po... 54 0.009 1 ( FG288449 ) 1108793271723 New World... Screwworm Egg 9261 ESTs C... 46 0.010 2 ( FG299008 ) 1108793324740 New World Screwworm Larvae 938
Dicty_cDB: Contig-U01649-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ... 54 0.009 1 ( FL645158 ) TS48-B12 Reticulitermes flavipes symbiont library...um slug cDNA, clone SSL339. 357 5e-94 1 ( CX086000 ) EHACD50TR E. histolytica Normalized cDNA library... ... 86 5e-21 3 ( CX079571 ) EHAA042TF E. histolytica Normalized cDNA library ... 86 6e-...21 3 ( CX089649 ) EHAE215TR E. histolytica Normalized cDNA library ... 86 6e-21 3 ( CX098388 ) EHAHL09TR E. histolytic...a Normalized cDNA library ... 86 7e-21 3 ( CX095481 ) EHAGE33TR E. histolytic
Dicty_cDB: Contig-U16423-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 65776 ) Dictyostelium discoideum cDNA clone:ddc36f16, 5' ... 74 3e-22 2 ( FG288312 ) 1108793266221 New World... 4e-19 3 ( FI057728 ) CHO_OF6610xh18r1.ab1 CHO_OF6 Nicotiana tabacum ge... 64 6e-19 3 ( FG286148 ) 1108770713996 New World...9c24,... 90 7e-18 3 ( CJ411606 ) Molgula tectiformis cDNA, larva clone:mtlv010d03,... 90 7e-18 3 ( FG288831 ) 1108793284713 New World...e-13 2 ( FG299437 ) 1108793335742 New World Screwworm Larvae 9387 EST... 80 2e-13 2 ( DV613229 ) EST1216225 ...BJ379331 ) Dictyostelium discoideum cDNA clone:ddc34c13, 3' ... 90 5e-13 1 ( FG300027 ) 1108793358668 New World
Dicty_cDB: Contig-U15610-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 32 1 ( DT767192 ) EST1201041 Aquilegia cDNA library Aquilegia formo... 42 0.040 3 ( EU151142 ) Haemophilus haemolyticu...e... 48 2.0 1 ( ET896158 ) CHO_OF385xi02r1.ab1 CHO_OF Nicotiana tabacum geno... 48 2.0 1 ( EI773383 ) PM1006E24TF BAC library...46 7.9 1 ( AG294250 ) Mus musculus molossinus DNA, clone:MSMg01-070C15.... 46 7.9 1 ( ES370059 ) 5-CP713-021G04 Normalized cDNA libra...03850-501 Normalized CNS library (juven... 42 1.1 2 ( EX859113 ) CBNF4825.rev CBN... 4 ( DU743946 ) ASNC1989.g2 HF10_10-07-02 uncultured marine micro... 38 2.5 3 ( EK037583 ) 1092959478755 Glo
Gonzales, Melissa; Bowden, G Tim
2002-06-26
The ultraviolet B (UVB) portion (280-320 nm) of the ultraviolet spectrum has been shown to contribute to the development of non-melanoma skin cancer in humans. Research in the human keratinocyte cell line, HaCaT, revealed that UVB irradiation caused the upregulation of the transcription factor activator protein-1 (AP-1). The AP-1 complex formed in UVB-irradiated HaCaT cells is specifically composed of c-fos and Jun D. c-Fos expression was induced in a manner that correlated with the UVB-induced activation of AP-1. To investigate how c-fos expression is regulated by UVB irradiation, the role of each of four cis elements within the c-fos promoter was evaluated. Clustered point mutations at the sis inducible element (SIE), serum response element (SRE), c-fos AP-1 site (FAP1), or cyclic AMP response elements (CRE) significantly inhibited UVB induction of the c-fos promoter. This indicated that all four cis elements are required for maximum promoter activity. The CRE and FAP1 elements were the two most active cis elements that mediate the UVB transactivation of c-fos. Homodimers of phosphorylated cAMP response element binding protein (CREB) were induced by UVB irradiation to bind to each of these elements. Therefore, CREB may function as an important regulatory protein in the UVB-induced expression of c-fos.
c-C5H5 on a Ni(1 1 1) surface: Theoretical study of the adsorption, electronic structure and bonding
International Nuclear Information System (INIS)
German, E.; Simonetti, S.; Pronsato, E.; Juan, A.; Brizuela, G.
2008-01-01
In the present work the ASED-MO method is applied to study the adsorption of cyclopentadienyl anion on a Ni(1 1 1) surface. The adsorption with the centre of the aromatic ring placed above the hollow position has been identified to be energetically the most favourable. The aromatic ring remains almost flat, the H atoms are tilted 17 deg. away from the metal surface. We modelled the metal surface by a two-dimensional slab of finite thickness, with an overlayer of c-C 5 H 5 - , one c-C 5 H 5 - per nine surface Ni atoms. The c-C 5 H 5 - molecule is attached to the surface with its five C atoms bonding mainly with three Ni atoms. The Ni-Ni bond in the underlying surface and the C-C bonds of c-C 5 H 5 - are weakened upon adsorption. We found that the band of Ni 5d z 2 orbitals plays an important role in the bonding between c-C 5 H 5 - and the surface, as do the Ni 6s and 6p z bands
Recent Progress in Electrochemical HbA1c Sensors: A Review
Directory of Open Access Journals (Sweden)
Baozhen Wang
2015-03-01
Full Text Available This article reviews recent progress made in the development of electrochemical glycated hemoglobin (HbA1c sensors for the diagnosis and management of diabetes mellitus. Electrochemical HbA1c sensors are divided into two categories based on the detection protocol of the sensors. The first type of sensor directly detects HbA1c by binding HbA1c on the surface of an electrode through bio-affinity of antibody and boronic acids, followed by an appropriate mode of signal transduction. In the second type of sensor, HbA1c is indirectly determined by detecting a digestion product of HbA1c, fructosyl valine (FV. Thus, the former sensors rely on the selective binding of HbA1c to the surface of the electrodes followed by electrochemical signaling in amperometric, voltammetric, impedometric, or potentiometric mode. Redox active markers, such as ferrocene derivatives and ferricyanide/ferrocyanide ions, are often used for electrochemical signaling. For the latter sensors, HbA1c must be digested in advance by proteolytic enzymes to produce the FV fragment. FV is electrochemically detected through catalytic oxidation by fructosyl amine oxidase or by selective binding to imprinted polymers. The performance characteristics of HbA1c sensors are discussed in relation to their use in the diagnosis and control of diabetic mellitus.
Dicty_cDB: Contig-U06086-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 34 1.9 2 ( CT531391 ) A BAC library has been constructed from cultivar ... 34 1.9 3 ( CT536760 ) A BAC lib...u... 36 2.9 2 ( CT504385 ) A BAC library has been constructed from cultivar ... 38 3.0 2 ( BX005275 ) ...1 ( DH327531 ) Oryzias latipes Fosmid clone:GOLWFno690_k15, forw... 46 3.2 1 ( CT562554 ) A BAC library has been constructed from cul...9 ) 16372 Swollen Stolon Solanum tuberosum cDNA, mRNA... 48 0.81 1 ( CK277118 ) EST723196 potato abiotic stress cDNA library... Sola... 48 0.81 1 ( CK277117 ) EST723195 potato abiotic stress cDNA library Sola... 48 0.81
Human genes for complement components C1r and C1s in a close tail-to-tail arrangement
International Nuclear Information System (INIS)
Kusumoto, H.; Hirosawa, S.; Salier, J.P.; Hagen, F.S.; Kurachi, K.
1988-01-01
Complementary DNA clones for human C1s were isolated from cDNA libraries that were prepared with poly(A) + RNAs of human liver and HepG2 cells. A clone with the largest cDNA insert of 2,664 base pairs (bp) was analyzed for its complete nucleotide sequence. It contained 202 bp of a 5' untranslated region, 45 bp of coding for a signal peptide (15 amino acid residues), 2,019 bp for complement component C1s zymogen (673 amino acid residues), 378 bp for a 3' untranslated region, a stop codon, and 17 bp of a poly(A) tail. The amino acid sequence of C1s was 40.5% identical to that of C1r, with excellent matches of tentative disulfide bond locations conserving the overall domain structure of C1r. DNA blotting and sequencing analyses of genomic DNA and of an isolated genomic DNA clone clearly showed that the human genes for C1r and C1s are closely located in a tail-to-tail arrangement at a distance of about 9.5 kilobases. Furthermore, RNA blot analyses showed that both C1r and C1s genes are primarily expressed in liver, whereas most other tissues expressed both C1r and C1s genes at much lower levels (less than 10% of that in liver). Multiple molecular sizes of specific mRNAs were observed in the RNA blot analyses for both C1r and C1s, indicating that alternative RNA processing(s), likely an alternative polyadenylylation, might take place for both genes
Dicty_cDB: Contig-U16287-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available zed ... 46 0.12 2 ( CK269023 ) EST715101 potato abiotic stress cDNA library Sola... 46 0.12 2 ( U54774 ) Nicotiana tabacu...a... 36 0.26 3 ( DV114899 ) CV03010A1H02.f1 CV03-normalized library Euphorbia... 36 0.26 3 ( BT013106 ) Lycopersicon esculentu...mate decarboxylase isozyme... 58 1e-06 2 ( CK273593 ) EST719671 potato abiotic stress cDNA library Sola... 5... from flowers,8... 62 7e-05 1 ( CV516768 ) 0048P0016Z_H01_SP6 Mimulus guttatus library 1 Mim... 62...e-04 1 ( CK278060 ) EST724138 potato abiotic stress cDNA library Sola... 60 3e-04 1 ( AP009552 ) Microcystis
26 CFR 1.381(c)(6)-1 - Depreciation method.
2010-04-01
... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Depreciation method. 1.381(c)(6)-1 Section 1.381... (CONTINUED) INCOME TAXES Insolvency Reorganizations § 1.381(c)(6)-1 Depreciation method. (a) Carryover... corporation which computes its allowance for the depreciation of the property under section 167(b)(2), (3), or...
Dicty_cDB: Contig-U16177-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available M01F05_RP Sugar Beet germination cDNA library Be... 54 1e-04 2 ( EG012316 ) STDB003A10u STDB Solanum tuberos...hytophthor... 52 0.048 1 ( CF858202 ) psMY010iA08r Agriculture Canada Phytophthora soja... 52 0.048 1 ( CF85...8120 ) psMY008iH11r Agriculture Canada Phytophthora soja... 52 0.048 1 ( CF857916 ) psMY006iB06r Agriculture...01618 ) MM10_C09 Young roots probed with 3 week old root ... 54 5e-05 2 ( EG552289 ) MM04F20_RP Sugar Beet germination cDNA library... Be... 54 5e-05 2 ( EG552173 ) MM04F20_XP Sugar Beet germination cDNA library
Dicty_cDB: Contig-U03911-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ) lag90e01.y1 Colon epithelia progenitors cDNA Mus ... 64 3e-13 2 ( AV452059 ) Mus musculus cDNA, Abe mouse ES cell cDNA library..... 64 8e-14 2 ( DT212191 ) N124_F10 Non embryogenic SSH library Cichorium in... 46 1e-13 4 ( DJ025875 ) Geno...eatus... 66 7e-12 2 ( AW739394 ) gb41d01.y1 Moss EST library PPN Physcomitrella pa... ...78 1e-11 2 ( BI741051 ) gc93a05.y1 Moss EST library PPN Physcomitrella pa... 78 1...10 2 ( BI741781 ) gc90g06.y1 Moss EST library PPN Physcomitrella pa... 74 2e-10 2 ( BU965247 ) sat08a12.y1 G
Preparation of D-[U-14C]galactose and α-D-[U-14C]galactose-1-phosphate
International Nuclear Information System (INIS)
Kolina, J.; Hromadkova, B.
1989-01-01
Optically pure D-[U- 14 C]galactose was prepared on a preparatory scale using the galactokinase enzyme. The suggested procedure allows to also prepare a α-D-[U- 14 C]galactose-1-phosphate and L-[U- 14 ]galactose giving good yield. The experiments proved that the raw fraction isolated from yeast of the Kluyveromyces fragilis strain or the Kluyveromyces lactis strain shows sufficient activity. Phosphorylation of D-[U- 14 C]galactose practically terminates after 30 mins of incubation. DL-[U- 14 C]galactose isolated using preparatory paper chromatography from the acid hydrolyzate of [U- 14 C] polysaccharide is a satisfactory radioactive precursor. The developed preparation procedure theoretically contributed towards the further elucidation of the problem of the proportional representation of galactose stereo-isomers in extracellular polysaccharide isolated from red algae. In this respect data in the literature differ and some sources state a significantly higher propertion of L-galactose. The experiments showed that [U- 14 C] polysaccharide isolated from the red algae Porphyridium cruentum prevalently contains D-[U- 14 C]galactose, which confirms the process of enzyme reaction. (author). 1 tab., 4 refs
Swidorski, Jacob J; Liu, Zheng; Sit, Sing-Yuen; Chen, Jie; Chen, Yan; Sin, Ny; Venables, Brian L; Parker, Dawn D; Nowicka-Sans, Beata; Terry, Brian J; Protack, Tricia; Rahematpura, Sandhya; Hanumegowda, Umesh; Jenkins, Susan; Krystal, Mark; Dicker, Ira B; Meanwell, Nicholas A; Regueiro-Ren, Alicia
2016-04-15
We have recently reported on the discovery of a C-3 benzoic acid (1) as a suitable replacement for the dimethyl succinate side chain of bevirimat (2), an HIV-1 maturation inhibitor that reached Phase II clinical trials before being discontinued. Recent SAR studies aimed at improving the antiviral properties of 2 have shown that the benzoic acid moiety conferred topographical constraint to the pharmacophore and was associated with a lower shift in potency in the presence of human serum albumin. In this manuscript, we describe efforts to improve the polymorphic coverage of the C-3 benzoic acid chemotype through modifications at the C-28 position of the triterpenoid core. The dimethylaminoethyl amides 17 and 23 delivered improved potency toward bevirimat-resistant viruses while increasing C24 in rat oral PK studies. Copyright © 2016 Elsevier Ltd. All rights reserved.
Dicty_cDB: Contig-U11911-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 15738 ) EST1224699 MTY Medicago truncatula cDNA clone MTY... 46 0.077 2 ( BF643524 ) NF021F09EC1F1079 Elicited cell culture Medic...6 0.079 2 ( BF647644 ) NF078B01EC1F1011 Elicited cell culture Medicago t... 46 0....ited cell culture Medicago t... 46 0.086 2 ( BQ136068 ) NF032G12EC1F1099 Elicited cell culture Medic...tyostelium discoideum cDNA clone:ddc53b21, 3' ... 188 2e-47 2 ( CK249786 ) EST733423 potato callus cDNA library..., normalized ... 46 4e-04 3 ( CK249616 ) EST733253 potato callus cDNA library
Dicty_cDB: Contig-U02520-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ) KBrH001K21F KBrH, Brassica rapa HindIII BAC libra... 46 3.3 1 ( CT538104 ) A BAC library has been constructed from culti...1 ( DR026249 ) Osmo00116 F. cylindrus osmotic stress library Fra... 46 3.3 1 ( DN805411 ) 76947238 Sea Urchi...( CV793140 ) c-030216-1w_E04.abd cDNA library of Tamarix andro... 46 3.3 1 ( CV672849 ) RET7SJ_07D06.T7 Schistosoma japonicum re...012 2 ( CK416159 ) AUF_IpPit_34_o05 Pituitary cDNA library Ictalurus... 54 0.013 1 ( FE840166 ) CCAG48972.g1...99 ) NF075H11EC1F1095 Elicited cell culture Medicago t... 48 0.20 2 ( BF647354 ) NF075A06EC1F1040 Elicited cell culture Medic
Directory of Open Access Journals (Sweden)
Jonathan W Arthur
2010-12-01
Full Text Available Enzymes encoded by the AKR1C1 and AKR1C2 genes are responsible for the metabolism of progesterone and 5α-dihydrotestosterone (DHT, respectively. The effect of amino acid substitutions, resulting from single nucleotide polymorphisms (SNPs in the AKR1C2 gene, on the enzyme kinetics of the AKR1C2 gene product were determined experimentally by Takashi et al. In this paper, we used homology modeling to predict and analyze the structure of AKR1C1 and AKR1C2 genetic variants. The experimental reduction in enzyme activity in the AKR1C2 variants F46Y and L172Q, as determined by Takahashi et al., is predicted to be due to increased instability in cofactor binding, caused by disruptions to the hydrogen bonds between NADP and AKR1C2, resulting from the insertion of polar residues into largely non-polar environments near the site of cofactor binding. Other AKR1C2 variants were shown to involve either conservative substitutions or changes taking place on the surface of the molecule and distant from the active site, confirming the experimental finding of Takahashi et al. that these variants do not result in any statistically significant reduction in enzyme activity. The AKR1C1 R258C variant is predicted to have no effect on enzyme activity for similar reasons. Thus, we provide further insight into the molecular mechanism of the enzyme kinetics of these proteins. Our data also highlight previously reported difficulties with online databases.
Dicty_cDB: Contig-U16598-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available m_3 Zea mays cDNA, mRNA se... 48 3e-10 4 ( FG288275 ) 1108793266181 New World Scr...se... 42 2e-05 3 ( GE557956 ) CCHT16070.b1_L10.ab1 CCHT Niger Seed Guizotia aby... 44 3e-05 3 ( FG284795 ) 1108770681787 New World... Screwworm Egg 9261 ESTs C... 46 5e-05 5 ( FG291287 ) 1108793338890 New World... Screwworm Egg 9261 ESTs C... 46 6e-05 5 ( FG283860 ) 1108770639778 New World Screwworm Eg...g 9261 ESTs C... 46 6e-05 5 ( FG290818 ) 1108793326675 New World Screwworm Egg 9261 ESTs C... 46 7e-05 5 ( F
Dicty_cDB: Contig-U16090-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available us leaf cDNA library Populus tremul... 46 6e-04 2 ( BJ279262 ) Triticum aesti... USDA-FP_186955 Lysiphlebus testaceipes adult whol... 50 1e-09 4 ( AL115000 ) Botrytis cinerea strain T4 cDNA library...-12 2 ( AL115390 ) Botrytis cinerea strain T4 cDNA library. 66 1e-12 2 ( EH017168 ) USDA-FP_182606 Lysiphlebus testaceipes adult...NA... 52 5e-08 2 ( BI127108 ) I086P23P Populus leaf cDNA library Populus tremul.....hophyton rubrum cDNA library 8 Tric... 48 6e-04 2 ( FC653988 ) CAXW13373.rev CAXW Lotti
Dicty_cDB: Contig-U15201-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 2e-04 2 ( EX698640 ) GF_AW109651c08 AW1 Schistosoma mansoni cDNA clone... 44 2e-04 2 ( CD147...-0107T-L395-E12-U.B MG1-0107 Schistosoma manso... 44 2e-04 2 ( CD147233 ) ML1-0002T-M131-E11-U.G ML1-0002 Sc
Dicty_cDB: Contig-U16031-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available iella... 54 4e-09 2 ( EX122338 ) BR106168 mature green leaf cDNA library KHLM Bra...a napus Root library Brassica napu... 50 7e-08 3 ( DV185277 ) CT047_B04_CT047_3700_91.ab1 C. tentans tissue cul... 3 ( EH423460 ) OL6023R Brassica oleracea var. alboglabra leaf cD... 54 3e-09 3 ( EX128986 ) BR112816 ovule and silique cDNA library..... 44 6e-07 3 ( EC773501 ) EST 9997 Guarana fruits cDNA library Paullinia cu... 58 6e-07 3 ( EV830362 ) TTSA...visiae chromosome IV reading frame ORF YDR025w. 52 1e-09 3 ( EX054146 ) BR038790 floral buds cDNA library
Energy Technology Data Exchange (ETDEWEB)
Herbert, M; Pichat, L [Commissariat a l' Energie Atomique, Saclay (France).Centre d' Etudes Nucleaires
1961-07-01
A description of the synthesis of dimethyl-1,1 guanylguanidine-{sup 14}C-2,4 hydrochloride passing through the {sup 14}C{sub 2} dicyandiamide. The overall yield with respect to Ba{sup 14}CO{sub 3} is 38 per cent. (author) [French] Description de la synthese du chlorhydrate de dimethyl-1,1 guanylguanidine {sup 14}C-2,4 par l'intermediaire de la dicyandiamide {sup 14}C{sub 2}. Le rendement global par rapport a {sup 14}CO{sub 3}Ba est de 38 pour cent. (auteur)
The Long and Winding Road to Optimal HbA1c Measurement
Little, Randie R.; Rohlfing, Curt
2016-01-01
The importance of hemoglobin A1c (HbA1c) as an indicator of mean glycemia and risks for complications in patients with diabetes mellitus was established by the results of long-term clinical trials, most notably the Diabetes Control and Complications Trial (DCCT) and United Kingdom Prospective Diabetes Study (UKPDS), published in 1993 and 1998 respectively. However, clinical application of recommended HbA1c targets that were based on these studies was difficult due to lack of comparability of HbA1c results among assay methods and laboratories. Thus, the National Glycohemoglobin Standardization Program (NGSP) was initiated in 1996 with the goal of standardizing HbA1c results to those of the DCCT/UKPDS. HbA1c standardization efforts have been highly successful; however, a number of issues have emerged on the “long and winding road” to better HbA1c, including the development of a higher-order HbA1c reference method by the International Federation of Clinical Chemistry (IFCC), recommendations to use HbA1c to diagnose as well as monitor diabetes, and point-of-care (POC) HbA1c testing. Here, we review the past, present and future of HbA1c standardization and describe the current status of HbA1c testing, including limitations that healthcare providers need to be aware of when interpreting HbA1c results. PMID:23318564
Dicty_cDB: Contig-U16395-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available virus 241ext gene for puta... 41 0.060 C72174( C72174 ) D8R protein - variola minor virus (strain Garcia...rio proteasome (prosome, m... 40 0.10 C72175( C72175 ) G1R protein - variola minor virus (strain Garcia-...
Directory of Open Access Journals (Sweden)
Jennifer B. Phillips
2011-11-01
Usher syndrome is the most prevalent cause of hereditary deaf-blindness, characterized by congenital sensorineural hearing impairment and progressive photoreceptor degeneration beginning in childhood or adolescence. Diagnosis and management of this disease are complex, and the molecular changes underlying sensory cell impairment remain poorly understood. Here we characterize two zebrafish models for a severe form of Usher syndrome, Usher syndrome type 1C (USH1C: one model is a mutant with a newly identified ush1c nonsense mutation, and the other is a morpholino knockdown of ush1c. Both have defects in hearing, balance and visual function from the first week of life. Histological analyses reveal specific defects in sensory cell structure that are consistent with these behavioral phenotypes and could implicate Müller glia in the retinal pathology of Usher syndrome. This study shows that visual defects associated with loss of ush1c function in zebrafish can be detected from the onset of vision, and thus could be applicable to early diagnosis for USH1C patients.
Dicty_cDB: Contig-U14112-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Oryza sativa Japonica Group genom... 77 8e-14 FJ787374_1( FJ787374 |pid:none) Nicotiana repanda protein kin..._1( FJ787369 |pid:none) Nicotiana repanda protein kinase-c... 79 1e-13 AC004260_13( AC004260 |pid:none) Arab...8... 72 2e-12 FJ787371_1( FJ787371 |pid:none) Nicotiana repanda protein kinase-c... 75 2e-12 FB875947_1( FB8
Model-Based GN and C Simulation and Flight Software Development for Orion Missions beyond LEO
Odegard, Ryan; Milenkovic, Zoran; Henry, Joel; Buttacoli, Michael
2014-01-01
For Orion missions beyond low Earth orbit (LEO), the Guidance, Navigation, and Control (GN&C) system is being developed using a model-based approach for simulation and flight software. Lessons learned from the development of GN&C algorithms and flight software for the Orion Exploration Flight Test One (EFT-1) vehicle have been applied to the development of further capabilities for Orion GN&C beyond EFT-1. Continuing the use of a Model-Based Development (MBD) approach with the Matlab®/Simulink® tool suite, the process for GN&C development and analysis has been largely improved. Furthermore, a model-based simulation environment in Simulink, rather than an external C-based simulation, greatly eases the process for development of flight algorithms. The benefits seen by employing lessons learned from EFT-1 are described, as well as the approach for implementing additional MBD techniques. Also detailed are the key enablers for improvements to the MBD process, including enhanced configuration management techniques for model-based software systems, automated code and artifact generation, and automated testing and integration.
Results from the BRACE 1.5 study: Climate change impacts of 1.5 C and 2 C warming
O'Neill, B. C.; Anderson, B.; Monaghan, A. J.; Ren, X.; Sanderson, B.; Tebaldi, C.
2017-12-01
In 2015, 195 countries negotiated the Paris Agreement on climate change, which set long-term goals of limiting global mean warming to well below 2 C and possibly 1.5 C. This event stimulated substantial scientific interest in climate outcomes and impacts on society associated with those levels of warming. Recently, the first set of global climate model simulations explicitly designed to meet those targets were undertaken with the Community Earth System Model (CESM) for use by the research community (Sanderson et al, accepted). The BRACE 1.5 project models societal impacts from these climate outcomes, combined with assumptions about future socioeconomic conditions according to the Shared Socioeconomic Pathways. These analyses build on a recently completed study of the Benefits of Reduced Anthropogenic Climate changE (BRACE), published as a set of 20 papers in Climatic Change, which examined the difference in impacts between two higher scenarios resulting in about 2.5 C and 3.7 C warming by late this century. BRACE 1.5 consists of a set of six papers to be submitted to a special collection in Environmental Research Letters that takes a similar approach but focuses on impacts at 1.5 and 2 C warming. We ask whether impacts differ substantially between the two climate scenarios, accounting for uncertainty in climate outcomes through the use of initial condition ensembles of CESM simulations, and in societal conditions by using alternative SSP-based development pathways. Impact assessment focuses on the health and agricultural sectors; modeling approaches include the use of a global mutli-region CGE model for economic analysis, both a process-based and an empirical crop model, a model of spatial population change, a model of climatic suitability for the aedes aegypti mosquito, and an epidemiological model of heat-related mortality. A methodological analysis also evaluates the use of climate model emulation techniques for providing climate information sufficient to
Dicty_cDB: Contig-U14329-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 2 0.41 3 ( DV113252 ) CV03005B1A12.f1 CV03-normalized library Euphorbia... 32 0.42 3 ( CB610770 ) ALBEDO0002_IaF_C05 Mature...NA non acclimated Bluecrop library Vaccin... 34 0.057 3 ( AL645532 ) Mouse DNA sequence from clone RP23-295E...formis cDNA, cleaving embryo clone:m... 38 0.085 2 ( CF811518 ) NA72 cDNA non acclimated Bluecrop library...TTEAF92THC Tetrahymena thermophila EST library, c... 44 0.22 2 ( AC096661 ) Homo sapiens BAC clone RP11-61G2...4425 ) TTEAV71THB Tetrahymena thermophila EST library, c... 44 0.27 2 ( CQ870098 ) Sequence 519 from Patent
Dicty_cDB: Contig-U07021-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U07021-1 no gap 601 2 3862699 3862098 MINUS 1 2 U07021 1 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U07021-1 Contig ID Contig-U07021-1 Contig update 2001. 8.30 Contig sequence >Contig-U07021-1 (Contig...-U07021-1Q) /CSM_Contig/Contig-U07021-1Q.Seq.d AAAAAAACAAAATGAATAAATTTAATATTACATCATTATTTATTATTTTA...TTTAATATATTCAGAAGGAAATTC TTATTTACAACAAAATTTCCCATTACTTTCTTANTTAAANTCCGTTAAAA T Gap no gap Contig length 601 C...QACCRTTQLFINYADNSFLDSAGFSPFGKVISGFNNTLNFYGGYGEEPDQSLIYSE GNSYLQQNFPLLSXLXSVK own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig
Developing 2 C-compatible investment criteria
Energy Technology Data Exchange (ETDEWEB)
Roeser, Frauke [NewClimate - Institute for Climate Policy and Global Sustainability gGmbH, Bonn (Germany); Weischer, Lutz [Germanwatch e.V., Koeln (Germany); Thomae, Jakob [2degrees Investing Initiative, New York, NY (United States); Hoehne, Niklas; Hagemann, Markus; El Alaoui, Alexander; Bals, Christoph; Eckstein, David; Kreft, Soenke; Rosse, Morten
2015-11-30
This report studies the development of criteria for assessing the compatibility of financial investments with the international goal to limit global temperature increase to below 2 C above pre-industrial levels. The findings are intended as a starting point and a key input for a longer term process to develop consensus-based 2 C investing criteria. The focus here is placed on investments in projects and physical assets, in particular of development and climate finance organisations. In order to limit global temperature increase to 2 C, global greenhouse gas (GHG) emissions will have to be reduced significantly, eventually to zero, during the course of this century. This requires shifting capital from high to low carbon investments as well as significant capital mobilisation for investments in 2 C-compatible infrastructure. Given the long lifetime of physical assets, and the urgency of decarbonisation over the coming decades, this needs to begin today. Public financial institutions can play a prominent role in contributing to aligning investment flows with the 2 C limit, as well as in closing the current infrastructure investment gap, responding to their explicit or implicit climate mandates and leadership role in the finance sector. The majority of international financial institutions integrate climate considerations into their finance decisions to some degree, and are familiar with different types of criteria, including positive and negative lists, qualitative and quantitative benchmarks, and the use of shadow carbon pricing. However, current approaches do not link to the 2 C limit. 2 C investment criteria are therefore needed to guide investors in this regard. Such criteria may also support other purposes, including an understanding of climate risks and improved reporting and accountability.
Developing 2 C-compatible investment criteria
International Nuclear Information System (INIS)
Roeser, Frauke; Weischer, Lutz; Thomae, Jakob; Hoehne, Niklas; Hagemann, Markus; El Alaoui, Alexander; Bals, Christoph; Eckstein, David; Kreft, Soenke; Rosse, Morten
2015-01-01
This report studies the development of criteria for assessing the compatibility of financial investments with the international goal to limit global temperature increase to below 2 C above pre-industrial levels. The findings are intended as a starting point and a key input for a longer term process to develop consensus-based 2 C investing criteria. The focus here is placed on investments in projects and physical assets, in particular of development and climate finance organisations. In order to limit global temperature increase to 2 C, global greenhouse gas (GHG) emissions will have to be reduced significantly, eventually to zero, during the course of this century. This requires shifting capital from high to low carbon investments as well as significant capital mobilisation for investments in 2 C-compatible infrastructure. Given the long lifetime of physical assets, and the urgency of decarbonisation over the coming decades, this needs to begin today. Public financial institutions can play a prominent role in contributing to aligning investment flows with the 2 C limit, as well as in closing the current infrastructure investment gap, responding to their explicit or implicit climate mandates and leadership role in the finance sector. The majority of international financial institutions integrate climate considerations into their finance decisions to some degree, and are familiar with different types of criteria, including positive and negative lists, qualitative and quantitative benchmarks, and the use of shadow carbon pricing. However, current approaches do not link to the 2 C limit. 2 C investment criteria are therefore needed to guide investors in this regard. Such criteria may also support other purposes, including an understanding of climate risks and improved reporting and accountability.
Dicty_cDB: Contig-U15132-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available s) Value N ( C22922 ) Dictyostelium discoideum gamete cDNA, clone FC-AM03. 1122 0.0 1 ( EY489954 ) CBBP17356.rev CBBP Hirudo medicina...lis hermaphrodi... 56 9e-12 4 ( EY481037 ) CBBP11163.rev CBBP Hirudo medicinalis he...( CZ542454 ) SRAA-aad44c05.g1 Strongyloides ratti whole genome... 66 1e-10 3 ( EY491469 ) CBBP18281.fwd CBBP Hirudo medicina...lis hermaphrodi... 56 3e-10 2 ( EY481038 ) CBBP11163.fwd CBBP Hirudo medicina...lis hermaphrodi... 56 3e-10 2 ( EY489955 ) CBBP17356.fwd CBBP Hirudo medicinalis hermaphrodi...
Dicty_cDB: Contig-U06794-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available opus laevis N-acetyltransferase... 179 7e-44 ( P41227 ) RecName: Full=N-terminal acetyltransferase compl...P2... 178 1e-43 (Q9QY36) RecName: Full=N-terminal acetyltransferase complex ARD1... 178 1e-43 AK009697_1( AK...3 (Q9UTI3) RecName: Full=N-terminal acetyltransferase A complex ca... 174 2e-42 D...( AL672002 |pid:none) Mouse DNA sequence from clone RP2... 152 6e-36 ( P07347 ) RecName: Full=N-terminal acetyltransferase A compl...867 |pid:none) Methanococcus maripaludis C6, c... 55 2e-06 ( Q03503 ) RecName: Full=N-terminal acetyltransferase C compl
Dicty_cDB: Contig-U00318-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 2 Mim... 48 0.90 1 ( CV517394 ) 0089P0002Z_H11_T7 Mimulus guttatus library 2 Mimu... 48 0.90 1 ( CT863034 ) Oryza sati...069 CHORI-252 Vervet Mo... 48 0.90 1 ( CV517459 ) 0089P0002Z_H11_SP6 Mimulus guttatus library...va Indica Group EST sequence:OSIGCRA212... 48 0.90 1 ( EW966883 ) LS_11_C22_T7 Headlice composite library...2( CP000609 |pid:none) Methanococcus maripaludis C5, c... 112 2e-23 EU016596_13( EU016596 |pid:none) Uncultured marine mic...roorganism H... 112 2e-23 EU016609_22( EU016609 |pid:none) Uncultured marine microorganism H..
Directory of Open Access Journals (Sweden)
Samantha Hughes
Full Text Available Correct cell fate choice is crucial in development. In post-embryonic development of the hermaphroditic Caenorhabitis elegans, distinct cell fates must be adopted in two diverse tissues. In the germline, stem cells adopt one of three possible fates: mitotic cell cycle, or gamete formation via meiosis, producing either sperm or oocytes. In the epidermis, the stem cell-like seam cells divide asymmetrically, with the daughters taking on either a proliferative (seam or differentiated (hypodermal or neuronal fate. We have isolated a novel conserved C. elegans tetratricopeptide repeat containing protein, TRD-1, which is essential for cell fate determination in both the germline and the developing epidermis and has homologs in other species, including humans (TTC27. We show that trd-1(RNAi and mutant animals have fewer seam cells as a result of inappropriate differentiation towards the hypodermal fate. In the germline, trd-1 RNAi results in a strong masculinization phenotype, as well as defects in the mitosis to meiosis switch. Our data suggests that trd-1 acts downstream of tra-2 but upstream of fem-3 in the germline sex determination pathway, and exhibits a constellation of phenotypes in common with other Mog (masculinization of germline mutants. Thus, trd-1 is a new player in both the somatic and germline cell fate determination machinery, suggestive of a novel molecular connection between the development of these two diverse tissues.
Dicty_cDB: Contig-U05216-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 064701 ) WNEL14b1 Wheat EST endosperm library Triticum aes... 40 0.032 2 ( AC200123 ) Zea mays chromosome 4 ... CF-24-HW fat cDNA... 36 0.055 2 ( EG551033 ) MM04K05_RP Sugar Beet germination cDNA library Be... 36 0.055 2 ( AG332587 ) Mus muscul...7 2 ( AZ506962 ) 1M0348D20F Mouse 10kb plasmid UUGC1M library Mus ... 40 0.057 2 ( BB898919 ) Macaca fascicul...V968176 ) GC06167 Gracilaria changii cDNA library Gracilari... 46 0.014 2 ( AG430324 ) Mus musculus molossin..._IpSto_12_p10 Stomach cDNA library Ictalurus p... 32 0.76 2 ( DX535456 ) GH_MBb0065G22f GH_MBb Gossypium hirsutum genomic
The role of C2-C7 and O-C2 angle in the development of dysphagia after cervical spine surgery.
Tian, Wei; Yu, Jie
2013-06-01
Dysphagia is a known complication of cervical surgery and may be prolonged or occasionally serious. A previous study showed that dysphagia after occipitocervical fusion was caused by oropharyngeal stenosis resulting from O-C2 (upper cervical lordosis) fixation in a flexed position. However, there have been few reports analyzing the association between the C2-C7 angle (middle-lower cervical lordosis) and postoperative dysphagia. The aim of this study was to analyze the relationship between cervical lordosis and the development of dysphagia after anterior and posterior cervical spine surgery (AC and PC). Three hundred fifty-four patients were reviewed in this retrospective clinical study, including 172 patients who underwent the AC procedure and 182 patients who had the PC procedure between June 2007 and May 2010. The presence and duration of postoperative dysphagia were recorded via face-to-face questioning or telephone interview performed at least 1 year after the procedure. Plain cervical radiographs before and after surgery were collected. The O-C2 angle and the C2-C7 angle were measured. Changes in the O-C2 angle and the C2-C7 angle were defined as dO-C2 angle = postoperative O-C2 angle - preoperative O-C2 angle and dC2-C7 angle = postoperative C2-C7 angle - preoperative C2-C7 angle. The association between postoperative dysphagia with dO-C2 angle and dC2-C7 angle was studied. Results showed that 12.8 % of AC and 9.4 % of PC patients reported dysphagia after cervical surgery. The dC2-C7 angle has considerable impact on postoperative dysphagia. When the dC2-C7 angle is greater than 5°, the chance of developing postoperative dysphagia is significantly greater. The dO-C2 angle, age, gender, BMI, operative time, blood loss, procedure type, revision surgery, most cephalic operative level, and number of operative levels did not significantly influence the incidence of postoperative dysphagia. No relationship was found between the dC2-C7 angle and the degree of
Directory of Open Access Journals (Sweden)
Jean Chen MD
2016-01-01
Full Text Available Hemoglobin A1c (A1c is used frequently to diagnose and treat diabetes mellitus. Therefore, it is important be aware of factors that may interfere with the accuracy of A1c measurements. This is a case of a rare hemoglobin variant that falsely elevated a nondiabetic patient’s A1c level and led to a misdiagnosis of diabetes. A 67-year-old male presented to endocrine clinic for further management after he was diagnosed with diabetes based on an elevated A1c of 10.7%, which is approximately equivalent to an average blood glucose of 260 mg/dL. Multiple repeat A1c levels remained >10%, but his home fasting and random glucose monitoring ranged from 92 to 130 mg/dL. Hemoglobin electrophoresis and subsequent genetic analysis diagnosed the patient with hemoglobin Wayne, a rare hemoglobin variant. This variant falsely elevates A1c levels when A1c is measured using cation-exchange high-performance liquid chromatography. When the boronate affinity method was applied instead, the patient’s A1c level was actually 4.7%. Though hemoglobin Wayne is clinically silent, this patient was erroneously diagnosed with diabetes and started on an antiglycemic medication. Due to this misdiagnosis, the patient was at risk of escalation in his “diabetes management” and hypoglycemia. Therefore, it is important that providers are aware of factors that may result in hemoglobin A1c inaccuracy including hemoglobin variants.
Characterization of methacetin-methoxy-"1"3C
International Nuclear Information System (INIS)
Lu Weijing; Lu Hao; Yang Weicheng; Liu Weixia; Li Shuai; Xu Zhongjie; Guan Liang; Zhu Chengmo; Chen Suyun; Jiang Lei
2010-01-01
Methacetin-methoxy-"1"3C was synthesized by using methanol-"1"3C with a novel method, and the characterization of it was performed using HPLC, LC-MS and "1HMNR. The results indicated that the synthetic was right. And the yield of methacetin-methoxy-"1"3C was 70.0% with 99% "1"3C abundance and 99.8% purity. Compared with the classical method, there was more benefit. The methacetin "1"3C-breath test was performed with the synthetic on the live mice, which showed a precise reflection of alteration of liver function in liver injury and functional recovery. (authors)
18 CFR 1c.1 - Prohibition of natural gas market manipulation.
2010-04-01
... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Prohibition of natural gas market manipulation. 1c.1 Section 1c.1 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT OF ENERGY GENERAL RULES PROHIBITION OF ENERGY MARKET MANIPULATION § 1c.1...
Hovingh, Elise S; van den Broek, Bryan; Kuipers, Betsy; Pinelli, Elena; Rooijakkers, Suzan H M; Jongerius, Ilse
2017-07-01
Whooping cough, or pertussis, is a contagious disease of the respiratory tract that is re-emerging worldwide despite high vaccination coverage. The causative agent of this disease is the Gram-negative Bordetella pertussis. Knowledge on complement evasion strategies of this pathogen is limited. However, this is of great importance for future vaccine development as it has become apparent that a novel pertussis vaccine is needed. Here, we unravel the effect of Virulence associated gene 8 (Vag8) of B. pertussis on the human complement system at the molecular level. We show that both recombinant and endogenously secreted Vag8 inhibit complement deposition on the bacterial surface at the level of C4b. We reveal that Vag8 binding to human C1-inhibitor (C1-inh) interferes with the binding of C1-inh to C1s, C1r and MASP-2, resulting in the release of active proteases that subsequently cleave C2 and C4 away from the bacterial surface. We demonstrate that the depletion of these complement components in the bacterial surrounding and subsequent decreased deposition on B. pertussis leads to less complement-mediated bacterial killing. Vag8 is the first protein described that specifically prevents C1s, C1r and MASP-2 binding to C1-inh and thereby mediates complement consumption away from the bacterial surface. Unravelling the mechanism of this unique complement evasion strategy of B. pertussis is one of the first steps towards understanding the interactions between the first line of defense complement and B. pertussis.
Hovingh, Elise S.; Kuipers, Betsy; Pinelli, Elena; Rooijakkers, Suzan H. M.
2017-01-01
Whooping cough, or pertussis, is a contagious disease of the respiratory tract that is re-emerging worldwide despite high vaccination coverage. The causative agent of this disease is the Gram-negative Bordetella pertussis. Knowledge on complement evasion strategies of this pathogen is limited. However, this is of great importance for future vaccine development as it has become apparent that a novel pertussis vaccine is needed. Here, we unravel the effect of Virulence associated gene 8 (Vag8) of B. pertussis on the human complement system at the molecular level. We show that both recombinant and endogenously secreted Vag8 inhibit complement deposition on the bacterial surface at the level of C4b. We reveal that Vag8 binding to human C1-inhibitor (C1-inh) interferes with the binding of C1-inh to C1s, C1r and MASP-2, resulting in the release of active proteases that subsequently cleave C2 and C4 away from the bacterial surface. We demonstrate that the depletion of these complement components in the bacterial surrounding and subsequent decreased deposition on B. pertussis leads to less complement-mediated bacterial killing. Vag8 is the first protein described that specifically prevents C1s, C1r and MASP-2 binding to C1-inh and thereby mediates complement consumption away from the bacterial surface. Unravelling the mechanism of this unique complement evasion strategy of B. pertussis is one of the first steps towards understanding the interactions between the first line of defense complement and B. pertussis. PMID:28742139
Dicty_cDB: Contig-U14348-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 71_1( FJ787371 |pid:none) Nicotiana repanda protein kinase-c... 94 3e-18 AC124968_9( AC124968 |pid:none) Med... 5e-17 FJ787374_1( FJ787374 |pid:none) Nicotiana repanda protein kinase-c... 90 5e-17 AE014298_1862( AE01429...08048_1( AY708048 |pid:none) Zea mays salt-inducible putative p... 90 5e-17 FJ787369_1( FJ787369 |pid:none) Nicotiana repanda
Provenzani, Riccardo; Tarvainen, Ilari; Brandoli, Giulia; Lempinen, Antti; Artes, Sanna; Turku, Ainoleena; Jäntti, Maria Helena; Talman, Virpi; Yli-Kauhaluoma, Jari; Tuominen, Raimo K; Boije Af Gennäs, Gustav
2018-01-01
Protein kinase C (PKC) isoforms play a pivotal role in the regulation of numerous cellular functions, making them extensively studied and highly attractive drug targets. Utilizing the crystal structure of the PKCδ C1B domain, we have developed hydrophobic isophthalic acid derivatives that modify PKC functions by binding to the C1 domain of the enzyme. In the present study, we aimed to improve the drug-like properties of the isophthalic acid derivatives by increasing their solubility and enhancing the binding affinity. Here we describe the design and synthesis of a series of multisubstituted pyrimidines as analogs of C1 domain-targeted isophthalates and characterize their binding affinities to the PKCα isoform. In contrast to our computational predictions, the scaffold hopping from phenyl to pyrimidine core diminished the binding affinity. Although the novel pyrimidines did not establish improved binding affinity for PKCα compared to our previous isophthalic acid derivatives, the present results provide useful structure-activity relationship data for further development of ligands targeted to the C1 domain of PKC.
Kim, E.S.; Cha, Y.; Ham, M.; Jung, J.; Kim, S.G.; Hwang, S.; Kleemann, R.; Moon, A.
2014-01-01
A crucial role of the inflammatory lipid sphingosine-1-phosphate (S1P) in breast cancer aggressiveness has been reported. Recent clinical studies have suggested that C-reactive protein (CRP) has a role in breast cancer development. However, limited information is available on the molecular basis for
17 CFR 270.3c-1 - Definition of beneficial ownership for certain 3(c)(1) funds.
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definition of beneficial... AND EXCHANGE COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.3c-1 Definition of beneficial ownership for certain 3(c)(1) funds. (a) As used in this section: (1) The term...