WorldWideScience

Sample records for brugia malayi l3

  1. Transcriptomes and pathways associated with infectivity, survival and immunogenicity in Brugia malayi L3

    Directory of Open Access Journals (Sweden)

    Spiro David

    2009-06-01

    Full Text Available Abstract Background Filarial nematode parasites cause serious diseases such as elephantiasis and river blindness in humans, and heartworm infections in dogs. Third stage filarial larvae (L3 are a critical stage in the life cycle of filarial parasites, because this is the stage that is transmitted by arthropod vectors to initiate infections in mammals. Improved understanding of molecular mechanisms associated with this transition may provide important leads for development of new therapies and vaccines to prevent filarial infections. This study explores changes in gene expression associated with the transition of Brugia malayi third stage larvae (BmL3 from mosquitoes into mammalian hosts and how these changes are affected by radiation. Radiation effects are especially interesting because irradiated L3 induce partial immunity to filarial infections. The underlying molecular mechanisms responsible for the efficacy of such vaccines are unkown. Results Expression profiles were obtained using a new filarial microarray with 18, 104 64-mer elements. 771 genes were identified as differentially expressed in two-way comparative analyses of the three L3 types. 353 genes were up-regulated in mosquito L3 (L3i relative to cultured L3 (L3c. These genes are important for establishment of filarial infections in mammalian hosts. Other genes were up-regulated in L3c relative to L3i (234 or irradiated L3 (L3ir (22. These culture-induced transcripts include key molecules required for growth and development. 165 genes were up-regulated in L3ir relative to L3c; these genes encode highly immunogenic proteins and proteins involved in radiation repair. L3ir and L3i have similar transcription profiles for genes that encode highly immunogenic proteins, antioxidants and cuticle components. Conclusion Changes in gene expression that normally occur during culture under conditions that support L3 development and molting are prevented or delayed by radiation. This may explain

  2. Susceptibility of the autogenous group of the Aedes scutellaris complex of mosquitoes to infection with Brugia malayi and Brugia pahangi.

    Science.gov (United States)

    Trpis, M

    1981-09-01

    Four species of mosquitoes which represent the Tonga group of the Aedes scutellaris complex (Ae. cooki, Ae. kesseli, Ae. tongae tabu and an undescribed Aedes sp. NUAOFO'OU) were tested for susceptibility to infection with Brugia malayi and B. pahangi. All tested strains were genetically fully (100%) susceptible to infection with both parasitic helminths. Higher survival of females harboring low quantities of infective larvae (1-9 L3/male) indicates a weak adaptation of the host to the parasite. Further analysis showed that in frequency distribution of infective larvae of B. malayi and B. pahangi, the most frequent category was 1-5 infective larvae per mosquito female. Distribution of te infective larvae into various parts of the mosquito body is a dynamic process. After development of L3 larvae in the thoracic muscles is completed, infective larvae migrate predominantly to the abdomen. From day 10 to 18 after an infective blood meal, L3 larvae migrate back to the thorax and head proboscis area. Low density of microfilariae in gerbils (5 mf/20 microliters) is sufficient for good infection in any of the tested mosquito species and strains. If a laboratory model with high susceptibility of mosquitoes to Brugia filarial worms is required, the autogenous group of mosquitoes of Tonga will serve as an excellent laboratory model. High susceptibility of the autogenous mosquito species to B. malayi and B. pahangi and absence of Brugian filariasis in the Polynesian region of the South Pacific is discussed.

  3. Molecular cloning, purification and characterization of Brugia malayi phosphoglycerate kinase.

    Science.gov (United States)

    Kumar, Ranjeet; Doharey, Pawan Kumar; Saxena, Jitendra Kumar; Rathaur, Sushma

    2017-04-01

    Phosphoglycerate kinase (PGK) is a glycolytic enzyme present in many parasites. It has been reported as a candidate molecule for drug and vaccine developments. In the present study, a full-length cDNA encoding the Brugia malayi 3-phosphoglycerate kinase (BmPGK) with an open reading frame of 1.3 kb was isolated and PCR amplified and cloned. The exact size of the BmPGK's ORF is 1377 bps. The BmPGK gene was subcloned into pET-28a (+) expression vector, the expressed enzyme was purified by affinity column and characterized. The SDS-PAGE analysis revealed native molecular weight of recombinant Brugia malayi 3-phosphoglycerate kinase (rBmPGK) to be ∼45 kDa. The enzyme was found sensitive to temperature and pH, it showed maximum activity at 25 °C and pH 8.5. The Km values for PGA and ATP were 1.77 and 0.967 mM, respectively. The PGK inhibitor, clorsulon and antifilarial drugs albendazole and ivermectin inhibited the enzyme. The specific inhibitor of PGK, clorsulon, competitively inhibited enzyme with Ki value 1.88 μM. Albendazole also inhibited PGK competitively with Ki value 35.39 μM. Further these inhibitory studies were confirmed by docking and molecular simulation of drugs with enzyme. Clorsulon interacted with substrate binding site with glutamine 37 as well as in hinge regions with aspartic acid 385 and valine 387 at ADP binding site. On the other hand albendazole interacted with asparagine 335 residues. These effects were in good association with binding interactions. Thus current study might help in designing and synthesis of effective inhibitors for this novel drug target and understanding their mode of interaction with the potent anthelmintic drugs. Copyright © 2017 Elsevier Inc. All rights reserved.

  4. Functional analysis of putative operons in Brugia malayi.

    Science.gov (United States)

    Liu, Canhui; Oliveira, Ana; Chauhan, Chitra; Ghedin, Elodie; Unnasch, Thomas R

    2010-01-01

    Operons are a common mode of gene organization in Caenorhabditis elegans. Similar gene arrangements suggest that functional operons may exist in Brugia malayi. To definitively test this hypothesis, a bicistronic reporter vector consisting of an upstream firefly luciferase gene and a downstream renilla luciferase gene was constructed. The genome was then surveyed to identify 15 gene pairs that were likely to represent operons. Two of four domains upstream of the 5' gene from these clusters exhibited promoter activity. When constructs replicating the promoter and intergenic arrangement found in the native putative operon were transfected into embryos, both firefly and renilla activities were detected, while constructs with the promoter alone or intergenic region alone produced no activity from the downstream reporter. These data confirm that functional operons exist in B. malayi. Mutation of three U-rich element homologues present in one of the operons resulted in a decrease in downstream renilla reporter activity, suggesting that these were important in mRNA maturation. Hemi-nested reverse transcriptase-PCR assays demonstrated that while the mRNA encoding the native downstream open reading frame of one operon contained an SL1 spliced leader at its 5' end, the renilla gene mRNA produced from the corresponding transgenic construct did not. Copyright 2009 Australian Society for Parasitology Inc. Published by Elsevier Ltd. All rights reserved.

  5. Sulfonamide chalcones: Synthesis and in vitro exploration for therapeutic potential against Brugia malayi.

    Science.gov (United States)

    Bahekar, Sandeep P; Hande, Sneha V; Agrawal, Nikita R; Chandak, Hemant S; Bhoj, Priyanka S; Goswami, Kalyan; Reddy, M V R

    2016-11-29

    Keeping in mind the immense biological potential of chalcones and sulfonamide scaffolds, a library of sulfonamide chalcones has been synthesized and evaluated for in vitro antifilarial assay against human lymphatic filarial parasite Brugia malayi. Experimental evidence showcased for the first time the potential of some sulfonamide chalcones as effective and safe antifilarial lead molecules against human lymphatic filarial parasite B. malayi. Sulfonamide chalcones 4d, 4p, 4q, 4t and 4aa displayed the significantly wide therapeutic window. Particularly chalcones with halogen substitution in aromatic ring proved to be potent antifilarial agents against Brugia malayi. Sulphonamide chalcones with lipophilic methyl moiety (4q and 4aa) at para position of terminal phenyl rings of compounds were found to have remarkable antifilarial activities with therapeutic efficacy. Observed preliminary evidence of apoptosis by effective chalcone derivatives envisaged its fair possibility to inhibit folate pathway with consequent defect in DNA synthesis. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

  6. The genome of Brugia malayi – all worms are not created equal

    OpenAIRE

    Scott, Alan; Ghedin, Elodie

    2008-01-01

    Filarial nematode parasites, the causative agents of elephantiasis and river blindness, undermine the livelihoods of over one hundred millions people in the developing world. Recently, the Filarial Genome Project reported the draft sequence of the ~95 Mb genome of the human filarial parasite Brugia malayi - the first parasitic nematode genome to be sequenced. Comparative genome analysis with the prevailing model nematode Caenorhabditis elegans revealed similarities and differences in genome s...

  7. Diversity and Expression of MicroRNAs in the Filarial Parasite, Brugia malayi

    Science.gov (United States)

    Poole, Catherine B.; Gu, Weifeng; Kumar, Sanjay; Jin, Jingmin; Davis, Paul J.; Bauche, David; McReynolds, Larry A.

    2014-01-01

    Human filarial parasites infect an estimated 120 million people in 80 countries worldwide causing blindness and the gross disfigurement of limbs and genitals. An understanding of RNA-mediated regulatory pathways in these parasites may open new avenues for treatment. Toward this goal, small RNAs from Brugia malayi adult females, males and microfilariae were cloned for deep-sequencing. From ∼30 million sequencing reads, 145 miRNAs were identified in the B. malayi genome. Some microRNAs were validated using the p19 RNA binding protein and qPCR. B. malayi miRNAs segregate into 99 families each defined by a unique seed sequence. Sixty-one of the miRNA families are highly conserved with homologues in arthropods, vertebrates and helminths. Of those miRNAs not highly conserved, homologues of 20 B. malayi miRNA families were found in vertebrates. Nine B. malayi miRNA families appear to be filarial-specific as orthologues were not found in other organisms. The miR-2 family is the largest in B. malayi with 11 members. Analysis of the sequences shows that six members result from a recent expansion of the family. Library comparisons found that 1/3 of the B. malayi miRNAs are differentially expressed. For example, miR-71 is 5–7X more highly expressed in microfilariae than adults. Studies suggest that in C.elegans, miR-71 may enhance longevity by targeting the DAF-2 pathway. Characterization of B. malayi miRNAs and their targets will enhance our understanding of their regulatory pathways in filariads and aid in the search for novel therapeutics. PMID:24824352

  8. Diversity and expression of microRNAs in the filarial parasite, Brugia malayi.

    Directory of Open Access Journals (Sweden)

    Catherine B Poole

    Full Text Available Human filarial parasites infect an estimated 120 million people in 80 countries worldwide causing blindness and the gross disfigurement of limbs and genitals. An understanding of RNA-mediated regulatory pathways in these parasites may open new avenues for treatment. Toward this goal, small RNAs from Brugia malayi adult females, males and microfilariae were cloned for deep-sequencing. From ∼ 30 million sequencing reads, 145 miRNAs were identified in the B. malayi genome. Some microRNAs were validated using the p19 RNA binding protein and qPCR. B. malayi miRNAs segregate into 99 families each defined by a unique seed sequence. Sixty-one of the miRNA families are highly conserved with homologues in arthropods, vertebrates and helminths. Of those miRNAs not highly conserved, homologues of 20 B. malayi miRNA families were found in vertebrates. Nine B. malayi miRNA families appear to be filarial-specific as orthologues were not found in other organisms. The miR-2 family is the largest in B. malayi with 11 members. Analysis of the sequences shows that six members result from a recent expansion of the family. Library comparisons found that 1/3 of the B. malayi miRNAs are differentially expressed. For example, miR-71 is 5-7X more highly expressed in microfilariae than adults. Studies suggest that in C.elegans, miR-71 may enhance longevity by targeting the DAF-2 pathway. Characterization of B. malayi miRNAs and their targets will enhance our understanding of their regulatory pathways in filariads and aid in the search for novel therapeutics.

  9. Molecular evidence for a functional ecdysone signaling system in Brugia malayi.

    Directory of Open Access Journals (Sweden)

    George Tzertzinis

    2010-03-01

    Full Text Available Filarial nematodes, including Brugia malayi, the causative agent of lymphatic filariasis, undergo molting in both arthropod and mammalian hosts to complete their life cycles. An understanding of how these parasites cross developmental checkpoints may reveal potential targets for intervention. Pharmacological evidence suggests that ecdysteroids play a role in parasitic nematode molting and fertility although their specific function remains unknown. In insects, ecdysone triggers molting through the activation of the ecdysone receptor: a heterodimer of EcR (ecdysone receptor and USP (Ultraspiracle.We report the cloning and characterization of a B. malayi EcR homologue (Bma-EcR. Bma-EcR dimerizes with insect and nematode USP/RXRs and binds to DNA encoding a canonical ecdysone response element (EcRE. In support of the existence of an active ecdysone receptor in Brugia we also cloned a Brugia rxr (retinoid X receptor homolog (Bma-RXR and demonstrate that Bma-EcR and Bma-RXR interact to form an active heterodimer using a mammalian two-hybrid activation assay. The Bma-EcR ligand-binding domain (LBD exhibits ligand-dependent transactivation via a GAL4 fusion protein combined with a chimeric RXR in mammalian cells treated with Ponasterone-A or a synthetic ecdysone agonist. Furthermore, we demonstrate specific up-regulation of reporter gene activity in transgenic B. malayi embryos transfected with a luciferase construct controlled by an EcRE engineered in a B. malayi promoter, in the presence of 20-hydroxy-ecdysone.Our study identifies and characterizes the two components (Bma-EcR and Bma-RXR necessary for constituting a functional ecdysteroid receptor in B. malayi. Importantly, the ligand binding domain of BmaEcR is shown to be capable of responding to ecdysteroid ligands, and conversely, ecdysteroids can activate transcription of genes downstream of an EcRE in live B. malayi embryos. These results together confirm that an ecdysone signaling system

  10. Glucose and Glycogen Metabolism in Brugia malayi Is Associated with Wolbachia Symbiont Fitness.

    Science.gov (United States)

    Voronin, Denis; Bachu, Saheed; Shlossman, Michael; Unnasch, Thomas R; Ghedin, Elodie; Lustigman, Sara

    2016-01-01

    Wolbachia are endosymbiotic bacteria found in the majority of arthropods and filarial nematodes of medical and veterinary importance. They have evolved a wide range of symbiotic associations. In filarial nematodes that cause human lymphatic filariasis (Wuchereria bancrofti, Brugia malayi) or onchocerciasis (Onchocerca volvulus), Wolbachia are important for parasite development, reproduction and survival. The symbiotic bacteria rely in part on nutrients and energy sources provided by the host. Genomic analyses suggest that the strain of Wolbachia found in B. malayi (wBm) lacks the genes for two glycolytic enzymes--6-phosphofructokinase and pyruvate kinase--and is thus potentially unable to convert glucose into pyruvate, an important substrate for energy generation. The Wolbachia surface protein, wBm00432, is complexed to six B. malayi glycolytic enzymes, including aldolase. In this study we characterized two B. malayi aldolase isozymes and found that their expression is dependent on Wolbachia fitness and number. We confirmed by immuno-transmission electron microscopy that aldolase is associated with the Wolbachia surface. RNAi experiments suggested that aldolase-2 plays a significant role in both Wolbachia survival and embryogenesis in B. malayi. Treatment with doxycycline reduced Wolbachia fitness and increased the amount of both glucose and glycogen detected in the filarial parasite, indicating that glucose metabolism and glycogen storage in B. malayi are associated with Wolbachia fitness. This metabolic co-dependency between Wolbachia and its filarial nematode indicates that glycolysis could be a shared metabolic pathway between the bacteria and B. malayi, and thus a potential new target for anti-filarial therapy.

  11. The Abundant Larval Transcript-1 and -2 Genes of Brugia malayi Encode Stage-Specific Candidate Vaccine Antigens for Filariasis

    Science.gov (United States)

    Gregory, William F.; Atmadja, Agnes K.; Allen, Judith E.; Maizels, Rick M.

    2000-01-01

    Lymphatic filariasis is a major tropical disease caused by the mosquito-borne nematodes Brugia and Wuchereria. About 120 million people are infected and at risk of lymphatic pathology such as acute lymphangitis and elephantiasis. Vaccines against filariasis must generate immunity to the infective mosquito-derived third-stage larva (L3) without accentuating immunopathogenic responses to lymphatic-dwelling adult parasites. We have identified two highly expressed genes, designated abundant larval transcript-1 and -2 (alt-1 and alt-2), from each of which mRNAs account for >1% of L3 cDNAs. ALT-1 and ALT-2 share 79% amino acid identity across 125 residues, including a putative signal sequence and a prominent acidic tract. Expression of alt-1 and alt-2 is initiated midway through development in the mosquito, peaking in the infective larva and declining sharply following entry into the host. Humans exposed to Brugia malayi show a high frequency of immunoglobulin G1 (IgG1) and IgG3 antibodies to ALT-1 and -2, distinguishing them from adult-stage antigens, which are targeted by the IgG4 isotype. Immunization of susceptible rodents (jirds) with ALT-1 elicited a 76% reduction in parasite survival, the highest reported for a single antigen from any filarial parasite. ALT-1 and the closely related ALT-2 are therefore strong candidates for a future vaccine against human filariasis. PMID:10858234

  12. Expression of the microfilarial sheath protein 2 (shp2) of the filarial parasites Litomosoides sigmodontis and Brugia malayi.

    Science.gov (United States)

    Conraths, F J; Hirzmann, J; Hobom, G; Zahner, H

    1997-03-01

    The microfilarial sheaths of the filarial parasites Brugia malayi, Brugia pahangi, and Litomosoides sigmodontis consist of several parasite proteins, probably ranging between 7 and 10. The gene encoding sheath protein 2 (shp2), which is the object of this study, is transcribed in embryos and in the uterine epithelium; at least in B. malayi, it is translated in both tissues. Apparently, shp2 is synthesized as a monomer, exported by the respective cells, and integrated into the microfilarial sheath. In the sheath, it exists as a highly polymerized molecule cross-linked by cysteine formation and other covalent bonds, presumably epsilon-(gamma-glutamyl)-lysine links.

  13. Infective Larvae of Brugia malayi Induce Polarization of Host Macrophages that Helps in Immune Evasion

    Directory of Open Access Journals (Sweden)

    Aditi Sharma

    2018-02-01

    Full Text Available Filarial parasites suppress, divert, or polarize the host immune response to aid their survival. However, mechanisms that govern the polarization of host MΦs during early filarial infection are not completely understood. In this study, we infected BALB/c mice with infective larvae stage-3 of Brugia malayi (Bm-L3 and studied their effect on the polarization of splenic MΦs. Results showed that MΦs displayed M2-phenotype by day 3 p.i. characterized by upregulated IL-4, but reduced IL-12 and Prostaglandin-D2 secretion. Increased arginase activity, higher arginase-1 but reduced NOS2 expression and poor phagocytic and antigen processing capacity was also observed. M2 MΦs supported T-cell proliferation and characteristically upregulated p-ERK but downregulated NF-κB-p65 and NF-κB-p50/105. Notably, Bm-L3 synergized with host regulatory T-cells (Tregs and polarized M2 MΦs to regulatory MΦs (Mregs by day 7 p.i., which secreted copious amounts of IL-10 and prostaglandin-E2. Mregs also showed upregulated expression levels of MHC-II, CD80, and CD86 and exhibited increased antigen-processing capacity but displayed impaired activation of NF-κB-p65 and NF-κB-p50/105. Neutralization of Tregs by anti-GITR + anti-CD25 antibodies checked the polarization of M2 MΦs to Mregs, decreased accumulation of regulatory B cells and inflammatory monocytes, and reduced secretion of IL-10, but enhanced IL-4 production and percentages of eosinophils, which led to Bm-L3 killing. In summary, we report hitherto undocumented effects of early Bm-L3 infection on the polarization of splenic MΦs and show how infective larvae deftly utilize the functional plasticity of host MΦs to establish themselves inside the host.

  14. Brugia malayi excreted/secreted proteins at the host/parasite interface: stage- and gender-specific proteomic profiling.

    Directory of Open Access Journals (Sweden)

    Sasisekhar Bennuru

    Full Text Available Relatively little is known about the filarial proteins that interact with the human host. Although the filarial genome has recently been completed, protein profiles have been limited to only a few recombinants or purified proteins of interest. Here, we describe a large-scale proteomic analysis using microcapillary reverse-phase liquid chromatography-tandem-mass spectrometry to identify the excretory-secretory (ES products of the L3, L3 to L4 molting ES, adult male, adult female, and microfilarial stages of the filarial parasite Brugia malayi. The analysis of the ES products from adult male, adult female, microfilariae (Mf, L3, and molting L3 larvae identified 852 proteins. Annotation suggests that the functional and component distribution was very similar across each of the stages studied; however, the Mf contributed a higher proportion to the total number of identified proteins than the other stages. Of the 852 proteins identified in the ES, only 229 had previous confirmatory expressed sequence tags (ESTs in the available databases. Moreover, this analysis was able to confirm the presence of 274 "hypothetical" proteins inferred from gene prediction algorithms applied to the B. malayi (Bm genome. Not surprisingly, the majority (160/274 of these "hypothetical" proteins were predicted to be secreted by Signal IP and/or SecretomeP 2.0 analysis. Of major interest is the abundance of previously characterized immunomodulatory proteins such as ES-62 (leucyl aminopeptidase, MIF-1, SERPIN, glutathione peroxidase, and galectin in the ES of microfilariae (and Mf-containing adult females compared to the adult males. In addition, searching the ES protein spectra against the Wolbachia database resulted in the identification of 90 Wolbachia-specific proteins, most of which were metabolic enzymes that have not been shown to be immunogenic. This proteomic analysis extends our knowledge of the ES and provides insight into the host-parasite interaction.

  15. Yeast-Based High-Throughput Screens to Identify Novel Compounds Active against Brugia malayi.

    Directory of Open Access Journals (Sweden)

    Elizabeth Bilsland

    2016-01-01

    Full Text Available Lymphatic filariasis is caused by the parasitic worms Wuchereria bancrofti, Brugia malayi or B. timori, which are transmitted via the bites from infected mosquitoes. Once in the human body, the parasites develop into adult worms in the lymphatic vessels, causing severe damage and swelling of the affected tissues. According to the World Health Organization, over 1.2 billion people in 58 countries are at risk of contracting lymphatic filariasis. Very few drugs are available to treat patients infected with these parasites, and these have low efficacy against the adult stages of the worms, which can live for 7-15 years in the human body. The requirement for annual treatment increases the risk of drug-resistant worms emerging, making it imperative to develop new drugs against these devastating diseases.We have developed a yeast-based, high-throughput screening system whereby essential yeast genes are replaced with their filarial or human counterparts. These strains are labeled with different fluorescent proteins to allow the simultaneous monitoring of strains with parasite or human genes in competition, and hence the identification of compounds that inhibit the parasite target without affecting its human ortholog. We constructed yeast strains expressing eight different Brugia malayi drug targets (as well as seven of their human counterparts, and performed medium-throughput drug screens for compounds that specifically inhibit the parasite enzymes. Using the Malaria Box collection (400 compounds, we identified nine filarial specific inhibitors and confirmed the antifilarial activity of five of these using in vitro assays against Brugia pahangi.We were able to functionally complement yeast deletions with eight different Brugia malayi enzymes that represent potential drug targets. We demonstrated that our yeast-based screening platform is efficient in identifying compounds that can discriminate between human and filarial enzymes. Hence, we are confident

  16. Yeast-Based High-Throughput Screens to Identify Novel Compounds Active against Brugia malayi.

    Science.gov (United States)

    Bilsland, Elizabeth; Bean, Daniel M; Devaney, Eileen; Oliver, Stephen G

    2016-01-01

    Lymphatic filariasis is caused by the parasitic worms Wuchereria bancrofti, Brugia malayi or B. timori, which are transmitted via the bites from infected mosquitoes. Once in the human body, the parasites develop into adult worms in the lymphatic vessels, causing severe damage and swelling of the affected tissues. According to the World Health Organization, over 1.2 billion people in 58 countries are at risk of contracting lymphatic filariasis. Very few drugs are available to treat patients infected with these parasites, and these have low efficacy against the adult stages of the worms, which can live for 7-15 years in the human body. The requirement for annual treatment increases the risk of drug-resistant worms emerging, making it imperative to develop new drugs against these devastating diseases. We have developed a yeast-based, high-throughput screening system whereby essential yeast genes are replaced with their filarial or human counterparts. These strains are labeled with different fluorescent proteins to allow the simultaneous monitoring of strains with parasite or human genes in competition, and hence the identification of compounds that inhibit the parasite target without affecting its human ortholog. We constructed yeast strains expressing eight different Brugia malayi drug targets (as well as seven of their human counterparts), and performed medium-throughput drug screens for compounds that specifically inhibit the parasite enzymes. Using the Malaria Box collection (400 compounds), we identified nine filarial specific inhibitors and confirmed the antifilarial activity of five of these using in vitro assays against Brugia pahangi. We were able to functionally complement yeast deletions with eight different Brugia malayi enzymes that represent potential drug targets. We demonstrated that our yeast-based screening platform is efficient in identifying compounds that can discriminate between human and filarial enzymes. Hence, we are confident that we can

  17. Suppression of Brugia malayi (sub-periodic larval development in Aedes aegypti (Liverpool strain fed on blood of animals immunized with microfilariae

    Directory of Open Access Journals (Sweden)

    K Athisaya Mary

    2005-07-01

    Full Text Available Preliminary studies were carried out to investigate the role of filarial specific antibodies, raised in an animal model against the filarial parasite, Brugia malayi (sub-periodic, in blocking their early development in an experimental mosquito host, Aedes aegypti (Liverpool strain. In order to generate filarial specific antibodies, Mongolian gerbils, Meriones unguiculatus, were immunized either with live microfilariae (mf of B. malayi or their homogenate. Mf were harvested from the peritoneal cavity of Mongolian gerbils with patent infection of B. malayi and fed to A. aegypti along with the blood from immunized animals. Development of the parasite in infected mosquitoes was monitored until they reached infective stage larvae (L3. Fewer number of parasites developed to first stage (L1 and subsequently to L2 and L3 in mosquitoes fed with blood of immunized animals, when compared to those fed with blood of control animals. The results thus indicated that filarial parasite specific antibodies present in the blood of the immunized animals resulted in the reduction of number of larvae of B. malayi developing in the mosquito host.

  18. Antifilarial activity of gum from Moringa oleifera Lam. on human lymphatic filaria Brugia malayi

    Directory of Open Access Journals (Sweden)

    V Kushwaha

    2011-01-01

    Full Text Available Aim: Currently available antifilarial drugs diethylcarbamazine, ivermectin and albendazole and their combinations, are not able to control lymphatic filariasis. Therefore, a better antifilarial agent is urgently required for proper management of the disease. Materials and Methods: In this study, we evaluated the antifilarial activity of gum extract of plant Moringa oleifera Lam. against the human lymphatic filarial parasite Brugia malayi using adult worms and microfilariae (mf in two in vitro assays (motility and inhition in MTT reduction for viability and two animal models, primary (Meriones unguiculatus implanted with B. malayi adult worms in the peritoneal cavity and secondary (subcutaneous B. malayi infective larvae induced Mastomys coucha, the model closer to the natural human filarial infection screens. Results: The gum extract inhibited 100% motility (irreversible loss of motility of mf and inhibited more than 56% MTT reduction potential of the adult female worms. The extract was safe in cytotoxicity test using Vero cell line, therefore followed in vivo in primary and secondary screens. In primary screen, the extract (5×500 mg/kg caused 69% macrofilaricidal and 83% sterilization of female worms and 44% macrofilaricidal activity in secondary screen (5 × 1000 mg/kg by oral route. Conclusion: Thus, it is concluded that the gum of the plant is macrofilaricidal in both in vitro and in vivo and may provide valuable leads for design and development of new antifilarial agents. This is the first ever report on the antifilarial efficacy of M. oleifera.

  19. Comparative analysis of ITS1 nucleotide sequence reveals distinct genetic difference between Brugia malayi from Northeast Borneo and Thailand.

    Science.gov (United States)

    Fong, Mun-Yik; Noordin, Rahmah; Lau, Yee-Ling; Cheong, Fei-Wen; Yunus, Muhammad Hafiznur; Idris, Zulkarnain Md

    2013-01-01

    Brugia malayi is one of the parasitic worms which causes lymphatic filariasis in humans. Its geographical distribution includes a large part of Asia. Despite its wide distribution, very little is known about the genetic variation and molecular epidemiology of this species. In this study, the internal transcribed spacer 1 (ITS1) nucleotide sequences of B. malayi from microfilaria-positive human blood samples in Northeast Borneo Island were determined, and compared with published ITS1 sequences of B. malayi isolated from cats and humans in Thailand. Multiple alignment analysis revealed that B. malayi ITS1 sequences from Northeast Borneo were more similar to each other than to those from Thailand. Phylogenetic trees inferred using Neighbour-Joining and Maximum Parsimony methods showed similar topology, with 2 distinct B. malayi clusters. The first cluster consisted of Northeast Borneo B. malayi isolates, whereas the second consisted of the Thailand isolates. The findings of this study suggest that B. malayi in Borneo Island has diverged significantly from those of mainland Asia, and this has implications for the diagnosis of B. malayi infection across the region using ITS1-based molecular techniques.

  20. Ultrastructural comparison of extracellular and intracellular encapsulation of Brugia malayi in Anopheles quadrimaculatus.

    Science.gov (United States)

    Chikilian, M L; Bradley, T J; Nayar, J K; Knight, J W

    1994-02-01

    Ultrastructural aspects of extracellular humoral encapsulation of microfilariae of Brugia malayi in the hemocoel of Anopheles quadrimaculatus were compared with those of intracellular encapsulation of first-stage larvae (L1) of the same parasite species, in the thoracic muscle cells of the same species of mosquito. The results showed that extracellular humoral encapsulation of microfilarial sheaths, and sheathed and exsheathed microfilariae, in the hemocoel of mosquitoes occurs around the parasite within the first 6 hr postingestion, apparently without initial participation of hemocytes. Hemocytes and their remnants were observed near the parasite during the first 6 hr postingestion. Within the next 24 hr, hemocytes attach to the initial humoral capsule. By contrast, intracellular encapsulation of L1S is initiated by the accumulation of a dense cytoplasmic layer derived from the infected thoracic muscle cell. Melanin deposits accumulate in this layer adjacent to the parasite cuticle, again without visible participation of hemocytes.

  1. Susceptibility of Anopheles quadrimaculatus (Diptera: Culicidae) to subperiodic Brugia malayi and Brugia pahangi (Nematoda: Filarioidea) adapted to nude mice and jirds.

    Science.gov (United States)

    Nayar, J K; Knight, J W; Vickery, A C

    1990-05-01

    Anopheles quadrimaculatus and Aedes aegypti (Black-eyed Liverpool strain) were fed on jirds and nude mice (jird-jird infection, jird-mouse infection, and mouse-jird infection) infected with subperiodic Brugia malayi and B. pahangi. Microfilariae of B. malayi from jird-mouse and mouse-jird infections developed normally in An. quadrimaculatus, whereas those from jird-jird infections did not develop. Microfilariae of both species from jirds and nude mice developed normally in Ae. aegypti and those of B. pahangi developed normally in An. quadrimaculatus. It is suggested that microfilariae from nude mice are modified physiologically, immunologically, or both so that they can develop in refractory An. quadrimaculatus, thus indicating that susceptibility and refractoriness of An. quadrimaculatus to B. malayi also is influenced by factors relating to the vertebrate host in addition to mosquito genetic factors.

  2. Effect of Brugia malayi on the growth and proliferation of endothelial cells in vitro.

    Science.gov (United States)

    Rao, U R; Zometa, C S; Vickery, A C; Kwa, B H; Nayar, J K; Sutton, E T

    1996-08-01

    Athymic mice (C3H/HeN) parasitized by Brugia malayi develop massively dilated lymphatics. The lymphatic endothelial lining is perturbed, and numerous mononuclear and giant cells are closely apposed to the endothelium. The hyperplastic endothelial cells and low opening pressure of the lymphatics suggest abnormal multiplication of these cells may be important in the dilation. We studied the in vitro growth rate of human umbilical vein endothelial cells cultured with adult worms and microfilariae of B. malayi. The tetrazolium salt reduction assays were used to quantify possible direct mitogenic or inhibitory effects. The growth factor-induced proliferation of endothelial cells was significantly suppressed by 44-51% on day 1, 46-81% on day 3, and 45-79% on day 5 in cultures containing adult female worms, which had greater suppressor activity on endothelial cell proliferation than male worms, microfilariae, or soluble adult worm extract. Culture supernatant containing female worm excretory-secretory products significantly inhibited the growth and multiplication of cells, suggesting that adult female worms release antigens or proteins that have inhibitory activity on growth factors necessary for endothelial cell proliferation in vitro. Excess human recombinant epidermal growth factor and bovine brain extract partly reversed the inhibitory activity of worms in culture and restored the endothelial cell proliferation when incubated with worm culture supernatant. Indomethacin and BW 775Hcl failed to restore normal endothelial proliferation in the presence of female worms, suggesting that parasite-derived prostanoids and cyclooxygenase products did not cause the inhibition. Lymph from dilated lymphatics, but not serum from infected mice, increased the proliferation of cells in vitro. Together, these data demonstrate that excretory-secretory products of B. malayi parasites suppress vascular endothelial proliferation in vitro. Furthermore, increases in the number of these cells

  3. Rapid detection and identification of Brugia malayi, B. pahangi, and Dirofilaria immitis by high-resolution melting assay.

    Science.gov (United States)

    Wongkamchai, Sirichit; Monkong, Nuntiya; Mahannol, Pakpimom; Taweethavonsawat, Piyanan; Loymak, Sumat; Foongladda, Suporn

    2013-01-01

    Human lymphatic filariasis is caused by filarial worms such as Brugia malayi for which the major reservoir is domestic cats. However, domestic cats or dogs also carry nonhuman filaria such as Brugia pahangi and Dirofilaria immitis. We have developed a single-tube, real-time PCR with a high-resolution melting (HRM) analysis assay for detection and identification of B. malayi, B. pahangi, and D. immitis in blood samples. The designated primer pair in the PCR can amplify a 114-bp region of mitochondrial 12S rRNA genes of these filarial worms. Subsequently, the HRM assay showed a specific melting temperature for each species. The assay showed the highest sensitivity and specificity in comparison with DNA sequences after assessment with 34 cat and 14 dog blood samples. This assay could be helpful for epidemiological studies of reservoirs and vectors.

  4. A Proteomic Analysis of the Body Wall, Digestive Tract, and Reproductive Tract of Brugia malayi.

    Directory of Open Access Journals (Sweden)

    C Paul Morris

    Full Text Available Filarial worms are parasitic nematodes that cause devastating diseases such as lymphatic filariasis (LF and onchocerciasis. Filariae are nematodes with complex anatomy including fully developed digestive tracts and reproductive organs. To better understand the basic biology of filarial parasites and to provide insights into drug targets and vaccine design, we conducted a proteomic analysis of different anatomic fractions of Brugia malayi, a causative agent of LF. Approximately 500 adult female B. malayi worms were dissected, and three anatomical fractions (body wall, digestive tract, and reproductive tract were obtained. Proteins from each anatomical fraction were extracted, desalted, trypsinized, and analyzed by microcapillary reverse-phase liquid chromatography-tandem-mass spectrometry. In total, we identified 4,785 B. malayi proteins. While 1,894 were identified in all three anatomic fractions, 396 were positively identified only within the digestive tract, 114 only within the body wall, and 1,011 only within the reproductive tract. Gene set enrichment analysis revealed a bias for transporters to be present within the digestive tract, suggesting that the intestine of adult filariae is functional and important for nutrient uptake or waste removal. As expected, the body wall exhibited increased frequencies of cytoskeletal proteins, and the reproductive tract had increased frequencies of proteins involved in nuclear regulation and transcription. In assessing for possible vaccine candidates, we focused on proteins sequestered within the digestive tract, as these could possibly represent "hidden antigens" with low risk of prior allergic sensitization. We identified 106 proteins that are enriched in the digestive tract and are predicted to localize to the surface of cells in the the digestive tract. It is possible that some of these proteins are on the luminal surface and may be accessible by antibodies ingested by the worm. A subset of 27 of these

  5. Homologs of the Caenorhabditis elegans masculinizing gene her-1 in C. briggsae and the filarial parasite Brugia malayi.

    OpenAIRE

    Streit, A; Li, W; Robertson, B; Schein, J; Kamal, I H; Marra, M; Wood, W B

    1999-01-01

    The masculinizing gene her-1 in Caenorhabditis elegans (Ce-her-1) encodes a novel protein, HER-1A, which is required for male development. To identify conserved elements in her-1 we have cloned and characterized two homologous nematode genes: one by synteny from the closely related free-living species C. briggsae (Cb-her-1) and the other, starting with a fortuitously identified expressed sequence tag, from the distantly related parasite Brugia malayi (Bm-her-1). The overall sequence identitie...

  6. Production of Brugia malayi BmSXP Recombinant Protein Expressed in Escherichia coli

    Directory of Open Access Journals (Sweden)

    Khoo, T. K.

    2010-01-01

    Full Text Available A rapid antibody detection test is very useful for detection of lymphatic filariasis, especially for certification and surveillance of post-mass drug administration. One such kit, panLF RapidTM (commercialized by Malaysian BioDiagnostic Research Sdn. Bhd. had been developed in our laboratory for the detection of all species of filarial infections. It is based on the detection of anti-filarial IgG4 antibodies that react with recombinant Brugia malayi antigens, BmR1 and BmSXP. In this study, the growth of recombinant bacteria that produce BmSXP was optimized under shake flask fermentation for high yield of the recombinant antigen. The optimizations involved selection of suitable growth medium, IPTG concentration and induction time. The medium that yielded the highest biomass as well as total protein was Terrific Broth (TB medium, which is an undefined medium. Initiation of induction of protein expression was found to be best at mid-log phase (OD600 = 1.5, with IPTG concentration of 1.0 mM, and harvest time at 9 h post-induction. This study showed that under the optimized conditions, the shake flask culture produced 4 g/L biomass (dry cell weight of recombinant Escherichia coli BmSXP/pPROEXHTa/TOP10F’, which yielded 2.42 mg/L of purified BmSXP recombinant antigen. The purified antigen was analyzed by SDS-PAGE and the antigenicity of protein was confirmed by Western blot.

  7. Stage- and gender-specific proteomic analysis of Brugia malayi excretory-secretory products.

    Directory of Open Access Journals (Sweden)

    Yovany Moreno

    Full Text Available INTRODUCTION: While we lack a complete understanding of the molecular mechanisms by which parasites establish and achieve protection from host immune responses, it is accepted that many of these processes are mediated by products, primarily proteins, released from the parasite. Parasitic nematodes occur in different life stages and anatomical compartments within the host. Little is known about the composition and variability of products released at different developmental stages and their contribution to parasite survival and progression of the infection. METHODOLOGY/PRINCIPAL FINDINGS: To gain a deeper understanding on these aspects, we collected and analyzed through 1D-SDS PAGE and LC-MS/MS the Excretory-Secretory Products (ESP of adult female, adult male and microfilariae of the filarial nematode Brugia malayi, one of the etiological agents of human lymphatic filariasis. This proteomic analysis led to the identification of 228 proteins. The list includes 76 proteins with unknown function as well as also proteins with potential immunoregulatory properties, such as protease inhibitors, cytokine homologues and carbohydrate-binding proteins. Larval and adult ESP differed in composition. Only 32 proteins were shared between all three stages/genders. Consistent with this observation, different gene ontology profiles were associated with the different ESP. CONCLUSIONS/SIGNIFICANCE: A comparative analysis of the proteins released in vitro by different forms of a parasitic nematode dwelling in the same host is presented. The catalog of secreted proteins reflects different stage- and gender-specific related processes and different strategies of immune evasion, providing valuable insights on the contribution of each form of the parasite for establishing the host-parasite interaction.

  8. Lectin binding to extracellularly melanized microfilariae of Brugia malayi from the hemocoel of Anopheles quadrimaculatus.

    Science.gov (United States)

    Nayar, J K; Mikarts, L L; Chikilian, M L; Knight, J W; Bradley, T J

    1995-11-01

    Binding patterns of fluorescein isothiocyanate (FITC)- and gold-conjugated lectins to extracellularly melanized sheathed and exsheathed microfilariae of subperiodic Brugia malayi, isolated from and in situ in the abdominal hemocoel of Anopheles quadrimaculatus 72-hr postinfection, were examined. Five FITC-conjugated lectins [Helix pomatia agglutinin (HPA), Arachis hypogaea (peanut agglutinin-PNA), Triticum vulgaris (wheat germ agglutinin-WGA), Lens culinaris (lentil-LCH), and Concanavalin A (Con A)] with specificities for different carbohydrate moieties were tested for binding to isolated melanized microfilariae and observed with transmitted light and fluorescence microscopy. All five FITC-lectins bound strongly to the acellular material accompanying the melanin deposits on the surface of isolated melanized microfilariae. Significant inhibition of FITC-lectin binding occurred when lectins were preincubated with their complementary carbohydrates before testing. H. pomatia agglutinin binding was totally inhibited by N-acetyl-D-glucosamine and N-acetyl-D-galactosamine. Other lectins were partially inhibited, such as PNA by galactose and lactose; WGA by N-acetylneuraminic acid; LCH by N-acetyl-D-glucosamine, mannose, glucose, and methyl alpha-D-mannopyranoside; and Con A by mannose and methyl alpha-D-mannopyranoside. Three gold-conjugated lectins (HPA, PNA, and Con A), examined by using transmission electron microscopy, bound to the outer surface of the acellular material associated with the melanin deposits on isolated melanized microfilarial sheaths and melanized microfilariae and to the remnants of lysed hemocytes found in the proximity of the melanized deposits. Con A in the presence of gold-labeled horseradish peroxidase, examined by using transmission electron microscopy, showed random binding within the melanized capsule formed around the microfilarial sheath in situ. These results indicate that the acellular material accompanying melanin deposits on melanized

  9. Potential involvement of Brugia malayi cysteine proteases in the maintenance of the endosymbiotic relationship with Wolbachia

    Directory of Open Access Journals (Sweden)

    Sara Lustigman

    2014-12-01

    Full Text Available Brugia malayi, a parasitic nematode that causes lymphatic filariasis, harbors endosymbiotic intracellular bacteria, Wolbachia, that are required for the development and reproduction of the worm. The essential nature of this endosymbiosis led to the development of anti-Wolbachia chemotherapeutic approaches for the treatment of human filarial infections. Our study is aimed at identifying specific proteins that play a critical role in this endosymbiotic relationship leading to the identification of potential targets in the adult worms. Filarial cysteine proteases are known to be involved in molting and embryogenesis, processes shown to also be Wolbachia dependent. Based on the observation that cysteine protease transcripts are differentially regulated in response to tetracycline treatment, we focused on defining their role in symbiosis. We observe a bimodal regulation pattern of transcripts encoding cysteine proteases when in vitro tetracycline treated worms were examined. Using tetracycline-treated infertile female worms and purified embryos we established that the first peak of the bimodal pattern corresponds to embryonic transcripts while the second takes place within the hypodermis of the adult worms. Localization studies of the native proteins corresponding to Bm-cpl-3 and Bm-cpl-6 indicate that they are present in the area surrounding Wolbachia, and, in some cases, the proteins appear localized within the bacteria. Both proteins were also found in the inner bodies of microfilariae. The possible role of these cysteine proteases during development and endosymbiosis was further characterized using RNAi. Reduction in Bm-cpl-3 and Bm-cpl-6 transcript levels was accompanied by hindered microfilarial development and release, and reduced Wolbachia DNA levels, making these enzymes strong drug target candidates.

  10. Comparison of an enzyme linked immunosorbent assay (ELISA) and a radioallergosorbent test (RAST) for detection of IgE antibodies to Brugia malayi

    NARCIS (Netherlands)

    Wahyuni, Sitti; van Ree, Ronald; Mangali, Andarias; Supali, Taniawati; Yazdanbakhsh, Maria; Sartono, Erliyani

    2003-01-01

    The enzyme linked immunosorbent assay (ELISA) for specific IgE antibodies to Brugia malayi was compared with the radioallergosorbent test (RAST) for use in immunoepidemiological studies of lymphatic filariasis. Sera used were from individuals (aged 5-82 years) living in an area endemic for lymphatic

  11. Immunization of Mastomys coucha with Brugia malayi recombinant trehalose-6-phosphate phosphatase results in significant protection against homologous challenge infection.

    Directory of Open Access Journals (Sweden)

    Susheela Kushwaha

    Full Text Available Development of a vaccine to prevent or reduce parasite development in lymphatic filariasis would be a complementary approach to existing chemotherapeutic tools. Trehalose-6-phosphate phosphatase of Brugia malayi (Bm-TPP represents an attractive vaccine target due to its absence in mammals, prevalence in the major life stages of the parasite and immunoreactivity with human bancroftian antibodies, especially from endemic normal subjects. We have recently reported on the cloning, expression, purification and biochemical characterization of this vital enzyme of B. malayi. In the present study, immunoprophylactic evaluation of Bm-TPP was carried out against B. malayi larval challenge in a susceptible host Mastomys coucha and the protective ability of the recombinant protein was evaluated by observing the adverse effects on microfilarial density and adult worm establishment. Immunization caused 78.4% decrease in microfilaremia and 71.04% reduction in the adult worm establishment along with sterilization of 70.06% of the recovered live females. The recombinant protein elicited a mixed Th1/Th2 type of protective immune response as evidenced by the generation of both pro- and anti-inflammatory cytokines IL-2, IFN-γ, TNF-α, IL-4 and an increased production of antibody isotypes IgG1, IgG2a, IgG2b and IgA. Thus immunization with Bm-TPP conferred considerable protection against B. malayi establishment by engendering a long-lasting effective immune response and therefore emerges as a potential vaccine candidate against lymphatic filariasis (LF.

  12. Immunogenicity and Protective Efficacy of Brugia malayi Heavy Chain Myosin as Homologous DNA, Protein and Heterologous DNA/Protein Prime Boost Vaccine in Rodent Model.

    Science.gov (United States)

    Gupta, Jyoti; Pathak, Manisha; Misra, Sweta; Misra-Bhattacharya, Shailja

    2015-01-01

    We earlier demonstrated the immunoprophylactic efficacy of recombinant heavy chain myosin (Bm-Myo) of Brugia malayi (B. malayi) in rodent models. In the current study, further attempts have been made to improve this efficacy by employing alternate approaches such as homologous DNA (pcD-Myo) and heterologous DNA/protein prime boost (pcD-Myo+Bm-Myo) in BALB/c mouse model. The gene bm-myo was cloned in a mammalian expression vector pcDNA 3.1(+) and protein expression was confirmed in mammalian Vero cell line. A significant degree of protection (79.2%±2.32) against L3 challenge in pcD-Myo+Bm-Myo immunized group was observed which was much higher than that exerted by Bm-Myo (66.6%±2.23) and pcD-Myo (41.6%±2.45). In the heterologous immunized group, the percentage of peritoneal leukocytes such as macrophages, neutrophils, B cells and T cells marginally increased and their population augmented further significantly following L3 challenge. pcD-Myo+Bm-Myo immunization elicited robust cellular and humoral immune responses as compared to pcD-Myo and Bm-Myo groups as evidenced by an increased accumulation of CD4+, CD8+ T cells and CD19+ B cells in the mouse spleen and activation of peritoneal macrophages. Though immunized animals produced antigen-specific IgG antibodies and isotypes, sera of mice receiving pcD-Myo+Bm-Myo or Bm-Myo developed much higher antibody levels than other groups and there was profound antibody-dependent cellular adhesion and cytotoxicity (ADCC) to B. malayi infective larvae (L3). pcD-Myo+Bm-Myo as well as Bm-Myo mice generated a mixed T helper cell phenotype as evidenced by the production of both pro-inflammatory (IL-2, IFN-γ) and anti-inflammatory (IL-4, IL-10) cytokines. Mice receiving pcD-Myo on contrary displayed a polarized pro-inflammatory immune response. The findings suggest that the priming of animals with DNA followed by protein booster generates heightened and mixed pro- and anti-inflammatory immune responses that are capable of providing

  13. Immunogenicity and Protective Efficacy of Brugia malayi Heavy Chain Myosin as Homologous DNA, Protein and Heterologous DNA/Protein Prime Boost Vaccine in Rodent Model.

    Directory of Open Access Journals (Sweden)

    Jyoti Gupta

    Full Text Available We earlier demonstrated the immunoprophylactic efficacy of recombinant heavy chain myosin (Bm-Myo of Brugia malayi (B. malayi in rodent models. In the current study, further attempts have been made to improve this efficacy by employing alternate approaches such as homologous DNA (pcD-Myo and heterologous DNA/protein prime boost (pcD-Myo+Bm-Myo in BALB/c mouse model. The gene bm-myo was cloned in a mammalian expression vector pcDNA 3.1(+ and protein expression was confirmed in mammalian Vero cell line. A significant degree of protection (79.2%±2.32 against L3 challenge in pcD-Myo+Bm-Myo immunized group was observed which was much higher than that exerted by Bm-Myo (66.6%±2.23 and pcD-Myo (41.6%±2.45. In the heterologous immunized group, the percentage of peritoneal leukocytes such as macrophages, neutrophils, B cells and T cells marginally increased and their population augmented further significantly following L3 challenge. pcD-Myo+Bm-Myo immunization elicited robust cellular and humoral immune responses as compared to pcD-Myo and Bm-Myo groups as evidenced by an increased accumulation of CD4+, CD8+ T cells and CD19+ B cells in the mouse spleen and activation of peritoneal macrophages. Though immunized animals produced antigen-specific IgG antibodies and isotypes, sera of mice receiving pcD-Myo+Bm-Myo or Bm-Myo developed much higher antibody levels than other groups and there was profound antibody-dependent cellular adhesion and cytotoxicity (ADCC to B. malayi infective larvae (L3. pcD-Myo+Bm-Myo as well as Bm-Myo mice generated a mixed T helper cell phenotype as evidenced by the production of both pro-inflammatory (IL-2, IFN-γ and anti-inflammatory (IL-4, IL-10 cytokines. Mice receiving pcD-Myo on contrary displayed a polarized pro-inflammatory immune response. The findings suggest that the priming of animals with DNA followed by protein booster generates heightened and mixed pro- and anti-inflammatory immune responses that are capable of

  14. The role of local secondary structure in the function of the trans-splicing motif of Brugia malayi.

    Science.gov (United States)

    Liu, Canhui; Chauhan, Chitra; Unnasch, Thomas R

    2010-02-01

    A 7-nt motif (the trans-splicing motif or TSM) was previously shown to be necessary and sufficient to direct trans-splicing of transgenic mRNAs in transgenic Brugia malayi embryos. Insertion of the TSM into two genes lacking a TSM homologue resulted in trans-splicing of transgenic mRNAs from one transgene but not the other, suggesting that local sequence context might affect TSM function. To test this hypothesis, constructs inserting the TSM into different positions of two B. malayi genes were tested for their ability to support trans-splicing of transgenic mRNAs. Transgenic mRNAs derived from constructs in which the insertion of the TSM did not result in a perturbation of the local predicted secondary structure were trans-spliced, while those in which the TSM perturbed the local secondary structure were not. These data suggest that local secondary structure plays a role in the ability of the TSM to direct trans-splicing.

  15. Inflammatory responses induced by the filarial nematode Brugia malayi are mediated by lipopolysaccharide-like activity from endosymbiotic Wolbachia bacteria.

    Science.gov (United States)

    Taylor, M J; Cross, H F; Bilo, K

    2000-04-17

    The pathogenesis of filarial disease is characterized by acute and chronic inflammation. Inflammatory responses are thought to be generated by either the parasite, the immune response, or opportunistic infection. We show that soluble extracts of the human filarial parasite Brugia malayi can induce potent inflammatory responses, including tumor necrosis factor (TNF)-alpha, interleukin (IL)-1beta, and nitric oxide (NO) from macrophages. The active component is heat stable, reacts positively in the Limulus amebocyte lysate assay, and can be inhibited by polymyxin B. TNF-alpha, IL-1beta, and NO responses were not induced in macrophages from lipopolysaccharide (LPS)-nonresponsive C3H/HeJ mice. The production of TNF-alpha after chemotherapy of microfilariae was also only detected in LPS-responsive C3H/HeN mice, suggesting that signaling through the Toll-like receptor 4 (TLR4) is necessary for these responses. We also show that CD14 is required for optimal TNF-alpha responses at low concentrations. Together, these results suggest that extracts of B. malayi contain bacterial LPS. Extracts from the rodent filaria, Acanthocheilonema viteae, which is not infected with the endosymbiotic Wolbachia bacteria found in the majority of filarial parasites, failed to induce any inflammatory responses from macrophages, suggesting that the source of bacterial LPS in extracts of B. malayi is the Wolbachia endosymbiont. Wolbachia extracts derived from a mosquito cell line induced similar LPS-dependent TNF-alpha and NO responses from C3H/HeN macrophages, which were eliminated after tetracycline treatment of the bacteria. Thus, Wolbachia LPS may be one of the major mediators of inflammatory pathogenesis in filarial nematode disease.

  16. Structure of the trehalose-6-phosphate phosphatase from Brugia malayi reveals key design principles for anthelmintic drugs.

    Directory of Open Access Journals (Sweden)

    Jeremiah D Farelli

    2014-07-01

    Full Text Available Parasitic nematodes are responsible for devastating illnesses that plague many of the world's poorest populations indigenous to the tropical areas of developing nations. Among these diseases is lymphatic filariasis, a major cause of permanent and long-term disability. Proteins essential to nematodes that do not have mammalian counterparts represent targets for therapeutic inhibitor discovery. One promising target is trehalose-6-phosphate phosphatase (T6PP from Brugia malayi. In the model nematode Caenorhabditis elegans, T6PP is essential for survival due to the toxic effect(s of the accumulation of trehalose 6-phosphate. T6PP has also been shown to be essential in Mycobacterium tuberculosis. We determined the X-ray crystal structure of T6PP from B. malayi. The protein structure revealed a stabilizing N-terminal MIT-like domain and a catalytic C-terminal C2B-type HAD phosphatase fold. Structure-guided mutagenesis, combined with kinetic analyses using a designed competitive inhibitor, trehalose 6-sulfate, identified five residues important for binding and catalysis. This structure-function analysis along with computational mapping provided the basis for the proposed model of the T6PP-trehalose 6-phosphate complex. The model indicates a substrate-binding mode wherein shape complementarity and van der Waals interactions drive recognition. The mode of binding is in sharp contrast to the homolog sucrose-6-phosphate phosphatase where extensive hydrogen-bond interactions are made to the substrate. Together these results suggest that high-affinity inhibitors will be bi-dentate, taking advantage of substrate-like binding to the phosphoryl-binding pocket while simultaneously utilizing non-native binding to the trehalose pocket. The conservation of the key residues that enforce the shape of the substrate pocket in T6PP enzymes suggest that development of broad-range anthelmintic and antibacterial therapeutics employing this platform may be possible.

  17. The heme biosynthetic pathway of the obligate Wolbachia endosymbiont of Brugia malayi as a potential anti-filarial drug target.

    Directory of Open Access Journals (Sweden)

    Bo Wu

    2009-07-01

    Full Text Available Filarial parasites (e.g., Brugia malayi, Onchocerca volvulus, and Wuchereria bancrofti are causative agents of lymphatic filariasis and onchocerciasis, which are among the most disabling of neglected tropical diseases. There is an urgent need to develop macro-filaricidal drugs, as current anti-filarial chemotherapy (e.g., diethylcarbamazine [DEC], ivermectin and albendazole can interrupt transmission predominantly by killing microfilariae (mf larvae, but is less effective on adult worms, which can live for decades in the human host. All medically relevant human filarial parasites appear to contain an obligate endosymbiotic bacterium, Wolbachia. This alpha-proteobacterial mutualist has been recognized as a potential target for filarial nematode life cycle intervention, as antibiotic treatments of filarial worms harboring Wolbachia result in the loss of worm fertility and viability upon antibiotic treatments both in vitro and in vivo. Human trials have confirmed this approach, although the length of treatments, high doses required and medical counter-indications for young children and pregnant women warrant the identification of additional anti-Wolbachia drugs.Genome sequence analysis indicated that enzymes involved in heme biosynthesis might constitute a potential anti-Wolbachia target set. We tested different heme biosynthetic pathway inhibitors in ex vivo B. malayi viability assays and report a specific effect of N-methyl mesoporphyrin (NMMP, which targets ferrochelatase (FC, the last step. Our phylogenetic analysis indicates evolutionarily significant divergence between Wolbachia heme genes and their human homologues. We therefore undertook the cloning, overexpression and analysis of several enzymes of this pathway alongside their human homologues, and prepared proteins for drug targeting. In vitro enzyme assays revealed a approximately 600-fold difference in drug sensitivities to succinyl acetone (SA between Wolbachia and human 5

  18. Comparison of migration and encapsulation of Brugia malayi microfilariae from the midgut to the hemocoel between Anopheles quadrimaculatus and Aedes aegypti.

    Science.gov (United States)

    Nayar, J K; Knight, J W

    1995-05-01

    Comparisons were made of migration and encapsulation of ingested sheathed microfilariae of Brugia malayi from the midgut into the hemocoel between Anopheles quadrimaculatus (refractory and susceptible strains to B. malayi) and Aedes aegypti (Black-eyed, Liverpool strain susceptible to B. malayi). Encapsulation and melanization of microfilarial sheaths and microfilariae occurred in both strains of An. quadrimaculatus and in Ae. aegypti. In both strains of An. quadrimaculatus, by 4 hr and by 24 hr after the ingestion of sheathed microfilariae of B. malayi in the infected bloodmeal, significantly more sheathed microfilariae penetrated the midgut and reached the hemocoel and thoracic muscles compared with those in Ae. aegypti. During the same time periods significantly more encapsulated and melanized microfilarial sheaths and a larger percentage of encapsulated and melanized microfilariae were observed in the hemocoel of both strains of An. quadrimaculatus than in Ae. aegypti. The results suggest that differences observed in the numbers of encapsulated and melanized microfilarial sheaths and percentages of melanized microfilariae between An. quadrimaculatus (both strains) and Ae. aegypti are due to different rates of penetration of the sheathed microfilariae from the midgut to the hemocoel.

  19. Nutritional factors and antimicrobials on development of infective larvae of subperiodic Brugia malayi (Nematoda: Filarioidea) in Anopheles quadrimaculatus and Aedes aegypti (Diptera: Culicidae).

    Science.gov (United States)

    Nayar, J K; Knight, J W

    1991-03-01

    The effects of nutritional factors and antimicrobials on the development of infective larvae of subperiodic Brugia malayi in susceptible Anopheles quadrimaculatus Say and Aedes aegypti (L.) were investigated. Larvae of both species of mosquitoes were reared on brewers yeast or a 1:1 brewers yeast-liver powder mixture. After emergence, one-half of the adults from each rearing condition were maintained on a 10% sucrose solution and the other half on a 10% sucrose solution containing 0.1% p-aminobenzoic acid (PABA). Females of both species of mosquitoes that fed on B. malayi-infected jirds showed a significant increase in the ineffective rate and intensity of infectiveness when the mosquito larvae were reared on the brewers yeast-liver powder diet. The addition of 0.1% PABA to the adult diet increased numbers of infective larvae of B. malayi that developed in Ae. aegypti but not in An. quadrimaculatus. The intensity of infectiveness of B. malayi was significantly greater when An. quadrimaculatus females were provided with a second blood meal from an uninfected jird and when females of both species were maintained on different concentrations of an antimicrobial solution.

  20. Identification of tgh-2, a Filarial Nematode Homolog of Caenorhabditis elegans daf-7 and Human Transforming Growth Factor β, Expressed in Microfilarial and Adult Stages of Brugia malayi

    OpenAIRE

    Gomez-Escobar, Natalia; Gregory, William F.; Maizels, Rick M.

    2000-01-01

    A novel member of the transforming growth factor β (TGF-β) family has been identified in the filarial nematode parasite Brugia malayi by searching the recently developed Expressed Sequence Tag (EST) database produced by the Filarial Genome Project. Designated tgh-2, this new gene shows most similarity to a key product regulating dauer larva formation in Caenorhabditis elegans (DAF-7) and to the human down-modulatory cytokine TGF-β. Homology to DAF-7 extends throughout the length of the 349-am...

  1. Tissue and stage-specific distribution of Wolbachia in Brugia malayi.

    Directory of Open Access Journals (Sweden)

    Kerstin Fischer

    2011-05-01

    Full Text Available BACKGROUND: Most filarial parasite species contain Wolbachia, obligatory bacterial endosymbionts that are crucial for filarial development and reproduction. They are targets for alternative chemotherapy, but their role in the biology of filarial nematodes is not well understood. Light microscopy provides important information on morphology, localization and potential function of these bacteria. Surprisingly, immunohistology and in situ hybridization techniques have not been widely used to monitor Wolbachia distribution during the filarial life cycle. METHODS/PRINCIPAL FINDINGS: A monoclonal antibody directed against Wolbachia surface protein and in situ hybridization targeting Wolbachia 16S rRNA were used to monitor Wolbachia during the life cycle of B. malayi. In microfilariae and vector stage larvae only a few cells contain Wolbachia. In contrast, large numbers of Wolbachia were detected in the lateral chords of L4 larvae, but no endobacteria were detected in the genital primordium. In young adult worms (5 weeks p.i., a massive expansion of Wolbachia was observed in the lateral chords adjacent to ovaries or testis, but no endobacteria were detected in the growth zone of the ovaries, uterus, the growth zone of the testis or the vas deferens. Confocal laser scanning and transmission electron microscopy showed that numerous Wolbachia are aligned towards the developing ovaries and single endobacteria were detected in the germline. In inseminated females (8 weeks p.i. Wolbachia were observed in the ovaries, embryos and in decreasing numbers in the lateral chords. In young males Wolbachia were found in distinct zones of the testis and in large numbers in the lateral chords in the vicinity of testicular tissue but never in mature spermatids or spermatozoa. CONCLUSIONS: Immunohistology and in situ hybridization show distinct tissue and stage specific distribution patterns for Wolbachia in B. malayi. Extensive multiplication of Wolbachia occurs in the

  2. Brugia malayi Microfilariae Induce a Regulatory Monocyte/Macrophage Phenotype That Suppresses Innate and Adaptive Immune Responses

    Science.gov (United States)

    Venugopal, Gopinath; Rao, Gopala B.; Lucius, Richard; Srikantam, Aparna; Hartmann, Susanne

    2014-01-01

    Background Monocytes and macrophages contribute to the dysfunction of immune responses in human filariasis. During patent infection monocytes encounter microfilariae in the blood, an event that occurs in asymptomatically infected filariasis patients that are immunologically hyporeactive. Aim To determine whether blood microfilariae directly act on blood monocytes and in vitro generated macrophages to induce a regulatory phenotype that interferes with innate and adaptive responses. Methodology and principal findings Monocytes and in vitro generated macrophages from filaria non-endemic normal donors were stimulated in vitro with Brugia malayi microfilarial (Mf) lysate. We could show that monocytes stimulated with Mf lysate develop a defined regulatory phenotype, characterised by expression of the immunoregulatory markers IL-10 and PD-L1. Significantly, this regulatory phenotype was recapitulated in monocytes from Wuchereria bancrofti asymptomatically infected patients but not patients with pathology or endemic normals. Monocytes from non-endemic donors stimulated with Mf lysate directly inhibited CD4+ T cell proliferation and cytokine production (IFN-γ, IL-13 and IL-10). IFN-γ responses were restored by neutralising IL-10 or PD-1. Furthermore, macrophages stimulated with Mf lysate expressed high levels of IL-10 and had suppressed phagocytic abilities. Finally Mf lysate applied during the differentiation of macrophages in vitro interfered with macrophage abilities to respond to subsequent LPS stimulation in a selective manner. Conclusions and significance Conclusively, our study demonstrates that Mf lysate stimulation of monocytes from healthy donors in vitro induces a regulatory phenotype, characterized by expression of PD-L1 and IL-10. This phenotype is directly reflected in monocytes from filarial patients with asymptomatic infection but not patients with pathology or endemic normals. We suggest that suppression of T cell functions typically seen in lymphatic

  3. Homologs of the Caenorhabditis elegans masculinizing gene her-1 in C. briggsae and the filarial parasite Brugia malayi.

    Science.gov (United States)

    Streit, A; Li, W; Robertson, B; Schein, J; Kamal, I H; Marra, M; Wood, W B

    1999-08-01

    The masculinizing gene her-1 in Caenorhabditis elegans (Ce-her-1) encodes a novel protein, HER-1A, which is required for male development. To identify conserved elements in her-1 we have cloned and characterized two homologous nematode genes: one by synteny from the closely related free-living species C. briggsae (Cb-her-1) and the other, starting with a fortuitously identified expressed sequence tag, from the distantly related parasite Brugia malayi (Bm-her-1). The overall sequence identities of the predicted gene products with Ce-HER-1A are only 57% for Cb-HER-1, which is considerably lower than has been found for most homologous briggsae genes, and 35% for Bm-HER-1. However, conserved residues are found throughout both proteins, and like Ce-HER-1A, both have putative N-terminal signal sequences. Ce-her-1 produces a larger masculinizing transcript (her-1a) and a smaller transcript of unknown function (her-1b); both are present essentially only in males. By contrast, Cb-her-1 appears to produce only one transcript, corresponding to her-1a; it is enriched in males but present also in hermaphrodites. Injection of dsRNA transcribed from Cb-her-1 into C. briggsae hermaphrodites (RNA interference) caused XO animals to develop into partially fertile hermaphrodites. Introducing a Cb-her-1 construct as a transgene under control of the C. elegans unc-54 myosin heavy chain promoter caused strong masculinization of both C. briggsae and C. elegans hermaphrodites. Introduction of a similar Bm-her-1 construct into C. elegans caused only very weak, if any, masculinization. We conclude that in spite of considerable divergence the Cb gene is likely to be a functional ortholog of Ce-her-1, while the function of the distantly related Bm gene remains uncertain.

  4. Real-time PCR detection of the HhaI tandem DNA repeat in pre- and post-patent Brugia malayi infections: a study in Indonesian transmigrants

    Science.gov (United States)

    2014-01-01

    Background Lymphatic filariasis caused by Wuchereria bancrofti or Brugia spp. is a public health problem in developing countries. To monitor bancroftian filariasis infections, Circulating Filarial Antigen (CFA) test is commonly used, but for brugian infections only microfilariae (Mf) microscopy and indirect IgG4 antibody analyses are available. Improved diagnostics for detecting latent infections are required. Methods An optimized real-time PCR targeting the brugian HhaI repeat was validated with plasma from microfilariae negative Mongolian gerbils (jirds) infected with B. malayi. Plasma samples from microfilaremic patients infected with B. malayi or W. bancrofti were used as positive and negative controls, respectively. PCR results of plasma samples from a transmigrant population in a B. malayi endemic area were compared to those of life-long residents in the same endemic area; and to IgG4 serology results from the same population. To discriminate between active infections and larval exposure a threshold was determined by correlation and Receiver-Operating Characteristics (ROC) curve analyses. Results The PCR detected HhaI in pre-patent (56 dpi) B. malayi infected jirds and B. malayi Mf-positive patients from Central Sulawesi, Indonesia. HhaI was also detected in 9/9 elephantiasis patients. In South Sulawesi 87.4% of the transmigrants and life-long residents (94% Mf-negative) were HhaI PCR positive. Based on ROC-curve analysis a threshold for active infections was set to >53 HhaI copies/μl (AUC: 0.854). Conclusions The results demonstrate that the HhaI PCR detects brugian infections with greater sensitivity than the IgG4 test, most notably in Mf-negative patients (i.e. pre-patent or latent infections). PMID:24685183

  5. A potential role for the interaction of Wolbachia surface proteins with the Brugia malayi glycolytic enzymes and cytoskeleton in maintenance of endosymbiosis.

    Science.gov (United States)

    Melnikow, Elena; Xu, Shulin; Liu, Jing; Bell, Aaron J; Ghedin, Elodie; Unnasch, Thomas R; Lustigman, Sara

    2013-01-01

    The human filarial parasite Brugia malayi harbors an endosymbiotic bacterium of the genus Wolbachia. The Wolbachia represent an attractive target for the control of filarial induced disease as elimination of the bacteria affects molting, reproduction and survival of the worms. The molecular basis for the symbiotic relationship between Wolbachia and their filarial hosts has yet to be elucidated. To identify proteins involved in this process, we focused on the Wolbachia surface proteins (WSPs), which are known to be involved in bacteria-host interactions in other bacterial systems. Two WSP-like proteins (wBm0152 and wBm0432) were localized to various host tissues of the B. malayi female adult worms and are present in the excretory/secretory products of the worms. We provide evidence that both of these proteins bind specifically to B. malayi crude protein extracts and to individual filarial proteins to create functional complexes. The wBm0432 interacts with several key enzymes involved in the host glycolytic pathway, including aldolase and enolase. The wBm0152 interacts with the host cytoskeletal proteins actin and tubulin. We also show these interactions in vitro and have verified that wBm0432 and B. malayi aldolase, as well as wBm0152 and B. malayi actin, co-localize to the vacuole surrounding Wolbachia. We propose that both WSP protein complexes interact with each other via the aldolase-actin link and/or via the possible interaction between the host's enolase and the cytoskeleton, and play a role in Wolbachia distribution during worm growth and embryogenesis.

  6. Rapid detection and identification of Wuchereria bancrofti, Brugia malayi, B. pahangi, and Dirofilaria immitis in mosquito vectors and blood samples by high resolution melting real-time PCR.

    Science.gov (United States)

    Thanchomnang, Tongjit; Intapan, Pewpan M; Tantrawatpan, Chairat; Lulitanond, Viraphong; Chungpivat, Sudchit; Taweethavonsawat, Piyanan; Kaewkong, Worasak; Sanpool, Oranuch; Janwan, Penchom; Choochote, Wej; Maleewong, Wanchai

    2013-12-01

    A simple, rapid, and high-throughput method for detection and identification of Wuchereria bancrofti, Brugia malayi, Brugia pahangi, and Dirofilaria immitis in mosquito vectors and blood samples was developed using a real-time PCR combined with high-resolution melting (HRM) analysis. Amplicons of the 4 filarial species were generated from 5S rRNA and spliced leader sequences by the real-time PCR and their melting temperatures were determined by the HRM method. Melting of amplicons from W. bancrofti, B. malayi, D. immitis, and B. pahangi peaked at 81.5±0.2℃, 79.0±0.3℃, 76.8±0.1℃, and 79.9±0.1℃, respectively. This assay is relatively cheap since it does not require synthesis of hybridization probes. Its sensitivity and specificity were 100%. It is a rapid and technically simple approach, and an important tool for population surveys as well as molecular xenomonitoring of parasites in vectors.

  7. Hemagglutinins in Anopheles quadrimaculatus, strains susceptible and refractory to Brugia malayi, and their role in the immune response to filarial parasites.

    Science.gov (United States)

    Nayar, J K; Knight, J W

    1997-01-01

    Hemagglutinins in the salivary gland extract and in the body fluid from strains of the mosquito, Anopheles quadrimaculatus, susceptible and refractory to the filarial parasite, Brugia malayi, had higher titers against Human A+, B- and O+, and sheep erythrocytes than against rabbit and jird erythrocytes. Hemagglutination activity in the body fluid was low in newly emerged females but increased and stabilized as they became older. Hemagglutination activity of the body fluid was not reduced by freezing at -20 degrees C, but it was destroyed following heating the body fluid to 60 degrees C and 100 degrees C for 45 min, indicating that the hemagglutinins are heat labile, and they are proteins or glycoproteins. Hemagglutinins in the salivary glands exhibited specificities for a broader range of carbohydrate moieties on the surface of Human A+ and sheep erythrocytes than those in the body fluid. Injections of specific carbohydrates in saline solution into B. malayi-infected females of the refractory strain of An. quadrimaculatus 24 hr after the infective blood meal showed that galactose, N-acetyl-D-galacto-samine, sorbose and mannose inhibited the increase in encapsulation (melanization) of L1 of B. malayi in the thoracic muscles of An. quadrimaculatus females when compared to those females injected with saline and other carbohydrates. The results suggest that hemagglutinins are present in the salivary gland extract and the body fluid of both strains of An. quadrimaculatus females and they may be involved in the immune response (encapsulation) to filarial parasites in An. quadrimaculatus.

  8. Chemical constituents and antifilarial activity of Lantana camara against human lymphatic filariid Brugia malayi and rodent filariid Acanthocheilonema viteae maintained in rodent hosts.

    Science.gov (United States)

    Misra, Namita; Sharma, Mithilesh; Raj, Kanwal; Dangi, Anil; Srivastava, Sudhir; Misra-Bhattacharya, Shailja

    2007-02-01

    Lymphatic filariasis continues to be a major health problem in tropical and subtropical countries. A macrofilaricidal agent capable of eliminating adult filarial parasites is urgently needed. In the present study, we report the antifilarial activity in the extract of stem portion of the plant Lantana camara. The crude extract at 1 g/kg for 5 days by oral route killed 43.05% of the adult Brugia malayi parasites and sterilized 76% of surviving female worms in the rodent model Mastomys coucha. A 34.5% adulticidal activity along with sterilization of 66% of female worms could be demonstrated in the chloroform fraction. Remarkable antifilarial activity was observed in the adult B. malayi transplanted gerbil model where up to 80% of the adult worms could be killed at the same dose and all the surviving female parasites were found sterilized. The extract was also found effective against a subcutaneous rodent filariid Acanthocheilonema viteae maintained in Mastomys coucha, where it exerted strong microfilaricidal (95.04%) and sterilization (60.66%) efficacy with mild macrofilaricidal action. Two compounds, oleanonic acid and oleanolic acid, isolated from hexane and chloroform fractions showed LC100 at 31.25 and 62.5 mug/ml, respectively, on B. malayi in vitro. This is the first ever report on the antifilarial efficacy of Lantana camara.

  9. Wolbachia lipoproteins: abundance, localisation and serology of Wolbachia peptidoglycan associated lipoprotein and the Type IV Secretion System component, VirB6 from Brugia malayi and Aedes albopictus.

    Science.gov (United States)

    Voronin, Denis; Guimarães, Ana F; Molyneux, Gemma R; Johnston, Kelly L; Ford, Louise; Taylor, Mark J

    2014-10-06

    Lipoproteins are the major agonists of Wolbachia-dependent inflammatory pathogenesis in filariasis and a validated target for drug discovery. Here we characterise the abundance, localisation and serology of the Wolbachia lipoproteins: Wolbachia peptidoglycan associated lipoprotein and the Type IV Secretion System component, VirB6. We used proteomics to confirm lipoprotein presence and relative abundance; fractionation, immunoblotting and confocal and electron immuno-microscopy for localisation and ELISA for serological analysis. Proteomic analysis of Brugia malayi adult female protein extracts confirmed the presence of two lipoproteins, previously predicted through bioinformatics: Wolbachia peptidoglycan associated lipoprotein (wBmPAL) and the Type IV Secretion System component, VirB6 (wBmVirB6). wBmPAL was among the most abundant Wolbachia proteins present in an extract of adult female worms with wBmVirB6 only detected at a much lower abundance. This differential abundance was reflected in the immunogold-labelling, which showed wBmPAL localised at numerous sites within the bacterial membranes, whereas wBmVirB6 was present as a single cluster on each bacterial cell and also located within the bacterial membranes. Immunoblotting of fractionated extracts confirmed the localisation of wBmPAL to membranes and its absence from cytosolic fractions of C6/36 mosquito cells infected with wAlbB. In whole worm mounts, antibody labelling of both lipoproteins were associated with Wolbachia. Serological analysis showed that both proteins were immunogenic and raised antibody responses in the majority of individuals infected with Wuchereria bancrofti. Two Wolbachia lipoproteins, wBmPAL and wBmVirB6, are present in extracts of Brugia malayi with wBmPAL among the most abundant of Wolbachia proteins. Both lipoproteins localised to bacterial membranes with wBmVirB6 present as a single cluster suggesting a single Type IV Secretory System on each Wolbachia cell.

  10. Construction of bacterial artificial chromosome libraries from the parasitic nematode Brugia malayi and physical mapping of the genome of its Wolbachia endosymbiont.

    Science.gov (United States)

    Foster, Jeremy M; Kumar, Sanjay; Ganatra, Mehul B; Kamal, Ibrahim H; Ware, Jennifer; Ingram, Jessica; Pope-Chappell, Jesse; Guiliano, David; Whitton, Claire; Daub, Jennifer; Blaxter, Mark L; Slatko, Barton E

    2004-05-01

    The parasitic nematode, Brugia malayi, causes lymphatic filariasis in humans, which in severe cases leads to the condition known as elephantiasis. The parasite contains an endosymbiotic alpha-proteobacterium of the genus Wolbachia that is required for normal worm development and fecundity and is also implicated in the pathology associated with infections by these filarial nematodes. Bacterial artificial chromosome libraries were constructed from B. malayi DNA and provide over 11-fold coverage of the nematode genome. Wolbachia genomic fragments were simultaneously cloned into the libraries giving over 5-fold coverage of the 1.1 Mb bacterial genome. A physical framework for the Wolbachia genome was developed by construction of a plasmid library enriched for Wolbachia DNA as a source of sequences to hybridise to high-density bacterial artificial chromosome colony filters. Bacterial artificial chromosome end sequencing provided additional Wolbachia probe sequences to facilitate assembly of a contig that spanned the entire genome. The Wolbachia sequences provided a marker approximately every 10 kb. Four rare-cutting restriction endonucleases were used to restriction map the genome to a resolution of approximately 60 kb and demonstrate concordance between the bacterial artificial chromosome clones and native Wolbachia genomic DNA. Comparison of Wolbachia sequences to public databases using BLAST algorithms under stringent conditions allowed confident prediction of 69 Wolbachia peptide functions and two rRNA genes. Comparison to closely related complete genomes revealed that while most sequences had orthologs in the genome of the Wolbachia endosymbiont from Drosophila melanogaster, there was no evidence for long-range synteny. Rather, there were a few cases of short-range conservation of gene order extending over regions of less than 10 kb. The molecular scaffold produced for the genome of the Wolbachia from B. malayi forms the basis of a genomic sequencing effort for

  11. Exome and Transcriptome Sequencing of Aedes aegypti Identifies a Locus That Confers Resistance to Brugia malayi and Alters the Immune Response

    KAUST Repository

    Juneja, Punita

    2015-03-27

    Many mosquito species are naturally polymorphic for their abilities to transmit parasites, a feature which is of great interest for controlling vector-borne disease. Aedes aegypti, the primary vector of dengue and yellow fever and a laboratory model for studying lymphatic filariasis, is genetically variable for its capacity to harbor the filarial nematode Brugia malayi. The genome of Ae. aegypti is large and repetitive, making genome resequencing difficult and expensive. We designed exome captures to target protein-coding regions of the genome, and used association mapping in a wild Kenyan population to identify a single, dominant, sex-linked locus underlying resistance. This falls in a region of the genome where a resistance locus was previously mapped in a line established in 1936, suggesting that this polymorphism has been maintained in the wild for the at least 80 years. We then crossed resistant and susceptible mosquitoes to place both alleles of the gene into a common genetic background, and used RNA-seq to measure the effect of this locus on gene expression. We found evidence for Toll, IMD, and JAK-STAT pathway activity in response to early stages of B. malayi infection when the parasites are beginning to die in the resistant genotype. We also found that resistant mosquitoes express anti-microbial peptides at the time of parasite-killing, and that this expression is suppressed in susceptible mosquitoes. Together, we have found that a single resistance locus leads to a higher immune response in resistant mosquitoes, and we identify genes in this region that may be responsible for this trait.

  12. Comparison of an enzyme linked immunosorbent assay (ELISA) and a radioallergosorbent test (RAST) for detection of IgE antibodies to Brugia malayi.

    Science.gov (United States)

    Wahyuni, Sitti; Van Ree, Ronald; Mangali, Andarias; Supali, Taniawati; Yazdanbakhsh, Maria; Sartono, Erliyani

    2003-01-01

    The enzyme linked immunosorbent assay (ELISA) for specific IgE antibodies to Brugia malayi was compared with the radioallergosorbent test (RAST) for use in immunoepidemiological studies of lymphatic filariasis. Sera used were from individuals (aged 5-82 years) living in an area endemic for lymphatic filariasis in South Sulawesi, Indonesia. The percentage of positive IgE ELISA reactions (52.6%) among the population was lower than the percentage of positive RAST (94.5%). Although an overall significant concordance was found between the two assays (P RAST result were negative in the ELISA, whereas only 6 (0.8%) subjects were positive by ELISA, yet negative by RAST. When the population was divided into those with active infection (positive for anti-filarial IgG4) and those not infected (mf-negative and negative for anti-filarial IgG4), the correlation between the two tests was higher in the IgG4-positive (rho = 0.70) than in the IgG4-negative (rho = 0.52) group. These results indicate that in assessment of B. malayi specific IgE antibody, RAST is superior to ELISA. However, given the use of radioactivity in the RAST method and given our results obtained in subjects with high anti-filarial IgG4, one could consider using the IgE-ELISA in areas with high endemicity for filariasis. In areas with low endemicity or where control programs are implemented, sera will have to be tested by RAST.

  13. Vaccination of Gerbils with Bm-103 and Bm-RAL-2 Concurrently or as a Fusion Protein Confers Consistent and Improved Protection against Brugia malayi Infection.

    Directory of Open Access Journals (Sweden)

    Sridhar Arumugam

    2016-04-01

    Full Text Available The Brugia malayi Bm-103 and Bm-RAL-2 proteins are orthologous to Onchocerca volvulus Ov-103 and Ov-RAL-2, and which were selected as the best candidates for the development of an O. volvulus vaccine. The B. malayi gerbil model was used to confirm the efficacy of these Ov vaccine candidates on adult worms and to determine whether their combination is more efficacious.Vaccine efficacy of recombinant Bm-103 and Bm-RAL-2 administered individually, concurrently or as a fusion protein were tested in gerbils using alum as adjuvant. Vaccination with Bm-103 resulted in worm reductions of 39%, 34% and 22% on 42, 120 and 150 days post infection (dpi, respectively, and vaccination with Bm-RAL-2 resulted in worm reductions of 42%, 22% and 46% on 42, 120 and 150 dpi, respectively. Vaccination with a fusion protein comprised of Bm-103 and Bm-RAL-2 resulted in improved efficacy with significant reduction of worm burden of 51% and 49% at 90 dpi, as did the concurrent vaccination with Bm-103 and Bm-RAL-2, with worm reduction of 61% and 56% at 90 dpi. Vaccination with Bm-103 and Bm-RAL-2 as a fusion protein or concurrently not only induced a significant worm reduction of 61% and 42%, respectively, at 150 dpi, but also significantly reduced the fecundity of female worms as determined by embryograms. Elevated levels of antigen-specific IgG were observed in all vaccinated gerbils. Serum from gerbils vaccinated with Bm-103 and Bm-RAL-2 individually, concurrently or as a fusion protein killed third stage larvae in vitro when combined with peritoneal exudate cells.Although vaccination with Bm-103 and Bm-RAL-2 individually conferred protection against B. malayi infection in gerbils, a more consistent and enhanced protection was induced by vaccination with Bm-103 and Bm-RAL-2 fusion protein and when they were used concurrently. Further characterization and optimization of these filarial vaccines are warranted.

  14. The TLR2/6 ligand PAM2CSK4 is a Th2 polarizing adjuvant in Leishmania major and Brugia malayi murine vaccine models.

    Science.gov (United States)

    Halliday, Alice; Turner, Joseph D; Guimarães, Ana; Bates, Paul A; Taylor, Mark J

    2016-02-20

    Toll-like receptors (TLRs) play an important role in the innate and adaptive immune responses to pathogens, and are the target of new vaccine adjuvants. TLR2 plays a role in parasite recognition and activation of immune responses during cutaneous leishmaniasis infection, suggesting that TLR2 could be targeted by adjuvants for use in Leishmania vaccines. We therefore explored using Pam2CSK4 (Pam2) and Pam3CSK4 (Pam3) lipopeptide adjuvants, which activate TLR2/6 and TLR2/1 heterodimers respectively, in vaccine models for parasitic infections. The use of lipopeptide adjuvants was explored using two vaccine models. For cutaneous leishmaniasis, the lipopeptide adjuvants Pam2 and Pam3 were compared to that of the Th1-driving double-stranded DNA TLR9 agonist CpG for their ability to improve the efficacy of the autoclaved Leishmania major (ALM) vaccine to protect against L. major infection. The ability of Pam2 to enhance the efficacy of a soluble Brugia malayi microfilariae extract (BmMfE) vaccine to protect against filarial infection was also assessed in a peritoneal infection model of B. malayi filariasis. Parasite antigen-specific cellular and humoral immune responses were assessed post-challenge. The use of lipopeptides in ALM-containing vaccines did not provide any protection upon infection with L. major, and Pam2 exacerbated the disease severity in vaccinated mice post-challenge. Pam2, and to a lesser extent Pam3, were able to elevate antigen-specific immune responses post-challenge in this model, but these responses displayed a skewed Th2 phenotype as characterised by elevated levels of IgG1. In the B. malayi vaccine model, the use of Pam2 as an adjuvant with BmMfE induced significant protective immunity to the same level as inclusion of an Alum adjuvant. Here, both Pam2 and Alum were found to enhance antigen-specific antibody production post-challenge, and Pam2 significantly elevated levels of antigen-specific IL-4, IL-5 and IL-13 produced by splenocytes. These

  15. The role of local secondary structure in the function of the trans splicing motif of Brugia malayi

    Science.gov (United States)

    Liu, Canhui; Chauhan, Chitra; Unnasch, Thomas R.

    2009-01-01

    A 7nt motif (the trans-splicing motif or TSM) was previously shown to be necessary and sufficient to direct trans-splicing of transgenic mRNAs in transgenic B. malayi embryos. Insertion of the TSM into two genes lacking a TSM homologue resulted in-trans splicing of transgenic mRNAs from one transgene but not the other, suggesting that local sequence context might affect TSM function. To test this hypothesis, constructs inserting the TSM into different positions of two B. malayi genes were tested for their ability to support trans-splicing of transgenic mRNAs. Transgenic mRNAs derived from constructs in which the insertion of the TSM did not result in a perturbation of the local predicted secondary structure were trans-spliced, while those in which the TSM perturbed the local secondary structure were not. These data suggest that local secondary structure plays a role in the ability of the TSM to direct trans-splicing. PMID:19852985

  16. PENENTUAN JENIS NYAMUK MansoniaSEBAGAI TERSANGKA VEKTOR FILARIASIS Brugia malayi DAN HEWAN ZOONOSIS DI KABUPATEN MUARO JAMBI

    Directory of Open Access Journals (Sweden)

    Santoso Santoso

    2015-01-01

    Full Text Available AbstrakFilariasis merupakan penyakit yang tidak mudah menular. Filariasis adalah penyakit yang ditularkan oleh nyamuk sebagai vector. Jenis nyamuk yang dapat berperan sebagai vector filariasis dipengaruhi oleh jenis cacing penyebab filaria. Brugia spp. umumnya ditularkan oleh nyamuk Mansonia spp dan Anopheles spp. Vektor dan hewan zoonosis merupakan salah satu factor yang dapat perlu mendapat perhatian dalam pengendalian filariasis. Penelitian terhadap vector dan hewan zoonosis telah dilakukan di Kabupaten Muaro Jambi untuk mengidentifikasi bionomik vektor dan kemungkinan adanya hewan zoonosis yang berperan sebagai penular filariasis. Desain penelitian adalah observasi, yaitu dengan melakukan penangkapan nyamuk dan pemeriksaan darah terhadap kucing. Jumlah kucing yang diperiksa sebanyak 18 ekor. Kucing yang positif microfilaria sebanyak 1 ekor. Jumlah nyamuk Mansonia spp. tertangkap sebanyak 1,167 ekor yang terdiri dari 6 species. Spesies nyamuk tertangkap paling banyak adalah Mansonia uniformis sebanyak 1.010 ekor dengan angka kekerapan 1,0. Berdasarkan hasil tersebut, maka diperlukan peran serta masyarakat untuk mengurangi kepadatan nyamuk dengan membersihkan genangan air dan mencegah gigitan nyamuk. Selain itu diperlukan juga penanganan terhadap hewan yang bertindak sebagai zoonosis dengan memberikan pengobatan terhadap kucing agar tidak menjadi sumber infeksi.Keywords : filariasis, Mansonia, vektor, zoonosis, Muaro Jambi.AbstractFilariasisis noteasily transmitted diseases. Filariasisis transmitted by mosquito vectors. Various types of mosquitoes can act as vectors of filariasis, depending on the type of microfilaria. Brugia spp. are generally transmitted by Mansonia spp and Anopheles spp. Vector and zoonotic animal are the factors that can transmit filariasis and need to have attention for controlling filariasis. Research on vector and zoonotic had been done in Muaro Jambi to determine bionomic vector and the possibility of animals can

  17. In vitro silencing of Brugia malayi trehalose-6-phosphate phosphatase impairs embryogenesis and in vivo development of infective larvae in jirds.

    Directory of Open Access Journals (Sweden)

    Susheela Kushwaha

    Full Text Available The trehalose metabolic enzymes have been considered as potential targets for drug or vaccine in several organisms such as Mycobacterium, plant nematodes, insects and fungi due to crucial role of sugar trehalose in embryogenesis, glucose uptake and protection from stress. Trehalose-6-phosphate phosphatase (TPP is one of the enzymes of trehalose biosynthesis that has not been reported in mammals. Silencing of tpp gene in Caenorhabditis elegans revealed an indispensable functional role of TPP in nematodes.In the present study, functional role of B. malayi tpp gene was investigated by siRNA mediated silencing which further validated this enzyme to be a putative antifilarial drug target. The silencing of tpp gene in adult female B. malayi brought about severe phenotypic deformities in the intrauterine stages such as distortion and embryonic development arrest. The motility of the parasites was significantly reduced and the microfilarial production as well as their in vitro release from the female worms was also drastically abridged. A majority of the microfilariae released in to the culture medium were found dead. B. malayi infective larvae which underwent tpp gene silencing showed 84.9% reduced adult worm establishment after inoculation into the peritoneal cavity of naïve jirds.The present findings suggest that B. malayi TPP plays an important role in the female worm embryogenesis, infectivity of the larvae and parasite viability. TPP enzyme of B. malayi therefore has the potential to be exploited as an antifilarial drug target.

  18. Genomes of parasitic nematodes (Meloidogyne hapla, Meloidogyne incognita, Ascaris suum and Brugia malayi) have a reduced complement of small RNA interference pathway genes: knockdown can reduce host infectivity of M. incognita.

    Science.gov (United States)

    Iqbal, Sadia; Fosu-Nyarko, John; Jones, Michael G K

    2016-07-01

    The discovery of RNA interference (RNAi) as an endogenous mechanism of gene regulation in a range of eukaryotes has resulted in its extensive use as a tool for functional genomic studies. It is important to study the mechanisms which underlie this phenomenon in different organisms, and in particular to understand details of the effectors that modulate its effectiveness. The aim of this study was to identify and compare genomic sequences encoding genes involved in the RNAi pathway of four parasitic nematodes: the plant parasites Meloidogyne hapla and Meloidogyne incognita and the animal parasites Ascaris suum and Brugia malayi because full genomic sequences were available-in relation to those of the model nematode Caenorhabditis elegans. The data generated was then used to identify some potential targets for control of the root knot nematode, M. incognita. Of the 84 RNAi pathway genes of C. elegans used as model in this study, there was a 42-53 % reduction in the number of effectors in the parasitic nematodes indicating substantial differences in the pathway between species. A gene each from six functional groups of the RNAi pathway of M. incognita was downregulated using in vitro RNAi, and depending on the gene (drh-3, tsn-1, rrf-1, xrn-2, mut-2 and alg-1), subsequent plant infection was reduced by up to 44 % and knockdown of some genes (i.e. drh-3, mut-2) also resulted in abnormal nematode development. The information generated here will contribute to defining targets for more robust nematode control using the RNAi technology.

  19. Brugia malayi Antigen (BmA Inhibits HIV-1 Trans-Infection but Neither BmA nor ES-62 Alter HIV-1 Infectivity of DC Induced CD4+ Th-Cells.

    Directory of Open Access Journals (Sweden)

    Emily E I M Mouser

    Full Text Available One of the hallmarks of HIV-1 disease is the association of heightened CD4+ T-cell activation with HIV-1 replication. Parasitic helminths including filarial nematodes have evolved numerous and complex mechanisms to skew, dampen and evade human immune responses suggesting that HIV-1 infection may be modulated in co-infected individuals. Here we studied the effects of two filarial nematode products, adult worm antigen from Brugia malayi (BmA and excretory-secretory product 62 (ES-62 from Acanthocheilonema viteae on HIV-1 infection in vitro. Neither BmA nor ES-62 influenced HIV-1 replication in CD4+ enriched T-cells, with either a CCR5- or CXCR4-using virus. BmA, but not ES-62, had the capacity to bind the C-type lectin dendritic cell-specific intercellular adhesion molecule-3-grabbing non-integrin (DC-SIGN thereby inhibiting HIV-1 trans-infection of CD4+ enriched T-cells. As for their effect on DCs, neither BmA nor ES-62 could enhance or inhibit DC maturation as determined by CD83, CD86 and HLA-DR expression, or the production of IL-6, IL-10, IL-12 and TNF-α. As expected, due to the unaltered DC phenotype, no differences were found in CD4+ T helper (Th cell phenotypes induced by DCs treated with either BmA or ES-62. Moreover, the HIV-1 susceptibility of the Th-cell populations induced by BmA or ES-62 exposed DCs was unaffected for both CCR5- and CXCR4-using HIV-1 viruses. In conclusion, although BmA has the potential capacity to interfere with HIV-1 transmission or initial viral dissemination through preventing the virus from interacting with DCs, no differences in the Th-cell polarizing capacity of DCs exposed to BmA or ES-62 were observed. Neither antigenic source demonstrated beneficial or detrimental effects on the HIV-1 susceptibility of CD4+ Th-cells induced by exposed DCs.

  20. Intracellular melanization in the mosquito Anopheles quadrimaculatus (Diptera: Culicidae) against the filarial nematodes, Brugia spp. (Nematoda: Filarioidea).

    Science.gov (United States)

    Nayar, J K; Knight, J W; Vickery, A C

    1989-05-01

    Intracellular melanization responses to developing larvae of Brugia species (B. malayi (Buckley), B. pahangi (Buckley and Edeson), and B. patei (Buckley, Nelson, and Heisch] in the thoracic muscle fibers of eight strains of Anopheles quadrimaculatus Say were first observed 48 to 72 h after an infective blood meal. Three to 4 d later, large numbers of melanized first-stage larvae were found within the thoracic muscle fibers. These intracellular responses were in addition to the extracellular responses to microfilariae and microfilarial sheaths of B. pahangi in the abdominal hemocoel of An. quadrimaculatus described in literature. Simultaneously, normal development of larvae of the three Brugia species also was observed in all eight strains of An. quadrimaculatus. Comparisons of melanized first-stage larvae and normally developing larvae of the three Brugia species in the thoracic muscle fibers of the eight strains of An. quadrimaculatus showed that there were distinct variations in numbers of melanized and developing larvae and percentage of females with melanized and developing larvae in different strains. Numbers of melanized first-stage larvae reflected the extent of refractoriness of An. quadrimaculatus strains. Fully melanized larvae showed no abnormalities in parasite organelles, indicating that refractoriness is due to an enhanced ability of the host to recognize the living parasite. Further comparison among the strains suggested that the mutants, Yellow Larvae and Vero Beach Colony were significantly more susceptible, and Red Stripe was the most refractory to all three Brugia species. Thus, the gene(s) controlling susceptibility and refractoriness to all three Brugia species probably occurs on the same autosomal chromosome as the mutations in these strains. The significance of intracellular melanization of filarial larvae is discussed with reference to the melanization responses to different parasites in other mosquitoes.

  1. A FIELD STUDY USING THE POLYMERASE CHAIN REACTION (PCR TO SCREEN FOR BRUGIA MICROFILARIAE IN HUMAN AND ANIMAL BLOOD

    Directory of Open Access Journals (Sweden)

    Janet Glover

    2012-09-01

    Full Text Available Blood samples from 43 humans and 14 cats positive with Brugia microfilariae were analyzed in a field study in Tanjung Pinang, Indonesia. The study used the polymerase chain reaction (PCR to compare the sensitivity of radioactive and biotinylated species-specific oligonuleotide probes. The cloning char­acterization of the Hha I repeat DNA family found in filarial parasites of the genus Brugia, and the development of species-specific probes for B.malayi and B.pahangi based on these repeats has been described elsewhere (PNAS USA 83: 797-801; Mol.Biochem. Parasitol. 2$: 163-170. The use of radioisotopes for labelling DNA probes is both expensive and inconvenient. To replace these probes, biotinylated DNA probes have been designed for non- radioactive detection of B.malayi and B.pahangi. These oligonucleotide probes have long tails of biotinylated uridine residues added to their 5' end. As little as 100 pg of Brugia DNA can be detected on dot blot with these probes. Detection of the probes is based on an avidin-alkaline phosphatase colorimetric assay. In order to distinguish between infected from uninfected individuals, it is necessary to detect the amount of DNA in one microfilaria (about 60 pg. The polymerase chain reaction (PCR is a procedure in which a small amount of DNA can be amplified up to 1 million-fold. A part of each sample in this study was PCR amplified and compared with the unamplified portion using both the radioactive and biotinylated DNA probe. The PCR amplified samples were accurately identified by both the radioactive and biotinylated B.malayi and B.pahangi probes. Even samples with as few as two microfilariae per lOOul of blood were easily detected. The samples that were not PCR amplified were accurately identified after only long exposures (greater than one week to the radioactive probes. The biotinylated probes, were not sensitive enough for accurate identification of the non-PCR amplified samples. The polymerase chain

  2. Cloning and expression analysis of two mucin-like genes encoding microfilarial sheath surface proteins of the parasitic nematodes Brugia and Litomosoides.

    Science.gov (United States)

    Hirzmann, Jörg; Hintz, Martin; Kasper, Martin; Shresta, Tilak R; Taubert, Anja; Conraths, Franz J; Geyer, Rudolf; Stirm, Stephan; Zahner, Horst; Hobom, Gerd

    2002-12-06

    In several filarial genera the first stage larvae (microfilariae) are enclosed by an eggshell-derived sheath that provides a major interface between the parasite and the host immune system. Analysis of the polypeptide constituents of the microfilarial sheath from the cotton rat filaria Litomosoides sigmodontis identified two abundant surface glycoproteins: Shp3a and Shp3. The corresponding genes and the orthologues of the human parasite Brugia malayi and the rodent filaria Brugia pahangi were cloned and sequenced. They encode secreted, mucin-like proteins with N-terminal Ser/Thr-rich repeats and a C-terminal anchor domain rich in aromatic amino acids. About 75% of the protein molecular masses result from post-translational modifications. The Ser/Thr-rich motifs are supposed to serve as targets for dimethylaminoethanol-phosphate substitutions. These modifications were detected only on the sheaths of the late developmental stage of stretched microfilariae, corresponding with the expression of the proteins in the epithelium of the distal part of the uterus and the specific transcription of shp3 and shp3a in the anterior female worm segment. Genomic analysis of all three species demonstrated a conserved linkage of the two genes. Their transcripts undergo cis- and trans-splicing. The transcription start sites of the primary transcripts were determined for the L. sigmodontis genes. The core promoter regions are remarkably conserved between the paralogue genes Ls-shp3a and Ls-shp3 and their orthologues in Brugia, implicating conserved regulatory elements.

  3. Brugia spp. and Litomosoides carinii: identification of a covalently cross-linked microfilarial sheath matrix protein (shp2).

    Science.gov (United States)

    Hirzmann, J; Schnaufer, A; Hintz, M; Conraths, F; Stirm, S; Zahner, H; Hobom, G

    1995-03-01

    A microfilarial sheath protein gene (shp2) coding for the major constituent of the insoluble, cross-linked sheath remnant (SR) from Brugia malayi, Brugia pahangi and Litomosoides carinii has been cloned and sequenced, based on peptide partial amino-acid sequences. All three closely related single-copy shp2 genes in the two genera carry a single intron in identical position; shp2 mRNAs are post-transcriptionally modified by both cis-splicing and trans-splicing. In accordance with their extracellular destinations the encoded proteins include signal peptide sequences; molecular masses of approx. 23 kDa are hence predicted for the mature secreted polypeptides. In their structures sheath matrix proteins shp2 may be regarded as extreme cases of a modular constitution, since these proteins largely consist of two different segments of multiple sequence repetitions, PAA and QYPQAP (or QYPQ), separated by elements of unique sequence. Extreme insolubility and cross-linking are likely to originate from these repetitive sequences within shp2, and to constitute the basic properties of a microfilarial matrix largely consisting of an shp2 network.

  4. Gene : CBRC-GGOR-01-0587 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available etical protein [Brugia malayi] gb|EDP38806.1| conserved hypothetical protein [Brugia malayi] 2e-19 32% MAWLAGWLGRLGWLAGLAGLVGWLAW...MAWLAGWLGWLGWQAFSAGLAGLAGRVAWLAWLAGWLGWLGWLGGLAGLAGWLAWLAGSRGWLPGLAGLAVWLAWVAWLAWLAGWLA...GLAGWVAGWLGWLGGFARLAVWAAWLPWVAGWLGWLGWLGWPAGLAGLAGLAGLAGRLAWLAWLAAWLGWLGWMASWLAWLAVWLGWLRWLAGLAGLGGSLAW

  5. Repeat region of Brugia malayi sheath protein (Shp-1) carries Dominant B epitopes recognized in filarial endemic population.

    Science.gov (United States)

    Jawaharlal, Jeya Prita Parasurama; Madhumathi, Jayaprakasam; Prince, Rajaiah Prabhu; Kaliraj, Perumal

    2014-09-01

    Transmission of lymphatic filariasis is mediated through microfilariae (L1 stage of the parasite) which is encased in an eggshell called sheath. The sheath protein Shp-1 stabilizes the structure due to the unique repeat region with Met-Pro-Pro-Gln-Gly sequences. Microfilarial proteins could be used as transmission blocking vaccines. Since the repeat region of Shp-1 was predicted to carry putative B epitopes, this region was used to analyze its reactivity with clinical samples towards construction of peptide vaccine. In silico analysis of Shp-1 showed the presence of B epitopes in the region 49-107. The polypeptide epitopic region Shp-149-107 was cloned and expressed in Escherichia coli. Antibody reactivity of the Shp-149-107 construct was evaluated in filarial endemic population by ELISA. Putatively immune endemic normals (EN) showed significantly high reactivity (P similar to that of whole protein proving that this region carries B epitopes responsible for its humoral response in humans. Thus this can be employed for inducing anti-microfilarial immunity in the infected population that may lead to reduction in transmission intensity and also it could be used along with other epitopes from different stages of the parasite in order to manage the disease effectively.

  6. L3 + Cosmics Experiment

    CERN Multimedia

    2002-01-01

    %RE4 %title\\\\ \\\\The L3+C experiment takes advantage of the unique properties of the L3 muon spectrometer to get an accurate measurement of cosmic ray muons 30 m underground. A new muon trigger, readout and DAQ system have been installed, as well as a scintillator array covering the upper surfaces of the L3 magnet for timing purposes. The acceptance amounts to 200 $m^2 sr$. The data are collected independently in parallel with L3 running. In spring 2000 a scintillator array will be installed on the roof of the SX hall in order to estimate the primary energy of air showers associated with events observed in L3+C.\\\\ \\\\The cosmic ray muon momentum spectrum, the zenith angular dependence and the charge ratio are measured with high accuracy between 20 and 2000 GeV/c. The results will provide new information about the primary composition, the shower development in the atmosphere, and the inclusive pion and kaon (production-) cross sections (specifically the "$\\pi$/K ratio") at high energies. These data will also hel...

  7. L3 Experiment

    CERN Multimedia

    Falagan bobillo, M A; Chen, E F A; Prokofiev, D; Prokofiev, D; Shvorab, A; Galaktionov, Y; Kopal, M; Cotorobai, F; Le goff, J; Tully, C; Van hoek, W; Nozik, V Z; Nessi-tedaldi, F; De la cruz, B; Wadhwa, M; Chtcheguelski, V; Anderhub, H B; Guo, Y; Garcia-abia, P; Piroue, P; Della marina, R; Cerrada, M; Gailloud, M; Xia, L; Chaturvedi, U K; Pistolesi, E; Zhang, S

    2002-01-01

    % L3 \\\\ \\\\ The detector consists of a large volume low field solenoid magnet, a small central tracking system with very high spatial resolution, a high resolution electromagnetic calorimeter encapsulating the central detector, a hadron calorimeter acting also as a muon filter, and high precision muon tracking chambers. \\\\ \\\\The detector is designed to measure energy and position of leptons with the highest obtainable precision allowing a mass resolution $\\Delta$m/m smaller than 2\\% in dilepton final states. Hadronic energy flux is detected by a fine-grained calorimeter, which also serves as muon filter and tracking device. \\\\ \\\\The outer boundary of the detector is given by the iron return-yoke of a conventional magnet, using aluminium plates for the coil. The field is 0.5~T over a length of 12~m. This large volume allows a high precision muon momentum measurement, performed by three sets of drift chambers in the central detector region. From the multiple measurement of the coordinate in the bending plane a m...

  8. Dicty_cDB: FC-AL11 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AW179914 |AW179914.1 SWYD25CAU05D03SK Brugia malayi young adult day 25 cDNA (SAW99MLW-BmYD25) Brugia malayi...BE132434 |BE132434.1 SWYACAL09G02SK Brugia malayi young adult cDNA (SAW99MLW-BmYA) Brugia malayi cDNA clone

  9. The L3 radiation monitor

    Energy Technology Data Exchange (ETDEWEB)

    Ahlen, S. [Boston Univ., MA (United States). Dept. of Physics; Goldstein, J. [Boston Univ., MA (United States). Dept. of Physics; Marin, A. [Boston Univ., MA (United States). Dept. of Physics; Xu, J. [Boston Univ., MA (United States). Dept. of Physics; Zhou, B. [Boston Univ., MA (United States). Dept. of Physics; Capell, M. [CERN/PPE, CH-1211, Geneva 23 (Switzerland); Wu, S. [CERN/PPE, CH-1211, Geneva 23 (Switzerland)

    1996-01-21

    A radiation monitoring system for the L3 experiment at the Large Electron Positron (LEP) collider is described. This system was installed in the L3 detector in April 1993. It provides information on the instantaneous and integrated radiation dose in the vicinity of the L3 silicon microvertex detector and time expansion chamber, and since April 1994 it has also provided trigger signals for the LEP beam dump in the case of large instantaneous dose rates in the L3 central tracking region. (orig.).

  10. Exsheathment of microfilariae of Brugia pahangi in Anopheles quadrimaculatus and Culex quinquefasciatus.

    Science.gov (United States)

    Shih, C M; Chen, C C

    1987-12-01

    In order to determine whether the exsheathment patterns described in our previous study occurred in other microfilaria-mosquito systems, exsheathment of microfilariae of Brugia pahangi was studied in two species of mosquitoes. The results of the quantitative observation revealed that the microfilariae of Brugia pahangi tend to carry their sheaths into the haemocoel of Anopheles quadrimaculatus and Culex quinquefasciatus within 4 hr after infected blood meals. The percentage of the sheathed microfilariae in the haemocoel progressively decreased to 0% at 24 hr post-ingestion. Microfilariae remaining in the midgut of both species of mosquitoes were recorded most frequently casting off their sheaths in the midgut 2 hr post-ingestion. The percentage of microfilariae exsheathed in the midgut progressively increased to about 100% and 40% 24 hr post-ingestion in Anopheles quadrimaculatus and Culex quinquefasciatus respectively. These results confirm that exsheathment of microfilariae of Brugia pahangi occurs both in the haemocoel and in the midgut of two species of mosquitoes.

  11. Disease: H01086 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available fti Brugia malayi [GN:bmy] Brugia timori ... Diethylcarbamazine [DG:DG01024] Ivermectin [DR:D00804] Albendazo...20 million infected, especially in tropical regions. Wuchereria bancrofti accounts for 91% of the cases whil...e Brugia malayi and B. timori (which has a distribution restricted to South and S

  12. Human infection with sub-periodic Brugia spp. in Gampaha District, Sri Lanka: a threat to filariasis elimination status?

    Science.gov (United States)

    Mallawarachchi, Chandana H; Nilmini Chandrasena, T G A; Premaratna, Ranjan; Mallawarachchi, S M N S M; de Silva, Nilanthi R

    2018-01-29

    Post-mass drug administration (MDA) surveillance during the lymphatic filariasis (LF) elimination program in Sri Lanka, revealed the re-emergence of brugian filariasis after four decades. This study was done with the objectives of investigating the epidemiology and age-specific vulnerability to infection. Surveillance was done using night blood smears (NBS) and the Brugia rapid test (BRT), to detect microfilaria (MF) and anti-Brugia IgG4 antibodies in blood samples collected from an age-stratified population enrolled from two high-risk study areas (SA)s, Pubudugama and Wedamulla in the Gampaha District. The periodicity of the re-emergent Brugia spp. was characterized by quantitative estimation of MF in blood collected periodically over 24 h using nucleopore-membrane filtration method. Of 994 participants [Pubudugama 467 (47.9%) and Wedamulla 527 (53%)] screened by NBS, two and zero cases were positive for MF at Pubudugama (MF rate, 0.43) and Wedamulla (MF rate, 0), respectively, with an overall MF rate of 0.2. Of the two MF positives, one participant had a W. bancrofti while the other had a Brugia spp. infection. Of 984 valid BRT test readings [Pubudugama (n = 461) and Wedamulla (n = 523)], two and seven were positive for anti-brugia antibodies by BRT at Pubudugama (antibody rate 0.43) and Wedamulla (antibody rate 1.34), respectively, with an overall antibody rate of 0.91. Both MF positives detected from SAs and two of three other Brugia spp. MF positives detected at routine surveillance by the National Anti-Filariasis Campaign (AFC) tested negative by the BRT. Association of Brugia spp. infections with age were not evident due to the low case numbers. MF was observed in the peripheral circulation throughout the day (subperiodic) with peak counts occurring at 21 h indicating nocturnal sub-periodicity. There is the low-level persistence of bancroftian filariasis and re-emergence of brugian filariasis in the Gampaha District, Sri Lanka. The periodicity

  13. Dicty_cDB: SHG115 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DV316421 |DV316421.1 NABOI60TF Aedes aegypti infected with Brugia Malayi Aedes aegypti cDNA clone NABOI60...DV316420 |DV316420.1 NABOI60T1O Aedes aegypti infected with Brugia Malayi Aedes aegypti cDNA clone NABOI60...DV298771 |DV298771.1 NABPS65TR Aedes aegypti infected with Brugia Malayi Aedes aegypti cDNA clone NABPS65

  14. Dicty_cDB: SHD538 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DV316421 |DV316421.1 NABOI60TF Aedes aegypti infected with Brugia Malayi Aedes aegypti cDNA clone NABOI60...DV316420 |DV316420.1 NABOI60T1O Aedes aegypti infected with Brugia Malayi Aedes aegypti cDNA clone NABOI60...DV298771 |DV298771.1 NABPS65TR Aedes aegypti infected with Brugia Malayi Aedes aegypti cDNA clone NABPS65...DV298769 |DV298769.1 NABPS65TF Aedes aegypti infected with Brugia Malayi Aedes aegypti cDNA clone NABPS65

  15. ORF Alignment: NC_006833 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available chia ... endosymbiont strain TRS of Brugia malayi] ... Length = 74 ... Query: 12 DIEAKIKKIVLEHISKD...VEKFNNSSKLSEHGADSLDAVEIIMAAEEEFGIEIPDEDAQKM 71 ... DIEAKIKKIVLEHISKDVEKFNNS...SKLSEHGADSLDAVEIIMAAEEEFGIEIPDEDAQKM Sbjct: 1 ... DIEAKIKKIVLEHISKDVEKFNNSSKLSEHGADSLDAVEIIMAAEEEFGIEIPDEDAQKM 60 ...

  16. L3+C air shower array

    CERN Multimedia

    Laurent Guiraud

    2000-01-01

    Photo 01: a view of the L3+C air shower array; 50 scintillators on the roof of the SX-hall above L3. Photo 02: view of one of the detectors of the array.Photo 04: detectors seen against the background of the LEP Point 2 facilities.

  17. Cutting the L3 torque tube

    CERN Multimedia

    Laurent Guiraud

    2001-01-01

    Workers cut the torque tube, with a plasma-cutting device on the L3 experiment, which closed with the LEP accelerator in 2000. L3 was housed in a huge red solenoid, which will be taken over by the ALICE detector when the new LHC is completed.

  18. L3 experiment dismantling at LEP

    CERN Multimedia

    Laurent Guiraud

    2001-01-01

    The last muon chamber is removed from the L3 experiment at the LEP collider, which was in operation from 1989 to 2000. The large red magnet yoke will be reused by the ALICE experiment when the LHC is constructed.

  19. GAMBARAN PERKEMBANGAN ANTIBODI TERHADAP KOMPONEN PROTEIN CACING MIKROFILARIA MALAYI DARI TRANSMIGRAN DI SULAWESI TENGGARA

    Directory of Open Access Journals (Sweden)

    Basundari Sri Utami

    2012-09-01

    Full Text Available The immune response to microfilarial antigen in malayan filariasis was found more prominent in ami-crofilaremic individuals than in the micro filaremics. It has been shown that in amicrofilaremic individuals antibody plays a role in reducing micro filaremiae. The targets antigens of antibody (IgG were shown to be protein components of microfilariae with molecular weight of 75, 70 and 25 Kd. This prospective study was aimed at detecting IgG against microfilariae in transmigrats, who had settled into an filarial endemic area. Sera of 10 individuals at 8, 13, 26, 39 and 52 moths after settling, were examined by ELISA and Wes­tern Blott against microfilaria of B. malayi. Four out of 10 transmigrants showed IgG that recognized the protein components of 77, 70 and 31 Kd and were shown at 39, 52 and 8 months after settling respectively, The IgG against components of 77 and 70 Kd were revealed later than the one against 31 Kd.

  20. $K_{l3}$ transition form factors

    CERN Document Server

    Ji, C R; Ji, Chueng-Ryong; Maris, Pieter

    2001-01-01

    The rainbow truncation of the quark Dyson-Schwinger equation is combined with the ladder Bethe-Salpeter equation for the meson bound state amplitudes and the dressed quark-W vertex in a manifestly covariant calculation of the K_{l3} transition form factors and decay width in impulse approximation. With model gluon parameters previously fixed by the chiral condensate, the pion mass and decay constant, and the kaon mass, our results for the K_{l3} form factors and the kaon semileptonic decay width are in good agreement with the experimental data.

  1. What is special about L3 processing?

    NARCIS (Netherlands)

    de Bot, Cornelis L. J. (Kees); Jaensch, Carol

    2015-01-01

    While research on third language (L3) and multilingualism has recently shown remarkable growth, the fundamental question of what makes trilingualism special compared to bilingualism, and indeed monolingualism, continues to be evaded. In this contribution we consider whether there is such a thing as

  2. A PRELIMINARY STUDY OF MALAYAN FILARIASIS IN PUDING VILLAGE, JAMBI PROVINCE (SUMATERA, INDONESIA

    Directory of Open Access Journals (Sweden)

    Sudomo M.

    2012-09-01

    Full Text Available Beberapa daerah di Propinsi Jambi akan dikembangkan menjadi daerah transmigrasi, satu di antara­nya adalah daerah Kumpeh yang terletak berdekatan dengan daerah endemik filariasis malayi. Desa yang paling dekat dengan lokasi transmigrasi tersebut adalah desa Puding. Penelitian pendahuluan tentang penyakit filariasis telah dikerjakan di desa Puding untuk mengetahui tingkat endemisitas, periodisitas B. malayi, fauna nyamuk, jenis nyamuk yang potensial menjadi vektor filariasis, hospes reservoir dan keadaan sosial-ekonomi-budaya penduduk setempat. Mf rate pada penduduk desa Puding adalah 18,7% dan dari B. malayi jenis subperiodiknokturna. Nyamuk yang tertangkap terdiri dari enam genera yaitu genus Anopheles, Aedes, Culex, Coquilletidia, Mansonia dan Tripteroides. Dari enam genera tersebut yang potensial untuk menjadi vektor filariasis adalah genus Mansonia dan ini didukung dengan diketemukannyd larva stadium L3 (infektif Brugia sp di tubuh nyamuk tersebut. Keadaan sosial-ekonomi-budaya, khususnya menyangkut adat istiadat dan kebiasaan penduduk setempat, telah dipelajari.

  3. Cognitive approaches to L3 acquisition

    Directory of Open Access Journals (Sweden)

    Maria del Pilar Garcia Mayo

    2012-06-01

    Full Text Available Multilingualism has established itself as an area of systematic research in linguistic studies over the last two decades. The multilingual phenomenon can be approached from different perspectives: educational, formal linguistic, neurolinguistic, psycholinguistic and sociolinguistic, among others. This article presents an overview of cognitive (psychological and formal linguistic approaches to third language (L3 acquisition where the assumption is that language acquisition is a complex multi-faceted process. After identifying what is meant by L3, the article briefly reviews the major issues addressed from both the psycholinguistic strand and the emerging L3 linguistic strand and concentrates on those aspects that are in need of further research in both.El plurilingüismo se ha ganado su propia área de investigación dentro de los estudios de lingüística en las últimas dos décadas. El fenómeno se puede abordar desde perspectivas diferentes: educativa, lingüística de carácter formal, neurolingüística, psicolingüística y sociolingüística, entre otras. Este artículo presenta una visión general de dos perspectivas cognitivas, la psicológica y la procedente de la lingüística formal, al tema de la adquisición de la tercera lengua (L3. Ambas perspectivas comparten la asunción de que la adquisición del lenguaje es un proceso complejo y con varias vertientes. Después de identificar lo que entendemos por L3, el artículo revisa de forma sucinta los principales temas que se han tratado tanto desde la perspectiva psicolingüística como desde la más emergente perspectiva lingüística en materia de L3 y se concentra en aquellos aspectos que consideramos que necesitan mayor investigación en ambas.

  4. Dicty_cDB: SHA714 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 48 0.17 1 AY330618 |AY330618.1 Brugia malayi independent phosphoglycerate mutase isoform 2 (iPGM) mRNA...48 0.17 1 AY330617 |AY330617.1 Brugia malayi independent phosphoglycerate mutase isoform 1 (iPGM) mRNA

  5. Dicty_cDB: SHF327 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 48 0.25 1 AY330618 |AY330618.1 Brugia malayi independent phosphoglycerate mutase isoform 2 (iPGM) mRNA...48 0.25 1 AY330617 |AY330617.1 Brugia malayi independent phosphoglycerate mutase isoform 1 (iPGM) mRNA

  6. Dicty_cDB: VHC573 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DV363639 |DV363639.1 NACAR32TR Aedes aegypti infected with Brugia Malayi Aedes aegypti cDNA clone NACAR32...DV363638 |DV363638.1 NACAR32TF Aedes aegypti infected with Brugia Malayi Aedes aegypti cDNA clone NACAR32

  7. Dicty_cDB: VHB787 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DV363639 |DV363639.1 NACAR32TR Aedes aegypti infected with Brugia Malayi Aedes aegypti cDNA clone NACAR32...DV363638 |DV363638.1 NACAR32TF Aedes aegypti infected with Brugia Malayi Aedes aegypti cDNA clone NACAR32

  8. Hadron calorimetry in the L3 detector

    Energy Technology Data Exchange (ETDEWEB)

    Adriani, O.; Civinini, C.; D' Alessandro, R.; Gallo, E.; Marchionni, A.; Meschini, M.; Pieri, M.; Wang, Y.F. (Istituto Nazionale di Fisica Nucleare, Florence (Italy) Florence Univ. (Italy)); Arefiev, A.; Galaktionov, Yu.; Gordeev, A.; Gorodkov, Yu.; Kamyshkov, Y.U.; Klimentov, A.; Koutsenko, V.; Malinin, A.; Morgunov, V.; Plyaskin, V.; Pojidaev, V.; Savin, A.; Shevchenko, S.; Shevchenko, V.; Shmakov, K.; Shoumilov, E.; Shoutko, V.; Tarkovsky, E.; Vetlitsky, I.; Vorobiev, I. (Institut Teoreticheskoj i Ehksperimental' noj Fiziki, Moscow (USSR)); An, Q.; Blomeke, P.; Cai, X.; Cui, X.; Gong, Z.F.; Ilyas, M.M.; Khan, R.; Kumar, V.; Kunin, A.; Lin, Y.B.; Qureshi, K.; Siedling, R.; Wadhawa, M.; Wu, R.J.; Wu, S.W.; Wu, Y.G.; Zichichi, A. (World Lab., Geneva (Switzerland). FBLJA Project); Azemoon, T.; Ball, R.C.; Capell, M.; Chen, M.L.; Goldfarb, S.; Jones, L.W.; Mills, G.B.; Roe, B.P. (Michigan Univ., Ann Arbor (USA)); Aziz, T.; Banerjee, S.; Chendvankar, S.R.; Ganguli, S.N.; Gurtu, A.; Malh

    1991-04-01

    The characteristics of the L3 hadron calorimeter as realized in the observation of hadronic jets and other events from e{sup +}e{sup -} c collisions at LEP are presented and discussed. The pattern-recognition algorithm utilizing the fine granularity of the calorimeter is described, and the observed overall resolution of 10.2% for hadron jets from Z decay is reported. The use of the calorimeter in providing information on muon energy losses is also noted. (orig.).

  9. Kosmische Myonen im L3-Detektor

    CERN Document Server

    Saidi, Rachid

    2000-01-01

    Durch die Untersuchung des Mondschattens in der primaren kosmischen Strahlung konnen Informationen uber die Winkelau osung des L3-Detektors gewonnen werden, sowie mit ausreichender Statistik das Verhaltnis von Antiprotonen zu Protonen fur Protonenergien um 1 TeV abgeschatzt werden. Die Bahn der Protonen vom Mond zur Erde wird durch folgende Eekte beein ut: Das Magnetfeld zwischen Mond und Erde lenkt die geladenen Teilchen ab. Fur 1 TeV Protonenenergie wurde ein Wert von 1:70 abgeschatzt. Die Mehrfachstreuung in der 30 m dicken Erdschicht uber L3 verursacht eine Winkelverschmierung von 3.5 mrad fur 100 GeV Myonen. Der Winkel zwischen Proton und den sekundaren Myonen, die durch Wechselwirkung von primaren Kernen mit den oberen Schichten der Atmosphare entstehen, betragt 3 mrad fur 100 GeV Myonen. Die berechnete Winkelau osung dieser Untersuchung fur den L3-Detektor mit verschiedenen Energien betragt einen Wert von 0:170 0:030 fur das starkste Myonschattensignal bei 150 GeV Myonenenergie. Dabei wurde fur den Mon...

  10. Analysis list: l(3)mbt [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available l(3)mbt Cell line,Larvae + dm3 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/target/l(3)mbt....1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/target/l(3)mbt.5.tsv http://dbarchive.bioscie...ncedbc.jp/kyushu-u/dm3/target/l(3)mbt.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/colo/l(3)mbt.Cel...l_line.tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/colo/l(3)mbt.Larvae.tsv

  11. The Effects of L2 Experience on L3 Perception

    Science.gov (United States)

    Onishi, Hiromi

    2016-01-01

    This study examines the influence of experience with a second language (L2) on the perception of phonological contrasts in a third language (L3). This study contributes to L3 phonology by examining the influence of L2 phonological perception abilities on the perception of an L3 at the beginner level. Participants were native speakers of Korean…

  12. Dnase1L3 Regulates Inflammasome-Dependent Cytokine Secretion

    Directory of Open Access Journals (Sweden)

    Guilan Shi

    2017-05-01

    Full Text Available Pediatric-onset systemic lupus erythematosus arises in humans and mice lacking the endonuclease Dnase1L3. When Dnase1L3 is absent, DNA from circulating apoptotic bodies is not cleared, leading to anti-DNA antibody production. Compared to early anti-DNA and anti-chromatin responses, other autoantibody responses and general immune activation in Dnase1L3−/− mice are greatly delayed. We investigated the possibility that immune activation, specifically inflammasome activation, is regulated by Dnase1L3. Here, we report that Dnase1L3 inhibition blocked both NLR family, pyrin domain containing 3 (NLRP3 and NLRC4 inflammasome-mediated release of high-mobility group box 1 protein and IL-1β. In contrast to IL-1β release, Dnase1L3 inhibition only mildly impaired NLRP3-dependent pyroptosis, as measured by propidium iodide uptake or LDH release. Mechanistically, we found that Dnase1L3 was needed to promote apoptosis-associated speck-like protein containing a caspase activation and recruitment domain (ASC nuclear export and speck formation. Our results demonstrate that Dnase1L3 inhibition separates cytokine secretion from pyroptosis by targeting ASC. These findings suggest that Dnase1L3 is necessary for cytokine secretion following inflammasome activation.

  13. Experimental Infection of Sheep using Infective Larvae (L3 ...

    African Journals Online (AJOL)

    Experimental Infection of Sheep using Infective Larvae (L3) harvested from the Faeces of Naturally Infected Swayne's Hartebeest ( Alcelaphus buselaphus swaynei ) at Senkele Swayne's Hartebeest Sanctuary, Ethiopia.

  14. Last L3 section removed from iron yoke

    CERN Multimedia

    Laurent Guiraud

    2001-01-01

    The inner section of the L3 detector is removed from its iron yoke. L3 ran on the LEP collider at CERN between 1989 and 2000. This magnet return yoke will be reused by the ALICE exeriment when the LHC is constructed.

  15. GLONASS CDMA L3 ambiguity resolution and positioning

    NARCIS (Netherlands)

    Zaminpardaz, Safoora; Teunissen, P.J.G.; Nadarajah, Nandakumaran

    2016-01-01

    A first assessment of GLONASS CDMA L3 ambiguity resolution and positioning performance is provided. Our analyses are based on GLONASS L3 data from the satellite pair SVNs 755-801, received by two JAVAD receivers at Curtin University, Perth, Australia. In our analyses, four different versions of

  16. IceBridge DMS L3 Photogrammetric DEM

    Data.gov (United States)

    National Aeronautics and Space Administration — The IceBridge DMS L3 Photogrammetric DEM (IODMS3) data set contains gridded digital elevation models and orthorectified images of Greenland derived from the Digital...

  17. L3 English acquisition in Denmark and Greenland

    DEFF Research Database (Denmark)

    Spellerberg, Stine Marie

    2011-01-01

    This paper presents findings of gender-related tendencies found in a study of factors influential in third language acquisition of English in Denmark and Greenland. A survey consisting of a questionnaire and an English test was carried out amongst pupils in their last year of compulsory schooling...... in Copenhagen, Denmark, and Nuuk, Greenland. In total, responses from 187 pupils were included, some of which were responses from pupils learning English as a second language; these respondents were included for comparisons (Copenhagen: L2 learners N =59, L3 learners N=32; Nuuk: L3 learners N=96; age: 14......–16 years). The results showed significant gender-related differences with different patterns between the three learner groups (L2 and L3 learners in Copenhagen, L3 learners in Nuuk) with regard to the level of English proficiency, the degree to which pupils like English as a school subject and the pupils...

  18. NASA's Preparations for ESA's L3 Gravitational Wave Mission

    Science.gov (United States)

    Stebbins, Robin

    2016-03-01

    The European Space Agency (ESA) selected gravitational-wave astrophysics as the science theme for its third large mission opportunity, known as `L3,' under its Cosmic Vision Programme. NASA is seeking a role as an international partner in L3. NASA is: (1) participating in ESA's early mission activities, (2) developing potential US technology contributions, (3) participating in ESA's LISA Pathfinder mission, (4) and conducting a study of how NASA might participate. This talk will survey the status of these activities.

  19. No evidence of Wolbachia endosymbiosis with Loa loa and Mansonella perstans

    NARCIS (Netherlands)

    Grobusch, M. P.; Kombila, M.; Autenrieth, I.; Mehlhorn, H.; Kremsner, P. G.

    2003-01-01

    Endosymbiotic Wolbachia bacteria from different filarial species, including major pathogens of humans such as Wuchereria bancrofti, Brugia malayi and Onchocerca volvulus, seem to play an important role in the development, viability and fertility of these worms. Wolbachia trigger inflammatory host

  20. Life cycle of Brugia pahangi (Nematoda) in nude mice, C3H/HeN (nu/nu).

    Science.gov (United States)

    Vincent, A L; Vickery, A C; Winters, A; Sodeman, W A

    1982-08-01

    The development of Brugia pahangi (Nematoda: Filarioidea) was studied in nude (congenitally athymic) mice C3H/HeN (nu/nu) and in their phenotypically normal littermates (nu/+). Nude mice were highly susceptible to this parasite. As in the natural host (the cat), the nematodes' third molt in nude mice occurred at 7 to 10 days. The final molt occurred at about 24 days for male worms and 33 days for female worms. Adult worms were smaller than those from other hosts, such as the cat. After inoculation of various numbers of infective larvae, recoveries of adult worms averaged about 15% of the inoculum. In long-term infections initiated with 100 larvae, about 75% of the worms localized in the heart or lungs. Patent infections were seen as early as day 50 PI. Microfilaremia developed in most nude mice given 100, 50, or 25 infective larvae, but was less frequent in those given only 10. Mean filaremias generally rose during the first 6 mo, but in individuals usually did not exceed 500-600/20 mm3 of blood. As in the Mongolian jird, intraperitoneal inoculations yielded large quantities of worms and microfilariae. Few worms could be recovered from normal mice after day 40, even when large (1,000 larvae) inocula were used. Microfilaremia was not detected in normal mice. Although recoveries of adult worms from some nude females were not as high as those from nude males, neither nude nor normal mice showed consistent evidence of a differential susceptibility based on sex. Given the strong, consistent dichotomy of response to B. pahangi between nude and normal mice, this system may be useful in studies of protective immune responses in filariasis.

  1. Reserve interlanguage transfer : the effects of L3 Italian & L3 French on L2 English pronoun use

    OpenAIRE

    Aysan, Zeynep

    2012-01-01

    Ankara : The Department of Teaching English as a Foreign Language, Bilkent University, 2012. Thesis (Master's) -- Bilkent University, 2012. Includes bibliographical references leaves 58-67. This study focuses on the reverse interlanguage transfer by examining the effects of the L3 Italian and L3 French on the L2 English subject pronoun use as well as the effects of referentiality. The participants were 60 tertiary level students studying at Ankara University English Prepara...

  2. Dicty_cDB: VHC396 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 DW189601 |DW189601.1 EST05871 Larval Stage 1 Aedes aegypti cDNA clone AEMR-LS1-006-D08-U.AB1 5', mRNA...DV299090 |DV299090.1 NABNN04TF Aedes aegypti infected with Brugia Malayi Aedes aegypti cDNA clone NABNN04...DV299012 |DV299012.1 NABNN04TRB Aedes aegypti infected with Brugia Malayi Aedes aegypti cDNA clone NABNN04

  3. Analysis of Multi Muon Events in the L3 Detector

    CERN Document Server

    Schmitt, Volker

    2000-01-01

    The muon density distribution in air showers initiated by osmi parti les is sensitive to the hemi al omposition of osmi rays. The density an be measured via the multipli ity distribution in a nite size dete tor, as it is L3. With a shallow depth of 30 meters under ground, the dete tor provides an ex ellent fa ility to measure a high muon rate, but being shielded from the hadroni and ele troni shower omponent. Subje t of this thesis is the des ription of the L3 Cosmi s experiment (L3+C), whi h is taking data sin e May 1999 and the analysis of muon bundles in the large magneti spe trometer of L3. The new osmi trigger and readout system is brie y des ribed. The in uen e of dierent primaries on the multipli ity distribution has been investigated using Monte Carlo event samples, generated with the CORSIKA program. The simulation results showed that L3+C measures in the region of the \\knee" of the primary spe trum of osmi rays. A new pattern re ognition has been developed and added to the re onstru tion ode, whi h ...

  4. Stirling-cycle cooler reliability growth at L-3 CE

    Science.gov (United States)

    Arndt, David; Kuo, Dan; Phan, Quang

    2011-06-01

    L-3 CE has in place a continuous effort to evaluate and improve the lifetime of its cryocooler products. This effort includes analysis of both lab environment reliability tests and field data from shipped units. The purpose of this paper is to outline L-3 CE's life testing methodology and provide reliability data for L-3 CE cryocoolers, specifically for the 0.6- Watt Cooler (Model B602), 1.0-Watt Reduced Size, Weight, and Power (RSWAP) Cooler (Model B610), and the 1.5- Watt Cooler (Model B1500). Cooler performance characteristics such as cooldown time, refrigeration capacity, and input power are monitored throughout the life of the cooler. The data presented here updates previously reported data. Field data for the 1.0-Watt Cooler (Model B1000) is also presented.

  5. SELECTED ASPECTS OF ETCS-L3 DEPLOYMENT

    Directory of Open Access Journals (Sweden)

    Petr Koutecký

    2016-09-01

    Full Text Available This paper focuses on selected problem areas in the implementation of ETCS L3, analyz-es their impacts and offers a number of possible solutions as a basis for pilot testing. It compares the suitability of each solution and summarizes their advantages and disadvantages.

  6. Appraisal Systems in L2 vs. L3 Learning Experiences

    Science.gov (United States)

    Gabrys-Barker, Danuta

    2011-01-01

    This article offers a comment on the ways multilingual language users perceive their L2 and L3 learning experiences at the level of appraisals, that is, variables that "assign value to current stimuli based on past experience". In the theoretical part of the article the concept of appraisals is introduced and briefly outlined from the different…

  7. Bilingual Education and L3 Learning: Metalinguistic Advantage or Not?

    Science.gov (United States)

    Rutgers, Dieuwerke; Evans, Michael

    2017-01-01

    Metalinguistic skills are highlighted in the literature as providing bilinguals with an advantage in additional language (L3) learning. The extent to which this may apply to bilingual education and content-and-language-integrated-learning settings, however, is as yet little understood. This article reports on a study exploring and comparing the…

  8. Metaphonological Awareness in Multilinguals: A Case of L3 Polish

    Science.gov (United States)

    Wrembel, Magdalena

    2015-01-01

    The paper focuses on an unexplored area of metalinguistic awareness in the acquisition of third language (L3) phonology, hereafter referred to as metaphonological awareness. It addresses the role of attention and noticing in input processing. The contribution constitutes a part of a larger scale project on metaphonological awareness in various…

  9. L2-Accented Speech in L3 Production

    Science.gov (United States)

    Wrembel, Magdalena

    2010-01-01

    The paper is aimed at investigating the sources of cross-linguistic influence in the third language (L3) phonology, and, particularly, the impact of the second language (L2) on the phonological acquisition of another foreign language. The study consisted in foreign accent judgements performed by a group of expert judges who were presented with…

  10. Repurposing auranofin as a lead candidate for treatment of lymphatic filariasis and onchocerciasis.

    Directory of Open Access Journals (Sweden)

    Christina A Bulman

    2015-02-01

    Full Text Available Two major human diseases caused by filariid nematodes are onchocerciasis, or river blindness, and lymphatic filariasis, which can lead to elephantiasis. The drugs ivermectin, diethylcarbamazine (DEC, and albendazole are used in control programs for these diseases, but are mainly effective against the microfilarial stage and have minimal or no effect on adult worms. Adult Onchocerca volvulus and Brugia malayi worms (macrofilariae can live for up to 15 years, reproducing and allowing the infection to persist in a population. Therefore, to support control or elimination of these two diseases, effective macrofilaricidal drugs are necessary, in addition to current drugs. In an effort to identify macrofilaricidal drugs, we screened an FDA-approved library with adult worms of Brugia spp. and Onchocerca ochengi, third-stage larvae (L3s of Onchocerca volvulus, and the microfilariae of both O. ochengi and Loa loa. We found that auranofin, a gold-containing drug used for rheumatoid arthritis, was effective in vitro in killing both Brugia spp. and O. ochengi adult worms and in inhibiting the molting of L3s of O. volvulus with IC50 values in the low micromolar to nanomolar range. Auranofin had an approximately 43-fold higher IC50 against the microfilariae of L. loa compared with the IC50 for adult female O. ochengi, which may be beneficial if used in areas where Onchocerca and Brugia are co-endemic with L. loa, to prevent severe adverse reactions to the drug-induced death of L. loa microfilariae. Further testing indicated that auranofin is also effective in reducing Brugia adult worm burden in infected gerbils and that auranofin may be targeting the thioredoxin reductase in this nematode.

  11. Experimental determination of magnetic characteristics of Kunashak L3 Chondrite

    Science.gov (United States)

    Kim, Hanul; Yu, Yongjae; Ryeol Lee, Seung

    2017-04-01

    A systematic alternating-field (AF) demagnetization on mutually oriented fragments of Kunashak L3 Chondrite was carried out. AF demagnetization spectra for natural remanent magnetization (NRM), anhysteretic remanent magnetization (ARM), and saturation isothermal remanent magnetization (SIRM) were compared. We found that NRM, ARM, and SIRM are controlled by two dominant coercivity fractions, one being in the order of 100 mT, were identified. Higher coercivity fraction was stable whose remanence appears to be carried by Fe-Ni alloys. It is apparent that softer coercivity fraction was governed by the metal-sulfur meting produced by shock metamorphism. Directions of NRM were consistent in mm-scale, implying that brecciation process is responsible for the consistent NRM direction of Kunashak L3 Chondrite.

  12. DNASE1L3 mutations in hypocomplementemic urticarial vasculitis syndrome.

    Science.gov (United States)

    Ozçakar, Z Birsin; Foster, Joseph; Diaz-Horta, Oscar; Kasapcopur, Ozgur; Fan, Yao-Shan; Yalçınkaya, Fatoş; Tekin, Mustafa

    2013-08-01

    Hypocomplementemic urticarial vasculitis syndrome (HUVS) is characterized by recurrent urticaria along with dermal vasculitis, arthritis, and glomerulonephritis. Systemic lupus erythematosus (SLE) develops in >50% of patients with HUVS, although the pathogenesis is unknown. The aim of this study was to identify the causative DNA mutations in 2 families with autosomal-recessive HUVS, in order to reveal the pathogenesis and facilitate the laboratory diagnosis. Autozygosity mapping was combined with whole-exome sequencing. In a family with 3 affected children, we identified a homozygous frameshift mutation, c.289_290delAC, in DNASE1L3. We subsequently identified another homozygous DNASE1L3 mutation leading to exon skipping, c.320+4delAGTA, in an unrelated family. The detected mutations led to loss of function, via either nonsense-mediated messenger RNA decay or abolished endonuclease activity, as demonstrated by a plasmid nicking assay. These results show that HUVS is caused by mutations in DNASE1L3, encoding an endonuclease that previously has been associated with SLE. Copyright © 2013 by the American College of Rheumatology.

  13. Results from the L3 experiment at LEP

    Energy Technology Data Exchange (ETDEWEB)

    Adriani, O.; Aguilar-Benitez, M.; Ahlen, S.; Alcaraz, J.; Aloisio, A.; Alverson, G.; Alviggi, M.G.; Ambrosi, G.; An, Q.; Anderhub, H.; Anderson, A.L.; Andreev, V.P.; Antonov, L.; Antreasyan, D.; Arce, P.; Arefiev, A.; Atamanchuk, A.; Azemoon, T.; Aziz, T.; Baba, P.V.K.S.; Bagnaia, P.; Bakken, J.A.; Baksay, L.; Ball, R.C.; Banerjee, S.; Bao, J.; Barillere, R.; Barone, L.; Baschirotto, A.; Battiston, R.; Bay, A.; Becattini, F.; Becker, U.; Behner, F.; Behrens, J.; Bencze, G.L.; Berdugo, J.; Berges, P.; Bertucci, B.; Betev, B.L.; Biasini, M.; Biland, A.; Bilei, G.M.; Bizzarri, R.; Blaising, J.J.; Bobbink, G.J.; Bock, R.; Boehm, A.; Borgia, B.; Bosetti, M.; Bourilkov, D.; Bourquin, M.; Boutigny, D.; Bouwens, B.; Brambilla, E.; Branson, J.G.; Brock, I.C.; Brooks, M.; Bujak, A.; Burger, J.D.; Burger, W.J.; Busenitz, J.; Buytenhuijs, A.; Cai, X.D.; Capell, M.; Caria, M.; Carlino, G.; Cartacci, A.M.; Castello, R.; Cerrada, M.; Cesaroni, F.; Chang, Y.H.; Chaturvedi, U.K.; Chemarin, M.; Chen, A.; L3 Collaboration

    1993-12-01

    In this report we summarize the major results from the first three years of running of the L3 detector at the Large Electron Positron collider (LEP). The L3 detector was designed to measure electrons, photons and muons with high precision; it has achieved ([Delta]E/E)[approx]1.4% for electrons and photons at E=45 GeV and ([Delta]p/p)[approx]2.5% for muons at p=45 GeV. Most of the experimental results presented are based on approximately 500 000 Z events. The data provide four independent checks of the Standard Model weak neutral currents to an accuracy of [approx]1%. These are: The measurement of Z parameters; the measurement of the forward-backward charge asymmetry of lepton pairs; the measurement of asymmetry parameters from Z[yields]b anti b decays; and the measurement of the [tau] lepton polarization asymmetry. The data also provide information on weak charged currents from measurements of b hadrons such as decay width, lifetime, and B[sup 0]- anti B[sup 0] mixing, and from measurements of [tau] leptons such as their lifetime and branching ratios. The large number of Z events and the resolution of the L3 detector allow precision tests of QED and QCD, including the production of [pi][sup 0], [eta] and hard photons. Leptonic final states with hard isolated photons are analyzed and high mass photon pairs are observed. Higgs boson production has not been observed and limits are given in the context of the Standard Model and its supersymmetric extensions. We also present upper limits on rare Z decays such as Z[yields][gamma][gamma][gamma] and on flavor violating decays such as Z[yields]e[tau], [mu][tau]. Finally, upper limits obtained in the search for various new particles and new interactions are reported. (orig.)

  14. A luminosity measurement at LEP using the L3 detector

    Energy Technology Data Exchange (ETDEWEB)

    Koffeman, E.N.

    1996-06-25

    To perform high precision measurements at particle colliders it is crucial to know the exact intensity of the colliding beams. In particle physics this quantity is generally referred to as the luminosity. The determination of the luminosity in one of the experiments (L3) is the topic of this thesis. The implementation and the use of a silicon strip detector in L3, will be described in detail. In chapter one the most important parameters measured at LEP are discussed, preceded by a short introduction to the Standard Model. The process generally used for luminosity measurements in electron positron colliders is small angle Bhabha scattering. This process is discussed at the end of chapter one. In chapter two the characteristics of the collider and the L3 experiment are given. Together with the signature of the small angle Bhabha scattering, these experimental conditions determine the specifications for the design of the luminosity monitor. The general features of silicon strip detectors for their application in high energy physics are presented in chapter three. Some special attention is given to the behaviour of the sensors used for the tracking detector in the luminosity monitor. The more specific design details of the luminosity monitor are constricted to chapter four. In chapter five the conversion from detector signals into ccordinates relevant for the analysis is explained. The selection of the small angle Bhabha scattering events and the subsequent determination of the luminosity, are presented in chapter six. Systematic uncertainties are carefully studied. Important for a good understanding of the Bhabha selection are the events where a photon is produced in the scattering process. These events are separately studied. In chapter seven a comparison is presented between the radiative events observed in the data and their modelling in the Bhlumi Monte Carlo programme. (orig.).

  15. Hydrogen Learning for Local Leaders – H2L3

    Energy Technology Data Exchange (ETDEWEB)

    Serfass, Patrick [Technology Transition Corporation, Washington, DC (United States)

    2017-03-30

    The Hydrogen Learning for Local Leaders program, H2L3, elevates the knowledge about hydrogen by local government officials across the United States. The program reaches local leaders directly through “Hydrogen 101” workshops and webinar sessions; the creation and dissemination of a unique report on the hydrogen and fuel cell market in the US, covering 57 different sectors; and support of the Hydrogen Student Design Contest, a competition for interdisciplinary teams of university students to design hydrogen and fuel cell systems based on technology that’s currently commercially available.

  16. Synthesis and aqueous phase behavior of thermoresponsive biodegradable poly(D,L-3-methylglycolide)-block-poly(ethyelene glycol)-block-poly(D,L-3-methylglycolide) triblock copolymers

    NARCIS (Netherlands)

    Zhong, Zhiyuan; Dijkstra, Pieter J.; Feijen, Jan; Kwon, Young-Min; Bae, You Han; Kim, Sung Wan

    2002-01-01

    Novel biodegradable thermosensitive triblock copolymers of poly(D,L-3-methylglycolide)-block-poly(ethylene glycol)-block-poly(D,L-3-methylglycolide) (PMG-PEG-PMG) have been synthesized. Ring-opening polymerization of D,L-3-methyl-glycolide (MG) initiated with poly(ethylene glycol) (PEG) and

  17. 21 CFR 866.6030 - AFP-L3% immunological test system.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AFP-L3% immunological test system. 866.6030... Systems § 866.6030 AFP-L3% immunological test system. (a) Identification. An AFP-L3% immunological test... measure, by immunochemical techniques, AFP and AFP-L3 subfraction in human serum. The device is intended...

  18. The soviet manned lunar program N1-L3

    Science.gov (United States)

    Lardier, Christian

    2018-01-01

    The conquest of space was marked by the Moon race in which the two superpowers, the United States and the Soviet Union, were engaged in the 1960s. On the American side, the Apollo program culminated with the Man on the Moon in July 1969, 50 years ago. At the same time, the Soviet Union carried out a similar program which was kept secret for 20 years. This N1-L3 program was unveiled in August 1989. Its goal was to arrive on the Moon before the Americans. It included an original super-rocket, development of which began in June 1960. But this program became a national priority only in August 1964 and the super-rocket failed four times between 1969 and 1972. This article analyses the reasons for these failures, which led to the cancellation of the program in 1974.

  19. Multilingual students' acquisition of English as their L3

    DEFF Research Database (Denmark)

    Samal Jalal, Rawand

    with regard to English proficiency. The current study conducted in Denmark investigated multilingual students’ English proficiency compared to their monolingual peers’, and examined which learning strategies proficient L3 learners utilize. The sample was comprised of 9-graders who are monolinguals (N = 82...... participants’ behavior (i.e., which learning strategies they employ) was observed during English classes for approximately 10 weeks. Preliminary analyses show that the monolinguals outperformed the multilinguals on a general English proficiency test; which stands in contrast to existing theories......) and multilinguals with Turkish L1 (N = 134). The participants provided basic demographic information, and were tested in their general English proficiency. Out of the 70 multilinguals with Turkish L1, 12 participants were selected for further testing; i.e., the four participants who scored the lowest, four...

  20. Attempts to Image the Early Inflammatory Response during Infection with the Lymphatic Filarial Nematode Brugia pahangi in a Mouse Model

    Science.gov (United States)

    Ritchie, Ryan; Goundry, Amy; O’Neill, Kerry; Marchesi, Francesco; Devaney, Eileen

    2016-01-01

    Helminth parasites remain a major constraint upon human health and well-being in many parts of the world. Treatment of these infections relies upon a very small number of therapeutics, most of which were originally developed for use in animal health. A lack of high throughput screening systems, together with limitations of available animal models, has restricted the development of novel chemotherapeutics. This is particularly so for filarial nematodes, which are long-lived parasites with a complex cycle of development. In this paper, we describe attempts to visualise the immune response elicited by filarial parasites in infected mice using a non-invasive bioluminescence imaging reagent, luminol, our aim being to determine whether such a model could be developed to discriminate between live and dead worms for in vivo compound screening. We show that while imaging can detect the immune response elicited by early stages of infection with L3, it was unable to detect the presence of adult worms or, indeed, later stages of infection with L3, despite the presence of worms within the lymphatic system of infected animals. In the future, more specific reagents that detect secreted products of adult worms may be required for developing screens based upon live imaging of infected animals. PMID:27992545

  1. Attempts to Image the Early Inflammatory Response during Infection with the Lymphatic Filarial Nematode Brugia pahangi in a Mouse Model.

    Directory of Open Access Journals (Sweden)

    Elmarie Myburgh

    Full Text Available Helminth parasites remain a major constraint upon human health and well-being in many parts of the world. Treatment of these infections relies upon a very small number of therapeutics, most of which were originally developed for use in animal health. A lack of high throughput screening systems, together with limitations of available animal models, has restricted the development of novel chemotherapeutics. This is particularly so for filarial nematodes, which are long-lived parasites with a complex cycle of development. In this paper, we describe attempts to visualise the immune response elicited by filarial parasites in infected mice using a non-invasive bioluminescence imaging reagent, luminol, our aim being to determine whether such a model could be developed to discriminate between live and dead worms for in vivo compound screening. We show that while imaging can detect the immune response elicited by early stages of infection with L3, it was unable to detect the presence of adult worms or, indeed, later stages of infection with L3, despite the presence of worms within the lymphatic system of infected animals. In the future, more specific reagents that detect secreted products of adult worms may be required for developing screens based upon live imaging of infected animals.

  2. Learning of relative clauses by L3 learners of English

    Directory of Open Access Journals (Sweden)

    Mansour Koosha

    2015-02-01

    Full Text Available In surveys of third language acquisition (TLA research, mixed results demonstrate that there is no consensus among researchers regarding the advantages and/or disadvantages of bilinguality on TLA. The main concern of the present study was, thus, to probe the probable differences between Persian monolingual and Azeri-Persian bilingual learners of English regarding their syntactic knowledge. It was an attempt to investigate whether they differ significantly in learning relative clauses. To carry out this study, a total of 200 female high school students studying at second grade were randomly selected from two educational districts of Tabriz and Shiraz in Iran. The participants were homogeneous in terms of English proficiency, sex, and age. They attended public high schools they were taught the same materials and had the same number of hours of instruction. A general proficiency test, a language history questionnaire, and two syntactic structure tasks were administered to both groups. Statistical analyses including t-tests and descriptive statistics revealed that monolinguals and bilinguals differ in the comprehension and production of English L3 relative clauses.

  3. L1 and L2 Distance Effects in Learning L3 Dutch

    Science.gov (United States)

    Schepens, Job J.; der Slik, Frans; Hout, Roeland

    2016-01-01

    Many people speak more than two languages. How do languages acquired earlier affect the learnability of additional languages? We show that linguistic distances between speakers' first (L1) and second (L2) languages and their third (L3) language play a role. Larger distances from the L1 to the L3 and from the L2 to the L3 correlate with lower…

  4. The structure-activity relationships of L3MBTL3 inhibitors: flexibility of the dimer interface.

    Science.gov (United States)

    Camerino, Michelle A; Zhong, Nan; Dong, Aiping; Dickson, Bradley M; James, Lindsey I; Baughman, Brandi M; Norris, Jacqueline L; Kireev, Dmitri B; Janzen, William P; Arrowsmith, Cheryl H; Frye, Stephen V

    2013-11-01

    We recently reported the discovery of UNC1215, a potent and selective chemical probe for the L3MBTL3 methyllysine reader domain. In this article, we describe the development of structure-activity relationships (SAR) of a second series of potent L3MBTL3 antagonists which evolved from the structure of the chemical probe UNC1215. These compounds are selective for L3MBTL3 against a panel of methyllysine reader proteins, particularly the related MBT family proteins, L3MBTL1 and MBTD1. A co-crystal structure of L3MBTL3 and one of the most potent compounds suggests that the L3MBTL3 dimer rotates about the dimer interface to accommodate ligand binding.

  5. Dicty_cDB: CHR293 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |DV396246.1 NADDZ32TR Aedes aegypti infected with Dengue virus Pool library Aedes aegypti cDNA clone NADDZ32...DV362177 |DV362177.1 NACAI42TF Aedes aegypti infected with Brugia Malayi Aedes aegypti cDNA clone NACAI42...DV362149 |DV362149.1 NACAI42TR Aedes aegypti infected with Brugia Malayi Aedes aegypti cDNA clone NACAI42...DV306367 |DV306367.1 NABMX90TF Aedes aegypti infected with Brugia Malayi Aedes aegypti cDNA clone NABMX90...|DV329097.1 NABTE46TF Aedes aegypti infected with Plasmodium gallinaceum Aedes aegypti cDNA clone NABTE46

  6. Differences between L3 and L2 x-ray absorption spectra

    NARCIS (Netherlands)

    Groot, F.M.F. de

    1995-01-01

    The L3 and L2 edges of transition metals show differences in their spectral shape. Also the ratio between the L3 and L2 edges is found to deviate from 2:1. The interactions responsible for these effects are: the multiplet effects and the 3d (4d) spin-orbit coupling. The electronic interactions and

  7. L2 and L3 Ultimate Attainment: An Investigation of Two Parameters

    Science.gov (United States)

    Hermas, Abdelkader

    2014-01-01

    This study considers the upper limit of ultimate attainment in the L2 French and L3 English of trilingual learners. The learners are native speakers of Moroccan Arabic who started learning L2 French at eight and L3 English at 16. They are advanced in both languages. Four constructions representing the verb movement and null subject parameter were…

  8. Dicty_cDB: CHQ580 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |DV406802.1 NADV458TR Aedes aegypti infected with Dengue virus Pool library Aedes aegypti cDNA clone NADV458...|DV406800.1 NADV458TF Aedes aegypti infected with Dengue virus Pool library Aedes aegypti cDNA clone NADV458...DV305807 |DV305807.1 NABMV02TRB Aedes aegypti infected with Brugia Malayi Aedes aegypti cDNA clone NABMV02...DV305761 |DV305761.1 NABMV01TF Aedes aegypti infected with Brugia Malayi Aedes aegypti cDNA clone NABMV01

  9. Role of uL3 in Multidrug Resistance in p53-Mutated Lung Cancer Cells

    Directory of Open Access Journals (Sweden)

    Annapina Russo

    2017-03-01

    Full Text Available Cancer is one of the most common causes of death among adults. Chemotherapy is crucial in determining patient survival and quality of life. However, the development of multidrug resistance (MDR continues to pose a significant challenge in the management of cancer. In this study, we analyzed the role of human ribosomal protein uL3 (formerly rpL3 in multidrug resistance. Our studies revealed that uL3 is a key determinant of multidrug resistance in p53-mutated lung cancer cells by controlling the cell redox status. We established and characterized a multidrug resistant Calu-6 cell line. We found that uL3 down-regulation correlates positively with multidrug resistance. Restoration of the uL3 protein level re-sensitized the resistant cells to the drug by regulating the reactive oxygen species (ROS levels, glutathione content, glutamate release, and cystine uptake. Chromatin immunoprecipitation experiments and luciferase assays demonstrated that uL3 coordinated the expression of stress-response genes acting as transcriptional repressors of solute carrier family 7 member 11 (xCT and glutathione S-transferase α1 (GST-α1, independently of Nuclear factor erythroid 2-related factor 2 (Nrf2. Altogether our results describe a new function of uL3 as a regulator of oxidative stress response genes and advance our understanding of the molecular mechanisms underlying multidrug resistance in cancers.

  10. NFE2L3 (NRF3): the Cinderella of the Cap'n'Collar transcription factors.

    Science.gov (United States)

    Chevillard, Grégory; Blank, Volker

    2011-10-01

    NFE2L3 [Nuclear factor (erythroid-derived 2)-like 3] or NRF3, a member of the Cap'n'Collar (CNC) family, is a basic-region leucine zipper (bZIP) transcription factor that was first identified over 10 years ago. Contrary to its extensively studied homolog NFE2L2 (NRF2), the regulation and function of the NFE2L3 protein have not yet attracted as much attention. Nevertheless, several recent reports have now shed light on the possible roles of NFE2L3. Structural and biochemical studies revealed a series of domains and modifications that are critical for its cellular regulation. The control of the subcellular localization of NFE2L3 appears to be essential for understanding its role in various cellular processes. Importantly, newer studies provide fascinating insights linking NFE2L3 to differentiation, inflammation, and carcinogenesis. Here, we present an overview of the current level of knowledge of NFE2L3 transcription factor biology in humans and mice. From being the Cinderella of the CNC transcription factors for many years, NFE2L3 may now rapidly come into its own.

  11. EX1504L3 Dive02 Ancillary Data Collection including reports, kmls, spreadsheets, images and data

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Standard suite of ancillary data files generated through a scripting process following an ROV dive on NOAA Ship Okeanos Explorer during EX1504L3: CAPSTONE Leg III:...

  12. EX1504L3 Dive06 Ancillary Data Collection including reports, kmls, spreadsheets, images and data

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Standard suite of ancillary data files generated through a scripting process following an ROV dive on NOAA Ship Okeanos Explorer during EX1504L3: CAPSTONE Leg III:...

  13. EX1004L3 Water Column Summary Report and Profile Data Collection

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A complete set of water column profile data and CTD Summary Report (if generated) generated by the Okeanos Explorer during EX1004L3: Exploration Indonesia - Bitung...

  14. TES/Aura L3 CO2 Lite Monthly Gridded V003

    Data.gov (United States)

    National Aeronautics and Space Administration — The TES Aura L3 CO2 data consist of daily atmospheric temperature and VMR for the atmospheric species. Data are provided at 2 degree latitude X 4 degree longitude...

  15. EX1502L3 Water Column Summary Report and Profile Data Collection

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A complete set of water column profile data and CTD Summary Report (if generated) generated by the Okeanos Explorer during EX1502L3: Caribbean Exploration (ROV)...

  16. EX1404L3 Water Column Summary Report and Profile Data Collection

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A complete set of water column profile data and CTD Summary Report (if generated) generated by the Okeanos Explorer during EX1404L3: Northeast Seamounts and Canyons...

  17. The novel carbohydrate epitope L3 is shared by some neural cell adhesion molecules.

    Science.gov (United States)

    Kücherer, A; Faissner, A; Schachner, M

    1987-06-01

    The monoclonal L3 antibody reacts with an N-glycosidically linked carbohydrate structure on at least nine glycoproteins of adult mouse brain. Three out of the L3 epitope-carrying glycoproteins could be identified as the neural cell adhesion molecules L1 and myelin-associated glycoprotein, and the novel adhesion molecule on glia. Expression of the L3 carbohydrate epitope is regulated independently of the protein backbone of these three glycoproteins. Based on the observation that out of three functionally characterized L3 epitope-carrying glycoproteins three fulfill the operational definition of an adhesion molecule, we would like to suggest that they form a new family of adhesion molecules that is distinct from the L2/HNK-1 carbohydrate epitope family of neural cell adhesion molecules. Interestingly, some members in each family appear to be unique to one family while other members belong to the two families.

  18. EX1504L3 Dive05 Ancillary Data Collection including reports, kmls, spreadsheets, images and data

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Standard suite of ancillary data files generated through a scripting process following an ROV dive on NOAA Ship Okeanos Explorer during EX1504L3: CAPSTONE Leg III:...

  19. EX1504L3 Water Column Summary Report and Profile Data Collection

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A complete set of water column profile data and CTD Summary Report (if generated) generated by the Okeanos Explorer during EX1504L3: CAPSTONE Leg III: Main Hawaiian...

  20. EX1605L3 Dive19 Ancillary Data Collection including reports, kmls, spreadsheets, and data

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Standard suite of ancillary data files generated through a scripting process following an ROV dive on NOAA Ship Okeanos Explorer during EX1605L3: CAPSTONE CNMI &...

  1. EX1504L3 Dive03 Ancillary Data Collection including reports, kmls, spreadsheets, images and data

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Standard suite of ancillary data files generated through a scripting process following an ROV dive on NOAA Ship Okeanos Explorer during EX1504L3: CAPSTONE Leg III:...

  2. EX1504L3 Dive07 Ancillary Data Collection including reports, kmls, spreadsheets, images and data

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Standard suite of ancillary data files generated through a scripting process following an ROV dive on NOAA Ship Okeanos Explorer during EX1504L3: CAPSTONE Leg III:...

  3. TES/Aura L3 H2O Monthly Gridded V004

    Data.gov (United States)

    National Aeronautics and Space Administration — The TES Aura L3 H2O data consist of daily atmospheric temperature and VMR for the atmospheric species. Data are provided at 2 degree latitude X 4 degree longitude...

  4. EX1202L3 Water Column Summary Report and Profile Data Collection

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A complete set of water column profile data and CTD Summary Report (if generated) generated by the Okeanos Explorer during EX1202L3: Gulf of Mexico Exploration...

  5. EX0909L3 Water Column Summary Report and Profile Data Collection

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A complete set of water column profile data and CTD Summary Report (if generated) generated by the Okeanos Explorer during EX0909L3: Mapping Field Trials - Hawaiian...

  6. TES/Aura L3 CH4 Daily Gridded V004

    Data.gov (United States)

    National Aeronautics and Space Administration — The TES Aura L3 CH4 data consist of daily averages of atmospheric Methane for atmospheric species. Data are provided at 2 degree latitude X 4 degree longitude...

  7. TES/Aura L3 CH4 Monthly Gridded V004

    Data.gov (United States)

    National Aeronautics and Space Administration — The TES Aura L3 CH4 data consist of monthly averages of atmospheric Methane for atmospheric species. Data are provided at 2 degree latitude X 4 degree longitude...

  8. TES/Aura L3 CO2 Daily Gridded V004

    Data.gov (United States)

    National Aeronautics and Space Administration — The TES Aura L3 CO2 data consist of daily atmospheric temperature and VMR for the atmospheric species. Data are provided at 2 degree latitude X 4 degree longitude...

  9. TES/Aura L3 HNO3 Monthly Gridded V004

    Data.gov (United States)

    National Aeronautics and Space Administration — The TES Aura L3 ATD data consist of monthly atmospheric temperature and VMR for the atmospheric species. Data are provided at 2 degree latitude X 4 degree longitude...

  10. EX1605L3 Dive17 Ancillary Data Collection including reports, kmls, spreadsheets, and data

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Standard suite of ancillary data files generated through a scripting process following an ROV dive on NOAA Ship Okeanos Explorer during EX1605L3: CAPSTONE CNMI &...

  11. EX1605L3 Dive22 Ancillary Data Collection including reports, kmls, spreadsheets, and data

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Standard suite of ancillary data files generated through a scripting process following an ROV dive on NOAA Ship Okeanos Explorer during EX1605L3: CAPSTONE CNMI &...

  12. EX1504L3 Dive04 Ancillary Data Collection including reports, kmls, spreadsheets, images and data

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Standard suite of ancillary data files generated through a scripting process following an ROV dive on NOAA Ship Okeanos Explorer during EX1504L3: CAPSTONE Leg III:...

  13. The L3+C detector, a unique tool-set to study cosmic rays

    CERN Document Server

    Adriani, O; Banerjee, S; Bähr, J; Betev, B L; Bourilkov, D; Bottai, S; Bobbink, Gerjan J; Cartacci, A M; Chemarin, M; Chen, G; Chen He Sheng; Chiarusi, T; Dai Chang Jiang; Ding, L K

    2002-01-01

    The L3 detector at the CERN electron-positron collider, LEP, has been employed for the study of cosmic ray muons. The muon spectrometer of L3 consists of a set of high-precision drift chambers installed inside a magnet with a volume of about 1000 m**3 and a field of 0.5 T. Muon momenta are measured with a resolution of a few percent at 50 GeV. The detector is located under 30 m of overburden. A scintillator air shower array of 54 m by 30 m is installed on the roof of the surface hall above L3 in order to estimate the energy and the core position of the shower associated with a sample of detected muons. Thanks to the unique properties of the L3+C detector, muon research topics relevant to various current problems in cosmic ray and particle astrophysics can be studied.

  14. EX1605L3 Dive11 Ancillary Data Collection including reports, kmls, spreadsheets, and data

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Standard suite of ancillary data files generated through a scripting process following an ROV dive on NOAA Ship Okeanos Explorer during EX1605L3: CAPSTONE CNMI &...

  15. EX1605L3 Dive09 Ancillary Data Collection including reports, kmls, spreadsheets, and data

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Standard suite of ancillary data files generated through a scripting process following an ROV dive on NOAA Ship Okeanos Explorer during EX1605L3: CAPSTONE CNMI &...

  16. EX1605L3 Dive02 Ancillary Data Collection including reports, kmls, spreadsheets, and data

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Standard suite of ancillary data files generated through a scripting process following an ROV dive on NOAA Ship Okeanos Explorer during EX1605L3: CAPSTONE CNMI &...

  17. EX1605L3 Dive01 Ancillary Data Collection including reports, kmls, spreadsheets, and data

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Standard suite of ancillary data files generated through a scripting process following an ROV dive on NOAA Ship Okeanos Explorer during EX1605L3: CAPSTONE CNMI &...

  18. EX1605L3 Dive16 Ancillary Data Collection including reports, kmls, spreadsheets, and data

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Standard suite of ancillary data files generated through a scripting process following an ROV dive on NOAA Ship Okeanos Explorer during EX1605L3: CAPSTONE CNMI &...

  19. EX1605L3 Dive10 Ancillary Data Collection including reports, kmls, spreadsheets, and data

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Standard suite of ancillary data files generated through a scripting process following an ROV dive on NOAA Ship Okeanos Explorer during EX1605L3: CAPSTONE CNMI &...

  20. EX1605L3 Dive20 Ancillary Data Collection including reports, kmls, spreadsheets, and data

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Standard suite of ancillary data files generated through a scripting process following an ROV dive on NOAA Ship Okeanos Explorer during EX1605L3: CAPSTONE CNMI &...

  1. EX1605L3 Dive21 Ancillary Data Collection including reports, kmls, spreadsheets, and data

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Standard suite of ancillary data files generated through a scripting process following an ROV dive on NOAA Ship Okeanos Explorer during EX1605L3: CAPSTONE CNMI &...

  2. Preparation and some properties of L-3-glycerophosphate dehydrogenase from pig brain mitochondria.

    Science.gov (United States)

    Dawson, A P; Thorne, C J

    1969-01-01

    1. A method is described for extraction and partial purification of mitochondrial l-3-glycerophosphate dehydrogenase from pig brain. 2. By the criteria that have so far been applied, the extraction and purification procedures do not modify the activity of the enzyme towards artificial electron acceptors. 3. The amounts of acid-liberatable flavine and iron in the preparation were measured. 4. A study was made of the effects of various analogues of l-3-glycerophosphate on the activity of the enzyme.

  3. Search on charginos and neutralinos with the L3 detector at LEP; Recherche de charginos et de neutralinos avec le detecteur L3 au LEP

    Energy Technology Data Exchange (ETDEWEB)

    Chereau, Xavier [Laboratoire d`Annecy-le-vieux de physique des particules, Grenoble-1 Univ., 74 Annecy (France)

    1998-04-30

    This work presents an experimental search for supersymmetric particles, the charginos and the neutralinos, at center of mass energies {radical} 161, 172 and 183 GeV, with the L3 detector at the e{sup +}e{sup -} collider LEP. Assuming R-parity conservation, SUSY events have a large missing energy, carried by the lightest supersymmetric particle (LSP), which allow us to distinguish them from standard events. Then, for all the studied final states and all the energies, we optimized the selections in order to have the best signal-to-noise ratio. No excess of events were observed with respect to the standard model predictions. We set upper limits on the chargino and neutralino production cross sections. In the frame of the constraint MSSM, these results were combined with the results from the L3 slepton analyses to set lower limits on the chargino and neutralino masses: particularly, we exclude a neutralino {chi}{sub 1}{sup 0} bar lighter than 25.9 GeV/c{sup 2} (95% C.L.). This result plays an important role for the interpretation of the dark matter in universe. The search for events with missing energy needs a detector with a good hermeticity. At the end of 1995, a new electromagnetic calorimeter was installed in the L3 experiment. Here we present the improvements of performances and the calibration of this detector composed of 48 bricks made with lead and scintillating fibers (SPACAL) 71 refs., 104 figs., 21 tabs.

  4. ESA’s L3 mission: A space-based gravitational-wave observatory

    Science.gov (United States)

    Mueller, Guido

    2016-04-01

    ESA selected the Gravitational Universe as the science theme for one of its future L-class missions. L3 will measure gravitational waves in the 10µHz to 100mHz window; probably the richest of all gravitational wave windows. Expected sources in this frequency band range from massive black hole mergers to extreme mass ratio inspirals to compact galactic binary systems.The L3 mission is expected to be based on the eLISA/LISA design which was submitted by the eLISA consortium as a notional mission concept. NASA started discussions with ESA how to join L3 and participates in ESA’s Gravitational Observatory Advisory Team. NASA is also in the process of setting up its own L3-Study team to look at potential US contributions to L3. This group will also act as the US partner for the eLISA consortium. In summary, the space component of the GW community has gained significant momentum over the last 12 months and a successful pathfinder mission and potential GW discoveries by Advanced LIGO and/or pulsar timing arrays should further strengthen the case for LISA.

  5. Measurement of the masses of the electroweak gauge bosons at L3; Bestimmung der Massen der elektroschwachen Eichbosonen bei L3

    Energy Technology Data Exchange (ETDEWEB)

    Rosenbleck, C.

    2006-10-09

    This thesis presents the measurement of the masses of the carriers of the weak force in the Standard Model of Particle Physics, the gauge bosons W and Z. The masses are determined using the kinematics of the bosons' decay products. The data were collected by the L3 experiment at the Large Electron Positron Collider (LEP) at centre-of-mass energies, {radical}(s), between 183 GeV and 209 GeV in the years 1997 to 2000. The Z-boson mass is determined to be m{sub Z}=91.272{+-}0.046 GeV. The second part of this analysis describes the measurement of the mass of the W-boson. The W-boson mass is determined to be m{sub W}=80.242{+-}0.057 GeV in this analysis. If combined with the L3 results at lower centre-of-mass energies, the final W boson mass value is m{sub W}=80.270{+-}0.055 GeV. The {rho} parameter is defined as {rho}=m{sup 2}{sub W}/(m{sup 2}{sub Z} . cos{sup 2} {theta}{sub W}). Using the value of m{sub Z} obtained in the Z resonance scan, the final value for m{sub W} and the value of {theta}{sub W}, {rho} is obtained to be {rho}=0.9937{+-}0.0024, yielding a 2.6{sigma} deviation from 1. Combining the L3 value for m{sub W} with the results of the LEP experiments ALEPH, DELPHI, and OPAL and the TEVATRON experiments CDF and DOe yields a W boson mass of m{sub W}=80.392{+-}0.029 GeV. Together with other measurements this determines the best value of the Higgs-boson mass to be m{sub H}=85{sub -28}{sup +39} GeV. (orig.)

  6. Mutations in the bacterial ribosomal protein l3 and their association with antibiotic resistance

    DEFF Research Database (Denmark)

    Klitgaard, Rasmus N; Ntokou, Eleni; Nørgaard, Katrine

    2015-01-01

    Different groups of antibiotics bind to the peptidyl transferase center (PTC) in the large subunit of the bacterial ribosome. Resistance to these groups of antibiotics has often been linked with mutations or methylations of the 23S rRNA. In recent years, there has been a rise in the number...... of studies where mutations have been found in the ribosomal protein L3 in bacterial strains resistant to PTC-targeting antibiotics but there is often no evidence that these mutations actually confer antibiotic resistance. In this study, a plasmid exchange system was used to replace plasmid-carried wild...... background. Ten plasmid-carried mutated L3 genes were constructed, and their effect on growth and antibiotic susceptibility was investigated. Additionally, computational modeling of the impact of L3 mutations in E. coli was used to assess changes in 50S structure and antibiotic binding. All mutations...

  7. Genetically designed L3 photonic crystal nanocavities with measured quality factor exceeding one million

    Energy Technology Data Exchange (ETDEWEB)

    Lai, Y.; Badolato, A., E-mail: antonio.badolato@gmail.com [Department of Physics and Astronomy, University of Rochester, Rochester, New York 14627 (United States); Pirotta, S.; Urbinati, G.; Gerace, D.; Galli, M. [Dipartimento di Fisica, Università di Pavia, via Bassi 6, 27100 Pavia (Italy); Minkov, M.; Savona, V. [Laboratory of Theoretical Physics of Nanosystems, Ecole Polytechnique Federale de Lausanne EPFL, CH-1015 Lausanne (Switzerland)

    2014-06-16

    We report on the experimental realization of ultra-high quality factor (Q) designs of the L3-type photonic crystal nanocavity. Based on genetic optimization of the positions of few nearby holes, our design drastically improves the performance of the conventional L3 as experimentally confirmed by direct measurement of Q ≃ 2 × 10{sup 6} in a silicon-based photonic crystal membrane. Our devices rank among the highest Q/V ratios ever reported in photonic crystal cavities, holding great promise for the realization of integrated photonic platforms based on ultra-high-Q resonators.

  8. L1/L2/L3 Writing Development: Longitudinal Case Study of a Japanese Multicompetent Writer

    Science.gov (United States)

    Kobayashi, Hiroe; Rinnert, Carol

    2013-01-01

    This longitudinal case study, supplemented by cross-sectional comparisons among five groups of writers with differing backgrounds, investigates how Natsu, a Japanese multilingual writer, developed her L1, L2 (English), and L3 (Chinese) writing competence over two and a half years. To create a comprehensive picture of this multilingual writer, the…

  9. Fast detection of alpha-fetoprotein-L3 using lens culinaris agglutinin immobilized gold nanoparticles.

    Science.gov (United States)

    Sun, Ying; Qin, Liubin; Liu, Dejun; Liu, Changhong; Sun, Yongwei; Duan, Yourong

    2014-06-01

    Colloidal gold is extensively used for molecular sensing because that the surface plasmon resonance (SPR) bands are affected by changes in the dielectric properties in the close vicinity of these structures due to the binding of ligands to the corresponding receptor molecules immobilized onto the nanostructures through chemi- or physisorption. We describe a simple method for the detection of Alpha-Fetoprotein-L3 which is a new generation of tumor marker for hepatocellular carcinoma (HCC) based on the aggregation of Lens culinaris agglutinin (LCA) Immobilized Gold Nanoparticles. The LCA conjugated GNPs obtained were 15-20 nm in diameter. The visible color change of the gold nanoparticles from purple to blue on interaction with 100 ng/mL of AFP-L3 is the principle applied here for the sensing of AFP-L3 level. UV/Vis spectroscopy also allows assay monitoring by quantifying the red shift of the plasmon resonance wavelength. With this method, the protein AFP-L3 can be rapidly detected as demanded for clinical diagnosis.

  10. Study of photon-induced L3 vacancy alignment for elements La to U

    Indian Academy of Sciences (India)

    Alignment of photon-induced L3 vacancies is studied in rare earth and high elements at energies of experimental interest, near thresholds to 60 keV, under non-relativistic dipole approximation. Numerical calculations of the matrix element are undertaken to produce theoretical data for comparison with the experimental ...

  11. Study of photon-induced L3 vacancy alignment for elements La to U

    Indian Academy of Sciences (India)

    Abstract. Alignment of photon-induced L3 vacancies is studied in rare earth and high. Z elements at energies of experimental interest, near thresholds to 60 keV, under non- relativistic dipole approximation. Numerical calculations of the matrix element are un- dertaken to produce theoretical data for comparison with the ...

  12. Double Object Constructions in L3 English: An Exploratory Study of Morphological and Semantic Constraints

    Science.gov (United States)

    Agirre, Ainara Imaz; García Mayo, María del Pilar

    2014-01-01

    The present study examines the acquisition of double object constructions (DOCs) ("Susan gave Peter an apple") by 90 Basque/Spanish learners of English as a third language (L3). The aim of this study was to explore whether (i) learners established a distinction when accepting DOCs vs. prepositional phrase constructions (PPCs)…

  13. Joint International Workshop on Professional Learning, Competence Development and Knowledge Management - LOKMOL and L3NCD

    NARCIS (Netherlands)

    Memmel, Martin; Ras, Eric; Weibelzahl, Stephan; Burgos, Daniel; Olmedilla, Daniel; Wolpers, Martin

    2006-01-01

    Memmel, M., Ras, E., Weibelzahl, S., Burgos, D., Olmedilla, D., & Wolpers, M. (2006). Joint International Workshop on Professional Learning, Competence Development and Knowledge Management - LOKMOL and L3NCD. Proceedings of ECTEL 2006. October 2nd-4th, Crete, Greece. Retrieved October 2nd, 2006,

  14. An automated synthesis module for preparation of L-3-[I-123]iodo-alpha-methyl tyrosine

    NARCIS (Netherlands)

    Luurtsema, G; Jager, PL; Piers, A; de Hooge, MN

    2001-01-01

    L-3-[I-123]iodo-alpha-methyl tyrosine (IMT) is an artificial amino acid suitable for SPECT imaging of various tumours. Manual synthesis of this radiopharmaceutical is reliable, but time-consuming and may require handling of large quantities of radioactivity. We developed an automated IMT synthesis

  15. Inter- and Intralingual Lexical Influences in Advanced Learners' French L3 Oral Production

    Science.gov (United States)

    Lindqvist, Christina

    2010-01-01

    The present study investigates lexical inter- and intralingual influences in the oral production of 14 very advanced learners of French L3. Lexical deviances are divided into two main categories: formal influence and meaning-based influence. The results show that, as predicted with respect to advanced learners, meaning-based influence is the most…

  16. Enhanced 1524-nm Emission From Ge Quantum Dots in a Modified Photonic Crystal L3 Cavity

    National Research Council Canada - National Science Library

    Yong Zhang; Cheng Zeng; Danping Li; Zengzhi Huang; Kezheng Li; Jinzhong Yu; Juntao Li; Xuejun Xu; Maruizumi, Takuya; Jinsong Xia

    2013-01-01

    .... The enhancement factor is 110, and the corresponding Purcell factor is estimated to be 6.7. The large enhancement is due to high Purcell factor and high collection efficiency of modified L3 cavity verified by far-field patterns...

  17. Ubiquitin C-terminal hydrolase-L3 regulates EMT process and cancer metastasis in prostate cell lines.

    Science.gov (United States)

    Song, Hyun Min; Lee, Jae Eun; Kim, Jung Hwa

    2014-09-26

    Ubiquitin C-terminal hydrolase-L3 (UCH-L3) is among the deubiquitinating enzymes (DUBs) that cleave ubiquitin (Ub) from Ub precursors or protein substrates. Many DUBs have been shown to participate in cancer progression in various tissues. However, the mechanism and role of UCH-L3 in carcinogenesis has largely been unknown until recently. Here we investigated the implication of UCH-L3 in prostate cancer progression. Interestingly, UCH-L3 is upregulated in normal or non-metastatic prostate cancer cells and is downregulated in metastatic prostate cancer cell lines. Notably, knockdown of UCH-L3 in normal prostate cell line RWPE1 promotes epithelial-to-mesenchymal transition (EMT), an important process for cancer cell invasion and metastasis. The induction of EMT by UCH-L3 knockdown results in an increase of cell migration and invasion. Yet, to the contrary, overexpression of UCH-L3 in highly metastatic prostate cancer cell line PC3 reverses EMT but the active site mutant UCH-L3 did not. Collectively, our findings identify UCH-L3 as a novel EMT regulator in prostate cells and highlight UCH-L3 as a potential therapeutic target for preventing metastatic prostate cancer. Copyright © 2014 Elsevier Inc. All rights reserved.

  18. AcEST: DK949163 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 36 2.3 tr|A8P3K7|A8P3K7_BRUMA Retinitis pigmentosa GTPase regulator-lik... 35 3.... 92 FGGGGN 97 >tr|A8P3K7|A8P3K7_BRUMA Retinitis pigmentosa GTPase regulator-like protein OS=Brugia malayi GN

  19. Mammographic parasitic calcifications in South West Nigeria ...

    African Journals Online (AJOL)

    Abstract. Introduction: Lymphatic filariasis caused by nematode parasite Wuchereria bancrofti and Brugia Malayi is endemic in the tropics. In Nigeria, 25% of the population is infected. Lymph edema and elephantiasis are the predominant manifestations. Its infrequent manifestation is in the breast. This paper discusses the ...

  20. Dicty_cDB: Contig-U13233-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ( AC229965 ) Choloepus hoffmanni clone CH281-86B11, WORKING DR... 48 1.2 1 ( AC22...nis familiaris STS g... 48 1.2 1 ( AJ508355 ) Brugia malayi ORF1, ORF2, ORF3 and ORF4 DNA and a... 48 1.2 1

  1. Large extracellular loop of tetraspanin as a potential vaccine candidate for filariasis.

    Directory of Open Access Journals (Sweden)

    Gajalakshmi Dakshinamoorthy

    Full Text Available Lymphatic filariasis affects nearly 120 million people worldwide and mass preventive chemotherapy is currently used as a strategy to control this infection. This has substantially reduced the incidence of the infection in several parts of the world. However, a prophylactic vaccine would be more effective in preventing future infections and will supplement the mass chemotherapy efforts. Unfortunately, there is no licensed vaccine available currently to prevent this infection. Molecules expressed on the surface of the parasite are potential candidates for vaccine development as they are exposed to the host immune system. In this study we show that the large extracellular loop of tetraspanin (TSP LEL, a protein expressed on the cuticle of Brugia malayi and Wuchereria bancrofti is a potential vaccine candidate. Our results showed that BmTSP LEL is expressed on the surface of B. malayi infective third stage larvae (L3 and sera from human subjects who are putatively immune to lymphatic filariasis carry high titer of IgG1 and IgG3 antibodies against BmTSP LEL and WbTSP LEL. We also showed that these antibodies in the sera of human subjects can participate in the killing of B. malayi L3 in an antibody dependent cell-mediated cytotoxicity mechanism. Vaccination trials in mice showed that close to 64% protection were achieved against challenge infections with B. malayi L3. Immunized animals showed high titer of anti-WbTSP LEL IgG1, IgG2a and IgG2b antibodies in the sera and IFN-γ secreting cells in the spleen. Onchocerca volvulus another filarial parasite also expresses TSP LEL. Cross-reactivity studies showed that IgG1 antibody in the sera of endemic normal subjects, recognize OvTSP LEL. Similarly, anti-OvTSP LEL antibodies in the sera of subjects who are immune to O. volvulus were also shown to cross-react with rWbTSP LEL and rBmTSP LEL. These findings thus suggested that rTSP LEL can be developed as a potential vaccine candidate against multiple

  2. Revising the worksheet with L3: a language and environment foruser-script interaction

    Energy Technology Data Exchange (ETDEWEB)

    Hohn, Michael H.

    2008-01-22

    This paper describes a novel approach to the parameter anddata handling issues commonly found in experimental scientific computingand scripting in general. The approach is based on the familiarcombination of scripting language and user interface, but using alanguage expressly designed for user interaction and convenience. The L3language combines programming facilities of procedural and functionallanguages with the persistence and need-based evaluation of data flowlanguages. It is implemented in Python, has access to all Pythonlibraries, and retains almost complete source code compatibility to allowsimple movement of code between the languages. The worksheet interfaceuses metadata produced by L3 to provide selection of values through thescriptit self and allow users to dynamically evolve scripts withoutre-running the prior versions. Scripts can be edited via text editors ormanipulated as structures on a drawing canvas. Computed values are validscripts and can be used further in other scripts via simplecopy-and-paste operations. The implementation is freely available underan open-source license.

  3. The (SPP) Green function and SU(3) breaking in K{sub l3} decays

    Energy Technology Data Exchange (ETDEWEB)

    Cirigliano, Vincenzo [California Institute of Technology, Pasadena, CA 91125 (United States); Ecker, Gerhard [Institut fuer Theoretische Physik, University of Vienna, A-1090 Vienna (Austria); Eidemueller, Markus [Departament de Fisica Teorica, IFIC, CSIC - Universitat de Valencia, Edifici d' Instituts de Paterna, Apt. Correus 22085, E-46071 Valencia (Spain); Kaiser, Roland [Institut fuer Theoretische Physik, University of Vienna, A-1090 Vienna (Austria); Pich, Antonio [Departament de Fisica Teorica, IFIC, CSIC - Universitat de Valencia, Edifici d' Instituts de Paterna, Apt. Correus 22085, E-46071 Valencia (Spain); Portoles, Jorge [Departament de Fisica Teorica, IFIC, CSIC - Universitat de Valencia, Edifici d' Instituts de Paterna, Apt. Correus 22085, E-46071 Valencia (Spain)

    2005-04-01

    Using the 1/N{sub C} expansion scheme and truncating the hadronic spectrum to the lowest-lying resonances, we match a meromorphic approximation to the (SPP) Green function onto QCD by imposing the correct large-momentum falloff, both off-shell and on the relevant hadron mass shells. In this way we determine a number of chiral low-energy constants of O(p{sup 6}), in particular the ones governing SU(3) breaking in the K{sub l3} vector form factor at zero momentum transfer. The main result of our matching procedure is that the known loop contributions largely dominate the corrections of O(p{sup 6}) to f{sub +}(0). We discuss the implications of our final value f{sub +}{sup K{sup 0}}{sup {pi}{sup -}}(0) 0.984{+-}0.012 for the extraction of V{sub us} from K{sub l3} decays.

  4. The effect of symmetry on the U L3 NEXAFS of octahedral coordinated uranium(vi)

    Energy Technology Data Exchange (ETDEWEB)

    Bagus, Paul S. [Department of Chemistry, University of North Texas, Denton, Texas 76203-5017, USA; Nelin, Connie J. [Consultant, Austin, Texas 78730, USA; Ilton, Eugene S. [Pacific Northwest National Laboratory, Richland, Washington 99352, USA

    2017-03-21

    We describe a detailed theoretical analysis of how distortions from ideal cubic or Oh symmetry affect the shape, in particular the width, of the U L3-edge NEXAFS for U(VI) in octahedral coordination. The full-width-half-maximum (FWHM) of the L3-edge white line decreases with increasing distortion from Oh symmetry due to the mixing of symmetry broken t2g and eg components of the excited state U(6d) orbitals. The mixing is allowed because of spin-orbit splitting of the ligand field split 6d orbitals. Especially for higher distortions, it is possible to identify a mixing between one of the t2g and one of the eg components, allowed in the double group representation when the spin-orbit interaction is taken into account. This mixing strongly reduces the ligand field splitting, which, in turn, leads to a narrowing of the U L3 white line. However, the effect of this mixing is partially offset by an increase in the covalent anti-bonding character of the highest energy spin-orbit split eg orbital. At higher distortions, mixing overwhelms the increasing anti-bonding character of this orbital which leads to an accelerated decrease in the FWHM with increasing distortion. Additional evidence for the effect of mixing of t2g and eg components is that the FWHM of the white line narrows whether the two axial U-O bond distances shorten or lengthen. Our ab initio theory uses relativistic wavefunctions for cluster models of the structures; empirical or semi-empirical parameters were not used to adjust prediction to experiment. A major advantage is that it provides a transparent approach for determining how the character and extent of the covalent mixing of the relevant U and O orbitals affect the U L3-edge white line.

  5. Results on the calibration of the L3 BGO calorimeter with cosmic rays

    Energy Technology Data Exchange (ETDEWEB)

    Bakken, J.A.; Barone, L.; Bay, A.; Blaising, J.J.; Borgia, B.; Bourilkov, D.; Boutigny, D.; Brock, I.C.; Buisson, C.; Capell, M.; Chaturvedi, U.K.; Chemarin, M.; Clare, R.; Coignet, G.; Denes, P.; DeNotaristefani, F.; Diemoz, M.; Duchesneau, D.; El Mamouni, H.; Extermann, P.; Fay, J.; Ferroni, F.; Gailloud, M.; Goujon, D.; Gratta, G.; Gupta, V.K.; Hilgers, K.; Ille, B.; Janssen, H.; Karyotakis, Y.; Kasser, A.; Kienzle-Focacci, M.N.; Krenz, W.; Lebrun, P.; Lecoq, P.; Leonardi, E.; Linde, F.L.; Lindemann, B.; Longo, E.; Lu, Y.S.; Luci, C.; Luckey, D.; Martin, J.P.; Merk, M.; Micke, M.; Morganti, S.; Newman, H.; Organtini, G.; Piroue, P.A.; Read, K.; Rosier-Lees, S.; Rosselet, P.; Sauvage, G.; Schmitz, D.; Schneegans, M.; Schwenke, J.; Stickland, D.P.; Tully, C.; Valente, E.; Vivargent, M.; Vuilleumier, L.; Wang, Y.F.; Weber, A.; Weill, R.; Wenninger, J. (1. Physikalisches Inst., RWTH-Aachen (Germany) National Inst. for High Energy Physics, NIKHEF, Amsterdam (Netherlands) Lab. d' Annecy-l; L3 BGO Collaboration

    1994-04-11

    During 1991 two cosmic rays runs took place for the calibration of the L3 electromagnetic calorimeter. In this paper we present the results of the first high statistics cosmic ray calibration of the calorimeter in situ, including the end caps. Results show that the accuracy on the measurement of the calibration constants that can be achieved in one month of data taking is of 1.3%. (orig.)

  6. Single tagged 2γ events with BGO, ALR, and VSAT of L3

    Science.gov (United States)

    Baksay, Laszlo; Dehmelt, Klaus; Hohlmann, Marcus

    2003-11-01

    In order to extend the investigation of the Q^2 evolution of the hadronic structure function F_2^γ with L3, to Q^2 as low as 0.5GeV^2 and as high as 3850GeV^2, we will include the electromagnetic calorimeters (BGO), active lead rings (ALR), and the very small angle tagging detectors (VSAT) as tagging devices for single tagged 2γ events. Strategies for selecting events with these detector components will be presented.

  7. Spacecraft trajectories to the L3 point of the Sun-Earth three-body problem

    Science.gov (United States)

    Tantardini, Marco; Fantino, Elena; Ren, Yuan; Pergola, Pierpaolo; Gómez, Gerard; Masdemont, Josep J.

    2010-11-01

    Of the three collinear libration points of the Sun-Earth Circular Restricted Three-Body Problem (CR3BP), L3 is that located opposite to the Earth with respect to the Sun and approximately at the same heliocentric distance. Whereas several space missions have been launched to the other two collinear equilibrium points, i.e., L1 and L2, taking advantage of their dynamical and geometrical characteristics, the region around L3 is so far unexploited. This is essentially due to the severe communication limitations caused by the distant and permanent opposition to the Earth, and by the gravitational perturbations mainly induced by Jupiter and the close passages of Venus, whose effects are more important than those due to the Earth. However, the adoption of a suitable periodic orbit around L3 to ensure the necessary communication links with the Earth, or the connection with one or more relay satellites located at L4 or L5, and the simultaneous design of an appropriate station keeping-strategy, would make it possible to perform valuable fundamental physics and astrophysics investigations from this location. Such an opportunity leads to the need of studying the ways to transfer a spacecraft (s/c) from the Earth’s vicinity to L3. In this contribution, we investigate several trajectory design methods to accomplish such a transfer, i.e., various types of two-burn impulsive trajectories in a Sun-s/c two-body model, a patched conics strategy exploiting the gravity assist of the nearby planets, an approach based on traveling on invariant manifolds of periodic orbits in the Sun-Earth CR3BP, and finally a low-thrust transfer. We examine advantages and drawbacks, and we estimate the propellant budget and time of flight requirements of each.

  8. Search for scalar leptons at LEP with the L3 detector

    CERN Document Server

    Xia, Lei

    2002-01-01

    In this thesis, I present a search for scalar leptons in e+e- annihilation using the L3 detector at LEP. Data collected in 1999 and 2000, at center-of-mass energies between 192 GeV and 208 GeV, was used in this analysis. This work covered the scalar lepton searches in both SUGRA and GMSB models. To achieve this analysis, a parametrized selection was developed to handle the different event signatures in SUGRA models. Improvement of the L3 simulation and reconstruction program packages was carried out so that one can simulated the scalar leptons in GMSB models correctly. The simulation of the L3 Time Expansion Chamber (TEC) dE/dx measurement was rewritten to facilitate the analysis for a stable slepton signal, which is relevant in some parts of the parameter space in GMSB models. In this analysis, we didn't abserve any significant indication of scalar lepton production of any type. We achieved the following mass exclusion limits for scalar leptons in SUGRA models, for large dM: M(scalar e) > 97 GeV (expected 97...

  9. Purification and properties of L-3-glycerophosphate dehydrogenase from pig brain mitochondria.

    Science.gov (United States)

    Cottingham, I R; Ragan, C I

    1980-10-15

    L-3-Glycerophosphate dehydrogenase (EC 1.1.99.5) was purified from pig brain mitochondria by extraction with deoxycholate, ion-exchange chromatography and (NH4)2SO4 fractionation in cholate, and preparative isoelectric focusing in Triton X-100. Sodium dodecyl sulphate/polyacrylamide gel electrophoresis shows that the purified enzyme consists of a single subunit of mol.wt. 75 000. The enzyme contains non-covalently bound FAD and low concentrations of iron and acid labile sulphide. No substrate reducible e.p.r. signals were detected. The conditions of purification, particularly the isoelectric focusing step, lead to considerable loss of FAD and possibly iron-sulphur centres. It is therefore not possible to decide with certainty whether the enzyme is a flavoprotein or a ferroflavoprotein. The enzyme catalyses the oxidation of L-3-glycerophosphate by a variety of electron acceptors, including ubiquinone analogues. A number if compounds known to inhibit ubiquinone oxidoreduction by other enzymes of the respiratory chain failed to inhibit L-3-glycerophosphate dehydrogenase, except at very high concentrations.

  10. Determination of the masses of electrical weak gauge bosons with L3

    CERN Document Server

    Rosenbleck, Christian

    2006-01-01

    This thesis presents the measurement of the masses of the carriers of the weak force in the Standard Model of Particle Physics, the gauge bosons W and Z. The masses are determined using the kinematics of the bosons' decay products. The data were collected by the L3 experiment at the Large Electron Positron Collider (LEP) at centre-of-mass energies, sqrt(s), between 183 GeV and 209 GeV in the years 1997 to 2000. The mass of the Z-boson, mZ, is already known very precisely: The L3 collaboration determined it to be mZ = 91.1898 +- 0.0031 GeV from a scan of the Z resonance. Therefore the main aim of this analysis is not the determination of the numerical value of mZ; instead the analysis is used to cross-check the measurement of the W boson mass since the methods are similar. Alternatively, the analysis can be used to measure the mean centre-of-mass energy at the L3 interaction point. The Z-boson mass is determined to be mZ = 91.272 +- 0.046 GeV. If interpreted as measurement of the centre-of-mass energy, this va...

  11. Predictive factors for a distal adjacent disorder with L3 as the lowest instrumented vertebra in Lenke 5C patients.

    Science.gov (United States)

    Ando, Kei; Imagama, Shiro; Ito, Zenya; Kobayashi, Kazuyoshi; Hida, Tetsuro; Ito, Kenyu; Tsushima, Akito; Ishikawa, Yoshimoto; Matsumoto, Akiyuki; Nishida, Yoshihiro; Ishiguro, Naoki

    2016-01-01

    To investigate what type of Lenke 5C patient benefits most from a fusion to L3 as the LIV. The subjects were 16 patients who underwent fusion surgery to L3 as the lowest instrumented vertebra (LIV), and who were then observed for a minimum of 2 years postoperatively. We considered an unsatisfactory radiologic outcome for the distal adjacent curve (DAD) to be an L3 or L4 tilt angle less than 10° or L3/4 disc wedging less than 10°. Patients were divided into 2 groups based on the radiologic outcome of the distal curve: the distal adjacent disorder+ (DAD+) and the distal adjacent disorder-(DAD-). We compared global balance, Cobb angles (thoracic and lumbar), L3 and L4 tilt angles and L3/4/5 disc angles between the 2 groups on preoperative, postoperative and final radiographs. Seven patients (43.8 %) met the criteria for the DAD+ group. On preoperative radiographs, there was a significant difference in the L3/4 disc angle: the DAD+ group opened to the preoperative convex side (-2.1° ± 3.0°) and the DAD- group opened to the preoperative concave side (4.7° ± 5.1°). The standing L3- and L4-CSVL and the L4-CSVL under traction were significantly different. In Lenke 5C patients who underwent fusion surgery to L3 as the LIV, preoperative LIV (L3), LIV + 1 (L4) translation and L3/4 disc angle on standing, plus LIV + 1 translation under traction were very important parameters correlating with postoperative global coronal balance.

  12. The arouser EPS8L3 gene is critical for normal memory in Drosophila.

    Directory of Open Access Journals (Sweden)

    Holly LaFerriere

    Full Text Available The genetic mechanisms that influence memory formation and sensitivity to the effects of ethanol on behavior in Drosophila have some common elements. So far, these have centered on the cAMP/PKA signaling pathway, synapsin and fas2-dependent processes, pumilio-dependent regulators of translation, and a few other genes. However, there are several genes that are important for one or the other behaviors, suggesting that there is an incomplete overlap in the mechanisms that support memory and ethanol sensitive behaviors. The basis for this overlap is far from understood. We therefore examined memory in arouser (aru mutant flies, which have recently been identified as having ethanol sensitivity deficits. The aru mutant flies showed memory deficits in both short-term place memory and olfactory memory tests. Flies with a revertant aru allele had wild-type levels of memory performance, arguing that the aru gene, encoding an EPS8L3 product, has a role in Drosophila memory formation. Furthermore, and interestingly, flies with the aru(8-128 insertion allele had deficits in only one of two genetic backgrounds in place and olfactory memory tests. Flies with an aru imprecise excision allele had deficits in tests of olfactory memory. Quantitative measurements of aru EPS8L3 mRNA expression levels correlate decreased expression with deficits in olfactory memory while over expression is correlated with place memory deficits. Thus, mutations of the aru EPS8L3 gene interact with the alleles of a particular genetic background to regulate arouser expression and reveals a role of this gene in memory.

  13. Measurement of the photon structure function F2 gamma with the L3 detector at LEP

    CERN Document Server

    Achard, P.; Aguilar-Benitez, M.; Alcaraz, J.; Alemanni, G.; Allaby, J.; Aloisio, A.; Alviggi, M.G.; Anderhub, H.; Andreev, Valery P.; Anselmo, F.; Arefev, A.; Azemoon, T.; Aziz, T.; Bagnaia, P.; Bajo, A.; Baksay, G.; Baksay, L.; Baldew, S.V.; Banerjee, S.; Banerjee, Sw.; Barczyk, A.; Barillere, R.; Bartalini, P.; Basile, M.; Batalova, N.; Battiston, R.; Bay, A.; Becattini, F.; Becker, U.; Behner, F.; Bellucci, L.; Berbeco, R.; Berdugo, J.; Berges, P.; Bertucci, B.; Betev, B.L.; Biasini, M.; Biglietti, M.; Biland, A.; Blaising, J.J.; Blyth, S.C.; Bobbink, G.J.; Bohm, A.; Boldizsar, L.; Borgia, B.; Bottai, S.; Bourilkov, D.; Bourquin, M.; Braccini, S.; Branson, J.G.; Brochu, F.; Burger, J.D.; Burger, W.J.; Cai, X.D.; Capell, M.; Cara Romeo, G.; Carlino, G.; Cartacci, A.; Casaus, J.; Cavallari, F.; Cavallo, N.; Cecchi, C.; Cerrada, M.; Chamizo, M.; Chang, Y.H.; Chemarin, M.; Chen, A.; Chen, G.; Chen, G.M.; Chen, H.F.; Chen, H.S.; Chiefari, G.; Cifarelli, L.; Cindolo, F.; Clare, I.; Clare, R.; Coignet, G.; Colino, N.; Costantini, S.; de la Cruz, B.; Cucciarelli, S.; de Asmundis, R.; Deglon, P.; Debreczeni, J.; Degre, A.; Dehmelt, K.; Deiters, K.; della Volpe, D.; Delmeire, E.; Denes, P.; DeNotaristefani, F.; De Salvo, A.; Diemoz, M.; Dierckxsens, M.; Dionisi, C.; Dittmar, M.; Doria, A.; Dova, M.T.; Duchesneau, D.; Duda, M.; Echenard, B.; Eline, A.; El Hage, A.; El Mamouni, H.; Engler, A.; Eppling, F.J.; Extermann, P.; Falagan, M.A.; Falciano, S.; Favara, A.; Fay, J.; Fedin, O.; Felcini, M.; Ferguson, T.; Fesefeldt, H.; Fiandrini, E.; Field, J.H.; Filthaut, F.; Fisher, P.H.; Fisher, W.; Fisk, I.; Forconi, G.; Freudenreich, K.; Furetta, C.; Galaktionov, Iouri; Ganguli, S.N.; Garcia-Abia, Pablo; Gataullin, M.; Gentile, S.; Giagu, S.; Gong, Z.F.; Grenier, Gerald Jean; Grimm, O.; Gruenewald, M.W.; Guida, M.; Gupta, V.K.; Gurtu, A.; Gutay, L.J.; Haas, D.; Hatzifotiadou, D.; Hebbeker, T.; Herve, Alain; Hirschfelder, J.; Hofer, H.; Hohlmann, M.; Holzner, G.; Hou, S.R.; Jin, B.N.; Jindal, P.; Jones, Lawrence W.; de Jong, P.; Josa-Mutuberria, I.; Kaur, M.; Kienzle-Focacci, M.N.; Kim, J.K.; Kirkby, Jasper; Kittel, W.; Klimentov, A.; Konig, A.C.; Kopal, M.; Koutsenko, V.; Kraber, M.; Kraemer, R.W.; Kruger, A.; Kunin, A.; Ladron de Guevara, P.; Laktineh, I.; Landi, G.; Lebeau, M.; Lebedev, A.; Lebrun, P.; Lecomte, P.; Lecoq, P.; Le Coultre, P.; Le Goff, J.M.; Leiste, R.; Levtchenko, M.; Levtchenko, P.; Li, C.; Likhoded, S.; Lin, C.H.; Lin, W.T.; Linde, F.L.; Lista, L.; Liu, Z.A.; Lohmann, W.; Longo, E.; Lu, Y.S.; Luci, C.; Luminari, L.; Lustermann, W.; Ma, W.G.; Malgeri, L.; Malinin, A.; Mana, C.; Mans, J.; Martin, J.P.; Marzano, F.; Mazumdar, K.; McNeil, R.R.; Mele, S.; Mermod, P.; Merola, L.; Meschini, M.; Metzger, W.J.; Mihul, A.; Milcent, H.; Mirabelli, G.; Mnich, J.; Mohanty, G.B.; Muanza, G.S.; Muijs, A.J.M.; Musicar, B.; Musy, M.; Nagy, S.; Natale, S.; Napolitano, M.; Nessi-Tedaldi, F.; Newman, H.; Nisati, A.; Novak, T.; Kluge, Hannelies; Ofierzynski, R.; Organtini, G.; Pal, I.; Palomares, C.; Paolucci, P.; Paramatti, R.; Passaleva, G.; Patricelli, S.; Paul, Thomas Cantzon; Pauluzzi, M.; Paus, C.; Pauss, F.; Pedace, M.; Pensotti, S.; Perret-Gallix, D.; Piccolo, D.; Pierella, F.; Pioppi, M.; Piroue, P.A.; Pistolesi, E.; Plyaskin, V.; Pohl, M.; Pojidaev, V.; Pothier, J.; Prokofev, D.; Rahal-Callot, G.; Rahaman, Mohammad Azizur; Raics, P.; Raja, N.; Ramelli, R.; Rancoita, P.G.; Ranieri, R.; Raspereza, A.; Razis, P.; Ren, D.; Rescigno, M.; Reucroft, S.; Riemann, S.; Riles, Keith; Roe, B.P.; Romero, L.; Rosca, A.; Rosemann, C.; Rosenbleck, C.; Rosier-Lees, S.; Roth, Stefan; Rubio, J.A.; Ruggiero, G.; Rykaczewski, H.; Sakharov, A.; Saremi, S.; Sarkar, S.; Salicio, J.; Sanchez, E.; Schafer, C.; Schegelsky, V.; Schopper, H.; Schotanus, D.J.; Sciacca, C.; Servoli, L.; Shevchenko, S.; Shivarov, N.; Shoutko, V.; Shumilov, E.; Shvorob, A.; Son, D.; Souga, C.; Spillantini, P.; Steuer, M.; Stickland, D.P.; Stoyanov, B.; Straessner, A.; Sudhakar, K.; Sultanov, G.; Sun, L.Z.; Sushkov, S.; Suter, H.; Swain, J.D.; Szillasi, Z.; Tang, X.W.; Tarjan, P.; Tauscher, L.; Taylor, L.; Tellili, B.; Teyssier, D.; Timmermans, Charles; Ting, Samuel C.C.; Ting, S.M.; Tonwar, S.C.; Toth, J.; Tully, C.; Tung, K.L.; Ulbricht, J.; Valente, E.; Van de Walle, R.T.; Vasquez, R.; Veszpremi, V.; Vesztergombi, G.; Vetlitsky, I.; Viertel, G.; Villa, S.; Vivargent, M.; Vlachos, S.; Vodopianov, I.; Vogel, H.; Vogt, H.; Vorobev, I.; Vorobyov, A.A.; Wadhwa, M.; Wang, Q.; Wang, X.L.; Wang, Z.M.; Weber, M.; Wynhoff, S.; Xia, L.; Xu, Z.Z.; Yamamoto, J.; Yang, B.Z.; Yang, C.G.; Yang, H.J.; Yang, M.; Yeh, S.C.; Zalite, An.; Zalite, Yu.; Zhang, Z.P.; Zhao, J.; Zhu, G.Y.; Zhu, R.Y.; Zhuang, H.L.; Zichichi, A.; Zimmermann, B.; Zoller, M.

    2005-01-01

    The e+e- -> e+e- hadrons reaction, where one of the two electrons is detected in a low polar-angle calorimeter, is analysed in order to measure the hadronic photon structure function F2gamma . The full high-energy and high-luminosity data set, collected with the L3 detector at centre-of-mass energies 189-209GeV, corresponding to an integrated luminosity of 608/pb is used. The Q^2 range 11-34GeV^2 and the x range 0.006-0.556 are considered. The data are compared with recent parton density functions.

  14. Inclusive $\\pi^{0}$ and $K_{S}^{0}$ in $\\gamma \\gamma$ reactions at L3

    CERN Document Server

    Achard, P

    2001-01-01

    The e/sup +/e/sup -/ to e/sup +/e/sup -/ pi /sup 0/+X and e/sup +/e /sup -/ to e/sup +/e/sup -/K/sub S//sup 0/+X reactions are studied at LEP using data collected with the L3 detector at square root s =189-202 GeV. Preliminary results for the differential cross section d sigma /dp/sub T/ in the transverse momentum range 0.2 GeV1 GeV the cross sections are compared to NLO QCD calculations and to LO Monte Carlo predictions. (15 refs).

  15. After-dinner speech: the path of LISA to become ‘L3

    Science.gov (United States)

    Huber, M. C. E.

    2017-05-01

    We describe the state of fundamental-physics experiments in space in the mid 1980s on both sides of the Atlantic, and then follow the development of this field within ESA’s Scientific Programme. The special case of LISA — a fundamental physics experiment in space also supported by astronomers, and now, following the ground-based detection of gravitational waves, the means to extend the observable spectrum of such waves towards lower frequencies and long-lasting signals — is then followed in its rise to become the ‘Large Project L3’ of ESA.

  16. L3 (sponge) phase in the very dilute regime : spontaneous tearing of the membrane ?

    Science.gov (United States)

    Filali, M.; Porte, G.; Appell, J.; Pfeuty, P.

    1994-02-01

    We use light scattering and conductimetry to investigate the very dilute range of the domain of existence of the sponge (L3) phase in the quaternary OBS/pentanol/brine system. In this part of the phase diagram we find a line of maximum turbidity where the scattered intensity shows a very sharp maximum and has a pure Ornstein Zernicke q-dependence. These features are not consistent with what is expected close to the symmetric asymmetric transition line. We question the possibility of the spontaneous tearing of the membrane first considered on theoretical grounds by Huse and Leibler (Phys.~Rev.~Lett. 66 (1991) 437).

  17. Mutations in the bacterial ribosomal protein l3 and their association with antibiotic resistance

    DEFF Research Database (Denmark)

    Klitgaard, Rasmus N; Ntokou, Eleni; Nørgaard, Katrine

    2015-01-01

    Different groups of antibiotics bind to the peptidyl transferase center (PTC) in the large subunit of the bacterial ribosome. Resistance to these groups of antibiotics has often been linked with mutations or methylations of the 23S rRNA. In recent years, there has been a rise in the number...... of studies where mutations have been found in the ribosomal protein L3 in bacterial strains resistant to PTC-targeting antibiotics but there is often no evidence that these mutations actually confer antibiotic resistance. In this study, a plasmid exchange system was used to replace plasmid-carried wild...

  18. Taking L3 Learning by the Horns: Benefits of Computer-Mediated Intervention for Dyslexic School Children

    Science.gov (United States)

    Pfenninger, Simone E.

    2016-01-01

    This study investigates the interrelation of motivation, autonomy, metacognition, and L3 gains made as a function of three months of intervention with computer software specifically designed for the private use of dyslexic Swiss German learners of Standard German as a second language (L2) and English as a third language (L3). Based on…

  19. Isolation of L-3-phenyllactyl-Phe-Lys-Ala-NH2 (Antho-KAamide), a novel neuropeptide from sea anemones

    DEFF Research Database (Denmark)

    Nothacker, H P; Rinehart, K L; Grimmelikhuijzen, C J

    1991-01-01

    We have isolated and sequenced the neuropeptide L-3-phenyllactyl-Phe-Lys-Ala-NH2 from the sea anemone Anthopleura elegantissima. This neuropeptide (named Antho-KAamide) has the unusual N-terminal L-3-phenyllactyl blocking group which has recently also been discovered in 2 other neuropeptides from...

  20. 76 FR 29274 - Interstate Electronics Corp., a Subsidiary of L-3 Communications Including On-Site Leased Workers...

    Science.gov (United States)

    2011-05-20

    ... Employment and Training Administration Interstate Electronics Corp., a Subsidiary of L-3 Communications Including On-Site Leased Workers from Bently Global Resources, Manpower Professional Huntington Beach... Electronics Corp., a subsidiary of L-3 Communications, including on-site leased workers from Bently Global...

  1. Activity of Tagetes minuta Linnaeus (Asteraceae) essential oil against L3 Anisakis larvae type 1.

    Science.gov (United States)

    Giarratana, Filippo; Muscolino, Daniele; Ziino, Graziella; Giuffrida, Alessandro; Marotta, Stefania Maria; Lo Presti, Vittorio; Chiofalo, Vincenzo; Panebianco, Antonio

    2017-05-01

    To evaluate in vitro effects of Tagetes minuta L. essential oil (TEO) on L3 Anisakis larvae type 1. In order to evaluate the potential use of Tagetes minuta essential oil against L3 Anisakis larvae three different media were tested: 1) a saline solution (SS); 2) an industrial marinating solution (MS); 3) sunflower seeds oil (SO). For each media and concentrations of TEO (0.1%, 0.5%, 1.0% and 5.0% v/v), 20 parasites were introduced into plastic Petri dishes (diameter 90 mm) and maintained at room temperature. As controls, larvae were maintained without TEO under identical experimental conditions in SS, MS and SO. A total of 900 larvae were tested. The normalized mean viability, LT100, LT50 and the percentage of inactivation at 24 h were calculated. In vitro tests revealed a complete inactivation of parasites in saline solution after 2 h with 5% and 1% of TEO. In marinating solution, a complete inactivation of parasites was observed after 4 h at all concentrations used. A slower activity for all TEO concentration was reported in SO. The results obtained, showing a strong activity against Anisakis larvae, confirm TEO as a larvicidal agent in the treatment of human anisakidosis and in the industrial marinating process. Copyright © 2017 Hainan Medical University. Production and hosting by Elsevier B.V. All rights reserved.

  2. A novel EWS-CREB3L3 gene fusion in a mesenteric sclerosing epithelioid fibrosarcoma.

    Science.gov (United States)

    Dewaele, Barbara; Libbrecht, Louis; Levy, Gabriel; Brichard, Benedicte; Vanspauwen, Vanessa; Sciot, Raf; Debiec-Rychter, Maria

    2017-09-01

    Sclerosing epithelioid fibrosarcoma (SEF) is a rare, malignant fibroblastic neoplasm, morphologically composed of cords, nests or sheets of monotonous epithelioid cells within a collagenous matrix. It has been recently characterized by recurrent pathogenic EWS-CREB3L1/2 or FUS-CREB3L2 fusions and common MUC4 protein expression by immunohistochemistry. Typically SEF occur in middle-aged adults and rarely have been reported within the abdominal cavity. Here we report an 18-year-old man with intraabdominal tumor and multiple disseminated liver metastases, presenting pure SEF histologic and immunophenotypic features. Fluorescence in situ hybridization analysis showed unbalanced rearrangement of Ewing sarcoma breakpoint region 1 (EWSR1) gene. Genomic profiling by array CGH, followed by RT-PCR and sequencing analysis, revealed a previously not reported EWSR1 translocation partner, cAMP-responsive element-binding protein 3-like 3 (CREB3L3). The novel EWSR1-CREB3L3 fusion further extends the range of fusion types involving EWSR1 that are characteristic for SEF. © 2017 Wiley Periodicals, Inc.

  3. Sublingual vein parameters, AFP, AFP-L3, and GP73 in patients with hepatocellular carcinoma.

    Science.gov (United States)

    Zhao, J; Guo, L-Y; Yang, J-M; Jia, J-W

    2015-06-26

    This study evaluated the diagnostic value of alpha-fetoprotein (AFP), AFP heterogeneity 3 (AFP-L3), Golgi protein 73 (GP73), and sublingual vein parameters in hepatocellular carcinoma (HCC). Levels of serum AFP, AFP-L3, GP73, and sublingual vein scores were measured in 34 patients with chronic hepatitis, 65 patients with post-hepatitis B cirrhosis, 71 patients with HCC, and 6 healthy controls. Logistic regression analysis was used to explore potential correlations. Sublingual vein grades in patients with HCC were higher than those in the other three groups; sublingual vein scores were also different between groups; combined diagnosis using AFP, GP73, and sublingual vein grade was superior to the individual parameters alone or when only two were used in different combinations. Thus, sublingual vein grade can be considered as an independent risk factor for diagnosis of HCC. Furthermore, combined detection with AFP, GP73, and sublingual vein grade is simple, inexpensive, and effective. It may therefore be suitable for screening high-risk populations for early diagnosis of HCC.

  4. The Solar Flare of the 14th of July 2000 (L3+C detector results)

    CERN Document Server

    Achard, P; Aguilar-Benítez, M; Van den Akker, M; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Anderhub, H; Andreev, V P; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Bajo, A; Baksay, G; Baksay, L; Bähr, J; Baldew, S V; Banerjee, S; Banerjee, Sw; Barczyk, A; Barillère, R; Bartalini, P; Basile, M; Batalova, N; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Bellucci, L; Berbeco, R; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Biasini, M; Biglietti, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, G J; Böhm, A; Boldizsar, L; Borgia, B; Bottai, S; Bourilkov, D; Bourquin, M; Braccini, S; Branson, J G; Brochu, F; Burger, J D; Burger, W J; Cai, X D; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A; Casaus, J; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada, M; Chamizo-Llatas, M; Chiarusi, T; Chang, Y H; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chiefari, G; Cifarelli, L; Cindolo, F; Clare, I; Clare, R; Coignet, G; Colino, N; Costantini, S; Dela Cruz, B; Cucciarelli, S; De Asmundis, R; Dglon, P; Debreczeni, J; Degré, A; Dehmelt, K; Deiters, K; Della Volpe, D; Delmeire, E; Denes, P; De Notaristefani, F; De Salvo, A; Diemoz, M; Dierckxsens, M; Ding, L K; Dionisi, C; Dittmar, M; Doria, A; Dova, M T; Duchesneau, D; Duda, M; Durán, I; Echenard, B; Eline, A; El-Hage, A; El-Mamouni, H; Engler, A; Eppling, F J; Extermann, P; Faber, G; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, M; Ferguson, T; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, F; Fisher, W; Forconi, G; Freudenreich, K; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gentile, S; Giagu, S; Gong, Z F; Grenier, G; Grabosch, H J; Grimm, O; Groenstege, H; Grünewald, M W; Guida, M; Guo, Y N; Gupta, S K; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Haller, C; Hatzifotiadou, D; Hayashi, Y; He, Z X; Hebbeker, T; Herv, A; Hirschfelder, J; Hofer, H; Hohlmann, M; Holzner, A; Hou, S R; Huo, A X; Ito, N; Jin, B N; Jindal, P; Jing, C L; Jones, L W; de Jong, P; Josa-Mutuberria, I; Kantserov, V A; Kaur, M; Kawakami, S; Kienzle-Focacci, M N; Kim, J K; Kirkby, Jasper; Kittel, W; Klimentov, A; König, A C; Kok, E; Korn, A; Kopal, M; Koutsenko, V F; Kraber, M; Kuang, H H; Krämer, R W; Krüger, A; Kuijpers, J; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Le Goff, J M; Lei, Y; Leich, H; Leiste, R; Levtchenko, M; Levchenko, P M; Li, C; Li, L; Li, Z C; Likhoded, S; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lü, Y S; Luci, C; Luminari, L; Lustermann, W; Ma, W G; Ma, X H; Ma, Y Q; Malgeri, L; Malinin, A; Maña, C; Mans, J; Martin, J P; Marzano, F; Mazumdar, K; McNeil, R R; Meng, X W; Merola, L; Meschini, M; Metzger, W J; Mihul, A; Van Mil, A; Milcent, H; Mirabelli, G; Mnich, J; Mohanty, G B; Monteleoni, B; Muanza, G S; Muijs, A J M; Musy, M; Nagy, S; Nahnhauer, R; Naumov, V A; Natale, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Nisati, A; Novák, T; Nowak, H; Ofierzynski, R A; Organtini, G; Pal, I; Palomares, C; Paolucci, P; Paramatti, R; Parriaud, J F; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, F; Pedace, M; Pensotti, S; Perret-Gallix, D; Petersen, B; Piccolo, D; Pierella, F; Pieri, M; Pioppi, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Pothier, J; Prokofev, D; Prokofiev, D O; Qing, C R; Rahal-Callot, G; Rahaman, M A; Raics, P; Raja, N; Ramelli, R; Rancoita, P G; Ranieri, R; Raspereza, A V; Ravindran, K C; Razis, P; Rembeczki, S; Ren, D; Rescigno, M; Reucroft, S; Rewiersma, P A M; Riemann, S; Rojkov, A; Romero, L; Rosca, A; Rosemann, C; Rosenbleck, C; Rosier-Lees, S; Roth, S; Rubio, J A; Ruggiero, G; Rykaczewski, H; Sakharov, A; Saremi, S; Sarkar, S; Salicio, J; Sánchez, E; Schäfer, C; Shchegelskii, V; Schöneich, B; Schotanus, D J; Sciacca, C; Servoli, L; Shen, C Q; Shevchenko, S; Shivarov, N; Shoutko, V; Shumilov, E; Shvorob, A; Son, D; Souga, C; Spillantini, P; Steuer, M; Stickland, D P; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Sushkov, S; Suter, H; Swain, J D; Szillási, Z; Tang, X W; Tarjan, P; Tauscher, L; Taylor, L; Tellili, B; Teyssier, D; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Trowitzsch, G; Tully, C; Tung, K L; Ulbricht, J; Unger, M; Valente, E; Verkooijen, H; Van de Walle, R T; Vásquez, R; Vesztergombi, G; Vetlitskii, I; Viertel, G; Vivargent, M; Vlachos, S; Vodopyanov, I; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Wadhwa, M; Wang, G; Wang, Q; Wang, X L; Wang, X W; Wang, Z M; Weber, M; Van Wijk, R; Wijnen, T A M; Wilkens, H; Wynhoff, S; Xia, L; Xu, Y P; Xu, Z Z; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Yang, X F; Yao, Z G; Yeh, S C; Yu, Z Q; Zalite, A; Zalite, Yu; Zhang, C; Zhang, F; Zhang, J; Zhang, S; Zhang, Z P; Zhao, J; Zhou, S J; Zhu, G Y; Zhu, R Y; Zhu, Q Q; Zhuang, H L; Zichichi, A; Zimmermann, B; Zöller, M; Zwart, A N M

    2006-01-01

    Several experiments have reported observations on possible correlations between the flux of high energy muons and intense solar flares. If confirmed, these observations would have significant implications for acceleration processes in the heliosphere able to accelerate protons and other ions to energies of at least tens of GeV. The solar flare of the 14 July 2000 offers a unique opportunity for the L3+C experiment to search for a correlated enhancement in the flux of muons using the L3 precision muon spectrometer. Its capabilities for observing a directional excess in the flux of muons above 15 GeV (corresponding to primary proton energies above 40 GeV) are presented along with observations made on the 14th of July 2000. We report an excess which appeared at a time coincident with the peak increase of solar protons observed at lower energies. The probability that the excess is a background fluctuation is estimated to be 1%. No similar excess of the muon flux was observed up to 1.5 hours after the solar flare ...

  5. GAS2L3, a target gene of the DREAM complex, is required for proper cytokinesis and genomic stability.

    Science.gov (United States)

    Wolter, Patrick; Schmitt, Kathrin; Fackler, Marc; Kremling, Heidi; Probst, Leona; Hauser, Stefanie; Gruss, Oliver J; Gaubatz, Stefan

    2012-05-15

    The mammalian DREAM complex is a key regulator of cell-cycle-regulated gene transcription and drives the expression of many gene products required for mitosis and cytokinesis. In this study, we characterized GAS2L3, which belongs to the GAS2 family of proteins with putative actin- and microtubule-binding domains as a target gene of DREAM. We found that GAS2L3 localizes to the spindle midzone and the midbody during anaphase and cytokinesis, respectively. Biochemical studies show that GAS2L3 binds to and bundles microtubules as well as F-actin in vitro. Strikingly, the RNAi-mediated knockdown of GAS2L3 results in chromosome segregation defects in multinucleated cells and in cells with multi-lobed nuclei. Likewise, chronic downregulation of GAS2L3 causes chromosome loss and aneuploidy. Time-lapse videomicroscopy experiments in GAS2L3-knockdown cells reveal abnormal oscillation of chromatin and the spindle during cytokinesis. Taken together, our data reveal novel, important roles of GAS2L3 for faithful cell division. Our work thus contributes to the understanding of how DREAM regulates cytokinesis.

  6. Combined Effect of the Cfr Methyltransferase and Ribosomal Protein L3 Mutations on Resistance to Ribosome-Targeting Antibiotics

    DEFF Research Database (Denmark)

    Pakula, Kevin K; Hansen, Lykke H; Vester, Birte

    2017-01-01

    . The presence of Cfr has a very minor influence on the growth rate. The resistance of the transformants to linezolid, tiamulin, florfenicol, and Synercid (a combination of quinupristin and dalfopristin [Q-D]) was measured by MIC assays. The resistance from Cfr was, in all cases, stronger than the effects...... of the L3 mutations, but various effects were obtained with the combinations of Cfr and L3 mutations ranging from a synergistic to an antagonistic effect. Linezolid and tiamulin susceptibility varied greatly among the L3 mutations, while no significant effects on florfenicol and Q-D susceptibility were...

  7. Proportional chambers of the barrel hadron calorimeter of the L3 experiment

    Energy Technology Data Exchange (ETDEWEB)

    Arefiev, A.; Azemoon, T.; Bachmann, U.; Ball, R.C.; Boehlen, W.E.; Capell, M.; Chen, C.; Chen, H.S.; Chumakov, M.; Galaktionov, Yu.

    1989-02-01

    The design and the mass production of the proportional wire chambers for the barrel part of the uranium-gas sampling hadron calorimeter of the L3 detector at the CERN Large Electron-Positron storage ring (LEP) are described. The chambers meet the specific requirements arising from the limited space available to the calorimeter, the radioactivity of uranium, and the physics criteria of good energy and position resolution for incident hadrons. The mass production techniques employed ensured that all of the 371664 chamber cells have uniform response (with 5% accuracy) to ionizing particles. Over 8000 chambers of the same design, in 53 different sizes, were manufactured and tested at the ITEP (Moscow), at the University of Michigan (Ann Arbor) and at the IHEP (Beijing).

  8. Leptonic two-photon events measured with L3 at the Large Electron Positron Collider (LEP)

    CERN Document Server

    Dehmelt, Klaus

    2006-01-01

    Virtual photons can fluctuate into diverse final states and among other processes, such fluctuations can yield muon-pairs. The fluctuation is a statistical process and can be described in terms of structure functions for photons. Apart from supplying another test of QED, purely leptonic processes provide a calibration fro the hadronic processes. We report on a measurement of dimuon events with single-tagged two-photon events from the LEP experiment L3, at c.m.s. energies between 189 GeV and 206 GeV, with an integrated luminosity of $\\mathcal{L}$ = 600 pb$^{-1}$. An overview of the fundamental physical processes, the detector and the anaytical tools, used for measuring dimuon events, and a discussion of the structure of dimuon events will be presented.

  9. 2016 CSSE L3 Milestone: Deliver In Situ to XTD End Users

    Energy Technology Data Exchange (ETDEWEB)

    Patchett, John M. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Nouanesengsy, Boonthanome [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Fasel, Patricia Kroll [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Ahrens, James Paul [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-09-13

    This report summarizes the activities in FY16 toward satisfying the CSSE 2016 L3 milestone to deliver in situ to XTD end users of EAP codes. The Milestone was accomplished with ongoing work to ensure the capability is maintained and developed. Two XTD end users used the in situ capability in Rage. A production ParaView capability was created in the HPC and Desktop environment. Two new capabilities were added to ParaView in support of an EAP in situ workflow. We also worked with various support groups at the lab to deploy a production ParaView in the LANL environment for both desktop and HPC systems. . In addition, for this milestone, we moved two VTK based filters from research objects into the production ParaView code to support a variety of standard visualization pipelines for our EAP codes.

  10. The active adenovirus protease is the intact L3 23K protein.

    Science.gov (United States)

    Webster, A; Kemp, G

    1993-07-01

    The L3 23K protein was isolated from adenovirus type 2 and shown to cleave purified substrates, confirming that this protein is the adenovirus protease. Separate antisera, prepared against the amino- and carboxy-terminal regions of the 23K protein react with active protease, demonstrating that, contrary to previous reports, zymogen activation is not involved in the regulation of this enzyme. Molecular exclusion chromatography indicated that the protease is active as a monomer. Purified protease was shown to be inhibited by Zn2+ and Cu2+ and by some, but not all, recognized cysteine protease inhibitors, indicating participation of a thiol group and providing additional support to the suggestion that regulation of the enzyme involves a form of thiol-disulphide interchange.

  11. Purifikasi Imunoglobulin Yolk Pada Ayam yang Divaksin terhadap Ekskretori/Sekretori Stadium L3 Ascaridia galli

    Directory of Open Access Journals (Sweden)

    Darmawi Darmawi

    2010-10-01

    Full Text Available Purification yolk immunoglobulin of hens vaccinated against excretory/secretory Ascaridia galli L3 larvae stage ABSTRACT. The main immunoglobulin fraction of poultry is called IgY, in order to distinguish it from the mammalian IgG. This article focus on purification yolk immunoglobulin of hens vaccinated against excretory/secretory Ascaridia galli larvae to obtained purity IgY. Active vaccinations with excretory/secretory antigen were applied intra muscularly of chickens with an initial dose of 80 μg. The vaccinations were repeated three times with dose of each 60 μg with an interval of one week. The first vaccinations were excretory/secretory antigen mixed with Fruend Adjuvant Complete and subsequently mixed with Freund Adjuvant Incomplete. Antibody response in yolk was detected at weekly intervals by agar gel precipitation test (AGPT. The chicken’s eggs were collected from 49 day after vaccinations. IgY was extracted from egg yolks by means of ammonium sulphate and purified using fast performance liquid chromatography (FPLC. The purity of anti-ekscretory/secretory IgY protein was determined by Bradford method (λ = 280 nm. The result showed that antibody in yolk was begun detect with AGPT at four weeks after vaccination. IgY concentration after purification was 0,875 ± 0.251 mg/ml. This study has shown that the product released in vitro by L3 stage A. galli is capable of stimulating humoral immunity by mean of producing antibody through yolk as biologic manufacturer could be a good choice.

  12. MODIS/Terra+Aqua Photosynthetically Active Radiation Daily/3-Hour L3 Global 5km SIN Grid V006

    Data.gov (United States)

    National Aeronautics and Space Administration — The MCD18A2 Version 6 is a MODIS Terra and Aqua combined Photosynthetically Active Radiation (PAR) gridded L3 product produced daily at 5 kilometer pixel resolution...

  13. MODIS/Terra+Aqua Surface Radiation Daily/3-Hour L3 Global 5km SIN Grid V006

    Data.gov (United States)

    National Aeronautics and Space Administration — The MCD18A1 Version 6 is a MODIS Terra and Aqua combined Downward Shortwave Radiation (DSR) gridded L3 product produced daily at 5 kilometer pixel resolution with...

  14. MODIS/Aqua 8-Day Clear Sky Radiance Bias Daily L3 Global 1Deg Zonal Bands V006

    Data.gov (United States)

    National Aeronautics and Space Administration — The "MODIS/AQUA 8 Day Clear Sky Radiance Bias Daily L3 Global 1 Deg Zonal Bands", MYDCSR_B files contain 1-degree zonal mean clear-sky biases (observed minus...

  15. MODIS/Aqua Land Surface Temperature/3-Band Emissivity Daily L3 Global 1km SIN Grid Day V006

    Data.gov (United States)

    National Aeronautics and Space Administration — MODIS/Aqua Land Surface Temperature/3-Band Emissivity Daily L3 Global 1km SIN Grid Day (MYD21A1D.006). A new suite of MODIS Land Surface Temperature (LST) and...

  16. MODIS/Terra Land Surface Temperature/3-Band Emissivity Daily L3 Global 1km SIN Grid Night V006

    Data.gov (United States)

    National Aeronautics and Space Administration — MODIS/Terra Land Surface Temperature/3-Band Emissivity Daily L3 Global 1km SIN Grid Night (MOD21A1N.006). A new suite of MODIS Land Surface Temperature (LST) and...

  17. MODIS/Aqua Land Surface Temperature/3-Band Emissivity Daily L3 Global 1km SIN Grid Night V006

    Data.gov (United States)

    National Aeronautics and Space Administration — MODIS/Aqua Land Surface Temperature/3-Band Emissivity Daily L3 Global 1km SIN Grid Night (MYD21A1N.006). A new suite of MODIS Land Surface Temperature (LST) and...

  18. MODIS/Terra Land Surface Temperature/3-Band Emissivity Daily L3 Global 1km SIN Grid Day V006

    Data.gov (United States)

    National Aeronautics and Space Administration — MODIS/Terra Land Surface Temperature/3-Band Emissivity Daily L3 Global 1km SIN Grid Day (MOD21A1D.006). A new suite of MODIS Land Surface Temperature (LST) and...

  19. Multi-Satellite Lambertian Equivalent Reflectivity (Noon Normalized) Daily L3 Global 5.0deg Lat Zones V1

    Data.gov (United States)

    National Aeronautics and Space Administration — The Multi-Satellite Lambertian Equivalent Reflectivity (Noon Normalized) Daily L3 Global 5.0deg Lat Zones data product (MSLERNNL3zm) is derived from observations...

  20. MODIS/Aqua 8-Day Clear Sky Radiance Bias Daily L3 Global 1Deg Zonal Bands V005

    Data.gov (United States)

    National Aeronautics and Space Administration — This is dataset "MODIS/AQUA 8 Day Clear Sky Radiance Bias Daily L3 Global 1 Deg Zonal Bands". View the MODIS Science Team home page for data set information:...

  1. Microcell-mediated chromosome transfer identifies EPB41L3 as a functional suppressor of epithelial ovarian cancers

    DEFF Research Database (Denmark)

    Dafou, Dimitra; Grun, Barbara; Sinclair, John

    2010-01-01

    lines. Using immunohistochemistry, 66% of 794 invasive ovarian tumors showed no EPB41L3 expression compared with only 24% of benign ovarian tumors and 0% of normal ovarian epithelial tissues. EPB41L3 was extensively methylated in ovarian cancer cell lines and primary ovarian tumors compared with normal...... (erythrocyte membrane protein band 4.1-like 3, alternative names DAL-1 and 4.1B) was a candidate ovarian cancer-suppressor gene. Immunoblot analysis showed that EPB41L3 was activated in TOV21G(+18) hybrids, expressed in normal ovarian epithelial cell lines, but was absent in 15 (78%) of 19 ovarian cancer cell...... tissues (P = .00004), suggesting this may be the mechanism of gene inactivation in ovarian cancers. Constitutive reexpression of EPB41L3 in a three-dimensional multicellular spheroid model of ovarian cancer caused significant growth suppression and induced apoptosis. Transmission and scanning electron...

  2. MODIS/Terra Vegetation Cover Conversion 96-Day L3 Global 250m SIN Grid V004

    Data.gov (United States)

    National Aeronautics and Space Administration — The MOD44A.004 dataset was decommissioned as of October 23, 2017. Users are encouraged to use Version 6 of MODIS/Terra Vegetation Continuous Fields Yearly L3 Global...

  3. The implications of the final L3 measurement of $\\sigma_{tot}(\\gamma\\gamma\\to b\\bar{b}$

    CERN Document Server

    Chyla, Jiri

    2006-01-01

    The excess of data on the total cross section of $\\bar{b}b$ production in $\\gamma\\gamma$ collisions over QCD predictions, observed by L3, OPAL and DELPHI Collaborations at LEP2, has so far defied explanation. The recent final analysis of L3 data has brought important new information concerning the dependence of the observed excess on the $\\gamma\\gamma$ collisions energy $W_{\\gamma\\gamma}$. The implications of this dependence are discussed.

  4. Prognostic Role of Pre-Treatment Serum AFP-L3% in Hepatocellular Carcinoma: Systematic Review and Meta-Analysis

    Science.gov (United States)

    Zhang, Yingjun; Liu, Xi; Li, Muxing; Wu, Zheng; Liu, Zhengwen; Lv, Yi; Wang, Bo

    2014-01-01

    Background Serum lens culinaris agglutinin-reactive fraction of α-fetoprotein (AFP-L3%) has been widely used for HCC diagnosis and follow-up surveillance as tumor serologic marker. However, the prognostic value of high pre-treatment serum AFP-L3% in patients with hepatocellular carcinoma (HCC) remains controversial. We therefore conduct a meta-analysis to assess the relationship between high pre-treatment serum AFP-L3% and clinical outcome of HCC. Methods Eligible studies were identified through systematic literature searches. A meta-analysis of fifteen studies (4,465 patients) was carried out to evaluate the association between high pre-treatment serum AFP-L3% and overall survival (OS) and disease-free survival (DFS) in HCC patients. Sensitivity and subgroup analyses were also conducted in this meta-analysis. Results Our analysis results showed that high pre-treatment serum AFP-L3% implied poor OS (HR: 1.65, 95%CI: 1.45–1.89 p<0.00001) and DFS (HR: 1.80, 95% CI: 1.49–2.17 p<0.00001) of HCC. Subgroup analysis revealed that there was association between pre-treatment serum AFP-L3% and endpoint (OS and DFS) in low AFP concentration HCC patients (HR: 1.96, 95% CI: 1.24–3.10, p = 0.004; HR: 2.53, 95% CI: 1.09–5.89, p = 0.03, respectively). Conclusion The current evidence suggests that high pre-treatment serum AFP-L3% levels indicated a poor prognosis for patients with HCC and AFP-L3% may have significant prognostic value in HCC patients with low AFP concentration. PMID:24498011

  5. Prognostic role of pre-treatment serum AFP-L3% in hepatocellular carcinoma: systematic review and meta-analysis.

    Directory of Open Access Journals (Sweden)

    Jiwen Cheng

    Full Text Available BACKGROUND: Serum lens culinaris agglutinin-reactive fraction of α-fetoprotein (AFP-L3% has been widely used for HCC diagnosis and follow-up surveillance as tumor serologic marker. However, the prognostic value of high pre-treatment serum AFP-L3% in patients with hepatocellular carcinoma (HCC remains controversial. We therefore conduct a meta-analysis to assess the relationship between high pre-treatment serum AFP-L3% and clinical outcome of HCC. METHODS: Eligible studies were identified through systematic literature searches. A meta-analysis of fifteen studies (4,465 patients was carried out to evaluate the association between high pre-treatment serum AFP-L3% and overall survival (OS and disease-free survival (DFS in HCC patients. Sensitivity and subgroup analyses were also conducted in this meta-analysis. RESULTS: Our analysis results showed that high pre-treatment serum AFP-L3% implied poor OS (HR: 1.65, 95%CI: 1.45-1.89 p<0.00001 and DFS (HR: 1.80, 95% CI: 1.49-2.17 p<0.00001 of HCC. Subgroup analysis revealed that there was association between pre-treatment serum AFP-L3% and endpoint (OS and DFS in low AFP concentration HCC patients (HR: 1.96, 95% CI: 1.24-3.10, p = 0.004; HR: 2.53, 95% CI: 1.09-5.89, p = 0.03, respectively. CONCLUSION: The current evidence suggests that high pre-treatment serum AFP-L3% levels indicated a poor prognosis for patients with HCC and AFP-L3% may have significant prognostic value in HCC patients with low AFP concentration.

  6. Prognostic role of pre-treatment serum AFP-L3% in hepatocellular carcinoma: systematic review and meta-analysis.

    Science.gov (United States)

    Cheng, Jiwen; Wang, Wanli; Zhang, Yingjun; Liu, Xi; Li, Muxing; Wu, Zheng; Liu, Zhengwen; Lv, Yi; Wang, Bo

    2014-01-01

    Serum lens culinaris agglutinin-reactive fraction of α-fetoprotein (AFP-L3%) has been widely used for HCC diagnosis and follow-up surveillance as tumor serologic marker. However, the prognostic value of high pre-treatment serum AFP-L3% in patients with hepatocellular carcinoma (HCC) remains controversial. We therefore conduct a meta-analysis to assess the relationship between high pre-treatment serum AFP-L3% and clinical outcome of HCC. Eligible studies were identified through systematic literature searches. A meta-analysis of fifteen studies (4,465 patients) was carried out to evaluate the association between high pre-treatment serum AFP-L3% and overall survival (OS) and disease-free survival (DFS) in HCC patients. Sensitivity and subgroup analyses were also conducted in this meta-analysis. Our analysis results showed that high pre-treatment serum AFP-L3% implied poor OS (HR: 1.65, 95%CI: 1.45-1.89 pAFP-L3% and endpoint (OS and DFS) in low AFP concentration HCC patients (HR: 1.96, 95% CI: 1.24-3.10, p = 0.004; HR: 2.53, 95% CI: 1.09-5.89, p = 0.03, respectively). The current evidence suggests that high pre-treatment serum AFP-L3% levels indicated a poor prognosis for patients with HCC and AFP-L3% may have significant prognostic value in HCC patients with low AFP concentration.

  7. Preparation and In Vitro Evaluation of Antitumor Activity of TGFαL3-SEB as a Ligand-Targeted Superantigen.

    Science.gov (United States)

    Yousefi, Forough; Mousavi, Seyed Fazlollah; Siadat, Seyed Davar; Aslani, Mohammad Mehdi; Amani, Jafar; Rad, Hamid Sedighian; Fooladi, Abbas Ali Imani

    2016-04-01

    Tumor-targeted superantigens (TTSs) have been used to treat a variety of tumors in preclinical studies. The TTS utilizes the powerful T-cell activation strategy by means of staphylococcal enterotoxins (SEs) as superantigens (Sags) to target tumor cells. Monoclonal antibodies and tumor-related ligands have been used as targeting molecules of Sag. In this study, we assessed the antitumor potency of tumor-targeted superantigen (TTS) strategy to design and produce fusion protein as a new antitumor candidate. The third loop (L3) of transforming growth factor α (TGF-α) was genetically conjugated to staphylococcal enterotoxin type B (TGFαL3-SEB), and its in vitro antitumor activity against murine breast cancer cells (A431 cell line) was evaluated. We designed and prepared TGFαL3-SEB chimeric protein and evaluated superantigenic activity, binding property to cancer cells, overexpression of epidermal growth factor receptor (EGFR), and in vitro antitumor activities. Cloning of tgfαl3-seb was confirmed by colony-polymerase chain reaction, enzymatic digestion, and sequencing. The recombinant TGFαL3-SEB fusion protein with molecular weight of 31 kDa was expressed and confirmed by anti-His Western-blot analysis. The TGFαL3-SEB fusion protein attached to A431 cell line with proper affinity and induced dose-dependent cytotoxicity against EGFR-expressing cancer cells in vitro. The TGFαL3-SEB chimeric protein exhibited potent in vitro antitumor activity. Our findings indicated that TGFαL3-SEB may be a promising anticancer candidate in cancer immunotherapy, and further studies are required to explore its potential in vivo therapeutic applications. © The Author(s) 2015.

  8. Activity of Tea Tree (Melaleuca alternifolia Essential Oil against L3 Larvae of Anisakis simplex

    Directory of Open Access Journals (Sweden)

    Carlota Gómez-Rincón

    2014-01-01

    Full Text Available Nematicidal activity of Melaleuca alternifolia essential oil, commonly known as tea tree oil (TTO, was assayed in vitro against L3 larvae of Anisakis simplex. The results showed a mortality of 100% for concentrations between 7 and 10 μL/mL after 48 h of incubation, obtaining an LD50 value of 4.53 μL/mL after 24 hours and 4.27 μL/mL after 48 hours. Concentration-dependent inhibition of acetylcholinesterase was observed for tea tree essential oil showing inhibition values of 100% at 100 μL/mL. This fact suggests that TTO may act as an AChE inhibitor. Terpinen-4-ol was discarded as main larvicide compound as it did not show larvicidal or anticholinesterase activity. The data obtained suggest that the essential oil of Melaleuca alternifolia may have a great therapeutic potential for the treatment of human anisakiasis.

  9. Attitude towards English and ESP acquisition as an L2 or L3 at university

    Directory of Open Access Journals (Sweden)

    Joseba Mikel González Ardeo

    2003-10-01

    Full Text Available Although several researchers have already investigated whether knowing more than one language will help students acquire additional languages (Edwards, 1995; Klein, 1995; Cenoz & Genesse, 1998b, one of the still unexplored areas when considering the difference between bilingualism and trilingualism is that of linguistic behaviour referred to adults (Hoffmann, 1999. The present study reflects on the socio-cultural and sociopolitical situation in the Basque Country and its relationship with performance in English as L2 or L3. Thus, a research was carried out by testing matched groups of Monolingual (Ml (Spanish versus Bilingual (Bl (Basque/Spanish university students, acquiring English for Specific Purposes (ESP within the following fields: Engineering "mechanical branch", Business Administration, and Nursing. Participants were tested on acquisition of specific technical vocabulary from their fields of study, and they were invited to complete a questionnaire on attitudes towards English. The Bls as a whole outperformed slightly the Mls, suggesting that Bls' immediate/academic aims are somewhat more easily achieved but the differences were not statistically significant. As far as their attitudes towards English are concerned, the differences between Mls and Bls were not significant either, both groups showing overall positive attitudes towards English.

  10. Charm and bottom production in two photon collisions at LEP with the L3 detector

    CERN Document Server

    Saremi, S

    2001-01-01

    Inclusive c and b quark production in gamma gamma collisions are studied with the L3 detector at the LEP collider. Data were collected at centre of mass energies from 189 GeV to 202 GeV for a total integrated luminosity of 410 pb/sup -1/. Hadronic final states containing c and b quarks are identified by detecting electrons or muons from their semileptonic decays. The cross section sigma ( gamma gamma to ccX) is measured as a function of the two photon centre of mass energy in the interval 5 GeV

  11. Complete suppression of Pfirsch-Schlueter current in a toroidal l=3 stellarator

    Energy Technology Data Exchange (ETDEWEB)

    Sato, Yasuhiko; Wakatani, Masahiro [Graduate School of Energy Science, Kyoto Univ., Uji, Kyoto (Japan); Yokoyama, Masayuki [National Inst. for Fusion Science, Toki, Gifu (Japan); Pustovitov, V.D. [Russian Research Center, Kurchatov Institute' , Moscow (Russian Federation)

    1999-10-01

    Pfirsch-Schlueter (P-S) current is an inherent property of a finite pressure toroidal equilibrium of tokamak and stellarator. However, it was pointed out recently (V.D. Pustovitov, Nuclear Fusion 36 (1996) 583) that the P-S current would be suppressed completely if the external vertical field could be adjusted to satisfy the condition {omega}=<{omega}> in an l=3 stellarator. Here {omega}=/B{sub 0}{sup 2}-2{epsilon} cos{theta}, l is a pole number, |B tilde| the vacuum helical magnetic field, B{sub 0} the toroidal field, {epsilon} the inverse aspect ratio, {theta} the poloidal angle and <...> denotes the average over the toroidal angle. An example of such a stellarator equilibrium is presented in this paper. For this stellarator equilibrium, behavior of rotational transform and Boozer magnetic spectrum is clarified when the pressure is increased. Both formation of helical magnetic axis and reduction of toroidal curvature are important ingredients to reduce the P-S current. However, the collisionless particle confinement is not improved in this example. (author)

  12. Electronic and phonon excitations in α -RuC l3

    Science.gov (United States)

    Reschke, S.; Mayr, F.; Wang, Zhe; Do, Seung-Hwan; Choi, K.-Y.; Loidl, A.

    2017-10-01

    We report on terahertz (THz), infrared reflectivity, and transmission experiments for wavenumbers from 10 to 8000 c m-1 (˜1 meV -1 eV ) and for temperatures from 5 to 295 K on the Kitaev candidate material α -RuC l3 . As reported earlier, the compound under investigation passes through a first-order structural phase transition, from a monoclinic high-temperature to a rhombohedral low-temperature phase. The phase transition shows an extreme and unusual hysteretic behavior, which extends from 60 to 166 K. In passing this phase transition, in the complete frequency range investigated, we found a significant reflectance change, which amounts to almost a factor of two. We provide a broadband spectrum of dielectric constant, dielectric loss, and optical conductivity from the THz to the mid-infrared regime and study in detail the phonon response and the low-lying electronic density of states. We provide evidence for the onset of an optical energy gap, which is on the order of 200 meV, in good agreement with the gap derived from measurements of the dc electrical resistivity. Remarkably, the onset of the gap exhibits a strong blue shift on increasing temperatures.

  13. Antihelmintic effects of nutmeg (Myristica fragans) on Anisakis simplex L3 larvae obtained from Micromesistius potassou.

    Science.gov (United States)

    López, Víctor; Gerique, Javier; Langa, Elisa; Berzosa, César; Valero, Marta Sofía; Gómez-Rincón, Carlota

    2015-06-01

    Anisakis simplex is a foodborne pathogen that can produce human infections and allergic reactions due to the high consumption of raw fish. The seeds of Myristica fragans (Myristicaceae), popularly known as nutmeg, are worldwide used as a culinary spice due to its flavour and properties in food preservation. A nutmeg extract was prepared, analyzed, screened for cytotoxicity and tested against Anisakis simplex L3 larvae. In order to detect the biologically active constituents of the extract, myristicin was tested on the larvae. An acetylcholinesterase inhibition bioassay was also carried out to investigate the antihelmintic mechanism of action. Our results demonstrate that nutmeg exerts antihelmintic effects on Anisakis simplex, being myristicin one of the active compounds. The extract induced a high rate of dead anisakis at concentrations between 0.5 and 0.7 mg/ml without being considered cytotoxic; however, an inhibition of acetylcholinesterase was discarded as the molecular mechanism involved in the activity. Copyright © 2015 Elsevier Ltd. All rights reserved.

  14. Activity of Tea Tree (Melaleuca alternifolia) Essential Oil against L3 Larvae of Anisakis simplex

    Science.gov (United States)

    Langa, Elisa; Murillo, Paula

    2014-01-01

    Nematicidal activity of Melaleuca alternifolia essential oil, commonly known as tea tree oil (TTO), was assayed in vitro against L3 larvae of Anisakis simplex. The results showed a mortality of 100% for concentrations between 7 and 10 μL/mL after 48 h of incubation, obtaining an LD50 value of 4.53 μL/mL after 24 hours and 4.27 μL/mL after 48 hours. Concentration-dependent inhibition of acetylcholinesterase was observed for tea tree essential oil showing inhibition values of 100% at 100 μL/mL. This fact suggests that TTO may act as an AChE inhibitor. Terpinen-4-ol was discarded as main larvicide compound as it did not show larvicidal or anticholinesterase activity. The data obtained suggest that the essential oil of Melaleuca alternifolia may have a great therapeutic potential for the treatment of human anisakiasis. PMID:24967378

  15. EPB41L3, TSP-1 and RASSF2 as new clinically relevant prognostic biomarkers in diffuse gliomas.

    Science.gov (United States)

    Perez-Janices, N; Blanco-Luquin, I; Tuñón, M T; Barba-Ramos, E; Ibáñez, B; Zazpe-Cenoz, I; Martinez-Aguillo, M; Hernandez, B; Martínez-Lopez, E; Fernández, A F; Mercado, M R; Cabada, T; Escors, D; Megias, D; Guerrero-Setas, D

    2015-01-01

    Hypermethylation of tumor suppressor genes is one of the hallmarks in the progression of brain tumors. Our objectives were to analyze the presence of the hypermethylation of EPB41L3, RASSF2 and TSP-1 genes in 132 diffuse gliomas (astrocytic and oligodendroglial tumors) and in 10 cases of normal brain, and to establish their association with the patients' clinicopathological characteristics. Gene hypermethylation was analyzed by methylation-specific-PCR and confirmed by pyrosequencing (for EPB41L3 and TSP-1) and bisulfite-sequencing (for RASSF2). EPB41L3, RASSF2 and TSP-1 genes were hypermethylated only in tumors (29%, 10.6%, and 50%, respectively), confirming their cancer-specific role. Treatment of cells with the DNA-demethylating-agent 5-aza-2'-deoxycytidine restores their transcription, as confirmed by quantitative-reverse-transcription-PCR and immunofluorescence. Immunohistochemistry for EPB41L3, RASSF2 and TSP-1 was performed to analyze protein expression; p53, ki-67, and CD31 expression and 1p/19q co-deletion were considered to better characterize the tumors. EPB41L3 and TSP-1 hypermethylation was associated with worse (p = 0.047) and better (p = 0.037) prognosis, respectively. This observation was confirmed after adjusting the results for age and tumor grade, the role of TSP-1 being most pronounced in oligodendrogliomas (p = 0.001). We conclude that EPB41L3, RASSF2 and TSP-1 genes are involved in the pathogenesis of diffuse gliomas, and that EPB41L3 and TSP-1 hypermethylation are of prognostic significance.

  16. Screening of the ‘Open Scaffolds’ collection from Compounds Australia identifies a new chemical entity with anthelmintic activities against different developmental stages of the barber's pole worm and other parasitic nematodes

    Directory of Open Access Journals (Sweden)

    Sarah Preston

    2017-12-01

    Full Text Available The discovery and development of novel anthelmintic classes is essential to sustain the control of socioeconomically important parasitic worms of humans and animals. With the aim of offering novel, lead-like scaffolds for drug discovery, Compounds Australia released the ‘Open Scaffolds’ collection containing 33,999 compounds, with extensive information available on the physicochemical properties of these chemicals. In the present study, we screened 14,464 prioritised compounds from the ‘Open Scaffolds’ collection against the exsheathed third-stage larvae (xL3s of Haemonchus contortus using recently developed whole-organism screening assays. We identified a hit compound, called SN00797439, which was shown to reproducibly reduce xL3 motility by ≥ 70%; this compound induced a characteristic, “coiled” xL3 phenotype (IC50 = 3.46–5.93 μM, inhibited motility of fourth-stage larvae (L4s; IC50 = 0.31–12.5 μM and caused considerable cuticular damage to L4s in vitro. When tested on other parasitic nematodes in vitro, SN00797439 was shown to inhibit (IC50 = 3–50 μM adults of Ancylostoma ceylanicum (hookworm and first-stage larvae of Trichuris muris (whipworm and eventually kill (>90% these stages. Furthermore, this compound completely inhibited the motility of female and male adults of Brugia malayi (50–100 μM as well as microfilariae of both B. malayi and Dirofilaria immitis (heartworm. Overall, these results show that SN00797439 acts against genetically (evolutionarily distant parasitic nematodes i.e. H. contortus and A. ceylanicum [strongyloids] vs. B. malayi and D. immitis [filarioids] vs. T. muris [enoplid], and, thus, might offer a novel, lead-like scaffold for the development of a relatively broad-spectrum anthelmintic. Our future work will focus on assessing the activity of SN00797439 against other pathogens that cause neglected

  17. Screening of the 'Open Scaffolds' collection from Compounds Australia identifies a new chemical entity with anthelmintic activities against different developmental stages of the barber's pole worm and other parasitic nematodes.

    Science.gov (United States)

    Preston, Sarah; Jiao, Yaqing; Baell, Jonathan B; Keiser, Jennifer; Crawford, Simon; Koehler, Anson V; Wang, Tao; Simpson, Moana M; Kaplan, Ray M; Cowley, Karla J; Simpson, Kaylene J; Hofmann, Andreas; Jabbar, Abdul; Gasser, Robin B

    2017-12-01

    The discovery and development of novel anthelmintic classes is essential to sustain the control of socioeconomically important parasitic worms of humans and animals. With the aim of offering novel, lead-like scaffolds for drug discovery, Compounds Australia released the 'Open Scaffolds' collection containing 33,999 compounds, with extensive information available on the physicochemical properties of these chemicals. In the present study, we screened 14,464 prioritised compounds from the 'Open Scaffolds' collection against the exsheathed third-stage larvae (xL3s) of Haemonchus contortus using recently developed whole-organism screening assays. We identified a hit compound, called SN00797439, which was shown to reproducibly reduce xL3 motility by ≥ 70%; this compound induced a characteristic, "coiled" xL3 phenotype (IC50 = 3.46-5.93 μM), inhibited motility of fourth-stage larvae (L4s; IC50 = 0.31-12.5 μM) and caused considerable cuticular damage to L4s in vitro. When tested on other parasitic nematodes in vitro, SN00797439 was shown to inhibit (IC50 = 3-50 μM) adults of Ancylostoma ceylanicum (hookworm) and first-stage larvae of Trichuris muris (whipworm) and eventually kill (>90%) these stages. Furthermore, this compound completely inhibited the motility of female and male adults of Brugia malayi (50-100 μM) as well as microfilariae of both B. malayi and Dirofilaria immitis (heartworm). Overall, these results show that SN00797439 acts against genetically (evolutionarily) distant parasitic nematodes i.e. H. contortus and A. ceylanicum [strongyloids] vs. B. malayi and D. immitis [filarioids] vs. T. muris [enoplid], and, thus, might offer a novel, lead-like scaffold for the development of a relatively broad-spectrum anthelmintic. Our future work will focus on assessing the activity of SN00797439 against other pathogens that cause neglected tropical diseases, optimising analogs with improved biological activities and characterising their targets

  18. An N-Terminal Fragment of Yeast Ribosomal Protein L3 Inhibits the Cytotoxicity of Pokeweed Antiviral Protein in Saccharomyces cerevisiae

    Directory of Open Access Journals (Sweden)

    Rong Di

    2014-04-01

    Full Text Available We have previously shown that ribosomal protein L3 is required for pokeweed antiviral protein (PAP, a type I ribosome inactivating protein, to bind to ribosomes and depurinate the α-sarcin/ricin loop (SRL in yeast. Co-expression of the N-terminal 99 amino acids of yeast L3 (L3Δ99 with PAP in transgenic tobacco plants completely abolished the toxicity of PAP. In this study, we investigated the interaction between PAP and L3Δ99 in Saccharomyces cerevisiae. Yeast cells co-transformed with PAP and L3Δ99 showed markedly reduced growth inhibition and reduced rRNA depurination by PAP, compared to cells transformed with PAP alone. Co-transformation of yeast with PAP and L3Δ21 corresponding to the highly conserved N-terminal 21 amino acids of L3Δ99, reduced the cytotoxicity of PAP. PAP mRNA and protein levels were elevated and L3Δ99 or L3Δ21 mRNA and protein levels were reduced in yeast co-transformed with PAP and L3Δ99 or with PAP and L3Δ21, respectively. PAP interacted with L3Δ21 in yeast cells in vivo and by Biacore analysis in vitro, suggesting that the interaction between L3Δ21 and PAP may inhibit PAP-mediated depurination of the SRL, leading to a reduction in the cytotoxicity of PAP.

  19. Diagnostic value of AFP-L3 and PIVKA-II in hepatocellular carcinoma according to total-AFP.

    Science.gov (United States)

    Choi, Jong Young; Jung, Seung Won; Kim, Hee Yeon; Kim, Myungshin; Kim, Yonggoo; Kim, Dong Goo; Oh, Eun-Jee

    2013-01-21

    To evaluate diagnostic value of α-fetoprotein (AFP)-L3 and prothrombin induced by vitamin K absence-II (PIVKA-II) in hepatocellular carcinoma (HCC). One hundred and sixty-eight patients during routine HCC surveillance were included in this study. Of the 168 patients, 90 (53.6%) had HCC including newly developed HCC (n = 82) or recurrent HCC after treatment (n = 8). Sera were obtained during their first evaluation for HCC development and at the time of HCC diagnosis before commencing HCC treatment. HCC was diagnosed by histological examination, appropriate imaging characteristics-computed tomography or magnetic resonance imaging. Control sera were collected from 78 patients with benign liver disease (BLD), which were obtained during routine surveillance with a suspicion of HCC. AFP, AFP-L3 and PIVKA-II were measured in the same serum by microchip capillary electrophoresis and liquid-phase binding assay on a micro-total analysis system Wako i30 auto analyzer. The performance characteristics of three tests and combined tests for the diagnosis of HCC were obtained using receiver operating characteristic curves in all populations and subgroups with AFP AFP AFP 20-200 ng/mL and 32 (35.6%) patients had AFP > 200 ng/mL. Of the 78 BLD patients, 74 (94.9%) patients had AFP AFP-L3 levels were higher in HCC than in BLD among patients with low AFP levels (AFP, AFP-L3, PIVKA-II and the combined markers, respectively. The combined AUC for three markers showed higher value than the AUCs of individual marker (P AFP-L3 had higher AUC value than PIVKA-II for HCC detection in entire patients (P = 0.043). With combination of AFP-L3 (cut-off > 5%) and PIVKA-II (cut-off > 40 AU/L), the sensitivity were 94.4% and specificity were 75.6% in all patients. In 112 patients with low AFP levels (AFP-L3, PIVKA-II and combine AFP-L3 and PIVKA-II tests were 0.824, 0.774 and 0.939, respectively. AFP-L3 with a cut-off value of 5% showed sensitivity of 71.1% and specificity of 83.8%, and PIVKA

  20. Recovery after fracture dislocation of L3/L4 ASIA B: Case report

    Directory of Open Access Journals (Sweden)

    Gustavo Caldera

    2016-02-01

    Full Text Available In fracture dislocations of the lumbar region, two anatomical facts can help preserve neurological damage in patients, when compared with trauma in the cervical or thoracic region. Firstly, the spinal cord in adults extends only to the lower edge of the first lumbar vertebra, and secondly, the large vertebral space in this region gives ample space for the roots of the cauda equine. As a result, the nerve injury may be minimal, because the nerve roots in this region are accommodated in a larger area, with less content and space. This study presents the case of a 48-year-old male, a construction worker, who suffered a fall from a height of approximately 15 meters, directly hitting the lumbar region against a beam, and presenting pain and inability to move the legs. The patient was brought to the emergency room 1 hour after the accident, clinically assessed, submitted to x-rays and a CT scan, and diagnosed as having an ASIA B L3-L4 fracture dislocation. Three hours after the accident, reduction was performed via posterior transpedicular fixation. One week later, an anterior approach was performed. The patient progressed to ASIA C 24 hours after the first surgery. Three months later, the patient was functional with ASIA D and good sphincter control. The author's purpose is to show the results obtained by an intervention in the initial hours of the trauma, which helped promote the evolution from a nonfunctional injury to a functional one, with near-total recovery. Keywords: Spine fracture, Recovery, Neurological deficit, Asia scale, Dislocation

  1. Complete genome sequence of the strain Defluviitoga tunisiensis L3, isolated from a thermophilic, production-scale biogas plant.

    Science.gov (United States)

    Maus, Irena; Cibis, Katharina Gabriela; Wibberg, Daniel; Winkler, Anika; Stolze, Yvonne; König, Helmut; Pühler, Alfred; Schlüter, Andreas

    2015-06-10

    An anaerobic, thermophilic bacterium belonging to the phylum Thermotogae was isolated from a rural, thermophilic biogas plant (54°C) producing methane-rich biogas from maize silage, barley, cattle and pig manure. Here we report the first complete genome sequence of the Defluviitoga tunisiensis strain L3, an isolate from the family Thermotogaceae. The strain L3 encodes several genes predicted to be involved in utilization of a large diversity of complex carbohydrates including cellobiose and xylan for the production of acetate, hydrogen (H2) and carbon dioxide (CO2). The genome sequence of D. tunisiensis L3 provides the basis for biotechnological exploitation of genetic determinants playing an important role in thermophilic fermentation processes utilizing renewable primary products. Copyright © 2015 Elsevier B.V. All rights reserved.

  2. Pyrosequencing Using SL and 5S rRNA as Molecular Markers for Identifying Zoonotic Filarial Nematodes in Blood Samples and Mosquitoes.

    Science.gov (United States)

    Sanpool, Oranuch; Tantrawatpan, Chairat; Thanchomnang, Tongjit; Janwan, Penchom; Intapan, Pewpan M; Rodpai, Rutchanee; Lulitanond, Viraphong; Taweethavonsawat, Piyanan; Maleewong, Wanchai

    2016-05-01

    Lymphatic filariasis is principally caused by Wuchereria bancrofti, and Brugia malayi. The other two filarial nematode species, Brugia pahangi and Dirofilaria immitis, possibly cause human zoonotic diseases. We propose the development of a PCR assay linked with DNA pyrosequencing as a rapid tool to identify W. bancrofti, B. malayi, B. pahangi, and D. immitis in blood samples and mosquitoes. Primers targeting the fragment of the 5S ribosomal RNA and spliced leader sequences were newly designed and developed to identify these four filarial nematodes. Analytical sensitivity and specificity were evaluated. Pyrosequencing determination of nucleotide variations within 36 nucleotides for B. malayi and B. pahangi, and 32 nucleotides for W. bancrofti and D. immitis is sufficient for differentiation of those filarial nematodes, and for detection of intraspecies genetic variation of B. malayi. This analysis could detect a single B. malayi, B. pahangi, W. bancrofti, and D. immitis microfilaria in blood samples. Overall, the PCR-linked pyrosequencing-based method was faster than direct sequencing and less expensive than real-time PCR or direct sequencing. This is the possibility of choice that can be applied in a high-throughput platform for identification and surveillance of reservoirs and vectors infected with lymphatic filaria in endemic areas.

  3. Learning minimally different words in a third language: L2 proficiency as a crucial predictor of accuracy in an L3 word learning task

    NARCIS (Netherlands)

    Simon, E.; Escudero, P.; Broersma, M.; Dziubalska-Kołaczyk, K.; Wrembel, M.; Kul, M.

    2010-01-01

    This study examines the effect of proficiency in the L2 (English) and L3 (Dutch) on word learning in the L3. Learners were 92 L1 Spanish speakers with differing proficiencies in L2 and L3, and 20 native speakers of Dutch. The learners were divided into basic and advanced English and Dutch

  4. Diagnostic value of alpha-fetoprotein-L3 and Golgi protein 73 in hepatocellular carcinomas with low AFP levels.

    Science.gov (United States)

    Xu, Wan-Ju; Guo, Bao-Li; Han, Yu-Gang; Shi, Lei; Ma, Wan-Shan

    2014-12-01

    This study aimed to investigate the clinical values of serum alpha-fetoprotein-L3 (AFP-L3) and Golgi protein 73 (GP73) in the diagnosis of hepatocellular carcinoma (HCC) with low alpha-fetoprotein (AFP). From January 2011 to December 2013, 50 low-AFP HCC patients confirmed by the color Doppler flow imaging (CDFI) and pathological examinations were collected. Forty-five patients with chronic liver diseases were also selected, including 29 liver cirrhosis patients, 15 chronic hepatitis B patients, and one severe hepatitis patient. Furthermore, 100 health volunteers with no evidence of benign or malignant liver diseases were included. The enzyme-linked immunosorbent assay (ELISA) method was applied to the GP73 quantitative assay. Serum AFP concentrations were determined using immunoassays utilizing enhanced chemiluminescence. Diagnostic accuracy of GP73 and AFP-L3 assays for low-AFP HCC was evaluated using receiver operating characteristic (ROC) curve analysis. Statistical analyses were conducted with the GraphPad Prism 5.0 software. Low-AFP HCC patients (35/50) exhibited higher positive rates of AFP-L3 than non-HCC patients (5/45) and healthy controls (2/100) (both P AFP HCC patients (40/50) compared to those of non-HCC patients (3/45) and healthy controls (1/100) (both P AFP-L3 and GP73 were observed between non-HCC patients and healthy controls (both P > 0.05). ROC curves showed that the area under the curve (AUC) of AFP-L3 for the diagnosis of low-AFP HCC was 0.6994 (sensitivity [Sen] = 70.0 %, specificity [Spe] = 95.2 %, accuracy = 88.7 %), while the AUC of GP73 was 0.8411 (Sen = 80.0 %, Spe = 97.2 %, accuracy = 92.8 %). Compared with single detection, the combination of AFP-L3 and GP73 levels for the diagnosis of low-AFP HCC showed higher Sen (94.0 %), Spe (93.1 %), and better accuracy (93.3 %). Our findings provide empirical evidence that the combination of AFP-L3 and GP73 is a good diagnostic strategy for low-AFP HCC.

  5. Kazuistika fyzioterapeutické péče o pacienta po disektomii L3/L4

    OpenAIRE

    Patríková, Jitka

    2012-01-01

    Case Study of physioterapy treatment of a patient after L3/L4 disectomy Objectives: The aim of the bachelor thesis is to create a complex perspective on a problem of herniated disc, on the course of disectomy and to propose following physiotherapy treatment after disectomy L3/L4. Methods: The thesis is divided into two parts. The first part proposes the possibilities of the examination and the treatment of the herniated disc. The second part focuses on the individual case report about a patie...

  6. MODIS/Terra Land Surface Temperature/3-Band Emissivity 8-Day L3 Global 1km SIN Grid V006

    Data.gov (United States)

    National Aeronautics and Space Administration — MODIS/Terra Land Surface Temperature/3-Band Emissivity 8-Day L3 Global 1km SIN Grid (MOD21A2.006). A new suite of MODIS Land Surface Temperature (LST) and Emissivity...

  7. MODIS/Aqua Land Surface Temperature/3-Band Emissivity 8-Day L3 Global 1km SIN Grid V006

    Data.gov (United States)

    National Aeronautics and Space Administration — MODIS/Aqua Land Surface Temperature/3-Band Emissivity 8-Day L3 Global 1km SIN Grid (MYD21A2.006). A new suite of MODIS Land Surface Temperature (LST) and Emissivity...

  8. LNO3 AND L3 Are Associated With Antiproliferative And Pro-Apoptotic Action In Hepatoma Cells

    Directory of Open Access Journals (Sweden)

    Leonardo Campos Zanelatto

    2016-06-01

    Full Text Available Abstract The identification of antitumoral substances is the focus of intense biomedical research. Two structural analogues of thalidomide, LNO3 and L3, are two synthetic compounds that might possess such antitumor properties. We evaluated the toxicological effects of these substances, including cytotoxicity, genotoxicity and induction of apoptosis in HTC cells. Additionally, the production of free radicals (nitric oxide and superoxide was investigated, and the expression of caspases genes 3, 8, and 9 were determined by RT-qPCR. The compounds exhibited cytotoxic effects that resulted in inhibited cell proliferation. LNO3 showed to be more effective and toxic than L3 in all assays. LNO3 stimulated the release of NO and superoxide, which was accompanied by the formation of peroxynitrite. Apoptosis was induced in a dose-dependent manner by both compounds; however, the expression of caspases 3, 8 and 9 was unchanged. These results suggested that L3 and LNO3 possess antiproliferative and pro-apoptotic effects in HTC cells. Additionally, although they exhibited cytotoxicity, L3 and LNO3 might be useful coadjuvants in tumor treatment studies.

  9. The HADHSC gene encoding short-chain L-3-hydroxyacyl-CoA dehydrogenase (SCHAD) and type 2 diabetes susceptibility

    DEFF Research Database (Denmark)

    van Hove, Els C; Hansen, Torben; Dekker, Jacqueline M

    2006-01-01

    The short-chain l-3-hydroxyacyl-CoA dehydrogenase (SCHAD) protein is involved in the penultimate step of mitochondrial fatty acid oxidation. Previously, it has been shown that mutations in the corresponding gene (HADHSC) are associated with hyperinsulinism in infancy. The presumed function...

  10. MODIS/Terra Land Surface Temperature/Emissivity Daily L3 Global 0.05Deg CMG V005

    Data.gov (United States)

    National Aeronautics and Space Administration — The MODIS/Terra V5 LST/E L3 Global CMG (Short name: MOD11C1) products incorporate 0.05º (5600 meters at the equator) pixels, which are derived from the MOD11B1 daily...

  11. MODIS/Aqua Land Surface Temperature/Emissivity Daily L3 Global 6km SIN Grid V005

    Data.gov (United States)

    National Aeronautics and Space Administration — The MODIS/Aqua LST/E L3 Global 1 km Grid (Short name: MYD11B1) products incorporate 6 km pixels (4.63 km pixels for versions prior to V005), which are produced daily...

  12. AVHRR Pathfinder version 5.3 level 3 collated (L3C) global 4km sea surface temperature

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The AVHRR Pathfinder Version 5.3 (PFV53) L3C Sea Surface Temperature data set is a collection of global, twice-daily (Day and Night) 4km sea surface temperature...

  13. Feasibility of tumor imaging using L-3-[iodine-123]-iodo-alpha-methyl-tyrosine in extracranial tumors

    NARCIS (Netherlands)

    Jager, PL; Franssen, EJF; Kool, W; Szabo, BG; Hoekstra, HJ; Groen, HJM; de Vries, EGE; van Imhoff, GW; Vaalburg, W; Piers, DA

    1998-01-01

    L-3-[I-123]-lodo-alpha-methyl-tyrosine (IMT) is a modified amino acid. It is reported to be avidly taken up in brain tumors, reflecting amino acid transport and is suitable for SPECT. Methods: To determine whether tumors outside the brain can also accumulate this tracer, we injected 300-450 MBq IMT

  14. Effect of electrical stimulation of hamstrings and L3/4 dermatome on gait in spinal cord injury

    NARCIS (Netherlands)

    van der Salm, Arjan; Veltink, Petrus H.; Hermens, Hermanus J.; Nene, A.V.; IJzerman, Maarten Joost

    2006-01-01

    Objective. To determine the effect of electrical stimulation of hamstrings and L3/4 dermatome on the swing phase of gait. Materials and Methods. Five subjects with incomplete spinal cord injury (SCI) with spasticity were included. Two electrical stimulation methods were investigated, i.e.,

  15. Examining Teachers' Views on the Implementation of English as L3 into Primary Schools: A Case of Kazakhstan

    Science.gov (United States)

    Zhetpisbayeva, Bakhytgul A.; Shelestova, Tatyana Y.; Abildina, Saltanat K.

    2016-01-01

    The Ministry of Education and Science of the Republic of Kazakhstan changed the State Educational Program for primary education and the curriculum for teaching English as a third language (L3) to grades 1-4 in 2013. As with many changes in the curriculum, English language teaching has also been changed and the starting age for learning of English…

  16. MODIS/Aqua Land Surface Temperature/Emissivity Monthly L3 Global 0.05Deg CMG V005

    Data.gov (United States)

    National Aeronautics and Space Administration — The MODIS/Aqua LST/E Monthly L3 Global CMG product (Short name: MYD11C3) is a monthly composited average, derived from the MYD11C1 daily global product, and stored...

  17. MODIS/Aqua Land Surface Temperature/Emissivity Daily L3 Global 1km SIN Grid V005

    Data.gov (United States)

    National Aeronautics and Space Administration — The MODIS/Aqua LST/E L3 Global 1 Km Grid (Short name: MYD11A1) products incorporate 1-km pixels, which are produced daily using the generalized split-window LST...

  18. MODIS/Terra Land Surface Temperature/Emissivity Daily L3 Global 6km SIN Grid V005

    Data.gov (United States)

    National Aeronautics and Space Administration — The MODIS/Terra V5 LST/E L3 Global 1 Km Grid (Short name: MOD11B1) products incorporate 6 km pixels, which are produced daily using the day/night LST algorithm (Wan...

  19. MODIS/Aqua Land Surface Temperature/Emissivity Daily L3 Global 0.05Deg CMG V041

    Data.gov (United States)

    National Aeronautics and Space Administration — The MODIS/Aqua V41 LST/E L3 Global CMG (Short name: MYD11C1) products incorporate 0.05º (5600 meters at the equator) pixels, which are derived from the MOD11B1 daily...

  20. Usefulness of AFP, AFP-L3, and PIVKA-II, and their combinations in diagnosing hepatocellular carcinoma.

    Science.gov (United States)

    Park, Sang Joon; Jang, Jae Young; Jeong, Soung Won; Cho, Young Kyu; Lee, Sae Hwan; Kim, Sang Gyune; Cha, Sang-Woo; Kim, Young Seok; Cho, Young Deok; Kim, Hong Soo; Kim, Boo Sung; Park, Suyeon; Bang, Hae In

    2017-03-01

    Alpha-fetoprotein (AFP), Lens culinaris-agglutinin-reactive fraction of AFP (AFP-L3), and protein induced by vitamin K absence or antagonist-II (PIVKA-II) are widely used as tumor markers for the diagnosis of hepatocellular carcinoma (HCC). This study compared the diagnostic values of AFP, AFP-L3, and PIVKA-II individually and in combination to find the best biomarker or biomarker panel.Seventy-nine patients with newly diagnosed HCC and 77 non-HCC control patients with liver cirrhosis were enrolled. AFP, AFP-L3, and PIVKA-II were measured in the same serum samples using microchip capillary electrophoresis and a liquid-phase binding assay on an automatic analyzer. Receiver-operating characteristic curve analyses were also applied to all combinations of the markers.When the 3 biomarkers were analyzed individually, AFP showed the largest area under the receiver-operating characteristic curve (AUC) (0.751). For combinations of the biomarkers, the AUC was highest (0.765) for "PIVKA-II > 40 mAU/mL and AFP > 10 ng/mL." The combination of "PIVKA-II > 40 mAU/mL and AFP > 10 ng/mL and AFP-L3 > 10%" had worse sensitivity and lower AUC (P = 0.001). The highest AUC of a single biomarker was highest for AFP and of a combination was "PIVKA-II > 40 mAU/mL and AFP > 10 ng/mL," with this also being the case when the cut-off value of AFP and AFP-L3 was changed.Alpha-fetoprotein showed the best diagnostic performance as a single biomarker for HCC. The diagnostic value of AFP was improved by combining it with PIVKA-II, but adding AFP-L3 did not contribute to the ability to distinguish between HCC and non-HCC liver cirrhosis. These findings were not altered when the cut-off value of AFP and AFP-L3 was changed.

  1. L(3,2,1- and L(4,3,2,1-labeling problems on interval graphs

    Directory of Open Access Journals (Sweden)

    Sk Amanathulla

    2017-12-01

    Full Text Available For a given graph G=(V,E, the L(3,2,1- and L(4,3,2,1-labeling problems assign the labels to the vertices of G. Let Z∗ be the set of non-negative integers. An L(3,2,1- and L(4,3,2,1-labeling of a graph G is a function f:V→Z∗ such that |f(x−f(y|≥k−d(x,y, for k=4,5 respectively, where d(x,y represents the distance (minimum number of edges between the vertices x and y, and 1≤d(x,y≤k−1. The L(3,2,1- and L(4,3,2,1-labeling numbers of a graph G, are denoted by λ3,2,1(G and λ4,3,2,1(G and they are the difference between highest and lowest labels used in L(3,2,1- and L(4,3,2,1-labeling respectively. In this paper, for an interval graph G, it is shown that λ3,2,1(G≤6Δ−3 and λ4,3,2,1(G≤10Δ−6, where Δ represents the maximum degree of the vertices of G. Also, two algorithms are designed to label an interval graph by maintaining L(3,2,1- and L(4,3,2,1-labeling conditions. The time complexities of both the algorithms are O(nΔ2, where n represent the number of vertices of G.

  2. Accuracy of manual palpation vs ultrasound for identifying the L3-L4 intervertebral space level in children.

    Science.gov (United States)

    Hayes, Jason; Borges, Bruno; Armstrong, Derek; Srinivasan, Ilavajady

    2014-05-01

    Insertion of needles into the spinal or epidural space is an important component of modern anesthetic practice. Needles are usually inserted at or below the L3-L4 intervertebral space to minimize the risk of spinal cord injury. Manual palpation is the most common method for identifying intervertebral spaces. However, anesthesiologists are increasingly using ultrasonography to guide the placement of regional, including neuraxial, anesthetic, and analgesic blocks. We undertook an observational study to compare the accuracy of manual palpation and ultrasound for determining the L3-L4 intervertebral space level. Thirty children 0-12 years of age undergoing lumbar puncture were enrolled. For each subject, an anesthesiologist, using the landmark palpation method, determined the point on a radio-opaque ruler that corresponded to the L3-L4 intervertebral space. A different anesthesiologist using the ultrasound method repeated this measurement. Fluoroscopy was then used to confirm the accuracy of each technique. The proportion of inaccurate measurements and the effects of anesthesiologists' experience, patient age, and size on the accuracy of each technique were compared. Thirty-seven percent of measurements by the landmark palpation method were inaccurate by ≥1 levels cephalad to the L3-L4 intervertebral space. However, less experienced anesthesiologists (residents and fellows) made a disproportionate number of inaccurate measurements compared to consultants. Twenty-three percent of measurements by the ultrasound method were inaccurate by ≥1 cephalad levels. The BMI-for-age percentile/weight-for-length percentile was higher in patients in whom either technique was inaccurate. This observational study found no difference in the accuracy of landmark palpation, when performed by a consultant anesthesiologist, and ultrasound for determining the L3-L4 intervertebral space in children. © 2014 John Wiley & Sons Ltd.

  3. Utilization of computer processed high definition video imaging for measuring motility of microscopic nematode stages on a quantitative scale: “The Worminator”

    Science.gov (United States)

    Storey, Bob; Marcellino, Chris; Miller, Melissa; Maclean, Mary; Mostafa, Eman; Howell, Sue; Sakanari, Judy; Wolstenholme, Adrian; Kaplan, Ray

    2014-01-01

    A major hindrance to evaluating nematode populations for anthelmintic resistance, as well as for screening existing drugs, new compounds, or bioactive plant extracts for anthelmintic properties, is the lack of an efficient, objective, and reproducible in vitro assay that is adaptable to multiple life stages and parasite genera. To address this need we have developed the “Worminator” system, which objectively and quantitatively measures the motility of microscopic stages of parasitic nematodes. The system is built around the computer application “WormAssay”, developed at the Center for Discovery and Innovation in Parasitic Diseases at the University of California, San Francisco. WormAssay was designed to assess motility of macroscopic parasites for the purpose of high throughput screening of potential anthelmintic compounds, utilizing high definition video as an input to assess motion of adult stage (macroscopic) parasites (e.g. Brugia malayi). We adapted this assay for use with microscopic parasites by modifying the software to support a full frame analysis mode that applies the motion algorithm to the entire video frame. Thus, the motility of all parasites in a given well are recorded and measured simultaneously. Assays performed on third-stage larvae (L3) of the bovine intestinal nematode Cooperia spp., as well as microfilariae (mf) of the filarioid nematodes B. malayi and Dirofilaria immitis, yielded reproducible dose responses using the macrocyclic lactones ivermectin, doramectin, and moxidectin, as well as the nicotinic agonists, pyrantel, oxantel, morantel, and tribendimidine. This new computer based-assay is simple to use, requires minimal new investment in equipment, is robust across nematode genera and developmental stage, and does not require subjective scoring of motility by an observer. Thus, the “Worminator” provides a relatively low-cost platform for developing genera- and stage-specific assays with high efficiency and reproducibility, low

  4. Utilization of computer processed high definition video imaging for measuring motility of microscopic nematode stages on a quantitative scale: “The Worminator”

    Directory of Open Access Journals (Sweden)

    Bob Storey

    2014-12-01

    Full Text Available A major hindrance to evaluating nematode populations for anthelmintic resistance, as well as for screening existing drugs, new compounds, or bioactive plant extracts for anthelmintic properties, is the lack of an efficient, objective, and reproducible in vitro assay that is adaptable to multiple life stages and parasite genera. To address this need we have developed the “Worminator” system, which objectively and quantitatively measures the motility of microscopic stages of parasitic nematodes. The system is built around the computer application “WormAssay”, developed at the Center for Discovery and Innovation in Parasitic Diseases at the University of California, San Francisco. WormAssay was designed to assess motility of macroscopic parasites for the purpose of high throughput screening of potential anthelmintic compounds, utilizing high definition video as an input to assess motion of adult stage (macroscopic parasites (e.g. Brugia malayi. We adapted this assay for use with microscopic parasites by modifying the software to support a full frame analysis mode that applies the motion algorithm to the entire video frame. Thus, the motility of all parasites in a given well are recorded and measured simultaneously. Assays performed on third-stage larvae (L3 of the bovine intestinal nematode Cooperia spp., as well as microfilariae (mf of the filarioid nematodes B. malayi and Dirofilaria immitis, yielded reproducible dose responses using the macrocyclic lactones ivermectin, doramectin, and moxidectin, as well as the nicotinic agonists, pyrantel, oxantel, morantel, and tribendimidine. This new computer based-assay is simple to use, requires minimal new investment in equipment, is robust across nematode genera and developmental stage, and does not require subjective scoring of motility by an observer. Thus, the “Worminator” provides a relatively low-cost platform for developing genera- and stage-specific assays with high efficiency and

  5. A Distinctive Silica-Rich, Sodium-Poor Igneous Clast in the Bovedy (L3) Chondrite

    Science.gov (United States)

    Ruzicka, A.; Boynton, W. V.

    1992-07-01

    Description of Bo-1. One slab of the Bovedy (L3) chondrite contains a large (~ 4 x 7 mm) white object that in hand specimen resembles the generally chondritic lithic fragment studied by Rubin et al. (1981). However, SEM, and EMPA studies of this object, designated Bo-1, reveal an unusually Si-rich, Na-poor bulk composition that is manifested by the presence of a silica mineral, the complete absence of olivine, and feldspar that is less sodic than usual for ordinary chondrites. The clast is a highly crystalline igneous rock and exhibits a well-defined crystallization sequence. Orthopyroxene (opx) comprises 83.8 vol% of Bo-1 and is zoned from En(sub)92-85 Wo(sub)0.1-0.2 to En(sub)74 Wo(sub)1.9-2.9. The more magnesian, less calcic opx was the first phase to crystallize in Bo-1. A silica mineral (SiO2, 6.2 vol%), probably either tridymite or cristobalite, crystallized next and appears slightly "corroded" (and veined) by clinopyroxene, suggesting minor reaction between the silica mineral and its surroundings. A small amount (1 vol%) of euhedral-subhedral pigeonite (pig) also crystallized about this time. Plagioclase (plag) was the last phase to join the crystallization sequence and consists of a fine-scale, often lamellar, intergrowth of bytownite-labradorite (5.8 vol%, mainly An(sub)70- 75Or(sub)1-03) and oligoclase (3.1 vol%, mainly An(sub)15-24 Or(sub)13-6). The latter deviates from feldspar stoichiometry and may be partly amorphous. Volumetrically insignificant augite (aug) occurs as (exsolution?) patches within opx, as thin veinlets crossing SiO(sub)2 grains, and as thin rims at the interface of SiO(sub)2 and plag. The rimming and veining aug may have crystallized together with plag from the last liquid in the rock. Minor chromite (0.2 vol%) and trace metal and sulfide are also present. Bulk composition of Bo-1. The composition of the clast was determined by combining SEM modal data with EMPA data for each phase. The calculated composition (in wt%) is: SiO2, 57

  6. ASPEK ZOONOTIK PARASIT NEMATODA PADA KERA DAN BINATANG MENGERAT DI BENGKULU, SUMATERA. INDONESIA

    Directory of Open Access Journals (Sweden)

    Untung S.

    2012-09-01

    Full Text Available Twentyfive monkeys and 481 rats were examined for parasitic nematodes in Bengkulu, nine species of nematode were found infecting these animals. Five of filarían nematodes, i.e. Brugia malayi, Brugia pahangi, Dirofilaria magnilarvatum and Edesonfilaria malayensis were infecting monkeys and one speciesTBreinlia booliati, was found infecting rats. Three species of gastrointestinal helminths, i.e. Trichuris trichiura, Enterobius vermicularis and Oestophagomomum spp were found in monkeys; a lung worm, Angiostrongylus cantonensis, was found in rats. The most important nematode species is B. malayi, which was found in Presbytis cristatus (36.8 % and in Macaca fascicularis (20.0 %. T. trichiura was found in R. cristatus (47.9 % and A. cantonensis in Rattus argentiventer (4.0 % and Rattus tiomanicus (2.9%.

  7. Dicty_cDB: SHI783 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DV318303 |DV318303.1 NABNX32TF Aedes aegypti infected with Brugia Malayi Aedes aegypti cDNA clone NABNX32...DV311931 |DV311931.1 NABOR34TF Aedes aegypti infected with Brugia Malayi Aedes aegypti cDNA clone NABOR34...DV288069 |DV288069.1 NAAHW80TF Aedes aegypti - Fat Bodies Normalized (NAFFB2) Aedes aegypti cDNA clone NAAHW80...DV284077 |DV284077.1 NAAG583TR Aedes aegypti - Fat Bodies Normalized (NAFFB2) Aedes aegypti cDNA clone NAAG583...DV284076 |DV284076.1 NAAG583TF Aedes aegypti - Fat Bodies Normalized (NAFFB2) Aedes aegypti cDNA clone NAAG583

  8. Dicty_cDB: SHB633 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |DV320266.1 NABRB33TF Aedes aegypti infected with Plasmodium gallinaceum Aedes aegypti cDNA clone NABRB33...|DV427212.1 NADX646TF Aedes aegypti infected with Dengue virus Pool library Aedes aegypti cDNA clone NADX646...DV314546 |DV314546.1 NABOO34TF Aedes aegypti infected with Brugia Malayi Aedes aegypti cDNA clone NABOO34...|DV396885.1 NADE310TR Aedes aegypti infected with Dengue virus Pool library Aedes aegypti cDNA clone NADE310...DV312022 |DV312022.1 NABOR89TRB Aedes aegypti infected with Brugia Malayi Aedes aegypti cDNA clone NABOR89

  9. Combined Effect of the Cfr Methyltransferase and Ribosomal Protein L3 Mutations on Resistance to Ribosome-Targeting Antibiotics

    DEFF Research Database (Denmark)

    Pakula, Kevin K; Hansen, Lykke H; Vester, Birte

    2017-01-01

    Several groups of antibiotics inhibit bacterial growth by binding to bacterial ribosomes. Mutations in ribosomal protein L3 have been associated with resistance to linezolid and tiamulin, which both bind at the peptidyl transferase center in the ribosome. Resistance to these and other antibiotics...... also occurs through methylation of 23S rRNA at position A2503 by the methyltransferase Cfr. The mutations in L3 and the cfr gene have been found together in clinical isolates, raising the question of whether they have a combined effect on antibiotic resistance or growth. We transformed a plasmid...... seen. This study underscores the complex interplay between various resistance mechanisms and cross-resistance, even from antibiotics with overlapping binding sites....

  10. Microcell-mediated chromosome transfer identifies EPB41L3 as a functional suppressor of epithelial ovarian cancers

    DEFF Research Database (Denmark)

    Dafou, Dimitra; Grun, Barbara; Sinclair, John

    2010-01-01

    We used a functional complementation approach to identify tumor-suppressor genes and putative therapeutic targets for ovarian cancer. Microcell-mediated transfer of chromosome 18 in the ovarian cancer cell line TOV21G induced in vitro and in vivo neoplastic suppression. Gene expression microarray...... profiling in TOV21G(+18) hybrids identified 14 candidate genes on chromosome 18 that were significantly overexpressed and therefore associated with neoplastic suppression. Further analysis of messenger RNA and protein expression for these genes in additional ovarian cancer cell lines indicated that EPB41L3...... (erythrocyte membrane protein band 4.1-like 3, alternative names DAL-1 and 4.1B) was a candidate ovarian cancer-suppressor gene. Immunoblot analysis showed that EPB41L3 was activated in TOV21G(+18) hybrids, expressed in normal ovarian epithelial cell lines, but was absent in 15 (78%) of 19 ovarian cancer cell...

  11. The design and construction of a double-sided Silicon Microvertex Detector for the L3 experiment at CERN

    Energy Technology Data Exchange (ETDEWEB)

    Adam, A. [Technical Univ., Budapest (Hungary). Physical Inst.; Ahlen, S.; Marin, A.; Zhou, B. [Boston Univ., MA (United States); Ambrosi, G.; Babucci, E.; Bertucci, B.; Biasini, M.; Bilei, G.M.; Caria, M.; Checcucci, B.; Easo, S.; Fiandrini, E.; Krastev, V.R.; Massetti, R.; Pauluzzi, M.; Santocchia, A.; Servoli, L. [INFN/Universita di Perugia (Italy); Baschirotto, A.; Bosetti, M.; Pensotti, S.; Rancoita, P.G.; Rattaggi, M.; Terzi, G. [INFN/Universita di Milano (Italy); Battiston, R. [CERN, Geneva (Switzerland)]|[INFN/Universita di Perugia (Italy); Bay, A.; Burger, W.J.; Extermann, P.; Perrin, E.; Susinno, G.F. [Univ. of Geneva (Switzerland); Bencze, G.Y.L.; Kornis, J.; Toth, J. [KFKI/Research Inst. for Particle and Nuclear Physics, Budapest (Hungary); Bobbink, G.J.; Duinker, P. [NIKHEF, Amsterdam (Netherlands); Brooks, M.L.; Coan, T.E.; Kapustinsky, J.S.; Kinnison, W.W.; Lee, D.M.; Mills, G.B.; Thompson, T.C. [Los Alamos National Lab., NM (United States); Busenitz, J.; DiBitonto, D. [Univ. of Alabama, Tuscaloosa, AL (United States); Camps, C.; Commichau, V.; Hangartner, K.; Schmitz, P. [RWTH, Aachen (Germany). 3. Physikalisches Institut; Castellini, G. [INFN/IROE, Firenze (Italy); Chen, A.; Hou, S.; Lin, W.T. [NCU, Chung/Li (Taiwan, Province of China); Gougas, A.; Kim, D.; Paul, T. [Johns Hopkins Univ., Baltimore, MD (United States); Hauviller, C.; Herve, A.; Josa, I. [CERN, Geneva (Switzerland); Landi, G. [INFN/Universita di Firenze (Italy); Lebeau, M. [LAPP, Annecy (France); Lecomte, P.; Viertel, G.M.; Waldmeier, S. [ETH Zurich (Switzerland); Leiste, R. [CERN, Geneva (Switzerland)]|[DESY-IFH, Zeuthen (Germany); Lejeune, E.; Weill, R. [Univ. of Lausanne (Switzerland); Lohmann, W.; Nowak, H.; Sachwitz, M.; Schoeniech, B.; Tonisch, F.; Trowitzsch, G.; Vogt, H. [DESY-IFH, Zeuthen (Germany); Passaleva, G. [INFN/Universita di Firenze (Italy)]|[INFN/Universita di Perugia (Italy); Yeh, S.C. [National Tsing Hua Univ., Hsinchu (Taiwan)

    1993-12-01

    A Silicon Microvertex Detector (SMD) has been commissioned for the L3 experiment at the Large Electron-Positron colliding-beam accelerator (LEP) at the European Center for Nuclear Physics, (CERN). The SMD is a 72,672 channel, two layer barrel tracker that is comprised of 96 ac-coupled, double-sided silicon detectors. Details of the design and construction are presented.

  12. Pig heart short chain L-3-hydroxyacyl-CoA dehydrogenase revisited: sequence analysis and crystal structure determination.

    OpenAIRE

    Barycki, J. J.; O'Brien, L. K.; Birktoft, J. J.; Strauss, A. W.; Banaszak, L. J.

    1999-01-01

    Short chain L-3-hydroxyacyl CoA dehydrogenase (SCHAD) is a soluble dimeric enzyme critical for oxidative metabolism of fatty acids. Its primary sequence has been reported to be conserved across numerous tissues and species with the notable exception of the pig heart homologue. Preliminary efforts to solve the crystal structure of the dimeric pig heart SCHAD suggested the unprecedented occurrence of three enzyme subunits within the asymmetric unit, a phenomenon that was thought to have hampere...

  13. Final Pre-40S Maturation Depends on the Functional Integrity of the 60S Subunit Ribosomal Protein L3

    Science.gov (United States)

    García-Gómez, Juan J.; Rosado, Iván V.; Tollervey, David; Kressler, Dieter; de la Cruz, Jesús

    2014-01-01

    Ribosomal protein L3 is an evolutionarily conserved protein that participates in the assembly of early pre-60S particles. We report that the rpl3[W255C] allele, which affects the affinity and function of translation elongation factors, impairs cytoplasmic maturation of 20S pre-rRNA. This was not seen for other mutations in or depletion of L3 or other 60S ribosomal proteins. Surprisingly, pre-40S particles containing 20S pre-rRNA form translation-competent 80S ribosomes, and translation inhibition partially suppresses 20S pre-rRNA accumulation. The GTP-dependent translation initiation factor Fun12 (yeast eIF5B) shows similar in vivo binding to ribosomal particles from wild-type and rpl3[W255C] cells. However, the GTPase activity of eIF5B failed to stimulate processing of 20S pre-rRNA when assayed with ribosomal particles purified from rpl3[W255C] cells. We conclude that L3 plays an important role in the function of eIF5B in stimulating 3′ end processing of 18S rRNA in the context of 80S ribosomes that have not yet engaged in translation. These findings indicate that the correct conformation of the GTPase activation region is assessed in a quality control step during maturation of cytoplasmic pre-ribosomal particles. PMID:24603549

  14. Improved BM212 MmpL3 inhibitor analogue shows efficacy in acute murine model of tuberculosis infection.

    Directory of Open Access Journals (Sweden)

    Giovanna Poce

    Full Text Available 1,5-Diphenyl pyrroles were previously identified as a class of compounds endowed with high in vitro efficacy against M. tuberculosis. To improve the physical chemical properties and drug-like parameters of this class of compounds, a medicinal chemistry effort was undertaken. By selecting the optimal substitution patterns for the phenyl rings at N1 and C5 and by replacing the thiomorpholine moiety with a morpholine one, a new series of compounds was produced. The replacement of the sulfur with oxygen gave compounds with lower lipophilicity and improved in vitro microsomal stability. Moreover, since the parent compound of this family has been shown to target MmpL3, mycobacterial mutants resistant to two compounds have been isolated and characterized by sequencing the mmpL3 gene; all the mutants showed point mutations in this gene. The best compound identified to date was progressed to dose-response studies in an acute murine TB infection model. The resulting ED(99 of 49 mg/Kg is within the range of commonly employed tuberculosis drugs, demonstrating the potential of this chemical series. The in vitro and in vivo target validation evidence presented here adds further weight to MmpL3 as a druggable target of interest for anti-tubercular drug discovery.

  15. The Role of Drosophila Merlin in the Control of Mitosis Exit and Development

    Science.gov (United States)

    2008-07-01

    genome.wus erm-like Brugia malayi merlin-like 316.m00022 http://www.tigr.or Schistosoma japonicum JF2 AAB49033 http://www.nhm.a Taenia saginata myosin-like...value of 100. Although the ERM-like proteins have been identified in Taenia saginata , Schistosoma japonicum, Echinococcus granu- losus, and...like proteins of parasites Taenia saginata , Echinococcus granulo- sus, and Echinococcus multilocularis contain an Arg76 resi- due, which is also a basic

  16. Short Course, High Dose Rifampicin Achieves Wolbachia Depletion Predictive of Curative Outcomes in Preclinical Models of Lymphatic\\ud Filariasis and Onchocerciasis

    OpenAIRE

    Aljayyoussi, Ghaith; Tyrer, Hayley; Ford, Louise; Sjoberg, Hanna; Pionnier, Nicolas; Waterhouse, David; Davies, Jill; Gamble, Joanne; Metugene, Haelly; Cook, Darren A. N.; Steven, Andrew; Sharma, Raman; Guimaraes, Ana F.; Clare, Rachel H.; Cassidy, Andrew

    2017-01-01

    Lymphatic filariasis (LF) and onchocerciasis are priority neglected tropical diseases targeted for elimination. The only safe drug treatment with substantial curative activity against the filarial nematodes responsible for LF (Brugia malayi, Wuchereria bancrofti) or onchocerciasis (Onchocerca volvulus) is doxycycline. The target of doxycycline is the essential endosymbiont, Wolbachia. Four to six weeks doxycycline therapy achieves >90% depletion of Wolbachia in worm tissues leading to blockad...

  17. [The studies on early warning of Lens culinaris-reactive alpha-Fetoprotein (AFP-L3) detecting in primary hepatocellular carcinoma].

    Science.gov (United States)

    Li, Yong-li; Ma, Hong-bin; Guo, Jing-xia; Shi, Jia-bin; Xu, Jun; Liu, Ai-xia; Yang, Li-hua; Li, Bo-an; Mao, Yuan-li

    2008-10-01

    To explore the significance of Lens culinaris-reactive alpha-Fetoprotein (AFP-L3) detection in primary hepatocellular carcinoma. AFP-L3 was isolated by using microspin column coupled with lens culinaris agglutinin (LCA), AFP and AFP-L3 were detected with chemiluminescent immunoassay, the proportion of AFP L3 levels were calculated, and the relationship between the elevated AFP-L3 (%) levels and benign and malignant liver disease was analyzed. There were significant differences in positive rate between the patients of HCC, suspected HCC and other liver disease (81.80%, 73.68%, 11.80%, respectively, P < 0.05). Among the undetermined HCC (suspected HCC, liver disease) patients, 12 out of 21 cases of AFP-13 positive were diagnosed to be HCC within 6 months, and 6 of them were diagnosed to be the single small HCC at the early stage through B-Ultrasonic Diagnosis or CT. Among 62 cases of AFP-L3 negative, 3 cases were diagnosed to be HCC within 6 months and the risk of occurrence of HCC for AFP-L3 positive increased 11.9 times. AFP-L3 has no correlation with AFP value, and it can be used as an independent HCC diagnosis factor. The detection of AFP-L3 has a significant implication for the identification of benign or malignant liver disease and the early stage predictive diagnosis of HCC while AFP increases.

  18. Search for supersymmetry in 2 different topologies with the L3 detector at Lep; Recherche de supersymetrie dans les canaux avec un ou deux leptons avec le detecteur L3 a LEP

    Energy Technology Data Exchange (ETDEWEB)

    Balandras, A

    2000-11-13

    The present thesis presents two different aspects of my work in the L3 experiment, which are on one side the search for supersymmetric particles, the scalar leptons, in two different topologies 'electron + X + E' and '2 leptons + 2 photons + E', each of them being related to two theoretical SUSY models, m-SUGRA and GMSB. On the other side my work has been completed by the study of the BGO crystal electromagnetic calorimeter of L3, and the calibration of the electromagnetic calorimeter EGAP. After the essential motivations being reviewed, the production and disintegration modes are detailed concerning the scalar lepton sector at LEP. Then one presents the analysis techniques which I used to perform my selection, and also the results obtained from the data collected by L3 for center of mass energies between {radical} S =183 GeV and 202 GeV. The selection criteria that allow to isolate the events I looked for, including efficiencies but also the background rate coming from Standard Model that one can expect are presented. The final interpretations of those results in both frameworks of m-SUGRA and GMSB are detailed at the end of this thesis. I took benefit of those results to derive some limits on the masses of the scalar leptons that do not depend on the free parameters of the SUSY models, especially on the selectron mass in the framework of m-SUGRA: M{sub e}-tilde{sub R} > 71.2 GeV. (authors)

  19. RECOMBINANT PROTEIN PRODUCTION OF ABUNDANT LARVAL TRANSCRIPT (ALT-2 IN ESCHERICHIA COLI

    Directory of Open Access Journals (Sweden)

    Kamran Ashraf

    2013-02-01

    Full Text Available Lymphatic filariasis is a major tropical disease caused by mosquito born nematodes Brugia malayi and Wuchereria bancrofti. Vaccine against filariasis must generate immunity to infective mosquito derived L3 stage. Two highly expressed genes designated abundant larval transcript-1 and -2 (alt-1 and alt-2. ALT-1 and ALT-2 represent closely related protein (79% it. Now, expression of this alt gene in E. coli BL21plysS for the production of vaccine is major challenge as no vaccine is available against this disease. Work was carried out to express this protein at laboratory scale bioreactor. At first optimization of different parameter like suitability of media, inducer concentration, induction time was done for getting maximum amount of recombinant protein. In shake flask studies, after induction (max cell density and max specific growth rate stage good expression of ALT-2 protein was found. However, at laboratory scale production done in bioreactor, expression level drastically decreased. Plasmid stability analysis was done in reactor and was found to be cause for decreased productivity. The stability was improved by increasing antibiotic concentration in the medium and also by pulsing antibiotic during induction. This led to better plasmid stability and increased expression levels in reactor similar to expression levels in shake flask studies.

  20. Evaluation of immune response elicited by inulin as an adjuvant with filarial antigens in mice model.

    Science.gov (United States)

    Mahalakshmi, N; Aparnaa, R; Kaliraj, P

    2014-10-01

    Filariasis caused by infectious parasitic nematodes has been identified as the second leading source of permanent and long-term disability in Sub-Saharan Africa, Asia and Latin America. Several vaccine candidates were identified from infective third-stage larvae (L3) which involves in the critical transition from arthropod to human. Hitherto studies of these antigens in combination with alum adjuvant have shown to elicit its characteristic Th2 responses. Inulin is a safe, non-toxic adjuvant that principally stimulates the innate immune response through the alternative complement pathway. In the present study, the immune response elicited by inulin and alum as adjuvants were compared with filarial antigens from different aetiological agents: secreted larval acidic protein 1 (SLAP1) from Onchocerca volvulus and venom allergen homologue (VAH) from Brugia malayi as single or as cocktail vaccines in mice model. The study revealed that inulin can induce better humoral response against these antigens than alum adjuvant. Antibody isotyping disclosed inulin's ability to elevate the levels of IgG2a and IgG3 antibodies which mediates in complement-dependent cytotoxicity and antibody-dependent cell-mediated cytotoxicity (ADCC), respectively, in mice. Splenocyte analysis showed that T cells prestimulated with inulin have higher stimulation index (P inulin formulation had induced higher cytotoxicity with filarial antigens (as single P inulin to deplete the levels of Treg and brought a balance in Th1/Th2 arms against filarial antigens in mice. © 2014 John Wiley & Sons Ltd.

  1. Multiplex Immunochips for High-Accuracy Detection of AFP-L3% Based on Surface-Enhanced Raman Scattering: Implications for Early Liver Cancer Diagnosis.

    Science.gov (United States)

    Ma, Hao; Sun, Xiaoying; Chen, Lei; Cheng, Weina; Han, Xiao Xia; Zhao, Bing; He, Chengyan

    2017-09-05

    α-Fetoprotein (AFP) is an important tumor biomarker. In particular, the overexpression of AFP-L3 is associated with hepatocellular carcinoma (HCC). Accordingly, several hospitals have begun to employ the ratio of AFP-L3 to the total AFP level (AFP-L3%) as new diagnostic evidence for HCC owing to its high diagnostic accuracy. However, current methods of detection for AFP and AFP-L3 are time-consuming, require multiple samples, and lack in sensitivity and specificity. Herein, we present a novel concept for the early diagnosis of HCC based on the combination of Raman frequency shift and intensity change, and developed surface-enhanced Raman scattering (SERS)-based immunochips via AFP-L3%. In the first step of the study, the frequency shift of 4-mercaptobenzoic acid (MBA) was applied for the quantitative determination of total AFP based on the AFP and anti-AFP interaction on MBA-modified silver chips. 5,5-Dithiobis(succinimidyl-2-nitrobenzoate) (DSNB)-modified immunogold was then incorporated with AFP-L3 antibodies for sandwich immunoreaction on the chips. As a result, we found that a typical Raman band intensity of DSNB presented an exponential linear relationship with the concentration of AFP-L3. Thus, the AFP-L3% can be calculated according to the concentrations of AFP-L3 and total AFP. The most important advantage of the proposed method is the combination of AFP-L3% and frequency shifts of SERS, which exhibits excellent reproducibility and high accuracy, and significantly simplifies the conventional detection procedure of AFP-L3%. Application of the proposed method with the serum of patients with HCC demonstrated its great potential in early liver cancer diagnosis.

  2. ASTEROFF: A Computer Code to Deflect NEOs by Missiles shot from L1 and L3 (Earth-Moon)

    Science.gov (United States)

    Maccone, C.

    We develop the mathematical theory for an automatic, space-based system to deflect NEOs by virtue of missiles shot from the Earth-Moon L1 and L3 Lagrangian Points. A patent application has been filed for the relevant code, dubbed ASTEROFF (= Asteroids OFF !). This code was already implemented, and a copyright for it was registered. In a paper published in Acta Astronautica, Vol. 50, No. 3, pp. 185-199 (2002), this author proved mathematically the following theorem (hereafter called the ``confocal conics theorem''): ``Within the sphere of influence of the Earth, any NEO could be hit by a missile at just an angle of 90 degrees, was the missile shot from Lagrangian Points L1 or L3 of the Earth-Moon system, rather than from the surface of the Earth''. As a consequence, the hitting missile would have move along a ``confocal ellipse'' (centered at the Earth) uniquely determined by the NEO's incoming hyperbola. Based on the above theorem, the author further shows in this paper that: The proposed defense system would be ideal to deflect NEOs that are small, i.e. less than one kilometer in diameter. Small NEOs are just the most difficult ones to be detected early enough and to such an orbital accuracy to be positively sure that they are indeed hazardous. The traditional theory of Keplerian orbits can successfully be applied to get an excellent first-order approximation of the (otherwise unknown) mathematical formulae of the energy/momentum requested to achieve the NEO deflection. Many engineering details about the missiles shot from L1 and L3, however, still have to be implemented into our simulations, partly because they are classified. Was one missile not enough to deflect the NEO completely, it is a great advantage of the ``confocal conics'' used here that the new, slightly deflected NEO's hyperbola would certainly be hit at nearly 90 degrees by another and slightly more eccentric elliptical missile trajectory. A sufficient number of missiles could thus be launched in a

  3. Optimal trajectories from the Earth-Moon L1 and L3 points to deflect hazardous asteroids and comets.

    Science.gov (United States)

    Maccone, Claudio

    2004-05-01

    Software code named asteroff was recently created by the author to simulate the deflection of hazardous asteroids off of their collision course with the Earth. This code was both copyrighted and patented to avoid unauthorized use of ideas that could possibly be vital to construct a planetary defense system in the vicinity of the Earth. Having so said, the basic ideas and equations underlying the asteroff simulation code are openly described in this paper. A system of two space bases housing missiles is proposed to achieve the planetary defense of the Earth against dangerous asteroids and comets, collectively called impactors herein. We show that the layout of the Earth-Moon system with the five relevant Lagrangian (or libration) points in space leads naturally to only one, unmistakable location of these two space bases within the sphere of influence of the Earth. These locations are at the two Lagrangian points L(1) (between the Earth and the Moon) and L(3) (in the direction opposite to the Moon from the Earth). We show that placing missile bases at L(1) and L(3) would enable those missiles to deflect the trajectory of impactors by hitting them orthogonally to their impact trajectory toward the Earth, so as to maximize their deflection. We show that confocal conics are the best class of trajectories fulfilling this orthogonal deflection requirement. One additional remark is that the theory developed in this paper is just a beginning for a wider set of future research. In fact, we only develop the Keplerian analytical theory for the optimal planetary defense achievable from the Earth-Moon Lagrangian points L(1) and L(3). Much more sophisticated analytical refinements would be needed to: (1) take into account many perturbation forces of all kinds acting on both the impactors and missiles shot from L(1) and L(3); (2) add more (non-optimal) trajectories of missiles shot from either the Lagrangian points L(4) and L(5) of the Earth-Moon System or from the surface of the

  4. Observation of a VHE Cosmic-Ray Flare-Signal with the L3+C Muon Spectrometer

    CERN Document Server

    Adriani, O; Aziz, T; Bähr, J; Banerjee, S; Becattini, F; Bellucci, L; Betev, B L; Blaising, J J; Bobbink, G J; Bottai, S; Bourilkov, D; Cartacci, A; Chemarin, M; Chen, G; Chen, G M; Chen, H S; Chiarusi, T; Coignet, G; Ding, L K; Duran, I; Eline, A; El Mamouni, H; Faber, G; Fay, J; Filthaut, F; Ganguli, S N; Gong, Z F; Grabosch, H J; Groenstege, H; Guo, Y N; Gupta, S; Gurtu, A; Haller, Ch; Hayashi, Y; He, Z X; Hebbeker, T; Herve, A; Hofer, H; Hoferjun, H; Huo, A X; Ito, N; Jing, C L; Jones, L W; Kantserov, V; Kawakami, S; Kittel, W; König, A C; Kok, E; Kuang, H H; Kuijpers, J; Ladron de Guevara, P; Le Coultre, P; Lei, Y; Leich, H; Leiste, R; Li, L; Li, Z C; Liu, Z A; Lohmann, W; Lu, Y S; Ma, W G; Ma, X H; Ma, Y Q; Mele, S; Meng, X W; Meschini, M; Metzger, W J; van Mil, A; Milcent, H; Mohanty, G B; Monteleoni, B; Nahnhauer, R; Naumov, V A; Nowak, H; Parriaud, J -F; Pauss, F; Petersen, B; Pieri, M; Pohl, M; Pojidaev, V; Qing, C R; Ramelli, R; Ranieri, R; Ravindran, K C; Rewiersma, P; Riemann, S; Rojkov, A; Romero, L; Schmitt, V; Schoeneich, B; Schotanus, D J; Shen, C Q; Spillantini, P; Sulanke, H; Tang, X W; Timmermans, C; Tonwar, S C; Trowitzsch, G; Unger, M; Verkooijen, H; Van de Walle, R T; Vogt, H; Wang, R G; Wang, Q; Wang, X L; Wang, X W; Wang, Z M; Wijk, R van; Wijnen, T A M; Wilkens, H; Xu, Y P; Xu, J S; Xu, Z Z; Yang, C G; Yang, X F; Yao, Z G; Yu, Z Q; Zhang, C; Zhang, F; Zhang, J; Zhang, S; Zhou, S J; Zhu, G Y; Zhu, Q Q; Zhuang, H L; Zwart, A N M

    2010-01-01

    The data collected by the L3+C muon spectrometer at the CERN Large Electron-Positron collider, LEP, have been used to search for short duration signals emitted by cosmic point sources. A sky survey performed from July to November 1999 and from April to November 2000 has revealed one single flux enhancement (chance probability = 2.6X10^{-3}) between the 17th and 20th of August 2000 from a direction with a galactic longitude of (265.02+-0.42)^° and latitude of (55.58+-0.24)^°. The energy of the detected muons was above 15 GeV.

  5. A search for flaring Very-High-Energy cosmic-ray sources with the L3+C muon spectrometer

    CERN Document Server

    Achard, P; Aguilar-Benítez, M; Van den Akker, M; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Anderhub, H; Andreev, V P; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Bajo, A; Baksay, G; Baksay, L; Bähr, J; Baldew, S V; Banerjee, S; Banerjee, Sw; Barczyk, A; Barillère, R; Bartalini, P; Basile, M; Batalova, N; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Bellucci, L; Berbeco, R; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Biasini, M; Biglietti, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, G J; Böhm, A; Boldizsar, L; Borgia, B; Bottai, S; Bourilkov, D; Bourquin, M; Braccini, S; Branson, J G; Brochu, F; Burger, J D; Burger, W J; Cai, X D; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A; Casaus, J; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada, M; Chamizo-Llatas, M; Chang, Y H; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chiarusi, T; Chiefari, G; Cifarelli, L; Cindolo, F; Clare, I; Clare, R; Coignet, G; Colino, N; Costantini, S; de la Cruz, B; Cucciarelli, S; De Asmundis, R; Dglon, P; Debreczeni, J; Degré, A; Dehmelt, K; Deiters, K; Della Volpe, D; Delmeire, E; Denes, P; De Notaristefani, F; De Salvo, A; Diemoz, M; Dierckxsens, M; Ding, L K; Dionisi, C; Dittmar, M; Doria, A; Dova, M T; Duchesneau, D; Duda, M; Durán, I; Echenard, B; Eline, A; El-Hage, A; El-Mamouni, H; Engler, A; Eppling, F J; Extermann, P; Faber, G; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, M; Ferguson, T; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, F; Fisher, P H; Fisher, W; Fisk, I; Forconi, G; Freudenreich, K; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gentile, S; Giagu, S; Gong, Z F; Grenier, H; Grabosch, G; Grimm, O; Groenstege, H; Grünewald, M W; Guida, M; Guo, Y N; Gupta, S K; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Haller, C; Hatzifotiadou, D; Hayashi, Y; He, Z X; Hebbeker, T; Hervé, A; Hirschfelder, J; Hofer, H; Hohlmann, M; Holzner, G; Hou, S R; Huo, A X; Ito, N; Jin, B N; Jindal, P; Jing, C L; Jones, L W; de Jong, P; Josa-Mutuberría, M I; Kantserov, V A; Kaur, i; Kawakami, S; Kienzle-Focacci, M N; Kim, J K; Kirkby, Jasper; Kittel, W; Klimentov, A; König, A C; Kok, E; Korn, A; Kopal, M; Koutsenko, V F; Kräber, M; Kuang, H H; Krämer, R W; Krüger, A; Kuijpers, J; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Le Goff, J M; Lei, Y; Leich, H; Leiste, R; Levtchenko, M; Levchenko, P M; Li, C; Li, L; Li, Z C; Likhoded, S; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lü, Y S; Luci, C; Luminari, L; Lustermann, W; Ma, W G; Ma, X H; Ma, Y Q; Malgeri, L; Malinin, A; Maña, C; Mans, J; Martin, J P; Marzano, F; Mazumdar, K; McNeil, R R; Mele, S; Meng, X W; Merola, L; Meschini, M; Metzger, W J; Mihul, A; van Mil, A; Milcent, H; Mirabelli, G; Mnich, J; Mohanty, G B; Monteleoni, B; Muanza, G S; Muijs, A J M; Musicar, B; Musy, M; Nagy, S; Nahnhauer, R; Naumov, V A; Natale, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Nisati, A; Novák, T; Nowak, H; Ofierzynski, R A; Organtini, G; Pal, I; Palomares, C; Paolucci, P; Paramatti, R; Parriaud, J F; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, F; Pedace, M; Pensotti, S; Perret-Gallix, D; Petersen, B; Piccolo, D; Pierella, F; Pieri, M; Pioppi, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Pothier, J; Prokofev, D; Prokofiev, D O; Quartieri, J; Qing, C R; Rahal-Callot, G; Rahaman, M A; Raics, P; Raja, N; Ramelli, R; Rancoita, P G; Ranieri, R; Raspereza, A V; Ravindran, K C; Razis, P; Ren, D; Rescigno, M; Reucroft, S; Rewiersma, P A M; Riemann, S; Riles, K; Roe, B P; Rojkov, A; Romero, L; Rosca, A; Rosemann, C; Rosenbleck, C; Rosier-Lees, S; Roth, S; Rubio, J A; Ruggiero, G; Rykaczewski, H; Saidi, R; Sakharov, A; Saremi, S; Sarkar, S; Salicio, J; Sánchez, E; Schäfer, C; Shchegelskii, V; Schmitt, V; Schöneich, B; Schopper, Herwig Franz; Schotanus, D J; Sciacca, C; Servoli, L; Shen, C Q; Shevchenko, S; Shivarov, N; Shoutko, V; Shumilov, E; Shvorob, A; Son, D; Souga, C; Spillantini, P; Steuer, M; Stickland, D P; Stoyanov, B; Strässner, A; Sudhakar, K; Sulanke, H; Sultanov, G G; Sun, L Z; Sushkov, S; Suter, H; Swain, J D; Szillási, Z; Tang, X W; Tarjan, P; Tauscher, L; Taylor, L; Tellili, B; Teyssier, D; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Trowitzsch, G; Tully, C; Tung, K L; Ulbricht, J; Unger, M; Valente, E; Verkooijen, H; Van de Walle, R T; Vásquez, R; Veszpremi, V; Vesztergombi, G; Vetlitskii, I; Vicinanza, D; Viertel, G; Villa, S; Vivargent, M; Vlachos, S; Vodopyanov, I; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Wadhwa, M; Wang, R G; Wang, Q; Wang, X L; Wang, X W; Wang, Z M; Weber, M; Van Wijk, R F; Wijnen, T A M; Wilkens, H; Wynhoff, S; Xia, L; Xu, Y P; Xu, J S; Xu, Z Z; Yang, B Z; Yang, C G; Yang, H J

    2006-01-01

    The L3+C muon detector at the Cern electron-position collider, LEP, is used for the detection of very-high-energy cosmic \\gamma-ray sources through the observation of muons of energies above 20, 30, 50 and 100 GeV. Daily or monthly excesses in the rate of single-muon events pointing to some particular direction in the sky are searched for. The periods from mid July to November 1999, and April to November 2000 are considered. Special attention is also given to a selection of known \\gamma-ray sources. No statistically significant excess is observed for any direction or any particular source.

  6. English L3 Learning in a Multilingual Context: The Role of Parental Education and L2 Exposure within the Living Community

    Science.gov (United States)

    De Angelis, Gessica

    2015-01-01

    The present study examines two factors in relation to English L3 proficiency development and school performance in a third language: (a) parental education and (b) second language exposure within the living community. Participants (n?=?50) are Italian L1 students with German L2 and English L3. All students (eighth grade, 14 years of age) were…

  7. Roles of linguistic knowledge, metacognitive knowledge and processing speed in L3, L2 and L1 reading comprehension: a structural equation modeling approach

    NARCIS (Netherlands)

    van Gelderen, A.; Schoonen, R.; de Glopper, K.; Hulstijn, J.; Snellings, P.; Simis, A.; Stevenson, M.

    2003-01-01

    In this article we present an analysis of the relationship between L3 reading comprehension and its constituent skills for bilingual Dutch students for whom English is a third language(L3) compared to monolingual Dutch students for whom English is a second language(L2). An analogous analysis is made

  8. Comparison of AFP-L3 and p53 Antigen Concentration with Alpha-Fetoprotein as Serum Markers for Hepatocellular Carcinoma.

    Science.gov (United States)

    Abdel-Aziz, Mohamed M; Elshal, Mohamed F; Abass, Aymn T; El-Kafrawy, Sherif; Ezzat, Sameera; Abdel-Wahab, Mohamed

    2016-01-01

    Hepatocellular carcinoma (HCC) has the worst prognosis among all major cancers, largely due to the lack of sensitive diagnostic markers. We aimed to compare three HCC tumor markers, alpha-fetoprotein (AFP), p53, and AFP-L3%, to evaluate whether measuring serum p53 levels and AFP-L3% has an additive diagnostic value for detection of HCC. A total of 86 patients with chronic liver diseases were included. HCC was detected in 68 (79.1%) patients. Twenty healthy age-matched volunteers served as healthy controls. Serum concentrations of AFP, AFP-L3, and p53 protein were measured. The correlations between the three markers with status of viral hepatitis, liver function tests, and Child-Pugh scores were determined. HCC patients showed significantly higher percentages of cirrhosis and Child-Pugh grade C (p AFP-L3% and p53 levels were significantly (p AFP-L3% was found significantly correlated with Child-Pugh classification (p AFP-L3, AFP, and p53; respectively. Combining AFP-L3 and p53 improved sensitivity to 95.4% with a specificity of 85%. No significant correlation was found between AFP, AFP-L3%, and p53; however, the simultaneous determination of the three tumor markers yielded a better diagnostic accuracy and sensitivity in the detection of HCCs than each biomarker alone.

  9. Pharmacologically induced long QT type 2 can be rescued by activation of IKs with benzodiazepine R-L3 in isolated guinea pig cardiomyocytes

    DEFF Research Database (Denmark)

    Nissen, Jakob Dahl; Diness, Jonas Goldin; Diness, Thomas Goldin

    2009-01-01

    of this study was to evaluate potential antiarrhythmic effects of compound induced IKs activation using the benzodiazepine L-364,373 (R-L3). Ventricular myocytes from guinea pigs were isolated and whole-cell current clamping was performed at 35 degrees C. It was found that 1 microM R-L3 significantly reduced...

  10. Genomic characterization of Defluviitoga tunisiensis L3, a key hydrolytic bacterium in a thermophilic biogas plant and its abundance as determined by metagenome fragment recruitment.

    Science.gov (United States)

    Maus, Irena; Cibis, Katharina Gabriela; Bremges, Andreas; Stolze, Yvonne; Wibberg, Daniel; Tomazetto, Geizecler; Blom, Jochen; Sczyrba, Alexander; König, Helmut; Pühler, Alfred; Schlüter, Andreas

    2016-08-20

    The genome sequence of Defluviitoga tunisiensis L3 originating from a thermophilic biogas-production plant was established and recently published as Genome Announcement by our group. The circular chromosome of D. tunisiensis L3 has a size of 2,053,097bp and a mean GC content of 31.38%. To analyze the D. tunisiensis L3 genome sequence in more detail, a phylogenetic analysis of completely sequenced Thermotogae strains based on shared core genes was performed. It appeared that Petrotoga mobilis DSM 10674(T), originally isolated from a North Sea oil-production well, is the closest relative of D. tunisiensis L3. Comparative genome analyses of P. mobilis DSM 10674(T) and D. tunisiensis L3 showed moderate similarities regarding occurrence of orthologous genes. Both genomes share a common set of 1351 core genes. Reconstruction of metabolic pathways important for the biogas production process revealed that the D. tunisiensis L3 genome encodes a large set of genes predicted to facilitate utilization of a variety of complex polysaccharides including cellulose, chitin and xylan. Ethanol, acetate, hydrogen (H2) and carbon dioxide (CO2) were found as possible end-products of the fermentation process. The latter three metabolites are considered to represent substrates for methanogenic Archaea, the key organisms in the final step of the anaerobic digestion process. To determine the degree of relatedness between D. tunisiensis L3 and dominant biogas community members within the thermophilic biogas-production plant, metagenome sequences obtained from the corresponding microbial community were mapped onto the L3 genome sequence. This fragment recruitment revealed that the D. tunisiensis L3 genome is almost completely covered with metagenome sequences featuring high matching accuracy. This result indicates that strains highly related or even identical to the reference strain D. tunisiensis L3 play a dominant role within the community of the thermophilic biogas-production plant

  11. VLBI-simulations for the estimation of degree-three Love and Shida numbers h3 and l3

    Science.gov (United States)

    Mendes Cerveira, P. J.; Boehm, J.; Wresnik, J.; Spicakova, H.; Schuh, H.

    2007-12-01

    For the displacement due to solid Earth tides, the IERS Conventions 2003 recommend several corrections to nominal values. One of these corrections is the in-phase contribution by using the real Love and Shida numbers h3 and l3 at all degree-3 tides, where only the contribution of the moon is relevant. The maximum predicted radial displacement is in the order of 1.7 mm. The nominal values are 0.292 for h3, and 0.015 for l3, respectively. Using realistic station and source catalogues, we simulated VLBI (Very Long Baseline Interferometry) group time delays, with a white noise going up to 2 cm, and taking into account the solid Earth tides displacement. Goal of this study was to investigate whether degree-3 Love and Shida numbers can be unambiguously determined from VLBI observations. Therefore, several setups w.r.t., e.g., station constellation, cutoff angle, time span, sampling interval, and different levels of white noise were tested. Attention was put into the separability and correlation between the degree-2 and degree-3 Love and Shida numbers.

  12. Examining teachers’ views on the implementation of English as L3 into primary schools: A case of Kazakhstan

    Directory of Open Access Journals (Sweden)

    Bakhytgul A Zhetpisbayeva

    2016-06-01

    Full Text Available The Ministry of Education and Science of the Republic of Kazakhstan changed the State Educational Program for primary education and the curriculum for teaching English as a third language (L3 to grades 1-4in 2013. As with many changes in the curriculum, English language teaching has also been changed and the starting age for learning of English language has been lowered to 6-7 years of age (Grade 1. However, implementation of the curriculum requires readiness on the part of the teachers and teachers' views about teaching English in primary school is important for successful implementation of English language policy. Thus, this research aims to investigate the teachers’ views about the starting age for L3 learning, teachers' professional development, teaching materials and problems of implementation of a language policy in primary schools in Kazakhstan. The data for the study was gathered from 105 English teachers working in different primary schools. The study revealed that most have not yet made a transition to the organized system of teaching English languages in primary school.

  13. Combination of triple biomarkers AFP, AFP-L3, and PIVAKII for early detection of hepatocellular carcinoma in China: Expectation.

    Science.gov (United States)

    Gao, Jianjun; Song, Peipei

    2017-01-01

    Hepatocellular carcinoma (HCC) remains a severe health threat in China. Early tumor detection is crucial for improving the prognosis of patients. Currently, ultrasound plus biomarker alpha fetoprotein (AFP) is recommended by Chinese Liver Cancer Diagnosis and Treatment Guidelines in China. However, most HCC continues to be diagnosed beyond an early stage due to insufficient sensitivity and specificity of current surveillance tools, highlighting the need for more accurate biomarkers to improve early HCC detection. In Japan, ultrasound plus triple biomarkers AFP, Lens culinaris agglutinin-reactive fraction of AFP (AFP-L3), and prothrombin induced by vitamin K absence II (PIVKA II) has been routinely used for HCC surveillance and achieved increased early HCC detection rate. Very recently, the assay of triple biomarkers AFP, AFP-L3, and PIVKA II using μTASWako i30 immuno-analyzer was brought into China. The prospect of the modality of ultrasound plus triple biomarkers for early HCC detection in China is expected in the future.

  14. Prolonged response to calling songs by the L3 auditory interneuron in female crickets (Acheta domesticus): intracellular evaluation.

    Science.gov (United States)

    Navia, Benjamin; Stout, John; Atkins, Gordon

    2003-03-01

    The L3 auditory interneuron in female Acheta domesticus, produces two different responses to the male calling song: an immediate response and a prolonged response. The prolonged response exhibited spiking activity and a correlated prolonged depolarization, both of which are clearly seen in intracellular recordings. The morphology revealed by intracellular staining was clearly the L3 neuron. The amplitude of the prolonged depolarization associated with the prolonged response increased with increases in sound intensity, resulting in increased spiking rates. Both depolarization and sound presentation increased the spiking rate and the slope of pre-potentials (thus leading to spiking threshold more quickly). Injecting hyperpolarizing current had the expected opposite effect. The effects of positive current injection and sound presentation were additive, resulting in spiking rates that were approximately double the rates in response to sound alone. Short postsynaptic potentials (PSPs), whose duration ranged from 15-60 ms, which may lead to action potentials were also observed in all recordings and summated with the prolonged depolarization, increasing the probability of spiking. Copyright 2003 Wiley-Liss, Inc.

  15. Antigenicity of Anisakis simplex s.s. L3 in parasitized fish after heating conditions used in the canning processing.

    Science.gov (United States)

    Tejada, Margarita; Olivares, Fabiola; de las Heras, Cristina; Careche, Mercedes; Solas, María Teresa; García, María Luisa; Fernandez, Agustín; Mendizábal, Angel; Navas, Alfonso; Rodríguez-Mahillo, Ana Isabel; González-Muñoz, Miguel

    2015-03-30

    Some technological and food processing treatments applied to parasitized fish kill the Anisakis larvae and prevent infection and sensitization of consumers. However, residual allergenic activity of parasite allergens has been shown. The aim here was to study the effect of different heat treatments used in the fish canning processing industry on the antigen recognition of Anisakis L3. Bigeye tuna (Thunnus obesus) and yellowfin tuna (Thunnus albacares) were experimentally infected with live L3 Anisakis. After 48 h at 5 ± 1 °C, brine was added to the muscle, which was then canned raw (live larvae) or heated (90 °C, 30 min) (dead larvae) and treated at 113 °C for 60 min or at 115 °C for 90 min. Anisakis antigens and Ani s 4 were detected with anti-crude extract and anti-Ani s 4 antisera respectively. Ani s 4 decreased in all lots, but the muscle retained part of the allergenicity irrespective of the canning method, as observed by immunohistochemistry. Dot blot analysis showed a high loss of Ani s 4 recognition after canning, but residual antigenicity was present. The results indicate that heat treatment for sterilization under the conditions studied produces a decrease in Ani s 4 and suggest a potential exposure risk for Anisakis-sensitized patients. © 2014 Society of Chemical Industry.

  16. Diagnosis of brugian filariasis by loop-mediated isothermal amplification.

    Directory of Open Access Journals (Sweden)

    Catherine B Poole

    Full Text Available In this study we developed and evaluated a Brugia Hha I repeat loop-mediated isothermal amplification (LAMP assay for the rapid detection of Brugia genomic DNA. Amplification was detected using turbidity or fluorescence as readouts. Reactions generated a turbidity threshold value or a clear visual positive within 30 minutes using purified genomic DNA equivalent to one microfilaria. Similar results were obtained using DNA isolated from blood samples containing B. malayi microfilariae. Amplification was specific to B. malayi and B. timori, as no turbidity was observed using DNA from the related filarial parasites Wuchereria bancrofti, Onchocerca volvulus or Dirofilaria immitis, or from human or mosquito. Furthermore, the assay was most robust using a new strand-displacing DNA polymerase termed Bst 2.0 compared to wild-type Bst DNA polymerase, large fragment. The results indicate that the Brugia Hha I repeat LAMP assay is rapid, sensitive and Brugia-specific with the potential to be developed further as a field tool for diagnosis and mapping of brugian filariasis.

  17. Evaluation of revisited fucosylated alpha-fetoprotein (AFP-L3) with an autoanalyzer μTAS in a clinical laboratory.

    Science.gov (United States)

    Choi, Jonghyeon; Park, Yongjung; Kim, Jeong-Ho; Kim, Hyon-Suk

    2012-01-18

    We assessed clinical and analytical performances of AFP and fucosylated AFP (AFP-L3) assays by a newly developed automated analyzer based on liquid-phase binding (micro-total analysis systems, μTAS). A total of 239 serum samples were obtained from 120 patients with hepatocellular carcinoma (HCC) and 119 without HCC. Precision of assays by the μTAS was evaluated, and the correlation between AFP-L3 and AFP levels was analyzed. Receiver operating characteristics curve-area under the curve (ROC-AUC) value was calculated to measure the diagnostic performance. Imprecision for AFP (ng/ml), AFP-L3 (ng/ml), and AFP-L3 (%) with 2 levels of QC materials was all within 5% coefficient of variation. AFP levels measured by the μTAS were correlated well with those by the UniCel DxI 800 Access (r=0.83). AFP-L3 concentrations in HCC patients were higher than those in control group (median 379.2 ng/ml in HCC, 1.0 ng/ml in non-HCC, PUniCel DxI 800, P<0.05 for both). AFP-L3 in HCC was significantly higher than that of control group. The μTAS showed good performances for routine uses in clinical laboratories for measuring AFP and AFP-L3. Copyright © 2011 Elsevier B.V. All rights reserved.

  18. Development of a highly sensitive glycan microarray for quantifying AFP-L3 for early prediction of hepatitis B virus-related hepatocellular carcinoma.

    Directory of Open Access Journals (Sweden)

    Chen-Shiou Wu

    Full Text Available The α-fetoprotein fraction L3 (AFP-L3, which is synthesized by malignant cells and incorporates a fucosylated oligosaccharide, has been investigated as a diagnostic and prognostic marker for hepatocellular carcinoma (HCC. Quantification of AFP-L3 by conventional enzyme-linked immunosorbent assay (ELISA has not always produced reliable results for serum samples with low AFP, and thus we evaluated the clinical utility of quantifying AFP-L3 using a new and highly sensitive glycan microarray assay. Sera from 9 patients with chronic hepatitis B and 32 patients with hepatitis B virus (HBV-related HCC were tested for AFP-L3 level using the glycan microarray. Additionally, we compared receiver operator characteristic curves for the ELISA and glycan microarray methods for determination of the AFP-L3: AFP-L1 ratio in patient samples. This ratio was calculated for 8 HCC patients who underwent transarterial embolization therapy pre- or post-treatment with AFP-L3. Glycan microarrays showed that the AFP-L3 ratio of HBV-related HCC patients was significantly higher than that measured for chronic hepatitis B patients. Overall parameters for estimating AFP-L3% in HCC samples were as follows: sensitivity, 53.13%; specificity, 88.89%; and area under the curve, 0.75. The elevated AFP-L3% in the 8 patients with HBV-related HCC was strongly associated with HCC progression. Following one month of transarterial embolization therapy, the relative mean AFP-L3% decreased significantly. In addition, we compared Fut8 gene expression between paired tumor and non-tumor tissues from 24 patients with HBV-related HCC. The Fut8 mRNA expression was significantly increased in tumorous tissues in these patients than that in non-tumor tissue controls. Higher expression of Fut8 mRNA in tumorous tissues in these patients was associated with poor differentiation than well and moderate differentiation. Our results describe a new glycan microarray for the sensitive and rapid

  19. Development of a highly sensitive glycan microarray for quantifying AFP-L3 for early prediction of hepatitis B virus-related hepatocellular carcinoma.

    Science.gov (United States)

    Wu, Chen-Shiou; Lee, Teng-Yu; Chou, Ruey-Hwang; Yen, Chia-Jui; Huang, Wei-Chien; Wu, Chung-Yi; Yu, Yung-Luen

    2014-01-01

    The α-fetoprotein fraction L3 (AFP-L3), which is synthesized by malignant cells and incorporates a fucosylated oligosaccharide, has been investigated as a diagnostic and prognostic marker for hepatocellular carcinoma (HCC). Quantification of AFP-L3 by conventional enzyme-linked immunosorbent assay (ELISA) has not always produced reliable results for serum samples with low AFP, and thus we evaluated the clinical utility of quantifying AFP-L3 using a new and highly sensitive glycan microarray assay. Sera from 9 patients with chronic hepatitis B and 32 patients with hepatitis B virus (HBV)-related HCC were tested for AFP-L3 level using the glycan microarray. Additionally, we compared receiver operator characteristic curves for the ELISA and glycan microarray methods for determination of the AFP-L3: AFP-L1 ratio in patient samples. This ratio was calculated for 8 HCC patients who underwent transarterial embolization therapy pre- or post-treatment with AFP-L3. Glycan microarrays showed that the AFP-L3 ratio of HBV-related HCC patients was significantly higher than that measured for chronic hepatitis B patients. Overall parameters for estimating AFP-L3% in HCC samples were as follows: sensitivity, 53.13%; specificity, 88.89%; and area under the curve, 0.75. The elevated AFP-L3% in the 8 patients with HBV-related HCC was strongly associated with HCC progression. Following one month of transarterial embolization therapy, the relative mean AFP-L3% decreased significantly. In addition, we compared Fut8 gene expression between paired tumor and non-tumor tissues from 24 patients with HBV-related HCC. The Fut8 mRNA expression was significantly increased in tumorous tissues in these patients than that in non-tumor tissue controls. Higher expression of Fut8 mRNA in tumorous tissues in these patients was associated with poor differentiation than well and moderate differentiation. Our results describe a new glycan microarray for the sensitive and rapid quantification of

  20. Development of a Highly Sensitive Glycan Microarray for Quantifying AFP-L3 for Early Prediction of Hepatitis B Virus–Related Hepatocellular Carcinoma

    Science.gov (United States)

    Chou, Ruey-Hwang; Yen, Chia-Jui; Huang, Wei-Chien; Wu, Chung-Yi; Yu, Yung-Luen

    2014-01-01

    The α-fetoprotein fraction L3 (AFP-L3), which is synthesized by malignant cells and incorporates a fucosylated oligosaccharide, has been investigated as a diagnostic and prognostic marker for hepatocellular carcinoma (HCC). Quantification of AFP-L3 by conventional enzyme-linked immunosorbent assay (ELISA) has not always produced reliable results for serum samples with low AFP, and thus we evaluated the clinical utility of quantifying AFP-L3 using a new and highly sensitive glycan microarray assay. Sera from 9 patients with chronic hepatitis B and 32 patients with hepatitis B virus (HBV)-related HCC were tested for AFP-L3 level using the glycan microarray. Additionally, we compared receiver operator characteristic curves for the ELISA and glycan microarray methods for determination of the AFP-L3: AFP-L1 ratio in patient samples. This ratio was calculated for 8 HCC patients who underwent transarterial embolization therapy pre- or post-treatment with AFP-L3. Glycan microarrays showed that the AFP-L3 ratio of HBV-related HCC patients was significantly higher than that measured for chronic hepatitis B patients. Overall parameters for estimating AFP-L3% in HCC samples were as follows: sensitivity, 53.13%; specificity, 88.89%; and area under the curve, 0.75. The elevated AFP-L3% in the 8 patients with HBV-related HCC was strongly associated with HCC progression. Following one month of transarterial embolization therapy, the relative mean AFP-L3% decreased significantly. In addition, we compared Fut8 gene expression between paired tumor and non-tumor tissues from 24 patients with HBV-related HCC. The Fut8 mRNA expression was significantly increased in tumorous tissues in these patients than that in non-tumor tissue controls. Higher expression of Fut8 mRNA in tumorous tissues in these patients was associated with poor differentiation than well and moderate differentiation. Our results describe a new glycan microarray for the sensitive and rapid quantification of

  1. Searching for artificial equilibrium points to place satellites "above and below" L3 in the Sun-Earth system

    Science.gov (United States)

    de Almeida, A. K., Jr.; Prado, A. F. B. A.; Sanchez, D. M.; Yokoyama, T.

    2017-10-01

    Regarding practical applications of L3 of the Sun-Earth system, there are few studies with the goal of placing a spacecraft at this point, or in orbit around it. One of the main problems in placing a spacecraft near this equilibrium point is the fact that it is located behind the Sun with respect to the Earth. The Sun would be blocking direct communication between the spacecraft and the Earth. The present research gives several options to solve this problem by using a solar sail to place one or two spacecraft above and/or below the Ecliptic plane. This sail could also be used for the mission itself, to collect energy or particles. By using an adequate size, location and attitude of the solar sail, the equilibrium point can be moved from its original location to allow communications between the spacecraft and the Earth. A preliminary study of a solar sail that uses this strategy is shown here.

  2. Cross section measurement of $\\tau$ pairs in two photon collisions with the L3 detector at LEP 2

    CERN Document Server

    Haas, D

    2001-01-01

    The production of tau pairs in gamma gamma collisions is studied with the L3 detector at LEP. Data were collected at square root =189-202 GeV for a total integrated luminosity of 393.0 pb/sup -1/. An exclusive decay channel is considered, with tau /sup +or-/ to e/sup +or-/ nu /sub tau / nu /sub e/ and tau /sup -or+/ to rho /sup -or+/ nu /sub tau /, with rho /sup -or+/ to pi /sup -or+/ pi /sup 0/. The cross section sigma (e/sup +/e/sup -/ to e/sup +/e/sup -/ tau /sup +/ tau /sup -/) is compared to O( alpha /sup 4/) QED calculations. The cross section of tau production is measured in gamma gamma collisions for the first time at LEP 2. (9 refs).

  3. Gallium nitride L3 photonic crystal cavities with an average quality factor of 16 900 in the near infrared

    Energy Technology Data Exchange (ETDEWEB)

    Vico Triviño, Noelia; Carlin, Jean-François; Butté, Raphaël; Grandjean, Nicolas [Institute of Condensed Matter Physics, Ecole Polytechnique Fédérale de Lausanne (EPFL), CH-1015 Lausanne (Switzerland); Minkov, Momchil, E-mail: momchil.minkov@epfl.ch; Savona, Vincenzo [Laboratory of Theoretical Physics of Nanosystems, Ecole Polytechnique Fédérale de Lausanne (EPFL), CH-1015 Lausanne (Switzerland); Urbinati, Giulia; Galli, Matteo [Dipartimento di Fisica, Università di Pavia, via Bassi 6, 27100 Pavia (Italy)

    2014-12-08

    Photonic crystal point-defect cavities were fabricated in a GaN free-standing photonic crystal slab. The cavities are based on the popular L3 design, which was optimized using an automated process based on a genetic algorithm, in order to maximize the quality factor. Optical characterization of several individual cavity replicas resulted in an average unloaded quality factor Q = 16 900 at the resonant wavelength λ∼1.3 μm, with a maximal measured Q value of 22 500. The statistics of both the quality factor and the resonant wavelength are well explained by first-principles simulations including fabrication disorder and background optical absorption.

  4. Identification of the new UV filter compound cysteine-L-3-hydroxykynurenine O-beta-d-glucoside in human lenses.

    Science.gov (United States)

    Hains, Peter G; Mizdrak, Jasminka; Streete, Isla M; Jamie, Joanne F; Truscott, Roger J W

    2006-09-18

    UV filters protect the human lens and retina from UV light-induced damage. Here, we report the identification of a new UV filter, cysteine-l-3-hydroxykynurenine O-beta-d-glucoside, which is present in older normal human lenses. Its structure was confirmed by independent synthesis. It is likely this novel UV filter is formed in the lens by nucleophilic attack of cysteine on the unsaturated ketone derived from deamination of 3-hydroxykynurenine O-beta-d-glucoside. Quantitation studies revealed considerable variation in normal lens levels that may be traced to the marked instability of the cysteine adduct. The novel UV filter was not detected in advanced nuclear cataract lenses.

  5. Gallium nitride L3 photonic crystal cavities with an average quality factor of 16,900 in the near infrared

    CERN Document Server

    Triviño, Noelia Vico; Urbinati, Giulia; Galli, Matteo; Carlin, Jean-François; Butté, Raphaël; Savona, Vincenzo; Grandjean, Nicolas

    2014-01-01

    Photonic crystal point-defect cavities were fabricated in a GaN free-standing photonic crystal slab. The cavities are based on the popular L3 design, which was optimized using an automated process based on a genetic algorithm, in order to maximize the quality factor. Optical characterization of several individual cavity replicas resulted in an average unloaded quality factor Q = 16,900 at the resonant wavelength {\\lambda} $\\sim 1.3$ {\\mu}m, with a maximal measured Q value of 22,500. The statistics of both the quality factor and the resonant wavelength are well explained by first-principles simulations including fabrication disorder and background optical absorption.

  6. Hybridization gap in the heavy-fermion compound UP d2A l3 via quasiparticle scattering spectroscopy

    Science.gov (United States)

    Jaggi, N. K.; Mehio, O.; Dwyer, M.; Greene, L. H.; Baumbach, R. E.; Tobash, P. H.; Bauer, E. D.; Thompson, J. D.; Park, W. K.

    2017-04-01

    We present results from point-contact spectroscopy of the antiferromagnetic heavy-fermion superconductor UP d2A l3 : Conductance spectra are taken from single crystals with two major surface orientations as a function of temperature and magnetic field and analyzed using a theory of cotunneling into an Anderson lattice. Spectroscopic signatures are clearly identified, including the distinct asymmetric double-peak structure arising from the opening of a hybridization gap when a coherent heavy-Fermi liquid is formed. Both the hybridization gap, found to be 7.2 ±0.3 meV at 4 K, and the conductance enhancement above a flat background decrease upon increasing temperature. While the hybridization gap is extrapolated to remain finite up to ˜28 K, close to the temperature around which the magnetic susceptibility displays a broad peak, the conductance enhancement vanishes at ˜18 K, slightly above the antiferromagnetic transition temperature (TN≈14 K ) . This rapid decrease of the conductance enhancement is understood as a consequence of the junction drifting away from the ballistic regime due to increased scattering off magnons associated with the localized U 5 f electrons. This shows that while the hybridization gap opening is not directly associated with the antiferromagnetic ordering, its visibility in the conductance is greatly affected by the temperature-dependent magnetic excitations. Our findings are not only consistent with the 5 f dual-nature picture in the literature but also shed new light on the interplay between the itinerant and localized electrons in UP d2A l3 .

  7. Multi-Satellite Lambertian Equivalent Reflectivity (Local Satellite Time) 1 day L3 Global 5.0deg Lat Zones V1 (MSLERLSTL3zm) at GES DISC

    Data.gov (United States)

    National Aeronautics and Space Administration — The Multi-Satellite Lambertian Equivalent Reflectivity (Local Satellite Time) 1 day L3 Global 5.0deg Lat Zones data product (MSLERLSTL3zm) is derived from...

  8. Multi-Satellite Lambertian Equivalent Reflectivity (Noon Normalized) 1 day L3 Global 5.0deg Lat Zones V1 (MSLERNNL3zm) at GES DISC

    Data.gov (United States)

    National Aeronautics and Space Administration — The Multi-Satellite Lambertian Equivalent Reflectivity (Noon Normalized) 1 day L3 Global 5.0deg Lat Zones data product (MSLERNNL3zm) is derived from observations...

  9. Multi-Satellite Lambertian Equivalent Reflectivity (Local Satellite Time) Daily L3 Global 5.0deg Lat Zones V1

    Data.gov (United States)

    National Aeronautics and Space Administration — The Multi-Satellite Lambertian Equivalent Reflectivity (Local Satellite Time) Daily L3 Global 5.0deg Lat Zones data product (MSLERLSTL3zm) is derived from...

  10. Delayed vertebral diagnosed L4 pincer vertebral fracture, L2-L3 ruptured vertebral lumbar disc hernia, L5 vertebral wedge fracture - Case report

    Directory of Open Access Journals (Sweden)

    Balasa D

    2016-08-01

    Full Text Available An association between delayed ruptured lumbar disc hernia, L5 vertebral wedge fracture and posttraumaticL4 pincer vertebral fracture (A2.3-AO clasification at different levels is a very rare entity. We present the case of a 55 years old male who falled down from a bicycle. 2 months later because of intense and permanent vertebral lumbar and radicular L2 and L3 pain (Visual Scal Autologus of Pain7-8/10 the patient came to the hospital. He was diagnosed with pincer vertebral L4 fracture (A2.3-AO clasification and L2-L3 right ruptured lumbar disc hernia in lateral reces. The patient was operated (L2-L3 right fenestration, and resection of lumbar disc hernia, bilateral stabilisation, L3-L4-L5 with titan screws and postero-lateral bone graft L4 bilateral harvested from iliac crest.

  11. SBUV2/NOAA-17 Ozone (O3) Profile and Total Column Ozone Monthly L3 Global 5.0deg Lat Zones V1

    Data.gov (United States)

    National Aeronautics and Space Administration — The Solar Backscattered Ultra Violet (SBUV) from NOAA-17 Level-3 monthly zonal mean (MZM) product (SBUV2N17L3zm) is derived from the Level-2 retrieved ozone...

  12. ROV Dive Products Dataset for EX1502L3: Caribbean Exploration (ROV) on NOAA Ship Okeanos Explorer between 20150409 and 20150430

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Dataset of folders containing ROV dive products for each ROV dive performed during EX1502L3. The files within the folder are text, image, graph, comma-separated...

  13. GOZCARDS Source Nitrous Oxide 1 month L3 10 degree Zonal Means on a Vertical Pressure Grid V1 (GozSmlpN2O) at GES DISC

    Data.gov (United States)

    National Aeronautics and Space Administration — The GOZCARDS Source Data for Nitrous Oxide 1 month L3 10 degree Zonal Averages on a Vertical Pressure Grid product (GozSmlpN2O) contains zonal means and related...

  14. GOZCARDS Merged Nitrous Oxide 1 month L3 10 degree Zonal Means on a Vertical Pressure Grid V1 (GozMmlpN2O) at GES DISC

    Data.gov (United States)

    National Aeronautics and Space Administration — The GOZCARDS Merged Data for Nitrous Oxide 1 month L3 10 degree Zonal Averages on a Vertical Pressure Grid product (GozMmlpN2O) contains zonal means and related...

  15. SBUV2/NOAA-14 Ozone (O3) Profile and Total Column Ozone Monthly L3 Global 5.0deg Lat Zones V1

    Data.gov (United States)

    National Aeronautics and Space Administration — The Solar Backscattered Ultra Violet (SBUV) from NOAA-14 Level-3 monthly zonal mean (MZM) product (SBUV2N14L3zm) is derived from the Level-2 retrieved ozone...

  16. SBUV2/NOAA-18 Ozone (O3) Profile and Total Column Ozone Monthly L3 Global 5.0deg Lat Zones V1

    Data.gov (United States)

    National Aeronautics and Space Administration — The Solar Backscattered Ultra Violet (SBUV) from NOAA-18 Level-3 monthly zonal mean (MZM) product (SBUV2N18L3zm) is derived from the Level-2 retrieved ozone...

  17. SBUV2/NOAA-16 Ozone (O3) Profile and Total Column Ozone Monthly L3 Global 5.0deg Lat Zones V1

    Data.gov (United States)

    National Aeronautics and Space Administration — The Solar Backscattered Ultra Violet (SBUV) from NOAA-16 Level-3 monthly zonal mean (MZM) product (SBUV2N16L3zm) is derived from the Level-2 retrieved ozone...

  18. SBUV2/NOAA-11 Ozone (O3) Profile and Total Column Ozone Monthly L3 Global 5.0deg Lat Zones V1

    Data.gov (United States)

    National Aeronautics and Space Administration — The Solar Backscattered Ultra Violet (SBUV) from NOAA-11 Level-3 monthly zonal mean (MZM) product (SBUV2N11L3zm) is derived from the Level-2 retrieved ozone...

  19. SBUV/Nimbus-07 Ozone (O3) Profile and Total Column Ozone Monthly L3 Global 5.0deg Lat Zones V1

    Data.gov (United States)

    National Aeronautics and Space Administration — The Solar Backscattered Ultra Violet (SBUV) from Nimbus-7 Level-3 monthly zonal mean (MZM) product (SBUVN07L3zm) is derived from the Level-2 retrieved ozone...

  20. SBUV2/NOAA-09 Ozone (O3) Profile and Total Column Ozone Monthly L3 Global 5.0deg Lat Zones V1

    Data.gov (United States)

    National Aeronautics and Space Administration — The Solar Backscattered Ultra Violet (SBUV) from NOAA-9 Level-3 monthly zonal mean (MZM) product (SBUV2N17L3zm) is derived from the Level-2 retrieved ozone profiles....

  1. SBUV2/NOAA-19 Ozone (O3) Profile and Total Column Ozone Monthly L3 Global 5.0deg Lat Zones V1

    Data.gov (United States)

    National Aeronautics and Space Administration — The Solar Backscattered Ultra Violet (SBUV) from NOAA-19 Level-3 monthly zonal mean (MZM) product (SBUV2N19L3zm) is derived from the Level-2 retrieved ozone...

  2. BUV/Nimbus-04 Ozone (O3) Profile and Total Column Ozone Monthly L3 Global 5.0deg Lat Zones V1

    Data.gov (United States)

    National Aeronautics and Space Administration — The Solar Backscattered Ultra Violet (SBUV) from Nimbus-4 Level-3 monthly zonal mean (MZM) product (BUVN04L3zm) is derived from the Level-2 retrieved ozone profiles....

  3. TOMS/Nimbus-7 UV Reflectivity Monthly L3 Global 1x1.25 deg Lat/Lon Grid V008

    Data.gov (United States)

    National Aeronautics and Space Administration — This data product contains TOMS/Nimbus-7 UV Reflectivity Monthly L3 Global 1x1.25 deg Lat/Lon Grid Version 8 data in ASCII format. The Total Ozone Mapping...

  4. TMI/TRMM surface soil moisture (LPRM) L3 1 day 25 km x 25 km daytime V001 (LPRM_TMI_DY_SOILM3) at GES DISC

    Data.gov (United States)

    National Aeronautics and Space Administration — TMI/TRMM surface soil moisture (LPRM) L3 1 day 25 km x 25 km daytime V001 is a Level 3 (gridded) data set. Its land surface parameters, surface soil moisture, land...

  5. TMI/TRMM surface soil moisture (LPRM) L3 1 day 25 km x 25 km nighttime V001 (LPRM_TMI_NT_SOILM3) at GES DISC

    Data.gov (United States)

    National Aeronautics and Space Administration — TMI/TRMM surface soil moisture (LPRM) L3 1 day 25 km x 25 km nighttime V001 is Level 3 (gridded) data set. Its land surface parameters, surface soil moisture, land...

  6. GOZCARDS Source Water Vapor 1 month L3 10 degree Zonal Means on a Vertical Pressure Grid V1 (GozSmlpH2O) at GES DISC

    Data.gov (United States)

    National Aeronautics and Space Administration — The GOZCARDS Source Data for Water Vapor 1 month L3 10 degree Zonal Averages on a Vertical Pressure Grid product (GozSmlpH2O) contains zonal means and related...

  7. In vivo effects of monoclonal anti-L3T4 antibody on immune responsiveness of mice infected with Schistosoma mansoni. Reduction of irradiated cercariae-induced resistance

    Energy Technology Data Exchange (ETDEWEB)

    Kelly, E.A.; Colley, D.G.

    1988-04-15

    Mice can be partially protected against challenge infections of Schistosoma mansoni cercariae by either single or multiple exposure to irradiated cercariae (x-cerc). The participation of L3T4+ lymphocytes on this resistance phenomenon was evaluated by selectively depleting this cell population through in vivo administration of mAb anti-L3T4 at three different times in relationship to the challenge infections. Treatment with anti-L3T4 before challenge such that depletion was effective during the time of cercarial skin penetration and dermal/s.c. residence significantly reduced the level of resistance induced by x-cerc sensitization. When treatment was delayed until after challenge, depletion of L3T4+ cells coincided with either the lung or post-lung/liver phases of schistosomular migration, and normal levels of x-cerc-induced resistance were induced. In contrast to once-immunized mice, mice hyperimmunized by five exposures to x-cerc and then depleted of L3T4+ cells at the time of challenge still expressed resistance to the challenge. These data suggest that when mice are sensitized only once with x-cerc the challenge infection provides a necessary immunologic boost which requires L3T4+ cells for effective expression of resistance. The requirement for this anamnestic effect by the challenge infection can be circumvented by hyperimmunization. Evaluation of the immune response of one-time sensitized or hyperimmunized mice demonstrated that cellular Ag-specific proliferative responses and mitogen-induced lymphokine production were abrogated after any of the various in vivo regimens of anti-L3T4 antibody. In contrast, immunoblot analysis of humoral responsiveness revealed a correlation between the expression of resistance and the ability of sera from immunized and anti-L3T4 treated mice to recognize a 75-kDa parasite antigenic component.

  8. SUSCEPTIBILIDAD DE LOS ESTADIOS L2 Y L3 DE Phyllophaga elenans A UNA CEPA NATIVA DE Heterorhabditis sp. EN CONDICIONES DE INVERNADERO

    Directory of Open Access Journals (Sweden)

    Daniela Rodríguez

    2009-01-01

    dosis de 500 y 625 nematodos.larva-1 presentaron una mortalidad significativamente mayor que el control. La mortalidad mayor (24%, se obtuvo al día 30 con la dosis de 625 nematodos.larva-1. La diferencia observada en los porcentajes de infección entre larvas L2 y L3 puede deberse a mecanismos de defensa o escape que podrían actuar en el estadio larval L3 de P. elenans.

  9. Inter-string Bose-Einstein correlations in hadronic Z decays using the L3 detector at LEP

    CERN Document Server

    Wang, Qin

    2008-01-01

    Bose-Einstein Correlations (BEC) of identical bosons can be used for the femtoscopy of the pro- duction properties of bosons in high energy particle collisions. This quantum mechanical BEC effect is a direct consequence of the symmetrization of the wave function of a boson system and is frequently used on photons in Astophysics to measure the angular size and other properties of distant stars. In particle collisions, the effect can be observed experimentally as an enhancement of the production of identical bosons with small four-momentum difference Q relative to a production that would occur in a world without Bose-Einstein statistics. In this thesis, BEC are studied between identical pions produced in electron-positron collisions at a center-of-mass energy of 91 GeV in the LEP e+ e− Collider of CERN, near Geneva. The final-state particles of these collisions are detected in the detector of the L3 experiment, which is positioned at one of the four intersections of LEP. According to the present picture of bo...

  10. Glycosylation of phenolic compounds by the site-mutated β-galactosidase from Lactobacillus bulgaricus L3.

    Directory of Open Access Journals (Sweden)

    Lili Lu

    Full Text Available β-Galactosidases can transfer the galactosyl from lactose or galactoside donors to various acceptors and thus are especially useful for the synthesis of important glycosides. However, these enzymes have limitations in the glycosylation of phenolic compounds that have many physiological functions. In this work, the β-galactosidase from Lactobacillus bulgaricus L3 was subjected to site-saturation mutagenesis at the W980 residue. The recombinant pET-21b plasmid carrying the enzyme gene was used as the template for mutation. The mutant plasmids were transformed into Escherichia coli cells for screening. One recombinant mutant, W980F, exhibited increased yield of glycoside when using hydroquinone as the screening acceptor. The enzyme was purified and the effects of the mutation on enzyme properties were determined in detail. It showed improved transglycosylation activity on novel phenolic acceptors besides hydroquinone. The yields of the glycosides produced from phenol, hydroquinone, and catechol were increased by 7.6% to 53.1%. Moreover, it generated 32.3% glycosides from the pyrogallol that could not be glycosylated by the wild-type enzyme. Chemical structures of these glycoside products were further determined by MS and NMR analysis. Thus, a series of novel phenolic galactosides were achieved by β-galactosidase for the first time. This was a breakthrough in the enzymatic galactosylation of the challenging phenolic compounds of great values.

  11. STAR-CCM+ (CFD) Calculations and Validation L3:VVI.H2L.P15.02

    Energy Technology Data Exchange (ETDEWEB)

    Gilkey, Lindsay [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2017-09-05

    This milestone presents a demonstration of the High-to-Low (Hi2Lo) process in the VVI focus area. Validation and additional calculations with the commercial computational fluid dynamics code, STAR-CCM+, were performed using a 5x5 fuel assembly with non-mixing geometry and spacer grids. This geometry was based on the benchmark experiment provided by Westinghouse. Results from the simulations were compared to existing experimental data and to the subchannel thermal-hydraulics code COBRA-TF (CTF). An uncertainty quantification (UQ) process was developed for the STAR-CCM+ model and results of the STAR UQ were communicated to CTF. Results from STAR-CCM+ simulations were used as experimental design points in CTF to calibrate the mixing parameter β and compared to results obtained using experimental data points. This demonstrated that CTF’s β parameter can be calibrated to match existing experimental data more closely. The Hi2Lo process for the STAR-CCM+/CTF code coupling was documented in this milestone and closely linked L3:VVI.H2LP15.01 milestone report.

  12. Measurement of the hadronic photon structure function F(2)(gamma) with the L3 detector at LEP

    CERN Document Server

    Baksay, Liza Gyongyi

    2005-01-01

    The photon is one of the basic components of our present understanding of elementary particles and their interactions. The theory of Quantum Electrodynamics describes this object as being the mediator of the electromagnetic force between charged particles. Contrary to earlier assumptions the photon turns out to have a "structure" due to quantum fluctuations into fermion anti-fermion pairs that can further interact with other particles. In this case the photon reveals its structure. The structure of the photon can be described by the concept of photon structure functions, which are studied at high energy accelerators like the Large Electron Positron Collider at the European Center for Particle Physics. With the large amount of data (L = 608 pb-1) collected with the L3 detector at center-of-mass energies 189 GeV < s < 209 GeV and the analysis method used in this dissertation, a measurement of the hadronic structure function F2gamma (x,Q2)/alpha is obtained with better precision than previous measurements....

  13. VizieR Online Data Catalog: 05 through L3 empirical stellar spectra from SDSS (Kesseli+, 2017)

    Science.gov (United States)

    Kesseli, A. Y.; West, A. A.; Veyette, M.; Harrison, B.; Feldman, D.; Bochanski, J. J.

    2017-08-01

    We present a library of empirical stellar spectra created using spectra from the Sloan Digital Sky Survey's Baryon Oscillation Spectroscopic Survey. The templates cover spectral types O5 through L3, are binned by metallicity from -2.0dex through +1.0dex, and are separated into main-sequence (dwarf) stars and giant stars. With recently developed M dwarf metallicity indicators, we are able to extend the metallicity bins down through the spectral subtype M8, making this the first empirical library with this degree of temperature and metallicity coverage. The wavelength coverage for the templates is from 3650 to 10200Å at a resolution of better than R~2000. Using the templates, we identify trends in color space with metallicity and surface gravity, which will be useful for analyzing large data sets from upcoming missions like the Large Synoptic Survey Telescope. Along with the templates, we are releasing a code for automatically (and/or visually) identifying the spectral type and metallicity of a star. (3 data files).

  14. A Back-to-Back 2L-3L Grid Integration of a Marine Current Energy Converter

    Directory of Open Access Journals (Sweden)

    Senad Apelfröjd

    2015-01-01

    Full Text Available The paper proposes a back-to-back 2L-3L grid connection topology for a marine current energy converter. A prototype marine current energy converter has been deployed by a research group at Uppsala University. The concept behind the prototype revolves around a fixed pitch vertical axis turbine directly connected to a permanent magnet synchronous generator (PMSG. The proposed grid connection system utilizes a well known and proven two level voltage source converter generator-side combined with a three-level cascaded H-bridge (CHB multilevel converter grid-side. The multilevel converter brings benefits in terms of efficiency, power quality and DC-link utilization. The system is here presented for a single marine current energy converter but can easily be scaled up for clusters of marine current energy converters. Control schemes for both grid-side and generator-side voltage source converters are presented. The start-up, steady state and dynamic performance of the marine current energy converter are investigated and simulation results are presented in this paper.

  15. [Perforation of small intestinal during hematologic recovery in an elderly man after induction therapy for acute lymphoblastic leukemia L3].

    Science.gov (United States)

    Bohgaki, T; Notoya, A; Mukai, M; Kohno, M

    2000-02-01

    A 67-year-old man with a 7-month history of dilated cardiomyopathy was admitted to our hospital because of general fatigue, shortness of breath, and anemia on laboratory examination. Increased blasts were observed in the bone marrow. The blasts were characterized by large cells with abundant, intensely basophilic, vacuolated cytoplasm, round nuclei, and prominent nucleoli. Chromosome analysis revealed a nonrandom t(8;22)(q24;q11) chromosomal abnormality, and surface-marker analysis disclosed a positive immunophenotype for CD10, CD19, CD20, CD38, HLA-DR, FMC7, and IgM-lambda. These findings yielded a diagnosis of L3 acute lymphoblastic leukemia. The patient was treated with chemotherapeutic agents. On the 39th hospital day, during hematologic recovery after induction therapy, abdominal pain developed. Abdominal X-ray films disclosed ileus with dilatation of the small bowel and Kerckring's folds. Conservative treatment was begun but the patient died. At autopsy, intestinal perforations were observed at a site 55 cm proximal to the ileocecal junction. A specimen of perforated tissue revealed a diffuse infiltration of leukemic cells through the small bowel wall. However, bone marrow specimens showed no signs of aggravation of leukemia.

  16. Terahertz spectroscopy of crystal-field transitions in magnetoelectric TmA l3(BO3)4

    Science.gov (United States)

    Kuzmenko, A. M.; Mukhin, A. A.; Ivanov, V. Yu.; Komandin, G. A.; Shuvaev, A.; Pimenov, A.; Dziom, V.; Bezmaternykh, L. N.; Gudim, I. A.

    2016-11-01

    Dynamic magnetic properties of magnetoelectric TmA l3(BO3)4 borate have been investigated by terahertz spectroscopy. Crystal-field transitions within the ground multiplet 3H6 of T m3 + ions are observed and they are identified as magnetic-dipole transitions from the ground singlet A1 to the next excited doublet E of T m3 + ions. Unexpected fine structure of the transitions is detected at low temperatures. The new modes are assigned to local distortions of the sites with D3 symmetry by B i3 + impurities, which resulted in the splitting of the A1→E transition. Two types of locally distorted sites are identified and investigated. The main contribution to the static magnetic susceptibility is shown to be determined by the matrix elements of the observed magnetic transitions. We demonstrate that even in case of local distortions the symmetry of the undistorted crystal is recovered for magnetic and for quadratic magnetoelectric susceptibilities.

  17. Photochemical interaction between the triplet state of 8-methoxypsoralen and the melanin precursor L-3,4 dihydroxyphenylalanine

    Energy Technology Data Exchange (ETDEWEB)

    Craw, M.; Truscott, T.G. (Paisley Coll. of Technology (UK)); Chedekel, M.R. (Johns Hopkins Univ., Baltimore, MD (USA). School of Hygiene and Public Health); Land, E.J. (Christie Hospital and Holt Radium Inst., Manchester (UK). Paterson Labs.)

    1984-02-01

    The photochemical interaction between 8-methoxypsoralen (8-MOP) and the melanin precursor L-3,4-dihydroxyphenylalanine (dopaH/sub 2/) has been studied using laser flash photolysis. Triplet excited 8-MOP was thus found to abstract electrons from dopaH/sub 2/ (k approx. 2 x 10/sup 9/ dm/sup 3/ mol/sup -1/ s/sup -1/) to form semireduced 8-MOP and semioxidised dopaH/sub 2/. The technique of pulse radiolysis was used to establish separately the spectra of (a) the semi-reduced form of 8-MOP at pH 6.5 and (b) the semioxidised forms of dopaH/sub 2/ at pH 6.5, 5.8, 4.6 and 3.3. The corresponding lambdasub(max) and extinction coefficients found were: for 8-MOP/sup -/ radical at pH 6.5, lambdasub(max) = 350 nm (epsilon = 9050 dm/sup 3/ mol/sup -1/ cm/sup -1/); for dopa/sup -/ radical at pH 6.5, lambdasub(max) = 305 nm (epsilon = 12000 dm/sup 3/ mol/sup -1/ cm/sup -1/) and for dopaH radical at pH 3.3, lambda = 305 nm (epsilon = 5900 dm/sup 3/ mol/sup -1/ cm/sup -1/).

  18. Identification of (L)-3-hydroxykynurenine O-sulfate in the buccal gland secretion of the parasitic lamprey, Lethenteron japonicum.

    Science.gov (United States)

    Odani, Shoji; Ito, Naoko; Hasegawa, Mai; Uchiumi, Toshio; Hase, Sumihiro

    2012-12-01

    Parasitic lampreys are known to secrete proteins having anticoagulant and vasodilator activities from the buccal glands during feeding on their host's blood. However, small molecules in the secretion have never been explored in detail. We examined the secretion of Japanese liver lamprey (Lethenteron japonicum) for small molecules and found an intensely fluorescent substance upon gel filtration. After purification by anion-exchange chromatography and reversed-phase HPLC, structure of the compound was determined to be L-3-hydroxykynurenine O-sulfate by NMR- and UV-spectrometry, complemented with enzymatic and chemical degradation. In vertebrates, the sulfate ester of 3-hydroxykynurenine is a compound that has been regarded as a urinary metabolite of tryptophan but not reported from normal tissues to date. Although the function of this molecule in the buccal glands remains to be elucidated, it is remarkable that the same substance was described in 1960s from two species of blood-sucking insects, Rhodnius prolixus and Triatoma infestans, suggesting its potential role in blood-feeding.

  19. Plankton diversity and aquatic ecology of a freshwater lake (L3 at Bharti Island, Larsemann Hills, east Antarctica

    Directory of Open Access Journals (Sweden)

    Pawan K. Bharti

    2015-04-01

    Full Text Available The Larsemann Hills range is an ice-free oasis on the Ingrid Christensen Coast of Princess Elizabeth Land, East Antarctica, which includes Bharti Island, Fisher Island, McLeod Island, Broknes Peninsula, Stornes Peninsula, and several other islands, promontories, and nunataks. The Larsemann Hills is an ice-free area of approximately 50 km2, located halfway between the Vestfold Hills and the Amery Ice Shelf on the south-eastern coast of Prydz Bay, Princess Elizabeth Land, East Antarctica. The ice-free area consists of two major peninsulas (Stornes and Broknes, four minor peninsulas, and approximately 130 near shore islands. The Larsemann Hills area contains more than 150 lakes at different Islands and peninsulas. Bharti Island of Larsemann Hills in east Antarctica was selected as a sampling site for the present study. Water sample was collected from a freshwater lake during XXXth Indian Scientific Expedition to Antarctica (ISEA and analyzed for the physico-chemical parameters, major elements, trace metals and major plankton diversity in surface lake water by following standard methodology. The concentrations of metals Cu, Pb, Cd, Zn and Cr were measured using Inductively Coupled Plasma Optical Emission Spectroscopy (ICP-OES. Phytoplankton and zooplankton were also assessed in the aquatic ecosystem of Lake L3 at Bharti Island, Larsemann Hills over east Antarctica. Psychrophillic bacteria were found 71 cfu in lake water, while total bacterial count was found to be 5.4 × 102cfu.

  20. Alpha-fetoprotein-L3 and Golgi protein 73 may serve as candidate biomarkers for diagnosing alpha-fetoprotein-negative hepatocellular carcinoma

    Directory of Open Access Journals (Sweden)

    Zhang ZG

    2015-12-01

    Full Text Available Zhiguo Zhang,1 Yanying Zhang,2 Yeying Wang,1 Lingling Xu,3 Wanju Xu3 1Department of Clinical Laboratory, Zhangqiu Maternity and Child Care Hospital, Zhangqiu, 2Department of Clinical Laboratory, Zaozhuang City Wangkai Infection Hospital, Zaozhuang, 3Department of Clinical Laboratory, Qianfoshan Hospital, Jinan, People’s Republic of China Abstract: Currently, there is no reliable biomarker for use in diagnosing alpha-fetoprotein (AFP-negative hepatocellular carcinoma (HCC. Such a biomarker would aid in making an early diagnosis of AFP-negative HCC, ensuring the timely initiation of treatment. This study examined AFP-L3 and Golgi protein 73 (GP73 as candidate biomarkers for AFP-negative HCC. The affinity adsorption method and enzyme-linked immunoassays were separately used to determine serum levels of AFP-L3 and GP73 in 50 patients with AFP-negative HCC, 30 non-HCC patients, and 50 healthy subjects. Fifty percent of patients with AFP-negative HCC tested positive for AFP-L3, while 3.33% of non-HCC patients and 2.00% of healthy subjects were AFP-L3 positive. Patients with AFP-negative HCC had significantly higher serum levels of AFP-L3 compared to non-HCC patients and healthy individuals; however, there was no significant difference in the AFP-L3 levels of non-HCC patients and healthy subjects. Sixty-six percent of patients with AFP-negative HCC tested positive for GP73, while 10% of non-HCC patients and 0% of healthy subjects were GP73-positive. Patients with AFP-negative HCC had significantly higher serum levels of GP73 compared to non-HCC patients and healthy subjects, but there was no significant difference between the GP73 levels of non-HCC patients and healthy individuals. Moreover, 20 patients with AFP-negative HCC were both AFP-L3- and GP73-positive, while no non-HCC patients or healthy subjects tested positive for both markers. Either AFP-L3 or GP73 may be used as a biomarker for diagnosing AFP-negative HCC, while their combined use

  1. The Polycomb Group Protein L3MBTL1 Represses a SMAD5-Mediated Hematopoietic Transcriptional Program in Human Pluripotent Stem Cells

    Directory of Open Access Journals (Sweden)

    Fabiana Perna

    2015-04-01

    Full Text Available Epigenetic regulation of key transcriptional programs is a critical mechanism that controls hematopoietic development, and, thus, aberrant expression patterns or mutations in epigenetic regulators occur frequently in hematologic malignancies. We demonstrate that the Polycomb protein L3MBTL1, which is monoallelically deleted in 20q- myeloid malignancies, represses the ability of stem cells to drive hematopoietic-specific transcriptional programs by regulating the expression of SMAD5 and impairing its recruitment to target regulatory regions. Indeed, knockdown of L3MBTL1 promotes the development of hematopoiesis and impairs neural cell fate in human pluripotent stem cells. We also found a role for L3MBTL1 in regulating SMAD5 target gene expression in mature hematopoietic cell populations, thereby affecting erythroid differentiation. Taken together, we have identified epigenetic priming of hematopoietic-specific transcriptional networks, which may assist in the development of therapeutic approaches for patients with anemia.

  2. Do L2 French or L2 English learners write better L3 German texts? The in-fluence of prior foreign language study on L3 German writing skills: the GaE/F Project

    Directory of Open Access Journals (Sweden)

    Lennart Bartelheimer

    2017-04-01

    Full Text Available Many learners of German as a foreign language (L3 are learning English or French as L2 before commencing their study of German, especially students from countries where English or French is, among other languages, the second official language or a common language in the educational system. For example: Among the approximately 219.000 non-German students who, in 2014, studied at German universities 38.000 were from China or India (L2 English and 11.000 were from Cameroon or Morocco (L2 French (DAAD 2015: 14-15. University-level German instructors at the Technische Universität Darmstadt have reported a higher level of competence in producing German texts by students who have learned French as L2 before German than those who have learned English as L2. Multilingualism researchers have investigated the impact of prior foreign language study on the learning of other languages. These influences include the learner’s personal experiences while learning a foreign language, the development of individual learning strategies and the ability to self-motivate. Just as important, however, are the structural and cultural aspects that affect the learning of additional foreign languages, namely the structural differences between the languages to be studied compared to already mastered languages, the teaching and learning culture and, last but not least, the intercultural differences in the norms governing the production of text types (cf. e.g. Herdina & Jessner 2002; Hufeisen 2002, 2010; Jessner 2006; Mißler 2000. On this basis, the project “German as a foreign language after English or French” (GaE/F [Deutsch als Fremdsprache nach Englisch oder Französisch (DaFnE/F] was initiated to investigate how the learning of L2 English or L2 French may affect the learning of L3 German, and, in particular, how it influences the production of appropriate German language texts as assessed by native speakers. It will investigate which linguistic features can be found

  3. L-3,4-Dihydroxyphenylalanine (l-DOPA) induces neuroendocrinological, physiological, and immunological regulation in white shrimp, Litopenaeus vannamei.

    Science.gov (United States)

    Mapanao, Ratchaneegorn; Kuo, Hsin-Wei; Chang, Chin-Chuan; Liu, Kuan-Fu; Cheng, Winton

    2018-01-03

    L-3,4-Dihydroxyphenylalanine (l-DOPA) is a precursor for dopamine (DA) synthesis. Assessments were conducted to analyze the effects of l-DOPA on mediating regulation of neuroendocrinological, immunological, and physiological parameters in the shrimp, Litopenaeus vannamei when they were individually injected with 0.01 N HCl or l-DOPA at 0.5 or 1.0 μmol shrimp -1 for 60, 120, and 240 min. For catecholamine synthesis evaluation, tyrosine hydroxylase (TH) and DA beta hydroxylase (DBH) activities, l-DOPA, DA, and norepinephrine (NE) levels in hemolymph were determined. The total hemocyte count (THC), differential hemocyte count (DHC), phenoloxidase (PO) activity, respiratory bursts (RBs), superoxide dismutase (SOD) activity, phagocytic activity, and clearance efficiency in response to the pathogen, Vibrio alginolyticus were assessed for immune responses, and plasma glucose and lactate levels were for physiological response. Results showed that the TH activity, THC, hyaline cells (HCs), and semigranular cells (SGCs) at 120 min, DA levels at 60-240 min, PO activity in hemocytes per 50 μL of hemolymph at 60-120 min, and PO activity per granulocyte (granular cells (GCs) + SGCs) at 60 min significantly increased, but TH activity, l-DOPA levels, GCs, SGCs, and respiratory bursts in hemocytes per 10 μL of hemolymph at 60 min, respiratory bursts per hemocyte and SOD activity at 120 min, phagocytic activity at 60-240 min, and the clearance efficiency at 60-120 min significantly decreased in shrimp injected with l-DOPA at 1.0 μmol shrimp -1 . In another experiment, 60 min after shrimp had received l-DOPA at 0.5 or 1.0 μmol shrimp -1 , they were challenged with an injection of V. alginolyticus at 2 × 10 5  colony-forming units (cfu) shrimp -1 . The injection of l-DOPA at 1.0 μmol shrimp -1 also significantly increased the cumulative mortality of shrimp by 16.7%, compared to the HCl-challenged control after 120 h. These results suggest

  4. Diagnostic value of Joint Detection of GP73 and AFP-L3 in Primary Hepatic Carcinoma with Low Concentration of AFP

    Directory of Open Access Journals (Sweden)

    Lei CAI

    2015-03-01

    Full Text Available Objective: To explore the applicative value of serum Golgi protein (GP73 and alpha-proteinvariant (AFP-L3 in the diagnosis of patients with primary hepatic carcinoma (PHC. Methods:Totally 110 patients were enrolled, including 60 PHC patients with low concentration of AFP ((1.1-108.0 μg/L and 50 patients with non-PHC digestive system diseases (20 cases of patients with chronic hepatitis, 15 patients with liver cirrhosis, 4 patients with bile duct cancer, 4 patients with gastric cancer, 4 patients with rectal cancer and 3 patients with colon cancer. In addition, 42 healthy people were selected as control group. GP73 was detected by enzyme-linked immunosorbent assay (ELISA trace centrifugal column method was adopted for separation of AFP-L3. Luo's chemiluminescence method was used to determine the total content of AFP and AFP-L3 in eluent for calculating the ratio of AFP-L3/ AFP. Results: The levels of serum GP73 and AFP-L3(% in PHC group were significantly higher than the other 2 groups (P<0.01 and the level of serum GP73 and AFP-L3 (% in Non-PHC group were higher than those in healthy group (P<0.01. ROC analysis showed that the area under ROC curve of single GP73 and AFP-L3(% in diagnosis of PHC and non-PHC were 0.887 and 0.860, respectively. Additionally, the ROC analysis also showed that critical value of GP73 and AFP-L3 for the diagnosis of HPC were 83.78 μg/L and 13.87%, respectively. The sensitivity of joint detection of serum GP73 or AFP-L3 was higher than detection of them alone (90.0 vs. 71.7 and 60.0, P<0.05 but the specificity was similar between single detection and joint detection (P>0.05. The positive predictive value and negative predictive value of joint detection of them was higher than single detections of them and there was significant differences in negative predictive value (P<0.05 but no difference in positive predictive value (P>0.05. The overall response rate of joint detection of GP73 and AFP-L3 was higher

  5. Mosquito transcriptome profiles and filarial worm susceptibility in Armigeres subalbatus.

    Directory of Open Access Journals (Sweden)

    Matthew T Aliota

    2010-04-01

    Full Text Available Armigeres subalbatus is a natural vector of the filarial worm Brugia pahangi, but it kills Brugia malayi microfilariae by melanotic encapsulation. Because B. malayi and B. pahangi are morphologically and biologically similar, comparing Ar. subalbatus-B. pahangi susceptibility and Ar. subalbatus-B. malayi refractoriness could provide significant insight into recognition mechanisms required to mount an effective anti-filarial worm immune response in the mosquito, as well as provide considerable detail into the molecular components involved in vector competence. Previously, we assessed the transcriptional response of Ar. subalbatus to B. malayi, and now we report transcriptome profiling studies of Ar. subalbatus in relation to filarial worm infection to provide information on the molecular components involved in B. pahangi susceptibility.Utilizing microarrays, comparisons were made between mosquitoes exposed to B. pahangi, B. malayi, and uninfected bloodmeals. The time course chosen facilitated an examination of key events in the development of the parasite, beginning with the very start of filarial worm infection and spanning to well after parasites had developed to the infective stage in the mosquito. At 1, 3, 6, 12, 24 h post infection and 2-3, 5-6, 8-9, and 13-14 days post challenge there were 31, 75, 113, 76, 54, 5, 3, 13, and 2 detectable transcripts, respectively, with significant differences in transcript abundance (increase or decrease as a result of parasite development.Herein, we demonstrate that filarial worm susceptibility in a laboratory strain of the natural vector Ar. subalbatus involves many factors of both known and unknown function that most likely are associated with filarial worm penetration through the midgut, invasion into thoracic muscle cells, and maintenance of homeostasis in the hemolymph environment. The data show that there are distinct and separate transcriptional patterns associated with filarial worm susceptibility

  6. Mosquito infection responses to developing filarial worms.

    Directory of Open Access Journals (Sweden)

    Sara M Erickson

    2009-10-01

    Full Text Available Human lymphatic filariasis is a mosquito-vectored disease caused by the nematode parasites Wuchereria bancrofti, Brugia malayi and Brugia timori. These are relatively large roundworms that can cause considerable damage in compatible mosquito vectors. In order to assess how mosquitoes respond to infection in compatible mosquito-filarial worm associations, microarray analysis was used to evaluate transcriptome changes in Aedes aegypti at various times during B. malayi development. Changes in transcript abundance in response to the different stages of B. malayi infection were diverse. At the early stages of midgut and thoracic muscle cell penetration, a greater number of genes were repressed compared to those that were induced (20 vs. 8. The non-feeding, intracellular first-stage larvae elicited few differences, with 4 transcripts showing an increased and 9 a decreased abundance relative to controls. Several cecropin transcripts increased in abundance after parasites molted to second-stage larvae. However, the greatest number of transcripts changed in abundance after larvae molted to third-stage larvae and migrated to the head and proboscis (120 induced, 38 repressed, including a large number of putative, immunity-related genes (approximately 13% of genes with predicted functions. To test whether the innate immune system of mosquitoes was capable of modulating permissiveness to the parasite, we activated the Toll and Imd pathway controlled rel family transcription factors Rel1 and Rel2 (by RNA interference knockdown of the pathway's negative regulators Cactus and Caspar during the early stages of infection with B. malayi. The activation of either of these immune signaling pathways, or knockdown of the Toll pathway, did not affect B. malayi in Ae. aegypti. The possibility of LF parasites evading mosquito immune responses during successful development is discussed.

  7. TOMS/Nimbus-7 UV Reflectivity Daily L3 Global 1x1.25 deg Lat/Lon Grid V008

    Data.gov (United States)

    National Aeronautics and Space Administration — This data product contains TOMS/Nimbus-7 UV Reflectivity Daily L3 Global 1x1.25 deg Lat/Lon Grid Version 8 data in ASCII format. The Total Ozone Mapping Spectrometer...

  8. TOMS/Nimbus-7 UV Aerosol Index Monthly L3 Global 1x1.25 deg Lat/Lon Grid V008

    Data.gov (United States)

    National Aeronautics and Space Administration — This data product contains TOMS/Nimbus-7 UV Aerosol Index Monthly L3 Global 1x1.25 deg Lat/Lon Grid Version 8 data in ASCII format. The Total Ozone Mapping...

  9. TOMS/Nimbus-7 Total Column Ozone Daily L3 Global 1x1.25 deg Lat/Lon Grid V008

    Data.gov (United States)

    National Aeronautics and Space Administration — This data product contains TOMS/Nimbus-7 Total Column Ozone Daily L3 Global 1x1.25 deg Lat/Lon Grid Version 8 data in ASCII format. The Total Ozone Mapping...

  10. TOMS/Nimbus-7 UV-B Erythemal Local Noon Irradiance Monthly L3 Global 1x1.25 deg Lat/Lon Grid V008

    Data.gov (United States)

    National Aeronautics and Space Administration — This data product contains TOMS/Nimbus-7 UV-B Erythemal Local Noon Irradiance Monthly L3 Global 1x1.25 deg Lat/Lon Grid Version 8 data in ASCII format. The Total...

  11. Multi-Satellite Lambertian Equivalent Reflectivity (Local Satellite Time) 10-Day L3 Global 2.0x5.0deg Lat/Lon Grid V1

    Data.gov (United States)

    National Aeronautics and Space Administration — The Multi-Satellite Lambertian Equivalent Reflectivity (Local Satellite Time) 10-Day L3 Global 2.0x5.0deg Lat/Lon Grid data product is derived from multi-satellite...

  12. TOMS/Earth Probe UV Reflectivity Monthly L3 Global 1x1.25 deg Lat/Lon Grid V008

    Data.gov (United States)

    National Aeronautics and Space Administration — This data product contains TOMS/Earth Probe UV Reflectivity Monthly L3 Global 1x1.25 deg Lat/Lon Grid Version 8 data in ASCII format. (The shortname for this Level-3...

  13. Multi-Satellite Lambertian Equivalent Reflectivity (Noon Normalized) 10-Day L3 Global 2.0x5.0deg Lat/Lon Grid V1

    Data.gov (United States)

    National Aeronautics and Space Administration — The Multi-Satellite Lambertian Equivalent Reflectivity (Noon Normalized) 10-Day L3 Global 2.0x5.0deg Lat/Lon Grid data product is derived from multi-satellite Solar...

  14. TOMS/Nimbus-7 UV-B Erythemal Local Noon Irradiance Daily L3 Global 1x1.25 deg Lat/Lon Grid V008

    Data.gov (United States)

    National Aeronautics and Space Administration — This data product contains TOMS/Nimbus-7 UV-B Erythemal Local Noon Irradiance Daily L3 Global 1x1.25 deg Lat/Lon Grid Version 8 data in ASCII format. The Total Ozone...

  15. TOMS/Earth Probe UV Aerosol Index Monthly L3 Global 1x1.25 deg Lat/Lon Grid V008

    Data.gov (United States)

    National Aeronautics and Space Administration — This data product contains TOMS/Earth Probe UV Aerosol Index Monthly L3 Global 1x1.25 deg Lat/Lon Grid Version 8 data in ASCII format. (The shortname for this...

  16. TOMS/Earth Probe UV-B Erythemal Local Noon Irradiance Daily L3 Global 1x1.25 deg Lat/Lon Grid V008

    Data.gov (United States)

    National Aeronautics and Space Administration — This data product contains TOMS/Earth Probe UV-B Erythemal Local Noon Irradiance Daily L3 Global 1x1.25 deg Lat/Lon Grid Version 8 data in ASCII format. (The...

  17. TOMS/Earth Probe Total Column Ozone Monthly L3 Global 1x1.25 deg Lat/Lon Grid V008

    Data.gov (United States)

    National Aeronautics and Space Administration — This data product contains TOMS/Earth Probe Total Column Ozone Monthly L3 Global 1x1.25 deg Lat/Lon Grid Version 8 data in ASCII format. (The shortname for this...

  18. TOMS/Earth Probe UV-B Erythemal Local Noon Irradiance Monthly L3 Global 1x1.25 deg Lat/Lon Grid V008

    Data.gov (United States)

    National Aeronautics and Space Administration — This data product contains TOMS/Earth Probe UV-B Erythemal Local Noon Irradiance Monthly L3 Global 1x1.25 deg Lat/Lon Grid Version 8 data in ASCII format. (The...

  19. TOMS/Earth Probe Total Column Ozone Daily L3 Global 1x1.25 deg Lat/Lon Grid V008

    Data.gov (United States)

    National Aeronautics and Space Administration — This data product contains TOMS/Earth Probe Total Column Ozone Daily L3 Global 1x1.25 deg Lat/Lon Grid Version 8 data in ASCII format. (The shortname for this...

  20. TOMS/Earth Probe UV Aerosol Index Daily L3 Global 1x1.25 deg Lat/Lon Grid V008

    Data.gov (United States)

    National Aeronautics and Space Administration — This data product contains TOMS/Earth Probe UV Aerosol Index Daily L3 Global 1x1.25 deg Lat/Lon Grid Version 8 data in ASCII format. (The shortname for this Level-3...

  1. TOMS/Earth Probe UV Reflectivity Daily L3 Global 1x1.25 deg Lat/Lon Grid V008

    Data.gov (United States)

    National Aeronautics and Space Administration — This data product contains TOMS/Earth Probe UV Reflectivity Daily L3 Global 1x1.25 deg Lat/Lon Grid Version 8 data in ASCII format. (The shortname for this Level-3...

  2. TOMS/Nimbus-7 Total Column Ozone Monthly L3 Global 1x1.25 deg Lat/Lon Grid V008

    Data.gov (United States)

    National Aeronautics and Space Administration — This data product contains TOMS/Nimbus-7 Total Column Ozone Monthly L3 Global 1x1.25 deg Lat/Lon Grid Version 8 data in ASCII format. The Total Ozone Mapping...

  3. Fracture of the L-4 vertebral body after use of a stand-alone interbody fusion device in degenerative spondylolisthesis for anterior L3-4 fixation.

    Science.gov (United States)

    Kwon, Yoon-Kwang; Jang, Ju-Hee; Lee, Choon-Dae; Lee, Sang-Ho

    2014-06-01

    Many studies attest to the excellent results achieved using anterior lumbar interbody fusion (ALIF) for degenerative spondylolisthesis. The purpose of this report is to document a rare instance of L-4 vertebral body fracture following use of a stand-alone interbody fusion device for L3-4 ALIF. The patient, a 55-year-old man, had suffered intractable pain of the back, right buttock, and left leg for several weeks. Initial radiographs showed Grade I degenerative spondylolisthesis, with instability in the sagittal plane (upon 15° rotation) and stenosis of central and both lateral recesses at the L3-4 level. Anterior lumbar interbody fusion of the affected vertebrae was subsequently conducted using a stand-alone cage/plate system. Postoperatively, the severity of spondylolisthesis diminished, with resolution of symptoms. However, the patient returned 2 months later with both leg weakness and back pain. Plain radiographs and CT indicated device failure due to anterior fracture of the L-4 vertebral body, and the spondylolisthesis had recurred. At this point, bilateral facetectomies were performed, with reduction/fixation of L3-4 by pedicle screws. Again, degenerative spondylolisthesis improved postsurgically and symptoms eased, with eventual healing of the vertebral body fracture. This report documents a rare instance of L-4 vertebral body fracture following use of a stand-alone device for ALIF at L3-4, likely as a consequence of angular instability in degenerative spondylolisthesis. Under such conditions, additional pedicle screw fixation is advised.

  4. Prolonged response to calling songs by the L3 auditory interneuron in female crickets (Acheta domesticus): possible roles in regulating phonotactic threshold and selectiveness for call carrier frequency.

    Science.gov (United States)

    Bronsert, Michael; Bingol, Hilary; Atkins, Gordon; Stout, John

    2003-03-01

    L3, an auditory interneuron in the prothoracic ganglion of female crickets (Acheta domesticus) exhibited two kinds of responses to models of the male's calling song (CS): a previously described, phasically encoded immediate response; a more tonically encoded prolonged response. The onset of the prolonged response required 3-8 sec of stimulation to reach its maximum spiking rate and 6-20 sec to decay once the calling song ceased. It did not encode the syllables of the chirp. The prolonged response was sharply selective for the 4-5 kHz carrier frequency of the male's calling songs and its threshold tuning matched the threshold tuning of phonotaxis, while the immediate response of the same neuron was broadly tuned to a wide range of carrier frequencies. The thresholds for the prolonged response covaried with the changing phonotactic thresholds of 2- and 5-day-old females. Treatment of females with juvenile hormone reduced the thresholds for both phonotaxis and the prolonged response by equivalent amounts. Of the 3 types of responses to CSs provided by the ascending L1 and L3 auditory interneurons, the threshold for L3's prolonged response, on average, best matched the same females phonotactic threshold. The prolonged response was stimulated by inputs from both ears while L3's immediate response was driven only from its axon-ipsilateral ear. The prolonged response was not selective for either the CS's syllable period or chirp rate. Copyright 2003 Wiley-Liss, Inc.

  5. The histone H4 lysine 20 monomethyl mark, set by PR-Set7 and stabilized by L(3mbt, is necessary for proper interphase chromatin organization.

    Directory of Open Access Journals (Sweden)

    Ayako Sakaguchi

    Full Text Available Drosophila PR-Set7 or SET8 is a histone methyltransferase that specifically monomethylates histone H4 lysine 20 (H4K20. L(3MBT has been identified as a reader of methylated H4K20. It contains several conserved domains including three MBT repeats binding mono- and dimethylated H4K20 peptides. We find that the depletion of PR-Set7 blocks de novo H4K20me1 resulting in the immediate activation of the DNA damage checkpoint, an increase in the size of interphase nuclei, and drastic reduction of cell viability. L(3mbt on the other hand stabilizes the monomethyl mark, as L(3mbt-depleted S2 cells show a reduction of more than 60% of bulk monomethylated H4K20 (H4K20me1 while viability is barely affected. Ploidy and basic chromatin structure show only small changes in PR-Set7-depleted cells, but higher order interphase chromatin organization is significantly affected presumably resulting in the activation of the DNA damage checkpoint. In the absence of any other known functions of PR-Set7, the setting of the de novo monomethyl mark appears essential for cell viability in the presence or absence of the DNA damage checkpoint, but once newly assembled chromatin is established the monomethyl mark, protected by L(3mbt, is dispensable.

  6. TOMS/Meteor-3 Total Column Ozone Daily L3 Global 1x1.25 deg Lat/Lon Grid V008

    Data.gov (United States)

    National Aeronautics and Space Administration — This data product contains TOMS/Meteor-3 Total Column Ozone Daily L3 Global 1x1.25 deg Lat/Lon Grid Version 8 data in ASCII format. (The shortname for this Meteor-3...

  7. Migration of Chadic speaking pastoralists within Africa based on population structure of Chad Basin and phylogeography of mitochondrial L3f haplogroup

    Directory of Open Access Journals (Sweden)

    Mulligan Connie J

    2009-03-01

    Full Text Available Abstract Background Chad Basin, lying within the bidirectional corridor of African Sahel, is one of the most populated places in Sub-Saharan Africa today. The origin of its settlement appears connected with Holocene climatic ameliorations (aquatic resources that started ~10,000 years before present (YBP. Although both Nilo-Saharan and Niger-Congo language families are encountered here, the most diversified group is the Chadic branch belonging to the Afro-Asiatic language phylum. In this article, we investigate the proposed ancient migration of Chadic pastoralists from Eastern Africa based on linguistic data and test for genetic traces of this migration in extant Chadic speaking populations. Results We performed whole mitochondrial genome sequencing of 16 L3f haplotypes, focused on clade L3f3 that occurs almost exclusively in Chadic speaking people living in the Chad Basin. These data supported the reconstruction of a L3f phylogenetic tree and calculation of times to the most recent common ancestor for all internal clades. A date ~8,000 YBP was estimated for the L3f3 sub-haplogroup, which is in good agreement with the supposed migration of Chadic speaking pastoralists and their linguistic differentiation from other Afro-Asiatic groups of East Africa. As a whole, the Afro-Asiatic language family presents low population structure, as 92.4% of mtDNA variation is found within populations and only 3.4% of variation can be attributed to diversity among language branches. The Chadic speaking populations form a relatively homogenous cluster, exhibiting lower diversification than the other Afro-Asiatic branches (Berber, Semitic and Cushitic. Conclusion The results of our study support an East African origin of mitochondrial L3f3 clade that is present almost exclusively within Chadic speaking people living in Chad Basin. Whole genome sequence-based dates show that the ancestral haplogroup L3f must have emerged soon after the Out-of-Africa migration (around

  8. Cytokine signature and antibody-mediated response against fresh and attenuated Anisakis simplex (L3) administration into Wistar rats: implication for anti-allergic reaction.

    Science.gov (United States)

    Abdel-Ghaffar, Fathy; Badr, Abeer Mahmoud; Morsy, Kareem; Ebead, Samar; El Deeb, Somaya; Al Quraishy, Saleh; Mehlhorn, Heinz

    2015-08-01

    The third larval stage (L3) of Anisakis simplex (Anisakidae) is one of the zoonotic parasitic nematodes in the musculature and visceral organs of marine fishes belonging to family Moronidae. The consumption of these high-commercial-value fish is widespread in many countries around the Mediterranean Sea including Egypt. The presence of these larvae in fish muscles poses a potential consumer hazard due to the parasite's ability to cause anisakidosis. Forty-two out of 60 (70%) of the European seabass Dicentrarchus labrax were found to be naturally infected by L3 of A. simplex in the form of encapsulated juveniles in the fish musculature. Morphological examination of recovered parasites by light and scanning electron microscopy showed that, in general, all specimens examined closely resembled A. simplex (L3). To evaluate the allergenicity of this nematode, white blood cell count; levels of T helper 1 (Th1) [interferon (IFN)-γ and tumor necrosis factor (TNF)-α)], Th2 [IL-4, IL-5, and IL-6], and Th17 [IL-17] related cytokines; total IgE and IgG antibodies; and nitric oxide (NO) were measured in the plasma of Wistar rats sensitized by oral inoculation with fresh, frozen, and heat-treated A. simplex L3 or rats intraperitoneally injected with L3 crude extract. Rats sensitized with fresh and frozen L3 larvae produced significantly higher levels of IFN-γ, IL-5, IL-17, and total IgE as compared to control rats. Heat-treated larvae administration resulted in a significant rise of IFN-γ, TNF-α, IL-5, and total IgE in comparison to control rats. Intraperitoneal sensitizations enhanced release of IFN-γ, TNF-α, and total IgE. Oral sensitization led to a significant production of NO. Thereby, frozen or cooked larval L3 cannot inhibit the release of Th-related cytokines and IgE, which might impact on the overall anti-parasitic immunity.

  9. Value of serum GP73, AFP, and AFP-L3 in diagnosis of liver cancer and recurrence monitoring after radiofrequency ablation

    Directory of Open Access Journals (Sweden)

    ZHANG Qin

    2015-02-01

    Full Text Available ObjectiveTo explore the clinical value of three serum tumor markers, Golgi protein 73 (GP73, alpha-fetoprotein (AFP, and AFP-L3, in the diagnosis of liver cancer and recurrence monitoring after radio frequency ablation. MethodsA total of 174 patients who visited our hospital from July 2012 to October 2013 were included in the study, consisting of 86 patients with newly diagnosed liver cancer, 39 with liver cirrhosis, 29 with hepatitis, and 20 healthy controls. Among the patients with newly diagnosed liver cancer, 37 were followed up for three months after the radiofrequency ablation. Serum levels of GP73, AFP, and AFP-L3 were measured by ELISA, electrochemiluminescence, and affinity adsorption chromatography, respectively. Nonparametric tests were performed on the results of serum samples from the four groups which showed skewed distribution and were represented by median (quartile interval [M(P25-P75]. Overall comparison was made by Kruskal-Wallis H test, and comparison between groups was made by Mann-Whitney U test. Pair-matching rank-sum test was performed using Wilcoxon Signed Ranks, and categorical data were analyzed by χ2 test. ResultsThe levels of GP73, AFP, and AFP-L3 in the liver cancer group were significantly higher than those in other groups (all P<0.05. The positive rates of GP73 and AFP-L3 in the liver cancer group were significantly higher than those in other groups (all P<0.05, and the positive rates of the two markers were significantly higher than that of AFP among patients with liver cancer (P<0.05. Thirty-seven patients with newly diagnosed liver cancer were reexamined three months after radiofrequency ablation, and the preoperational AFP-L3 level in the patients who had recurrence was significantly higher than that in the patients without recurrence (P<0.05. ConclusionSerum GP73, AFP, and AFP-L3 show great values in the diagnosis of liver cancer. AFP-L3 can be used as an indicator for the identification of

  10. Combined use of AFP, PIVKA-II, and AFP-L3 as tumor markers enhances diagnostic accuracy for hepatocellular carcinoma in cirrhotic patients.

    Science.gov (United States)

    Lim, Tae Seop; Kim, Do Young; Han, Kwang-Hyub; Kim, Hyon-Suk; Shin, Seung Hwan; Jung, Kyu Sik; Kim, Beom Kyung; Kim, Seung Up; Park, Jun Yong; Ahn, Sang Hoon

    2016-03-01

    As data on the effectiveness of tumor markers in detecting hepatocellular carcinoma (HCC) in cirrhotic patients are limited, we investigated the diagnostic accuracy of alpha-fetoprotein (AFP), protein induced by vitamin K absence or antagonist-II (PIVKA-II), and Lens culinaris agglutinin-reactive fraction of AFP (AFP-L3). This retrospective study enrolled 361 cirrhotic patients with HCC, and 276 cirrhotic patients without HCC occurrence. Most patients were men (n = 431, 67.7%); the median age was 57.0 years. The main etiology of chronic liver disease was chronic hepatitis B (n = 467, 73.3%). The sensitivity and specificity of combined three biomarkers was 87.0 and 60.1% in overall HCC, and 75.7 and 60.1% in early HCC, respectively (cutoff: 20 ng/mL for AFP, 40 mAU/mL for PIVKA-II, and 5% for AFP-L3). The area under the receiver operating characteristic curve (AUROC) for HCC diagnosis was 0.765 (95% confidence interval [CI], 0.728-0.801) for AFP; 0.823 (95% CI, 0.791-0.854) for PIVKA-II; and 0.755 (95% CI, 0.718-0.792) for AFP-L3. The AUROC for early HCC diagnosis was 0.754 (95% CI, 0.691-0.816) for AFP, 0.701 (95% CI, 0.630-0.771) for PIVKA-II, and 0.670 (95% CI, 0.596-0.744) for AFP-L3. Combining the three tumor markers increased the AUROC to 0.877 (95% CI, 0.851-0.903) for HCC diagnosis, and 0.773 (95% CI, 0.704-0.841) for early HCC diagnosis. Diagnostic accuracy improved upon combining the AFP, PIVKA-II, and AFP-L3 tumor markers compared to each marker alone in detecting HCC and early HCC in cirrhotic patients.

  11. Measurement of the radiative vacancy transfer probabilities from the $L_{3}$ to M and to N shells for W, Re and Pb using synchrotron radiation

    CERN Document Server

    Bonzi, E V

    2006-01-01

    The radiative vacancy transfer probabilities from L/sub 3/ to M shell, eta/sub L3/M(R) and L/sub 3/ to N shell, eta/sub L3/N(R), have been determined for W, Re and Pb. The pure elements samples were excited by monochromatic synchrotron radiation. The X-rays were generated by excitation of L/sub 3/ edge and measured using a high resolution Si(Li) detector. The experimentally determined radiative vacancy transfer probabilities were compared with the theoretical values deduced using radiative X-ray emission rates based on the relativistic Dirac-Hartree-Slater (RDHS) model. In the case of Pb, the experimental data were compared as well with experimental values of Simsek. In both cases, a good agreement was found between the datasets.

  12. Expression of Genes Encoding the Enzymes for Glycogen and Trehalose Metabolism in L3 and L4 Larvae of Anisakis simplex

    Directory of Open Access Journals (Sweden)

    E. Łopieńska-Biernat

    2015-01-01

    Full Text Available Trehalose and glycogen metabolism plays an important role in supporting life processes in many nematodes, including Anisakis simplex. Nematodes, cosmopolitan helminths parasitizing sea mammals and humans, cause a disease known as anisakiasis. The aim of this study was to investigate the expression of genes encoding the enzymes involved in the metabolism of trehalose and glycogen—trehalose-6-phosphate synthase (TPS, trehalose-6-phosphate phosphatase (TPP, glycogen synthase (GS, and glycogen phosphorylase (GP—in stage L3 and stage L4 larvae of A. simplex. The expression of mRNA all four genes, tps, tpp, gs, and gp, was examined by real-time polymerase chain reaction. The A. simplex ribosomal gene (18S was used as a reference gene. Enzymatic activity was determined. The expression of trehalose enzyme genes was higher in L3 than in L4 larvae, but an inverse relationship was noted for the expression of gs and gp genes.

  13. Delocalization and occupancy effects of 5f orbitals in plutonium intermetallics using L3-edge resonant X-ray emission spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Booth, C. H.; Medling, S. A.; Jiang, Yu; Bauer, E. D.; Tobash, P. H.; Mitchell, J. N.; Veirs, D. K.; Wall, M. A.; Allen, P. G.; Kas, J. J.; Sokaras, D.; Nordlund, D.; Weng, T. -C.

    2014-06-24

    Although actinide (An) L3 -edge X-ray absorption near-edge structure (XANES) spectroscopy has been very effective in determining An oxidation states in insulating, ionically bonded materials, such as in certain coordination compounds and mineral systems, the technique fails in systems featuring more delocalized 5f orbitals, especially in metals. Recently, actinide L3-edge resonant X-ray emission spec- troscopy (RXES) has been shown to be an effective alternative. This technique is further demonstrated here using a parameterized partial unoccupied density of states method to quantify both occupancy and delocalization of the 5f orbital in ?-Pu, ?-Pu, PuCoGa5 , PuCoIn5 , and PuSb2. These new results, supported by FEFF calculations, highlight the effects of strong correlations on RXES spectra and the technique?s ability to differentiate between f-orbital occupation and delocalization.

  14. Isolation of L-3-phenyllactyl-Leu-Arg-Asn-NH sub 2 (Antho-RNamide), a sea anemone neuropeptide containing an unusual amino-terminal blocking group

    Energy Technology Data Exchange (ETDEWEB)

    Grimmelikhuijzen, C.J.P.; Jacob, E.; Graff, D.; Reinscheid, R.K.; Nothacker, H.P. (Univ. of Hamburg (West Germany)); Rinehart, K.L.; Staley, A.L. (Univ. of Illinois, Urbana (USA))

    1990-07-01

    Using a radioimmunoassay for the carboxyl-terminal sequence Arg-Asn-NH{sub 2}, the authors have purified a peptide from acetic acid extracts of the sea anemone Anthopleura elegantissima. By classical amino acid analyses, mass spectrometry, and {sup 1}H NMR spectroscopy, the structure of this peptide was determined as 3-phenyllactyl-Leu-Arg-Asn-NH{sub 2}. By using reversed-phase HPLC and a chiral mobile phase, it was shown that the 3-phenyllactyl group had the L configuration. Immunocytochemical staining with antiserum against Arg-Asn-NH{sub 2} showed that L-3-phenyllactyl-Leu-Arg-Asn-NH{sub 2} (Antho-RNamide) was localized in neutrons of sea anemones. The L-3-phenyllactyl group has not been found earlier in neuropeptides of vertebrates or higher invertebrates. They propose that this residue renders Antho-RNamide resistant to nonspecific aminopeptidases, thereby increasing the stability of the peptide after neuronal release.

  15. Isolation of L-3-phenyllactyl-Leu-Arg-Asn-NH2 (Antho-RNamide), a sea anemone neuropeptide containing an unusual amino-terminal blocking group

    DEFF Research Database (Denmark)

    Grimmelikhuijzen, C J; Rinehart, K L; Jacob, E

    1990-01-01

    Using a radioimmunoassay for the carboxyl-terminal sequence Arg-Asn-NH2, we have purified a peptide from acetic acid extracts of the sea anemone Anthopleura elegantissima. By classical amino acid analyses, mass spectrometry, and 1H NMR spectroscopy, the structure of this peptide was determined as 3......-phenyllactyl-Leu-Arg-Asn-NH2. By using reversed-phase HPLC and a chiral mobile phase, it was shown that the 3-phenyllactyl group had the L configuration. Immunocytochemical staining with antiserum against Arg-Asn-NH2 showed that L-3-phenyllactyl-Leu-Arg-Asn-NH2 (Antho-RNamide) was localized in neurons of sea...... anemones. The L-3-phenyllactyl group has not been found earlier in neuropeptides of vertebrates or higher invertebrates. We propose that this residue renders Antho-RNamide resistant to nonspecific aminopeptidases, thereby increasing the stability of the peptide after neuronal release....

  16. Ricerca di chargini a 130 GeV < $\\sqrt{s}$ < 161 GeV, con l'esperimento L3 al LEP

    CERN Document Server

    Giagu, S

    1997-01-01

    The subject of this work is the search for charginos with the L3 detector at LEP, using the data collected by L3 during the years 1995-1996 at center of mass energies $130 GeV < \\sqrt{s} < 161 GeV$. In the thesis are described the design and realization of a new Monte Carlo generator (DFGT) for chargiNO1production and decay at $e^+e^-$ colliders, which is based on the evaluation of the full matrix elements of the process, and the realization and the results of two analysis, one cuts based conventional analysis, and a new and more advanced one based on the EPDE multivariate method. The results of this search are also compared with the predictions of the CMSSM model to obtain esclusion limits on the model parameters space and mass limits on charginos.

  17. Deletion of chromosome 12q21 affecting KCNC2 and ATXN7L3B in a family with neurodevelopmental delay and ataxia.

    Science.gov (United States)

    Rajakulendran, Sanjeev; Roberts, Joanna; Koltzenburg, Martin; Hanna, Michael G; Stewart, Helen

    2013-11-01

    To describe the clinical and genetic findings in a family affected by neurodevelopmental delay and cerebellar ataxia. The affected mother and her two children underwent clinical assessments followed by radiological, neurophysiological and cytogenetic investigations. All three affected members exhibited varying degrees of delay in attaining motor and cognitive milestones, along with learning difficulties and cerebellar ataxia. All three harboured a new 670 kb deletion of chromosome 12q21. Two genes, KCNC2 and ATXN7L3B, lie within the deleted region. This family's complex phenotype is associated with a new chromosomal deletion, which suggests potential roles for the two genes, KCNC2 and ATXN7L3B, in human neurological disease.

  18. Retarded Onchocerca volvulus L1 to L3 larval development in the Simulium damnosum vector after anti-wolbachial treatment of the human host

    Directory of Open Access Journals (Sweden)

    Albers Anna

    2012-01-01

    Full Text Available Abstract Background The human parasite Onchocerca volvulus harbours Wolbachia endosymbionts essential for worm embryogenesis, larval development and adult survival. In this study, the development of Wolbachia-depleted microfilariae (first stage larvae to infective third stage larvae (L3 in the insect vector Simulium damnosum was analysed. Methods Infected volunteers in Cameroon were randomly and blindly allocated into doxycycline (200 mg/day for 6 weeks or placebo treatment groups. After treatment, blackflies were allowed to take a blood meal on the volunteers, captured and dissected for larval counting and DNA extraction for quantitative real-time PCR analysis. Results PCR results showed a clear reduction in Wolbachia DNA after doxycycline treatment in microfilariae from human skin biopsies with > 50% reduction at one month post-treatment, eventually reaching a reduction of > 80%. Larval stages recovered from the insect vector had similar levels of reduction of endosymbiotic bacteria. Larval recoveries were analysed longitudinally after treatment to follow the kinetics of larval development. Beginning at three months post-treatment, significantly fewer L3 were seen in the blackflies that had fed on doxycycline treated volunteers. Concomitant with this, the proportion of second stage larvae (L2 was significantly increased in this group. Conclusions Doxycycline treatment and the resulting decline of Wolbachia endobacteria from the microfilaria resulted in retarded development of larvae in the insect vector. Thus, anti-wolbachial treatment could have an additive effect for interrupting transmission by reducing the number of L3 that can be transmitted by blackflies.

  19. Measurement of the radiative L3-M vacancy transfer probabilities of some 4f elements and compounds using Indus-2 synchrotron radiation

    Science.gov (United States)

    Krishnananda; Mirji, Santosh; Badiger, N. M.; Tiwari, M. K.

    2016-08-01

    The L X-ray intensity ratios (ILα/ILl, ILα/ILβ, ILα/ILγ) and the radiative L3-M vacancy transfer probabilities (ηL3-M) of some 4f elements such as Gd, Tb, Ho and compounds; Pr2O3, Pr2(CO3)3·8H2O, Nd2O3, Sm2O3, Sm2(CO3)3·2.85H2O, Sm2(SO4)3·8H2O, Gd2(CO3)3, Tb2O3, Dy2(SO4)3, Ho2O3 and HoF3 have been measured using Indus-2 synchrotron radiation. The elements and compounds are excited by synchrotron radiation and the emitted characteristic L X-ray photons are measured with high resolution silicon drift detector. The measured intensity ratios of compounds are not influenced by the chemical environment. However, the ηL3-M values of compound targets indicate the effect of crystal structure.

  20. Inactivation of Anisakis simplex L3 in the flesh of white spotted conger (Conger myriaster) by high hydrostatic pressure and its effect on quality.

    Science.gov (United States)

    Lee, Ki-Hoon; Park, Shin Young; Ha, Sang-Do

    2016-06-01

    Koreans consume much seafood; the country is surrounded on the east, west and south by the sea. Koreans have eaten raw sashimi for a long time. However, a concern in the raw sea food industry is that the parasitic nematode Anisakis simplex L3 occurs naturally in marine fish. Thus, the fishery industry needs a non-thermal processing method. High hydrostatic pressure (HPP) has been demonstrated to be effective. White spotted conger flesh containing 20 live larvae was exposed to different pressures (150 and 200 MPa for 1 and 5 min; 250 and 300 MPa each for 1 min). The viability of A. simplex L3 was significantly (p  0.05) in any of the Hunter colour ('L', 'a' and 'b') values were found after HPP at 200 MPa for 5 min. The fresh treated at 300 MPa for 1 min scored 4.0 (the defect limit of quality) of flavour, texture and overall acceptability in untrained sensory evaluation using a seven-point hedonic scale. However, the flesh treated at 200 MPa for 5 min scored > 5.0 ('like') for all sensory parameters. This study suggested that HPP at 200 MPa for 5 min could potentially be used for the inactivation of A. simplex L3 in raw fishery food products without any concomitant changes in their colour or sensory qualities.

  1. A transferência fonético-fonológica L2 (francês – L3 (inglês: um estudo de caso

    Directory of Open Access Journals (Sweden)

    Cintia Avila Blank

    2012-11-01

    Full Text Available Ao observar o foco dos estudos em aquisição de língua estrangeira,não é raro encontrar trabalhos sobre as relações entre a língua materna(L1 e a língua estrangeira (L2. Contudo, investigações acerca decomo o conhecimento das línguas previamente aprendidas (tanto aL1 como a L2 podem influenciar a aquisição de uma terceira língua(L3 são escassas. Essa lacuna motivou um estudo de caso sobre atransferência fonético-fonológica em que se investigou se aassimilação vocálica na L3 (inglês ocorreria em direção àscaracterísticas vocálicas (F1, F2 e duração da L1 (português ouda L2 (francês do participante. Os dados, obtidos através de tarefasde leitura oral nas três línguas, foram analisados acusticamente como programa Praat. Discutidos a partir do conexionismo, os resultadosda análise acústica apontam para a criação, nas vogais da L3, decategorias fonéticas híbridas entre a L1 e a L2.

  2. Comparison of the E3 and L3 regions for arming oncolytic adenoviruses to achieve a high level of tumor-specific transgene expression.

    Science.gov (United States)

    Robinson, M; Ge, Y; Ko, D; Yendluri, S; Laflamme, G; Hawkins, L; Jooss, K

    2008-01-01

    Arming oncolytic adenoviral vectors with anticancer transgenes that can be expressed in a tumor-selective manner may enable the engineering of vectors with increased potency, while retaining their safety profile. Armed oncolytic adenoviral vectors were constructed in which transgene expression has been linked via modified splice acceptor sequences that did not necessitate the deletion of any part of the adenoviral genome. Several oncolytic adenoviral vectors were compared in which the transgene was inserted in place of either the E3 or the L3 region. While all vectors had similar viral growth and cytotoxicity characteristics, the highest level of transgene expression was observed from a vector in which the transgene had been inserted downstream of the L3 23K protease gene, the Ad-23K-GM vector. Notably, no transgene expression occurred with this vector in the absence of DNA replication either in vitro or in vivo. In contrast, viruses in which the transgene was inserted into E3 locations exhibited a low level of transgene expression even in the absence of DNA replication. In summary, by utilizing the L3 region for arming oncolytic viruses, higher levels of tumor-specific transgene expression can be obtained without the need to delete any parts of the viral genome.

  3. Contribution to the design and implementation of the trigger and acquisition system of the L3 experiment at LEP; Contribution a l`elaboration et a la mise en oeuvre du systeme de declenchement et d`acquisition de l`experience L3 au LEP

    Energy Technology Data Exchange (ETDEWEB)

    Cai, X.

    1994-10-01

    The thesis is devoted to the trigger and data acquisition system of the L3 experiment at LEP. It is a large distributed system with multiple levels to trigger, collect and record events detected by the L3 detector. The three trigger levels are designed to reduce a possible first level trigger rate of 100 Hz to a few Hz. The readout and event building systems have intermediate buffering so that the only dead time is only introduced during digitization of the detector signals. The emphasis of this thesis is on the Hadron Calorimeter (one of the sub detectors) readout system, the L3 event building system and the upgraded level-3-trigger system. Both hardware and software are described. (author). 126 refs., 48 figs., 23 tabs.

  4. Retarded Onchocerca volvulus L1 to L3 larval development in the Simulium damnosum vector after anti-wolbachial treatment of the human host.

    Science.gov (United States)

    Albers, Anna; Esum, Mathias Eyong; Tendongfor, Nicholas; Enyong, Peter; Klarmann, Ute; Wanji, Samuel; Hoerauf, Achim; Pfarr, Kenneth

    2012-01-11

    The human parasite Onchocerca volvulus harbours Wolbachia endosymbionts essential for worm embryogenesis, larval development and adult survival. In this study, the development of Wolbachia-depleted microfilariae (first stage larvae) to infective third stage larvae (L3) in the insect vector Simulium damnosum was analysed. Infected volunteers in Cameroon were randomly and blindly allocated into doxycycline (200 mg/day for 6 weeks) or placebo treatment groups. After treatment, blackflies were allowed to take a blood meal on the volunteers, captured and dissected for larval counting and DNA extraction for quantitative real-time PCR analysis. PCR results showed a clear reduction in Wolbachia DNA after doxycycline treatment in microfilariae from human skin biopsies with > 50% reduction at one month post-treatment, eventually reaching a reduction of > 80%. Larval stages recovered from the insect vector had similar levels of reduction of endosymbiotic bacteria. Larval recoveries were analysed longitudinally after treatment to follow the kinetics of larval development. Beginning at three months post-treatment, significantly fewer L3 were seen in the blackflies that had fed on doxycycline treated volunteers. Concomitant with this, the proportion of second stage larvae (L2) was significantly increased in this group. Doxycycline treatment and the resulting decline of Wolbachia endobacteria from the microfilaria resulted in retarded development of larvae in the insect vector. Thus, anti-wolbachial treatment could have an additive effect for interrupting transmission by reducing the number of L3 that can be transmitted by blackflies. © 2012 Albers et al; licensee BioMed Central Ltd.

  5. The GALAD scoring algorithm based on AFP, AFP-L3, and DCP significantly improves detection of BCLC early stage hepatocellular carcinoma.

    Science.gov (United States)

    Best, J; Bilgi, H; Heider, D; Schotten, C; Manka, P; Bedreli, S; Gorray, M; Ertle, J; van Grunsven, L A; Dechêne, A

    2016-12-01

    Background: Hepatocellular carcinoma (HCC) is one of the leading causes of death in cirrhotic patients worldwide. The detection rate for early stage HCC remains low despite screening programs. Thus, the majority of HCC cases are detected at advanced tumor stages with limited treatment options. To facilitate earlier diagnosis, this study aims to validate the added benefit of the combination of AFP, the novel biomarkers AFP-L3, DCP, and an associated novel diagnostic algorithm called GALAD. Material and methods: Between 2007 and 2008 and from 2010 to 2012, 285 patients newly diagnosed with HCC and 402 control patients suffering from chronic liver disease were enrolled. AFP, AFP-L3, and DCP were measured using the µTASWako i30 automated immunoanalyzer. The diagnostic performance of biomarkers was measured as single parameters and in a logistic regression model. Furthermore, a diagnostic algorithm (GALAD) based on gender, age, and the biomarkers mentioned above was validated. Results: AFP, AFP-L3, and DCP showed comparable sensitivities and specifities for HCC detection. The combination of all biomarkers had the highest sensitivity with decreased specificity. In contrast, utilization of the biomarker-based GALAD score resulted in a superior specificity of 93.3 % and sensitivity of 85.6 %. In the scenario of BCLC 0/A stage HCC, the GALAD algorithm provided the highest overall AUROC with 0.9242, which was superior to any other marker combination. Conclusions: We could demonstrate in our cohort the superior detection of early stage HCC with the combined use of the respective biomarkers and in particular GALAD even in AFP-negative tumors. © Georg Thieme Verlag KG Stuttgart · New York.

  6. Studies of Hadronic Event Structure in $e^+ e^-$ Annihilation from 30 GeV to 209 GeV with the L3 Detector

    CERN Document Server

    Achard, P.; Aguilar-Benitez, M.; Alcaraz, J.; Alemanni, G.; Allaby, J.; Aloisio, A.; Alviggi, M.G.; Anderhub, H.; Andreev, Valery P.; Anselmo, F.; Arefev, A.; Azemoon, T.; Aziz, T.; Bagnaia, P.; Bajo, A.; Baksay, G.; Baksay, L.; Baldew, S.V.; Banerjee, S.; Banerjee, Sw.; Barczyk, A.; Barillere, R.; Bartalini, P.; Basile, M.; Batalova, N.; Battiston, R.; Bay, A.; Becattini, F.; Becker, U.; Behner, F.; Bellucci, L.; Berbeco, R.; Berdugo, J.; Berges, P.; Bertucci, B.; Betev, B.L.; Biasini, M.; Biglietti, M.; Biland, A.; Blaising, J.J.; Blyth, S.C.; Bobbink, G.J.; Bohm, A.; Boldizsar, L.; Borgia, B.; Bottai, S.; Bourilkov, D.; Bourquin, M.; Braccini, S.; Branson, J.G.; Brochu, F.; Burger, J.D.; Burger, W.J.; Cai, X.D.; Capell, M.; Romeo, G.Cara; Carlino, G.; Cartacci, A.; Casaus, J.; Cavallari, F.; Cavallo, N.; Cecchi, C.; Cerrada, M.; Chamizo, M.; Chang, Y.H.; Chemarin, M.; Chen, A.; Chen, G.; Chen, G.M.; Chen, H.F.; Chen, H.S.; Chiefari, G.; Cifarelli, L.; Cindolo, F.; Clare, I.; Clare, R.; Coignet, G.; Colino, N.; Costantini, S.; de la Cruz, B.; Cucciarelli, S.; van Dalen, J.A.; de Asmundis, R.; Deglon, P.; Debreczeni, J.; Degre, A.; Dehmelt, K.; Deiters, K.; della Volpe, D.; Delmeire, E.; Denes, P.; DeNotaristefani, F.; De Salvo, A.; Diemoz, M.; Dierckxsens, M.; Dionisi, C.; Dittmar, M.; Doria, A.; Dova, M.T.; Duchesneau, D.; Duda, M.; Echenard, B.; Eline, A.; El Hage, A.; El Mamouni, H.; Engler, A.; Eppling, F.J.; Extermann, P.; Falagan, M.A.; Falciano, S.; Favara, A.; Fay, J.; Fedin, O.; Felcini, M.; Ferguson, T.; Fesefeldt, H.; Fiandrini, E.; Field, J.H.; Filthaut, F.; Fisher, P.H.; Fisher, W.; Fisk, I.; Forconi, G.; Freudenreich, K.; Furetta, C.; Galaktionov, Iouri; Ganguli, S.N.; Garcia-Abia, Pablo; Gataullin, M.; Gentile, S.; Giagu, S.; Gong, Z.F.; Grenier, Gerald Jean; Grimm, O.; Gruenewald, M.W.; Guida, M.; Gupta, V.K.; Gurtu, A.; Gutay, L.J.; Haas, D.; Hatzifotiadou, D.; Hebbeker, T.; Herve, Alain; Hirschfelder, J.; Hofer, H.; Hohlmann, M.; Holzner, G.; Hou, S.R.; Hu, Y.; Jin, B.N.; Jones, Lawrence W.; de Jong, P.; Josa-Mutuberria, I.; Kaur, M.; Kienzle-Focacci, M.N.; Kim, J.K.; Kirkby, Jasper; Kittel, W.; Klimentov, A.; Konig, A.C.; Kopal, M.; Koutsenko, V.; Kraber, M.; Kraemer, R.W.; Kruger, A.; Kunin, A.; Ladron de Guevara, P.; Laktineh, I.; Landi, G.; Lebeau, M.; Lebedev, A.; Lebrun, P.; Lecomte, P.; Lecoq, P.; Le Coultre, P.; Le Goff, J.M.; Leiste, R.; Levtchenko, M.; Levtchenko, P.; Li, C.; Likhoded, S.; Lin, C.H.; Lin, W.T.; Linde, F.L.; Lista, L.; Liu, Z.A.; Lohmann, W.; Longo, E.; Lu, Y.S.; Luci, C.; Luminari, L.; Lustermann, W.; Ma, W.G.; Malgeri, L.; Malinin, A.; Mana, C.; Mangeol, D.; Mans, J.; Martin, J.P.; Marzano, F.; Mazumdar, K.; McNeil, R.R.; Mele, S.; Merola, L.; Meschini, M.; Metzger, W.J.; Mihul, A.; Milcent, H.; Mirabelli, G.; Mnich, J.; Mohanty, G.B.; Muanza, G.S.; Muijs, A.J.M.; Musicar, B.; Musy, M.; Nagy, S.; Natale, S.; Napolitano, M.; Nessi-Tedaldi, F.; Newman, H.; Nisati, A.; Novak, T.; Kluge, Hannelies; Ofierzynski, R.; Organtini, G.; Pal, I.; Palomares, C.; Paolucci, P.; Paramatti, R.; Passaleva, G.; Patricelli, S.; Paul, Thomas Cantzon; Pauluzzi, M.; Paus, C.; Pauss, F.; Pedace, M.; Pensotti, S.; Perret-Gallix, D.; Petersen, B.; Piccolo, D.; Pierella, F.; Pioppi, M.; Piroue, P.A.; Pistolesi, E.; Plyaskin, V.; Pohl, M.; Pojidaev, V.; Pothier, J.; Prokofev, D.; Quartieri, J.; Rahal-Callot, G.; Rahaman, Mohammad Azizur; Raics, P.; Raja, N.; Ramelli, R.; Rancoita, P.G.; Ranieri, R.; Raspereza, A.; Razis, P.; Ren, D.; Rescigno, M.; Reucroft, S.; Riemann, S.; Riles, Keith; Roe, B.P.; Romero, L.; Rosca, A.; Rosemann, C.; Rosenbleck, C.; Rosier-Lees, S.; Roth, Stefan; Rubio, J.A.; Ruggiero, G.; Rykaczewski, H.; Sakharov, A.; Saremi, S.; Sarkar, S.; Salicio, J.; Sanchez, E.; Schafer, C.; Schegelsky, V.; Schopper, H.; Schotanus, D.J.; Sciacca, C.; Servoli, L.; Shevchenko, S.; Shivarov, N.; Shoutko, V.; Shumilov, E.; Shvorob, A.; Son, D.; Souga, C.; Spillantini, P.; Steuer, M.; Stickland, D.P.; Stoyanov, B.; Straessner, A.; Sudhakar, K.; Sultanov, G.; Sun, L.Z.; Sushkov, S.; Suter, H.; Swain, J.D.; Szillasi, Z.; Tang, X.W.; Tarjan, P.; Tauscher, L.; Taylor, L.; Tellili, B.; Teyssier, D.; Timmermans, Charles; Ting, Samuel C.C.; Ting, S.M.; Tonwar, S.C.; Toth, J.; Tully, C.; Tung, K.L.; Ulbricht, J.; Valente, E.; Van de Walle, R.T.; Vasquez, R.; Veszpremi, V.; Vesztergombi, G.; Vetlitsky, I.; Vicinanza, D.; Viertel, G.; Villa, S.; Vivargent, M.; Vlachos, S.; Vodopianov, I.; Vogel, H.; Vogt, H.; Vorobev, I.; Vorobyov, A.A.; Wadhwa, M.; Wang, Q.; Wang, X.L.; Wang, Z.M.; Weber, M.; Wilkens, H.; Wynhoff, S.; Xia, L.; Xu, Z.Z.; Yamamoto, J.; Yang, B.Z.; Yang, C.G.; Yang, H.J.; Yang, M.; Yeh, S.C.; Zalite, An.; Zalite, Yu.; Zhang, Z.P.; Zhao, J.; Zhu, G.Y.; Zhu, R.Y.; Zhuang, H.L.; Zichichi, A.; Zimmermann, B.; Zoller, M.

    2004-01-01

    In this Report, QCD results obtained from a study of hadronic event structure in high energy e^+e^- interactions with the L3 detector are presented. The operation of the LEP collider at many different collision energies from 91 GeV to 209 GeV offers a unique opportunity to test QCD by measuring the energy dependence of different observables. The main results concern the measurement of the strong coupling constant, \\alpha_s, from hadronic event shapes and the study of effects of soft gluon coherence through charged particle multiplicity and momentum distributions.

  7. Motility in the L3 stage is a poor phenotype for detecting and measuring resistance to avermectin/milbemycin drugs in gastrointestinal nematodes of livestock.

    Science.gov (United States)

    George, Melissa M; Lopez-Soberal, Lorraine; Storey, Bob E; Howell, Sue B; Kaplan, Ray M

    2017-12-18

    Motility is a commonly used in vitro phenotype for assessing anthelmintic activity of candidate compounds, and for detecting anthelmintic resistance in nematodes. Third-stage larvae (L3) of parasitic nematodes are commonly used in motility-based assays because L3 are simple to obtain and can remain viable in storage for extended periods. To improve the measurement of motility of microscopic stages of nematodes, our laboratory developed the Worminator, which quantitatively measures motility of parasites. Using the Worminator, we compared the dose-response characteristics of several avermectin/milbemycin (AM) compounds using L3 from both AM-susceptible and AM-resistant Cooperia spp. (abamectin, doramectin, eprinomectin, ivermectin, moxidectin) and Haemonchus contortus (eprinomectin, ivermectin, moxidectin). Concentrations tested with the Worminator ranged from 0.156 to 40 μM. Differences in EC50 between AM-susceptible and AM-resistant isolates of Cooperia spp. and Haemonchus contortus were small, with resistance ratios ranging from 1.00 to 1.34 for Cooperia spp., 0.99 to 1.65 for Haemonchus contortus. Larval migration inhibition assays were conducted using the same isolates and were equally ineffective for detection of resistance with resistance ratios less than 2.0. These results contrast with those of the Larval Development Assay where we obtained a resistance ratio of 16.48 using the same isolates of Haemonchus contortus. Moreover, even at the highest concentration tested (40 μM), 100% inhibition of motility was never achieved and EC50 for Worminator assays were more than 100× higher than peak plasma levels achieved in vivo following treatment. These data demonstrate that dose-response characteristics for inhibition of motility in L3 of gastrointestinal nematodes of livestock do not significantly differ for AM-susceptible and AM-resistant isolates. These data challenge the suitability of motility as a phenotype for detecting and measuring resistance to AM

  8. Crystal-field excitations in multiferroic TbMnO3 by Mn L3 and O K resonant inelastic X-ray scattering

    Science.gov (United States)

    Feng, Jiatai; Juhin, Amélie; Delaunay, Renaud; Jarrier, Romain; Jaouen, Nicolas; Nicolaou, Alessandro; Sinclair, Ryan; Zhou, Haidong; Mariot, Jean-Michel; Chiuzbǎian, Sorin G.

    2017-11-01

    d-d excitations in multiferroic TbMnO3 have been investigated by X-ray absorption spectroscopy and resonant inelastic X-ray scattering at the Mn L3,2 and O K edges. Confrontation between experimental data and multiplet crystal-field calculations performed for Mn3+ ions in D4h symmetry has enabled us to identify the origin of the observed excitations and has provided reliable manganese crystal-field parameters that enter the description of the antisymmetric exchange interaction responsible for the multiferroicity in this compound.

  9. Construction of a light-emitting diode fluorescence detector for high-performance liquid chromatography and its application to fluorometric determination of L-3-hydroxybutyrate.

    Science.gov (United States)

    Chen, Chien-Ming; Lee, Jen-Ai; Huang, Tzu-Chuan

    2012-02-01

    This study employed a new light source, a light-emitting diode (LED), for fluorescence detection of high-performance liquid chromatography to measure the concentration of trace constituents in biological fluids. Using l-3-hydroxybutyrate ( l-3HB) as a tested trace compound, the function of the new system was compared with that of the current commercially available model. A detailed schematic diagram of the path of the detection rays in the LED detector is given. A voltage-stabilizer for the drive circuit was designed with an input of 10 V and an output of 8 V, and another voltage regulator was used to maintain a constant 8 V. Then the regulator was used to set the output voltage for the LED at 2.8 V by two external resistors. Replacing the xenon lamp with LED, this system provided higher photon density and a narrow spectrum at a wavelength of 491 nm. At room temperature (22.1°C), the average temperature of six places in the chamber of LED detector was 22.1°C compared with 51.1°C in the xenon detector. The spectra of the excitation light sources were measured. Compared with the xenon lamp, approximately 1.32 times higher excitation intensity was obtained by the LED source. The accuracy of detection of l-3HB in 50 μL of rat serum was 99.85-100.85%, and the intra-day and inter-day precision values were within 8.99 and 13.90%, respectively. The limit of detection of l-3HB was approximately 0.73 µM (signal-to-noise ratio 3). The sensitivity of the proposed LED detector was comparable to that of traditional fluorescence detectors using xenon arc lamps; however, the cost and operating temperature of LED lamps were far lower. This assay system could be further used to detect trace constituents in various samples. Copyright © 2011 John Wiley & Sons, Ltd.

  10. Dicty_cDB: VSD233 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AMP1 v2 Brugia malayi cDNA 5' similar to TR:O01849 O01849 SIMILARITY TO RAT AND MOUSE SPERM OUTER DENSE FIBER...1849 O01849 SIMILARITY TO RAT AND MOUSE SPERM OUTER DENSE FIBER PROTEIN. [1] ;, m...milar to TR:O01849 O01849 SIMILARITY TO RAT AND MOUSE SPERM OUTER DENSE FIBER PROTEIN. [1] ;, mRNA sequence.... cDNA 5' similar to TR:O01849 O01849 SIMILARITY TO RAT AND MOUSE SPERM OUTER DENSE FIBER PROTEIN. [1] ;, mRN...lar to TR:O01849 O01849 SIMILARITY TO RAT AND MOUSE SPERM OUTER DENSE FIBER PROTE

  11. SURVEI DARAH JARI FILARIASIS DI DESA BATUMARTA X KEC. MADANG SUKU III KABUPATEN OGAN KOMERING ULU (OKU TIMUR, SUMATERA SELATAN TAHUN 2012

    Directory of Open Access Journals (Sweden)

    R. Irpan Pahlepi

    2015-01-01

    Full Text Available AbstrakFilariasis atau penyakit kaki gajah adalah golongan penyakit menular yang disebabkan oleh cacing filaria  yang  ditularkan  melalui  berbagai  jenis  nyamuk.  Penyebaran  filariasis  hampir  meliputi  seluruh wilayah di Indonesia termasuk Kabupaten Ogan Komering Ulu (OKU Timur. Angka kesakitan filarisis di Kabupaten OKU Timur tahun 2007 sebesar 1,05%. Kegiatan pengobatan massal di Kabupaten OKU Timur belum pernah dilakukan sampai saat ini, sehingga perlu dilakukan penelitian yang bertujuan untuk mengetahui tingkat penyebaran penyakit filariasis. Penelitian ini merupakan penelitian survei dengan desain potong lintang. Pengambilan dan pemeriksaan sediaan darah jari dilakukan pada malam hari dimulai pukul 19.00 WIB. Jumlah penduduk yang diperiksa sebanyak 502. Hasil pemeriksaan diperoleh 4 orang positif mikrofilaria (Mf_ rate 0,8% dengan spesies Brugia  malayi  dan  kepadatan  rata-rata  200mf/ml.  Seluruh  kasus  yang  ditemukan  merupakan  kasus baru. Hasil penelitian ini menunjukkan bahwa penularan filariasis masih terjadi di Kabupaten OKU Timur sehingga perlu adanya pengobatan massal untuk mencegah penularan lebih lanjut.Kata kunci : Filariasis, Brugia malayi, Survei darah jari, OKU TimurAbstractFilariasis or elephantiasis is an infectious diseases caused by filarial worms that transmitted by various species of mosquitoes. Filariasis distributions almost covers all districts in Indonesia including East Ogan Komering Ulu (OKU. Filarisais morbidity in East OKU regency in 2007 was 1.05 %. Mass treatment in the district of East OKU have not been done yet, so it is necessary to do a research that aim to determine the prevalen of filariasis. This study is a cross-sectional survey design. Collection and examination of finger’s blood was done at night starting at 19:00. Number of people examined were 502. Examination results obtained 4 positive microfilariae (Mf_ rate 0.8 % of Brugia malayi and the average density of 200

  12. Influx-Operated Ca2+ Entry via PKD2-L1 and PKD1-L3 Channels Facilitates Sensory Responses to Polymodal Transient Stimuli

    Directory of Open Access Journals (Sweden)

    Mingfeng Hu

    2015-10-01

    Full Text Available The polycystic TRP subfamily member PKD2-L1, in complex with PKD1-L3, is involved in physiological responses to diverse stimuli. A major challenge to understanding whether and how PKD2-L1/PKD1-L3 acts as a bona fide molecular transducer is that recombinant channels usually respond with small or undetectable currents. Here, we discover a type of Ca2+ influx-operated Ca2+ entry (ICE that generates pronounced Ca2+ spikes. Triggered by rapid onset/offset of Ca2+, voltage, or acid stimuli, Ca2+-dependent activation amplifies a small Ca2+ influx via the channel. Ca2+ concurrently drives a self-limiting negative feedback (Ca2+-dependent inactivation that is regulated by the Ca2+-binding EF hands of PKD2-L1. Our results suggest a biphasic ICE with opposite Ca2+ feedback regulation that facilitates sensory responses to multimodal transient stimuli. We suggest that such a mechanism may also occur for other sensory modalities and other Ca2+ channels.

  13. Influx-Operated Ca(2+) Entry via PKD2-L1 and PKD1-L3 Channels Facilitates Sensory Responses to Polymodal Transient Stimuli.

    Science.gov (United States)

    Hu, Mingfeng; Liu, Yuxia; Wu, Jinzhi; Liu, Xiaodong

    2015-10-27

    The polycystic TRP subfamily member PKD2-L1, in complex with PKD1-L3, is involved in physiological responses to diverse stimuli. A major challenge to understanding whether and how PKD2-L1/PKD1-L3 acts as a bona fide molecular transducer is that recombinant channels usually respond with small or undetectable currents. Here, we discover a type of Ca(2+) influx-operated Ca(2+) entry (ICE) that generates pronounced Ca(2+) spikes. Triggered by rapid onset/offset of Ca(2+), voltage, or acid stimuli, Ca(2+)-dependent activation amplifies a small Ca(2+) influx via the channel. Ca(2+) concurrently drives a self-limiting negative feedback (Ca(2+)-dependent inactivation) that is regulated by the Ca(2+)-binding EF hands of PKD2-L1. Our results suggest a biphasic ICE with opposite Ca(2+) feedback regulation that facilitates sensory responses to multimodal transient stimuli. We suggest that such a mechanism may also occur for other sensory modalities and other Ca(2+) channels. Copyright © 2015 The Authors. Published by Elsevier Inc. All rights reserved.

  14. Ionization cross sections of the Au L subshells by electron impact from the L3 threshold to 100 keV

    Science.gov (United States)

    Barros, Suelen F.; Vanin, Vito R.; Maidana, Nora L.; Martins, Marcos N.; García-Alvarez, Juan A.; Santos, Osvaldo C. B.; Rodrigues, Cleber L.; Koskinas, Marina F.; Fernández-Varea, José M.

    2018-01-01

    We measured the cross sections for Au Lα, Lβ, Lγ, Lℓ and Lη x-ray production by the impact of electrons with energies from the L3 threshold to 100 keV using a thin Au film whose mass thickness was determined by Rutherford Backscattering Spectrometry. The x-ray spectra were acquired with a Si drift detector, which allowed to separate the components of the Lγ multiplet lines. The measured Lα, Lβ, {{L}}{γ }1, L{γ }{2,3,6}, {{L}}{γ }{4,4\\prime }, {{L}}{γ }5, {{L}}{\\ell } and Lη x-ray production cross sections were then employed to derive Au L1, L2 and L3 subshell ionization cross sections with relative uncertainties of 8%, 7% and 7%, respectively; these figures include the uncertainties in the atomic relaxation parameters. The correction for the increase in electron path length inside the Au film was estimated by means of Monte Carlo simulations. The experimental ionization cross sections are about 10% above the state-of-the-art distorted-wave calculations.

  15. L3 detector: BGO assembly

    CERN Multimedia

    CERN

    1989-01-01

    Explanation and presentation of its construction ( Feb-March 1989). The detector is a multi-layered cylindrical set of different devices, each of them measuring physical quantities relevant to the reconstruction of the collision under study. The three main outer layers are the electro-magnetic calorimeter (also called BGO because it's made of Bismuth Germanium Oxide), the hadronic calorimeter (HCAL) and the muon detector.

  16. L3.PHI.CTF.P10.02-rev2 Coupling of Subchannel T/H (CTF) and CRUD Chemistry (MAMBA1D)

    Energy Technology Data Exchange (ETDEWEB)

    Salko, Robert K. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Palmtag, Scott [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Collins, Benjamin S. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Kendrick, Brian [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Seker, Jeffrey [Westinghouse Electric Company LLC, Cranberry Township, PA (United States)

    2015-05-15

    The purpose of this milestone is to create a preliminary capability for modeling light water reactor (LWR) thermal-hydraulic (T/H) and CRUD growth using the CTF subchannel code and the subgrid version of the MAMBA CRUD chemistry code, MAMBA1D. In part, this is a follow-on to Milestone L3.PHI.VCS.P9.01, which is documented in Report CASL-U-2014-0188-000, titled "Development of CTF Capability for Modeling Reactor Operating Cycles with Crud Growth". As the title suggests, the previous milestone set up a framework for modeling reactor operation cycles with CTF. The framework also facilitated coupling to a CRUD chemistry capability for modeling CRUD growth throughout the reactor operating cycle. To demonstrate the capability, a simple CRUD \\surrogate" tool was developed and coupled to CTF; however, it was noted that CRUD growth predictions by the surrogate were not considered realistic. This milestone builds on L3.PHI.VCS.P9.01 by replacing this simple surrogate tool with the more advanced MAMBA1D CRUD chemistry code. Completing this task involves addressing unresolved tasks from Milestone L3.PHI.VCS.P9.01, setting up an interface to MAMBA1D, and extracting new T/H information from CTF that was not previously required in the simple surrogate tool. Speci c challenges encountered during this milestone include (1) treatment of the CRUD erosion model, which requires local turbulent kinetic energy (TKE) (a value that CTF does not calculate) and (2) treatment of the MAMBA1D CRUD chimney boiling model in the CTF rod heat transfer solution. To demonstrate this new T/H, CRUD modeling capability, two sets of simulations were performed: (1) an 18 month cycle simulation of a quarter symmetry model of Watts Bar and (2) a simulation of Assemblies G69 and G70 from Seabrook Cycle 5. The Watts Bar simulation is merely a demonstration of the capability. The simulation of the Seabrook cycle, which had experienced CRUD-related fuel rod failures, had actual CRUD-scrape data to compare with

  17. Participation of L3T4 in T cell activation in the absence of class II major histocompatibility complex antigens. Inhibition by anti-L3T4 antibodies is a function both of epitope density and mode of presentation of anti-receptor antibody

    DEFF Research Database (Denmark)

    Owens, T; Fazekas de St Groth, B

    1987-01-01

    The recognition of many class II major histocompatibility complex (MHC)-associated antigens by T cells requires the participation of the L3T4 molecule. It has been proposed that this molecule acts to stabilize low affinity binding to antigen in association with MHC and thereby increases the avidity...... of T cell/antigen interactions. By using antibodies against the T cell antigen receptor (TCR) to activate T cells, thereby circumventing the requirement for antigen presenting cells and MHC-associated antigen, we have been able to study the function of L3T4 in the absence of class II MHC. We have used...... two monoclonal antibodies, KJ16-133.18 and F23.1, that recognize a determinant encoded by the T cell receptor V beta 8 gene family. These antibodies were used to select two clones of T cells with surface phenotype Thy-1.2+, L3T4+, Lyt-2-, KJ16-133.18+, F23.1+, IA-, IE-. One of these clones (E9.D4...

  18. The effect of the spacer of bis(biurea) ligands on the structure of A2 L3 -type (A=anion) phosphate complexes.

    Science.gov (United States)

    Wu, Biao; Li, Shaoguang; Lei, Yibo; Hu, Huaiming; de Sousa Amadeu, Nader; Janiak, Christoph; Mathieson, Jennifer S; Long, De-Liang; Cronin, Leroy; Yang, Xiao-Juan

    2015-02-02

    By tuning the length and rigidity of the spacer of bis(biurea) ligands L, three structural motifs of the A2 L3 complexes (A represents anion, here orthophosphate PO4 (3-) ), namely helicate, mesocate, and mono-bridged motif, have been assembled by coordination of the ligand to phosphate anion. Crystal structure analysis indicated that in the three complexes, each of the phosphate ions is coordinated by twelve hydrogen bonds from six surrounding urea groups. The anion coordination properties in solution have also been studied. The results further demonstrate the coordination behavior of phosphate ion, which shows strong tendency for coordination saturation and geometrical preference, thus allowing for the assembly of novel anion coordination-based structures as in transition-metal complexes. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  19. A TRANSFERÊNCIA GRAFO-FÔNICO-FONOLÓGICA L2 (FRANCÊS) - L3 (INGLÊS): UM ESTUDO CONEXIONISTA

    OpenAIRE

    Blank, Cintia Avila

    2008-01-01

    As pesquisas na área de língua estrangeira apresentam uma forte tendência em investigar a relação entre a L1 e a L2, deixando de lado a explicação dos processos de transferência que podem ocorrer quando da aprendizagem de mais de uma língua estrangeira. No presente estudo, tem-se por objetivo analisar a transferência de padrões grafo-fônicofonológicos da L2 para a L3, através de uma abordagem conexionista. Para tanto, um estudo de caso foi desenvolvido, contando com um sujeito ...

  20. Study of the Solar Anisotropy for Cosmic Ray Primaries of about 200 GeV Energy with the L3+C Muon Detector

    CERN Document Server

    Achard, P; Aguilar-Benitez, M; van den Akker, M; Alcaraz, J; Alemanni, G; Allaby, J; Aloisio, A; Alviggi, M G; Anderhub, H; Andreev, Valery P; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Bajo, A; Baksay, G; Baksay, L; Bahr, J; Baldew, S V; Banerjee, S; Banerjee, Sw; Barczyk, A; Barillere, R; Bartalini, P; Basile, M; Batalova, N; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Bellucci, L; Berbeco, R; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Biasini, M; Biglietti, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, G J; Bohm, A; Boldizsar, L; Borgia, B; Bottai, S; Bourilkov, D; Bourquin, M; Braccini, S; Branson, J G; Brochu, F; Burger, J D; Burger, W J; Cai, X D; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A; Casaus, J; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada, M; Chamizo, M; Chiarusi, T; Chang, Y H; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chiefari, G; Cifarelli, L; Cindolo, F; Clare, I; Clare, R; Coignet, G; Colino, N; Costantini, S; de la Cruz, B; Cucciarelli, S; van Dalen, J; de Asmundis, R; Deglon, P; Debreczeni, J; Degre, A; Dehmelt, K; Deiters, K; della Volpe, D; Delmeire, E; Denes, P; DeNotaristefani, F; De Salvo, A; Diemoz, M; Dierckxsens, M; Ding, L K; Dionisi, C; Dittmar, M; Doria, A; Dova, M T; Duchesneau, D; Duda, M; Duran, I; Echenard, B; Eline, A; El Hage, A; El Mamouni, H; Engler, A; Eppling, F J; Extermann, P; Faber, G; Falagan, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, M; Ferguson, T; Fesefeldt, H; Fiandrini, E; Field, J H; Filthaut, F; Fisher, W; Fisk, I; Forconi, G; Freudenreich, K; Furetta, C; Galaktionov, Iouri; Ganguli, S N; Garcia-Abia, Pablo; Gataullin, M; Gentile, S; Giagu, S; Gong, Z F; Grabosch, H J; Grenier, G; Grimm, O; Groenstege, H; Gruenewald, M W; Guida, M; Guo, Y N; Gupta, S; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Haller, Ch; Hatzifotiadou, D; Hayashi, Y; He, Z X; Hebbeker, T; Herve, Alain; Hirschfelder, J; Hofer, H; Hohlmann, M; Holzner, G; Hou, S R; Huo, A X; Hu, Y; Ito, N; Jin, B N; Jing, C L; Jones, Lawrence W; de Jong, P; Josa-Mutuberria, I; Kantserov, V; Kaur, M; Kawakami, S; Kienzle-Focacci, M N; Kim, J K; Kirkby, Jasper; Kittel, W; Klimentov, A; Konig, A C; Kok, E; Korn, A; Kopal, M; Koutsenko, V; Kraber, M; Kuang, H H; Kraemer, R W; Kruger, A; Kuijpers, J; Kunin, A; Ladron de Guevara, P; Laktineh, I; Landi, G; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Le Goff, J M; Lei, Y; Leich, H; Leiste, R; Levtchenko, M; Levtchenko, P; Li, C; Li, L; Li, Z C; Likhoded, S; Lin, C H; Lin, W T; Linde, F L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lu, Y S; Luci, C; Luminari, L; Lustermann, W; Ma, W G; Ma, X H; Ma, Y Q; Malgeri, L; Malinin, A; Mana, C; Mans, J; Martin, J P; Marzano, F; Mazumdar, K; McNeil, R R; Mele, S; Meng, X W; Merola, L; Meschini, M; Metzger, W J; Mihul, A; van Mil, A; Milcent, H; Mirabelli, G; Mnich, J; Mohanty, G B; Monteleoni, B; Muanza, y G S; Muijs, A J M; Musicar, B; Musy, M; Nagy, S; Nahnhauer, R; Naumov, V A; Natale, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Nisati, A; Novak, T; Kluge, Hannelies; Ofierzynski, R; Organtini, G; Pal, I; Palomares, C; Paolucci, P; Paramatti, R; Parriaud, J -F; Passaleva, G; Patricelli, S; Paul, Thomas Cantzon; Pauluzzi, M; Paus, C; Pauss, F; Pedace, M; Pensotti, S; Perret-Gallix, D; Petersen, B; Piccolo, D; Pierella, F; Pieri, M; Pioppi, M; Piroue, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pojidaev, V; Pothier, J; Prokofev, D; Quartieri, J; Qing, C R; Rahal-Callot, G; Rahaman, Mohammad Azizur; Raics, P; Raja, N; Ramelli, R; Rancoita, P G; Ranieri, R; Raspereza, A; Ravindran, K C; Razis, P; Ren, D; Rescigno, M; Reucroft, S; Rewiersma, P; Riemann, y S; Riles, Keith; Roe, B P; Rojkov, A; Romero, L; Rosca, A; Rosemann, C; Rosenbleck, C; Rosier-Lees, S; Roth, Stefan; Rubio, J A; Ruggiero, G; Rykaczewski, H; Saidi, R; Sakharov, A; Saremi, S; Sarkar, S; Salicio, J; Sanchez, E; Schafer, C; Schegelsky, V; Schmitt, V; Schoeneich, B; Schopper, H; Schotanus, D J; Sciacca, C; Servoli, L; Shen, C Q; Shevchenko, S; Shivarov, N; Shoutko, V; Shumilov, E; Shvorob, A; Son, D; Souga, C; Spillantini, P; Steuer, M; Stickland, D P; Stoyanov, B; Straessner, A; Sudhakar, K; Sulanke, H; Sultanov, G; Sun, L Z; Sushkov, S; Suter, H; Swain, J D; Szillasi, Z; Tang, X W; Tarjan, P; Tauscher, L; Taylor, L; Tellili, B; Teyssier, D; Timmermans, Charles; Ting, Samuel C C; Ting, S M; Tonwar, S C; Toth, J; Trowitzsch, G; Tully, C; Tung, K L; Ulbricht, J; Unger, M; Valente, E; Verkooijen, H; Van de Walle, R T; Vasquez, R; Veszpremi, V; Vesztergombi, G; Vetlitsky, I; Vicinanza, D; Viertel, G; Villa, S; Vivargent, M; Vlachos, S; Vodopianov, I; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Wadhwa, M; Wang, R G; Wang, Q; Wang, X L; Wang, X W; Wang, Z M; Weber, M; van Wijk, R; Wijnen, T A M; Wilkens, H; Wynhoff, S; Xia, L; Xu, Y P; Xu, J S; Xu, Z Z; Yamamoto, J; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Yang, X F; Yao, Z G; Yeh, S C; Yu, Z Q; Zalite, An; Zalite, Yu; Zhang, C; Zhang, F; Zhang, J; Zhang, S; Zhang, Z P; Zhao, J; Zhou, S J; Zhu, G Y; Zhu, R Y; Zhuang, H L; Zhu, Q Q; Zichichi, A; Zimmermann, B; Zoller, M; Zwart, A N M

    2008-01-01

    Primary cosmic rays experience multiple deflections in the nonuniform galactic and heliospheric magnetic fields which may generate anisotropies. A study of anisotropies in the energy range between 100 and 500 GeV is performed. This energy range is not yet well explored. The L3 detector at the CERN electron-positron collider, LEP, is used for a study of the angular distribution of atmospheric muons with energies above 20 GeV. This distribution is used to investigate the isotropy of the time-dependent intensity of the primary cosmic-ray flux with a Fourier analysis. A small deviation from isotropy at energies around 200 GeV is observed for the second harmonics at the solar frequency. No sidereal anisotropy is found at a level above 10^-4. The measurements have been performed in the years 1999 and 2000.

  1. Clinical efficacy of lumbar interbody fusion using a channel system combined with ozone therapy for the treatment of central-type L3-L4 lumbar disc herniation.

    Science.gov (United States)

    Wang, Yu; Sun, Hong; Qin, Shuzhen

    2017-02-01

    The clinical efficacy of minimally invasive lumbar interbody fusion via the intervertebral foramen combined with ozone (O3) therapy for the treatment of L3-L4 central-type lumbar disc herniation was explored. We recruited patients with sciatica who attended our hospital between July 2013 and October 2015 and underwent lumbar X-ray (anteroposterior and lateral view), lumbar flexion-extension radiographs, computed tomography, and magnetic resonance imaging after admission. Seventy-four patients with central-type lumbar disc herniation but no other complications were randomly selected and divided into the observation and control groups. The observation group comprised 37 patients treated with lumbar fusion using a channel system combined with O3 therapy, whereas the control group comprised 37 patients treated with lumbar fusion alone. The effects of the two therapies were evaluated using visual analog scale, Japanese Orthopaedic Association, and MacNab scores. There was no significant difference in scores between the two groups before surgery (P>0.05). The scores of the observation group after treatment were significantly lower than those before surgery and those of the control group (P0.05). Lumbar fusion using a channel system combined with O3 therapy for the treatment of L3-L4 central-type lumbar disc herniation is safe and effective. It has the advantages of reduced trauma, fewer complications, and rapid pain relief, and it promotes the recovery of lumbar function. Strict mastery of the surgical indications is key to the success of the procedure; however, it is worth expanding its use in the clinical setting.

  2. Prognostic value of serum AFP, AFP-L3, and GP73 in monitoring short-term treatment response and recurrence of hepatocellular carcinoma after radiofrequency ablation.

    Science.gov (United States)

    Wang, Nan-Ya; Wang, Cong; Li, Wei; Wang, Guan-Jun; Cui, Guo-Zhen; He, Hua; Zhao, Heng-Jun

    2014-01-01

    Alpha-fetoprotein (AFP), Lens culinaris agglutinin-reactive fraction of AFP (AFP-L3), and Golgi protein 73 (GP73) levels have been widely used as tumor markers for the diagnosis of hepatocellular carcinoma (HCC). The aim of this study was to investigate whether these tumor markers could be used to monitor short-term treatment response and recurrence of HCC in patients undergoing radiofrequency ablation (RFA). Between July 2012 and July 2013, 53 consecutive patients with newly diagnosed HCC were prospectively enrolled in this study. Among these, 32 patients underwent RFA, after which they were followed up prospectively at the First Hospital of Jilin University in China. AFP, AFP-L3, and GP-73 values pre-RFA were not associated with tumor size, whereas AFP and GP-73 levels tended to be associated with tumor number, the presence of vascular invasion, deterioration of liver function, advanced-stage disease, and a poor performance status. GP-73 levels were dramatically elevated in the patients with hepatitis C-associated HCC. Neither pre-RFA nor 1-month post-RFA tumor marker values were associated with short-term outcome. The short-term recurrence rate of AFP-positive patients measured 1 month post-RFA was obviously higher than that of AFP-negative patients. AFP and GP-73 values were associated with clinical variables representing tumor growth and invasiveness, and the AFP value measured 1 month post-RFA was a strong predictor of short-term recurrence in patients with HCC.

  3. Laboratory Study of the OH + Permethylsiloxane (L2, L3, D3, and D4) Reaction Rate Coefficients Between 240 and 370 K

    Science.gov (United States)

    Burkholder, J. B.; Bernard, F.; Papadimitriou, V. C.

    2016-12-01

    The atmospheric chemistry of organosiloxanes has recently been implicated in the formation of new particles as well as regional and indoor air quality. Methylsiloxanes with Sicosmetics, textiles, health care and household products and in industrial applications as solvents and lubricants. They are released into the atmosphere during manufacturing, use, and disposal and have been observed in the atmosphere in ppb levels in certain locations. However, the fundamental chemical properties of this class of compounds, particularly their reactivity with the OH radical, are presently not fully characterized. In this work, the temperature dependence of the rate coefficients for the OH radical reaction with the simplest linear (L2 and L3) and cyclic (D3 and D4) siloxanes were measured: OH + (CH3)3SiOSi(CH3)3 = Products L2OH + [(CH3)3SiO]2Si(CH3)2 = Products L3OH + [-Si(CH3)2O-]3 = Products D3OH + [-Si(CH3)2O-]4 = Products D4OH rate coefficients were measured under pseudo-first conditions in OH over the temperature range 240-370 K using a pulsed laser photolysis-laser induced fluorescence (PLP-LIF) technique and at 296 K using a relative rate method. The present results are compared with available literature data where possible and discrepancies are discussed. The results from this work will be discussed in terms of the atmospheric lifetimes of these methylsiloxanes and the reactivity trends for this class of compound.

  4. GHRSST L3C global sub-skin Sea Surface Temperature from the Advanced Very High Resolution Radiometer (AVHRR) on Metop satellites (currently Metop-B) (GDS V2) produced by OSI SAF (GDS version 2)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A global Group for High Resolution Sea Surface Temperature (GHRSST) Level 3 Collated (L3C) dataset derived from the Advanced Very High Resolution Radiometer (AVHRR)...

  5. GHRSST L3C global sub-skin Sea Surface Temperature from the Advanced Very High Resolution Radiometer (AVHRR) on Metop satellites (currently Metop-A) (GDS V2) produced by OSI SAF (GDS version 2)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A global Group for High Resolution Sea Surface Temperature (GHRSST) Level 3 Collated (L3C) dataset derived from the Advanced Very High Resolution Radiometer (AVHRR)...

  6. AMSR-E/Aqua surface soil moisture (LPRM) L3 1 day 25 km x 25 km descending V002 (LPRM_AMSRE_D_SOILM3) at GES DISC

    Data.gov (United States)

    National Aeronautics and Space Administration — AMSR-E/Aqua surface soil moisture (LPRM) L3 1 day 25 km x 25 km descending V002 is a Level 3 (gridded) data set. Its land surface parameters, surface soil moisture,...

  7. AMSR-E/Aqua surface soil moisture (LPRM) L3 1 day 25 km x 25 km ascending V002 (LPRM_AMSRE_A_SOILM3) at GES DISC

    Data.gov (United States)

    National Aeronautics and Space Administration — AMSR-E/Aqua surface soil moisture (LPRM) L3 1 day 25 km x 25 km ascending V002 is a Level 3 (gridded) data set. Its land surface parameters, surface soil moisture,...

  8. [Predictive value of single nucleotide polymorphisms of HLA-C and UBE2L3 in evaluating the effect of telbivudine antiviral therapy during pregnancy].

    Science.gov (United States)

    Liu, J F; Wang, J; Guo, D D; Qi, C J; Cao, F R; Tian, Z; Yao, N J; Wu, Y C; Yang, Y; He, Y L; Zhao, Y R; Chen, T Y

    2017-08-20

    Objective: To investigate the association between single nucleotide polymorphisms (SNPs) of rs3130542 and rs4821116 in the HLA-C and UBE2L3 genes and the effect of telbivudine antiviral therapy during pregnancy in HBeAg-positive mothers through a large-sample control study, and to provide a basis for the development of individualized blocking strategies for pregnant women with a high viral load. Methods: The genotypes of rs3130542 and rs4821116 were determined for 312 pregnant women with a high viral load who received telbivudine antiviral therapy during the second or third trimester of pregnancy, and the dominant model, recessive model, and additive model were used to analyze the association between the genotypes of these two loci and the reduction in HBV DNA load. The Shapiro-Wilk test and the Levene test were used to evaluate data normality and homogeneity of variances, and the t-test or the non-parametric Mann-Whitney U test was selected based on data type and was used for the comparison of means between groups. The Hardy-Weinberg equilibrium was used to determine the genotype of SNPs, and the dominant model, recessive model, and additive model were used for analysis. Results: Mothers with an AA/AG genotype of rs3130542 in the HLA-C gene had a significantly higher probability of HBV DNA load ≥10(3) IU/ml at the time of delivery (P < 0.05) and a significantly higher risk of failure in the prevention of mother-to-child transmission, no matter whether they started to take telbivudine at week 24 or 28 of pregnancy. The association between the genotype of rs4821116 in the UBE2L3 gene and the reduction in viral load in pregnant women needed to be confirmed by studies with a larger sample size. Conclusion: Pregnant women with a high viral load and an AA/AG genotype of rs3130542 in the HLA-C gene tend to have poor response to antiviral therapy during pregnancy, and early antiviral intervention is recommended for such patients.

  9. Suche nach dem Higgs-Boson in hadronischen Endzuständen mit fehlender Energie am L3-Experiment bei LEP

    CERN Document Server

    Zöller, Marc Henning

    2005-01-01

    This thesis presents searches for the Higgs boson, which is predicted by the Standard Model of Particle Physics and its extensions in order to endow fermions and bosons with their observed masses. While the Standard Model predicts only one Higgs boson »H«, the Minimal Supersymmetric Extension contains five Higgs bosons. This analysis refers to the light neutral »h«, which has nearly the same properties as the Standard Model Higgs boson. The analyses are based on data taken by the L3 experiment at the Large Electron Positron Collider (LEP) near Geneva during the years 1998 until 2000, which corresponds to an integrated luminosity of 629.7 pb−1 and which were collected in a center-of-mass energy range from 189 GeV to 209 GeV. The Higgs boson searches presented here analyse the data with regard to hadronic events with missing energy, since the visible energy is reduced compared to the total energy given by the LEP collider. According to theoretical prediction these final states can be produced via the Higg...

  10. Retention Mechanisms of Citric Acid in Ternary Kaolinite-Fe(III)-Citrate Acid Systems Using Fe K-edge EXAFS and L3,2-edge XANES Spectroscopy

    Science.gov (United States)

    Yang, Jianjun; Wang, Jian; Pan, Weinan; Regier, Tom; Hu, Yongfeng; Rumpel, Cornelia; Bolan, Nanthi; Sparks, Donald

    2016-01-01

    Organic carbon (OC) stability in tropical soils is strongly interlinked with multivalent cation interaction and mineral association. Low molecular weight organic acids (LMWOAs) represent the readily biodegradable OC. Therefore, investigating retention mechanisms of LMWOAs in mineral-cation-LMWOAs systems is critical to understanding soil C cycling. Given the general acidic conditions and dominance of kaolinite in tropical soils, we investigated the retention mechanisms of citric acid (CA) in kaolinite-Fe(III)-CA systems with various Fe/CA molar ratios at pH ~3.5 using Fe K-edge EXAFS and L3,2-edge XANES techniques. With Fe/CA molar ratios >2, the formed ferrihydrite mainly contributed to CA retention through adsorption and/or coprecipitation. With Fe/CA molar ratios from 2 to 0.5, ternary complexation of CA to kaolinite via a five-coordinated Fe(III) bridge retained higher CA than ferrihydrite-induced adsorption and/or coprecipitation. With Fe/CA molar ratios ≤0.5, kaolinite-Fe(III)-citrate complexation preferentially occurred, but less CA was retained than via outer-sphere kaolinite-CA complexation. This study highlighted the significant impact of varied Fe/CA molar ratios on CA retention mechanisms in kaolinite-Fe(III)-CA systems under acidic conditions, and clearly showed the important contribution of Fe-bridged ternary complexation on CA retention. These findings will enhance our understanding of the dynamics of CA and other LMWOAs in tropical soils. PMID:27212680

  11. Search for TeV-Antiprotons in Space from the Shadowing of Cosmic Rays by the Moon with the L3+C Detector

    CERN Document Server

    Xu, Yupeng

    2005-01-01

    A search for antiprotons in the primary cosmic ray flux has been performed by observing the Moon shadow with the muon data collected by the L3+C experiment at CERN during 1999 and 2000. The angular resolution of the detector and its dependences on the muon energy and zenith angle are obtained at the event level with a Monte Carlo simulation and the analysis of real double muon data using a maximum likelihood method. The Moon shadow effect is observed in three muon momentum bands > 100GeV/c, 65 - 100 GeV/c and 30 - 65 GeV/c with a significance of 7.0 cr, 5.8 cr and 5.2 cr respectively. Two dimensional maximum likelihood analyses are performed, both with binned data and unbinned data. The unbinned method gives a smaller uncertainty on the measurement of the antiproton to proton ratio. For a muon momentum cut at 70 GeV/c, the antiproton to proton ratio is measured to be -0.12 + 0.11 and an upper limit of this ratio is estimated to be 0.08 (at 90% confidence level) for primary energies in the range 0.8 TeV to 2.4...

  12. Radiographic versus direct measurements of the spinal canal at lumbar vertebrae L3-L5 and their relations to age and body stature

    Energy Technology Data Exchange (ETDEWEB)

    Leiviskae, T.; Videman, T.; Nurminen, T.; Troup, J.D.G.

    The role of the narrow lumbar spinal canal in back and sciatic pain is well established. The accuracy of measurements obtained from lumbar radiographs was therefore analyzed in lumbar spine specimens taken from 132 male cadavers. After removal of soft tissues, the same distances were measured on the bones of 80 specimens. Comparisons were made after correction for magnification, the radiographic measurements of interpedicular distances being, on average, 2 mm greater at L3 than the osteologic ones and 4 mm greater at L5. Interarticular distances, midsagittal diameters, and pedicular lengths were, on average, 1 mm greater and foraminal anteroposterior measurements 1 mm less than the osteologic ones. Body stature correlated with interpedicular and interarticular distances, pedicular length, and foraminal anteroposterior measurements. In older age groups, the midsagittal diameter tended to be reduced. A number of correlations were found between the five measurements, e.g. between the anteroposterior diameter of the intervertebral foramen and the pedicular length. Measurements in the transverse plane were independent of those in the anteroposterior plane. These results confirm and amplify preliminary observations and indicate the potential value of simple measurements on lumbar spine films as an alternative to more sophisticated and expensive radiologic investigations. (orig.).

  13. Data Rates Assessment on L2–L3 CPU Bus and Bus between CPU and RAM in Modern CPUs

    Directory of Open Access Journals (Sweden)

    Maria S. Komar

    2017-01-01

    Full Text Available In this paper, a modern CPU architecture with several different cache levels is described, and current CPU performance limitations such as silicone physical limitations or frequency increase bounds are mentioned. As usual, changes of the currently existing architecture are proposed as a way of increasing CPU performance, data rates on the internal and external CPU interfaces must be known. It would help to assess applicability of proposed solutions and allow to optimize them. This paper is aimed at getting real values of traffic on L2-L3 cache interface inside CPU and CPU-RAM bus load as well as show dependencies of total traffic on the interfaces of interest on the number of active cores, CPU frequency and test type. Measurements methodology using Intel Performance Counter Monitor by Intel is provided and equations that allow to get data rates from internal CPU counters are explained. Both real life and synthetic tests are described. Dependency of total traffic on the number of active cores and dependency of total traffic on CPU frequency are provided as plots. Dependency of total traffic on test type provided as bar plot for multiple CPU frequencies.

  14. Advanced approach to the local structure reconstruction and theory validation on the example of the W L3-edge extended x-ray absorption fine structure of tungsten

    Science.gov (United States)

    Jonane, Inga; Anspoks, Andris; Kuzmin, Alexei

    2018-02-01

    Atomistic simulations of the experimental W L3-edge extended x-ray absorption fine structure (EXAFS) of bcc tungsten at T = 300 K were performed using classical molecular dynamics (MD) and reverse Monte Carlo (RMC) methods. The MD-EXAFS method based on the results of MD simulations allowed us to access the structural information, encoded in EXAFS, beyond the first coordination shell and to validate the accuracy of two interaction potential models—the embedded atom model potential and the second nearest-neighbor modified embedded atom method potential. The RMC-EXAFS method was used for more elaborate analysis of the EXAFS data giving access to thermal disorder effects. The results of both methods suggest that the correlation in atomic motion in bcc tungsten becomes negligible above 8 Å. This fact allowed us to use the EXAFS data to determine not only mean-square relative displacements of atomic W–W pair motion but also mean-square displacements of individual tungsten atoms, which are usually accessible from diffraction data only.

  15. Determinación de las propiedades mecánicas de unidades de columna anterior y unidades funcionales del segmento lumbar porcino L3-L4

    Directory of Open Access Journals (Sweden)

    Ricardo Gustavo Rodríguez-Cañizo

    2014-01-01

    Full Text Available Los especímenes porcinos han demostrado ser una excelente opción para la experimentación de la columna vertebral, ya que tanto anatómica como biomecánicamente tienen similitudes con los humanos. No obstante, existen diferencias que deben ser tomadas en cuenta cuando se comparan ambos especímenes. El objetivo de este estudio es realizar pruebas de compresión axial a Unidades de Columna Anterior (UCA’s y a Unidades Funcionales (UF’s del segmento lumbar porcino L3-L4, para determinar el coeficiente de rigidez y comparar los resultados obtenidos con la información encontrada en la literatura para el caso humano. Los resultados mostraron que las UF’s soportan aproximadamente un 22% más de carga en comparación con las UCA’s, lo cual se aproxima al 18% encontrado para el caso humano. Se concluye por lo tanto, que principalmente características como la morfometría vertebral, influye de manera directa en las propiedades mecánicas de las UCA’s y las UF’s.

  16. Estimation of Ce 4f-5d Interaction by Analysis of Partial Fluorescence Yield at the Ce L3 Edge of CeO2

    Science.gov (United States)

    Tonai, Hironori; Sasabe, Norimasa; Uozumi, Takayuki; Kawamura, Naomi; Mizumaki, Masaichiro

    2017-09-01

    Partial fluorescence yield (PFY) spectroscopy, which corresponds to a high-resolution version of the X-ray absorption spectroscopy (XAS), is experimentally performed at the Ce L3 edge of CeO2, and the result is theoretically analyzed using an impurity Anderson model (IAM). In order to estimate the Ce 4f-5d interaction Ufd, we employ a semi-empirical IAM framework based on the local density approximation+U method; Slater-Koster parameters describing the valence of CeO2 are estimated by band mapping within the linear combination of atomic orbitals scheme, and the resulting realistic valence structure is considered in the IAM analysis. The global structure of the PFY-XAS result, which consists of the Ce 2p3/2 → 5d dipole transition and the Ce 2p3/2 → 4f quadrupole transition, is excellently reproduced by the calculation. The Ufd value is estimated to be 3.0 eV. We emphasize that the sensitivity of PFY-XAS to Ufd makes it a good ruler for obtaining the Ufd values of Ce compounds.

  17. Interlaminar shear stresses and laminae separation in a disc. Finite element analysis of the L3-L4 motion segment subjected to axial compressive loads.

    Science.gov (United States)

    Goel, V K; Monroe, B T; Gilbertson, L G; Brinckmann, P

    1995-03-15

    This study analyzed interlaminar shear stresses across the laminae of a ligamentous L3-L4 motion segment. A three-dimensional finite element model of the motion segment was developed and its response in axial compression mode was predicted. The contributions of "mechanical" factors in producing laminae separation in a disc are not well understood, especially when the nucleus is still gel-like in appearance (stage 1 of disc degeneration). All types of stresses are likely to contribute to laminae separation. The authors believe it is partially due to the interlaminar shear stresses at the laminae interfaces in specific regions of an intact disc because the disc is a composite structure. The effects of anular tears on the interlaminar shear stresses were also investigated. These tears can be circumferential or radial in nature, and commonly occur in the aged, degenerated disc. A large number of biomechanical studies dealing with the role of the disc vis-a-vis other spinal components have been reported in the literature. The role of mechanical factors, however, in producing laminae separation, especially when the nucleus is still gel-like in appearance (stage 1 of disc degeneration), is not entirely clear. A three-dimensional nonlinear finite element model of an intact L3-L4 lumbar motion segment, based on the use of a special type of element for the disc anulus, was created to investigate the interlaminar shear stresses in the anulus. The effects of radial "out-in," radial "in-out," and "circumferential" injuries were analyzed. Injury was modeled as element removal in the posterolateral portion of the disc. Models subjected to axial compressive loads, ranging from 200 N to 2000 N, were analyzed. In addition to the interlaminar shear stresses, disc bulge, and displacements including coupled motions were predicted. The theoretical disc bulge predictions for the radial in-out injury case were in agreement with the disc bulge data obtained experimentally. Displacements

  18. Summary of International Waste Management Programs (LLNL Input to SNL L3 MS: System-Wide Integration and Site Selection Concepts for Future Disposition Options for HLW)

    Energy Technology Data Exchange (ETDEWEB)

    Greenberg, Harris R. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Blink, James A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Halsey, William G. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Sutton, Mark [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2011-08-11

    The Used Fuel Disposition Campaign (UFDC) within the Department of Energy’s Office of Nuclear Energy (DOE-NE) Fuel Cycle Technology (FCT) program has been tasked with investigating the disposal of the nation’s spent nuclear fuel (SNF) and high-level nuclear waste (HLW) for a range of potential waste forms and geologic environments. This Lessons Learned task is part of a multi-laboratory effort, with this LLNL report providing input to a Level 3 SNL milestone (System-Wide Integration and Site Selection Concepts for Future Disposition Options for HLW). The work package number is: FTLL11UF0328; the work package title is: Technical Bases / Lessons Learned; the milestone number is: M41UF032802; and the milestone title is: “LLNL Input to SNL L3 MS: System-Wide Integration and Site Selection Concepts for Future Disposition Options for HLW”. The system-wide integration effort will integrate all aspects of waste management and disposal, integrating the waste generators, interim storage, transportation, and ultimate disposal at a repository site. The review of international experience in these areas is required to support future studies that address all of these components in an integrated manner. Note that this report is a snapshot of nuclear power infrastructure and international waste management programs that is current as of August 2011, with one notable exception. No attempt has been made to discuss the currently evolving world-wide response to the tragic consequences of the earthquake and tsunami that devastated Japan on March 11, 2011, leaving more than 15,000 people dead and more than 8,000 people missing, and severely damaging the Fukushima Daiichi nuclear power complex. Continuing efforts in FY 2012 will update the data, and summarize it in an Excel spreadsheet for easy comparison and assist in the knowledge management of the study cases.

  19. Diagnosis of maxillofacial tumor with L-3-[18f]-fluoro-alpha-methyltyrosine (FMT) PET: a comparative study with FDG-PET.

    Science.gov (United States)

    Miyakubo, Mitsuyuki; Oriuchi, Noboru; Tsushima, Yoshito; Higuchi, Tetsuya; Koyama, Keiko; Arai, Kiyokazu; Paudyal, Bishnuhari; Iida, Yasuhiko; Hanaoka, Hirofumi; Ishikita, Tomohiro; Nakasone, Yoshiki; Negishi, Akihide; Mogi, Kenji; Endo, Keigo

    2007-02-01

    To compare L-3-[18F]-fluoro-a-methyltyrosine (FMT)-positron emission tomography (PET) and 2-[18F]-fluoro-2-deoxy-D-glucose (FDG)-PET in the differential diagnosis of maxillofacial tumors. This study included 36 patients (16 males, 20 females; 31-90 years old) with untreated malignant tumors (34 squamous cell carcinoma, one mucoepidermoid carcinoma, one rhabdomyosarcoma) and seven patients (five males, two females; 32-81 years old) with benign lesions. In all patients, both FMT-PET and FDG-PET were performed within two weeks before biopsy or treatment of the lesions. To evaluate the diagnostic usefulness of FMT-PET and FDG-PET, visual interpretation and semiquantitative analysis were performed. PET images were rated according to the contrast of tumor uptake as compared with background, and were statistically analyzed. As a semiquantitative analysis, standardized uptake values (SUV) of the primary tumors were measured, and the SUV data were analyzed using receiver operating characteristic (ROC) curves. The mean SUV of the malignant lesions were significantly higher than those of the benign lesions in both FMT-PET (2.62 +/- 1.58 vs. 1.20 +/- 0.30, p FMT and FDG. ROC analysis revealed that there was no statistically significant difference in SUVs between FMT and FDG for differentiating malignant tumors. In 27 of 36 patients, FMT-PET had better contrast of malignant tumor visualization to the surrounding normal structures by visual assessment (p FMT-PET based on the uptake in maxillofacial tumors is equivalent to FDG-PET. However, the contrast of FMT uptake between maxillofacial tumors and the surrounding normal structures is higher than that of FDG, indicating the possibility of accurate diagnosis of maxillofacial tumors by FMT-PET.

  20. Enhancement of L-3-hydroxybutyryl-CoA dehydrogenase activity and circulating ketone body levels by pantethine. Relevance to dopaminergic injury

    Directory of Open Access Journals (Sweden)

    de Reggi Max

    2010-04-01

    Full Text Available Abstract Background The administration of the ketone bodies hydroxybutyrate and acetoacetate is known to exert a protective effect against metabolic disorders associated with cerebral pathologies. This suggests that the enhancement of their endogenous production might be a rational therapeutic approach. Ketone bodies are generated by fatty acid beta-oxidation, a process involving a mitochondrial oxido-reductase superfamily, with fatty acid-CoA thioesters as substrates. In this report, emphasis is on the penultimate step of the process, i.e. L-3-hydroxybutyryl-CoA dehydrogenase activity. We determined changes in enzyme activity and in circulating ketone body levels in the MPTP mouse model of Parkinson's disease. Since the active moiety of CoA is pantetheine, mice were treated with pantethine, its naturally-occurring form. Pantethine has the advantage of being known as an anti-inflammatory and hypolipidemic agent with very few side effects. Results We found that dehydrogenase activity and circulating ketone body levels were drastically reduced by the neurotoxin MPTP, whereas treatment with pantethine overcame these adverse effects. Pantethine prevented dopaminergic neuron loss and motility disorders. In vivo and in vitro experiments showed that the protection was associated with enhancement of glutathione (GSH production as well as restoration of respiratory chain complex I activity and mitochondrial ATP levels. Remarkably, pantethine treatment boosted the circulating ketone body levels in MPTP-intoxicated mice, but not in normal animals. Conclusions These finding demonstrate the feasibility of the enhancement of endogenous ketone body production and provide a promising therapeutic approach to Parkinson's disease as well as, conceivably, to other neurodegenerative disorders.

  1. Search for baryon number violating decays of supersymmetric particles e{sup +}e{sup -} collisions produced in the L3 detector at LEP; Recherche de particules supersymetriques se desintegrant avec violation du nombre baryonique dans les collisions e{sup +}e{sup -} produites dans le detecteur L3 a LEP

    Energy Technology Data Exchange (ETDEWEB)

    Brochu, F

    2000-04-01

    This thesis is based on baryon number and then R-Parity (R{sub p}) violation, both allowed in the Minimal Supersymmetric Standard Model (MSSM) framework. This hypothesis leads to supersymmetric particles' decay topologies significantly different from those ever studied and opens new possibilities on searches for supersymmetry. We will detail throughout this work the phenomenological consequences of the baryon number violation hypothesis, the resulting decay signatures in an e{sup +}e{sup -} collider and the analysis setup developed to isolate these decays in the data collected by the L3 experiment at LEP between 1997 and 2000. In order to validate the search methods developed, we also measured the cross-section of the process e{sup +}e{sup -} {yields} ZZ {yields} qq-bar q'q'-bar. (author)

  2. Filarial worms reduce Plasmodium infectivity in mosquitoes.

    Directory of Open Access Journals (Sweden)

    Matthew T Aliota

    2011-02-01

    Full Text Available Co-occurrence of malaria and filarial worm parasites has been reported, but little is known about the interaction between filarial worm and malaria parasites with the same Anopheles vector. Herein, we present data evaluating the interaction between Wuchereria bancrofti and Anopheles punctulatus in Papua New Guinea (PNG. Our field studies in PNG demonstrated that An. punctulatus utilizes the melanization immune response as a natural mechanism of filarial worm resistance against invading W. bancrofti microfilariae. We then conducted laboratory studies utilizing the mosquitoes Armigeres subalbatus and Aedes aegypti and the parasites Brugia malayi, Brugia pahangi, Dirofilaria immitis, and Plasmodium gallinaceum to evaluate the hypothesis that immune activation and/or development by filarial worms negatively impact Plasmodium development in co-infected mosquitoes. Ar. subalbatus used in this study are natural vectors of P. gallinaceum and B. pahangi and they are naturally refractory to B. malayi (melanization-based refractoriness.Mosquitoes were dissected and Plasmodium development was analyzed six days after blood feeding on either P. gallinaceum alone or after taking a bloodmeal containing both P. gallinaceum and B. malayi or a bloodmeal containing both P. gallinaceum and B. pahangi. There was a significant reduction in the prevalence and mean intensity of Plasmodium infections in two species of mosquito that had dual infections as compared to those mosquitoes that were infected with Plasmodium alone, and was independent of whether the mosquito had a melanization immune response to the filarial worm or not. However, there was no reduction in Plasmodium development when filarial worms were present in the bloodmeal (D. immitis but midgut penetration was absent, suggesting that factors associated with penetration of the midgut by filarial worms likely are responsible for the observed reduction in malaria parasite infections.These results could have an

  3. Multi-Satellite Lambertian Equivalent Reflectivity (Local Satellite Time) 10-Day L3 Global 2.0x5.0deg Lat/Lon Grid V1 (MSLERLSTL3d10) at GES DISC

    Data.gov (United States)

    National Aeronautics and Space Administration — The Multi-Satellite Lambertian Equivalent Reflectivity (Local Satellite Time) 10-Day L3 Global 2.0x5.0deg Lat/Lon Grid data product is derived from multi-satellite...

  4. l378eg.m77t - MGD77 data file for Geophysical data from field activity L-3-78-EG in Eastern Gulf of Alaska from 06/22/1978 to 07/04/1978

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry, gravity, and magnetic data along with DGPS navigation data was collected as part of field activity L-3-78-EG in Eastern Gulf of Alaska from...

  5. AMSR-E/Aqua root zone soil moisture (LPRM) L3 1 day 25 km x 25 km descending and 2-Layer Palmer Water Balance Model V001 (LPRM_AMSRE_D_RZSM3) at GES DISC

    Data.gov (United States)

    National Aeronautics and Space Administration — AMSR-E/Aqua root zone soil moisture (LPRM) L3 1 day 25 km x 25 km descending and 2-Layer Palmer Water Balance Model V001 is a Level 3 (gridded) root zone soil...

  6. Uptake mechanisms of L-3-[I-125]iodo-alpha-methyl-tyrosine in a human small-cell lung cancer cell line : comparison with L-1-[C-14]tyrosine

    NARCIS (Netherlands)

    Jager, PL; De Vries, EGE; Piers, DA; Timmer-Bosscha, H

    The radiolabelled amino acid analogue L-3-[I-125]iodo-alpha-methyl-tyrosine (IMT) is under evaluation in brain tumours, where it reflects amino acid transport activity, but is also taken up in many other tumour types. This study investigated the uptake mechanism of IMT in tumour cells not derived

  7. Multi-Satellite Lambertian Equivalent Reflectivity (Noon Normalized) 10-Day L3 Global 2.0x5.0deg Lat/Lon Grid V1 (MSLERNNL3d10) at GES DISC

    Data.gov (United States)

    National Aeronautics and Space Administration — The Multi-Satellite Lambertian Equivalent Reflectivity (Noon Normalized) 10-Day L3 Global 2.0x5.0deg Lat/Lon Grid data product is derived from multi-satellite Solar...

  8. Evaluation of immune responses and analysis of the effect of vaccination of the Leishmania major recombinant ribosomal proteins L3 or L5 in two different murine models of cutaneous leishmaniasis.

    Science.gov (United States)

    Ramírez, Laura; Santos, Diego M; Souza, Ana P; Coelho, Eduardo A F; Barral, Aldina; Alonso, Carlos; Escutia, Marta R; Bonay, Pedro; de Oliveira, Camila I; Soto, Manuel

    2013-02-18

    Four new antigenic proteins located in Leishmania ribosomes have been characterized: S4, S6, L3 and L5. Recombinant versions of the four ribosomal proteins from Leishmania major were recognized by sera from human and canine patients suffering different clinical forms of leishmaniasis. The prophylactic properties of these proteins were first studied in the experimental model of cutaneous leishmaniasis caused by L. major inoculation into BALB/c mice. The administration of two of them, LmL3 or LmL5 combined with CpG-oligodeoxynucleotides (CpG-ODN) was able to protect BALB/c mice against L. major infection. Vaccinated mice showed smaller lesions and parasite burden compared to mice inoculated with vaccine diluent or vaccine adjuvant. Protection was correlated with an antigen-specific increased production of IFN-γ paralleled by a decrease of the antigen-specific IL-10 mediated response in protected mice relative to non-protected controls. Further, it was demonstrated that BALB/c mice vaccinated with recombinant LmL3 or LmL5 plus CpG-ODN were also protected against the development of cutaneous lesions following inoculation of L. braziliensis. Together, data presented here indicate that LmL3 or LmL5 ribosomal proteins combined with Th1 inducing adjuvants, may be relevant components of a vaccine against cutaneous leishmaniasis caused by distinct species. Copyright © 2013 Elsevier Ltd. All rights reserved.

  9. l380np.m77t - MGD77 data file for Geophysical data field activity L-3-80-NP in North Pacific from 05/22/1980 to 06/04/1980

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry and magnetics data along with DGPS navigation data was collected as part of field activity L-3-80-NP in North Pacific from 05/22/1980 to...

  10. AMSR2/GCOM-W1 surface soil moisture (LPRM) L3 1 day 25 km x 25 km ascending V001 (LPRM_AMSR2_A_SOILM3) at GES DISC

    Data.gov (United States)

    National Aeronautics and Space Administration — AMSR2/GCOM-W1 surface soil moisture (LPRM) L3 1 day 25 km x 25 km ascending V001 is a Level 3 (gridded) data set. Its land surface parameters, surface soil moisture,...

  11. AMSR2/GCOM-W1 surface soil moisture (LPRM) L3 1 day 25 km x 25 km descending V001 (LPRM_AMSR2_D_SOILM3) at GES DISC

    Data.gov (United States)

    National Aeronautics and Space Administration — AMSR2/GCOM-W1 surface soil moisture (LPRM) L3 1 day 25 km x 25 km descending V001 is a Level 3 (gridded) data set. Its land surface parameters, surface soil...

  12. AMSR2/GCOM-W1 surface soil moisture (LPRM) L3 1 day 10 km x 10 km ascending V001 (LPRM_AMSR2_DS_A_SOILM3) at GES DISC

    Data.gov (United States)

    National Aeronautics and Space Administration — AMSR2/GCOM-W1 surface soil moisture (LPRM) L3 1 day 10 km x 10 km ascending V001 is a Level 3 (gridded) data set. Its land surface parameters, surface soil moisture,...

  13. AMSR2/GCOM-W1 surface soil moisture (LPRM) L3 1 day 10 km x 10 km descending V001 (LPRM_AMSR2_DS_D_SOILM3) at GES DISC

    Data.gov (United States)

    National Aeronautics and Space Administration — AMSR2/GCOM-W1 surface soil moisture (LPRM) L3 1 day 10 km x 10 km descending V001 is a Level 3 (gridded) data set. Its land surface parameters, surface soil...

  14. Cross-protective effect of a combined L5 plus L3 Leishmania major ribosomal protein based vaccine combined with a Th1 adjuvant in murine cutaneous and visceral leishmaniasis

    Science.gov (United States)

    2014-01-01

    Background Two Leishmania major ribosomal proteins L3 (LmL3) and L5 (LmL5) have been described as protective molecules against cutaneous leishmaniasis due to infection with L. major and Leishmania braziliensis in BALB/c mice when immunized with a Th1 adjuvant (non-methylated CpG-oligodeoxynucleotides; CpG-ODN). In the present study we analyzed the cross-protective efficacy of an LmL3-LmL5-CpG ODN combined vaccine against infection with Leishmania amazonensis and Leishmania chagasi (syn. Leishmania infantum) the etiologic agents of different clinical forms of human leishmaniasis in South America. Methods The combined vaccine was administered subcutaneously to BALB/c mice. After immunization the cellular and humoral responses elicited were analyzed. Mice were independently challenged with L. amazonensis and L. chagasi. The size of the cutaneous lesions caused by the infection with the first species, the parasite loads and the immune response in both infection models were analyzed nine weeks after challenge. Results Mice vaccinated with the combined vaccine showed a Th1-like response against LmL3 and LmL5. Vaccinated mice were able to delay lesion development due to L. amazonensis infection and to control parasite loads in the site of infection. A reduction of the parasite burden in the lymph nodes draining the site of infection and in the liver and spleen was observed in the vaccinated mice after a subcutaneous infection with L. chagasi. In both models of infection, protection was correlated to parasite antigen-specific production of IFN-γ and down-regulation of parasite-mediated IL-4 and IL-10 responses. Conclusions The data presented here demonstrate the potential use of L. major L3 and L5 recombinant ribosomal proteins for the development of vaccines against various Leishmania species. PMID:24382098

  15. Cross-protective effect of a combined L5 plus L3 Leishmania major ribosomal protein based vaccine combined with a Th1 adjuvant in murine cutaneous and visceral leishmaniasis.

    Science.gov (United States)

    Ramirez, Laura; Corvo, Laura; Duarte, Mariana C; Chávez-Fumagalli, Miguel A; Valadares, Diogo G; Santos, Diego M; de Oliveira, Camila I; Escutia, Marta R; Alonso, Carlos; Bonay, Pedro; Tavares, Carlos A P; Coelho, Eduardo A F; Soto, Manuel

    2014-01-02

    Two Leishmania major ribosomal proteins L3 (LmL3) and L5 (LmL5) have been described as protective molecules against cutaneous leishmaniasis due to infection with L. major and Leishmania braziliensis in BALB/c mice when immunized with a Th1 adjuvant (non-methylated CpG-oligodeoxynucleotides; CpG-ODN). In the present study we analyzed the cross-protective efficacy of an LmL3-LmL5-CpG ODN combined vaccine against infection with Leishmania amazonensis and Leishmania chagasi (syn. Leishmania infantum) the etiologic agents of different clinical forms of human leishmaniasis in South America. The combined vaccine was administered subcutaneously to BALB/c mice. After immunization the cellular and humoral responses elicited were analyzed. Mice were independently challenged with L. amazonensis and L. chagasi. The size of the cutaneous lesions caused by the infection with the first species, the parasite loads and the immune response in both infection models were analyzed nine weeks after challenge. Mice vaccinated with the combined vaccine showed a Th1-like response against LmL3 and LmL5. Vaccinated mice were able to delay lesion development due to L. amazonensis infection and to control parasite loads in the site of infection. A reduction of the parasite burden in the lymph nodes draining the site of infection and in the liver and spleen was observed in the vaccinated mice after a subcutaneous infection with L. chagasi. In both models of infection, protection was correlated to parasite antigen-specific production of IFN-γ and down-regulation of parasite-mediated IL-4 and IL-10 responses. The data presented here demonstrate the potential use of L. major L3 and L5 recombinant ribosomal proteins for the development of vaccines against various Leishmania species.

  16. Learning More, Perceiving More? A Comparison of L1 Cantonese--L2 English--L3 French Speakers and L1 Cantonese--L2 English Speakers in Hong Kong

    Science.gov (United States)

    Tsang, Wai Lan

    2015-01-01

    This paper reports on a study examining the relationship between language learning and perceived language differences. Two groups of native Cantonese speakers in Hong Kong, L1 Cantonese--L2 English (CE) and L1 Cantonese--L2 English--L3 French (CEF), were asked to complete two tasks: a placement test in English (as well as in French for the CEF…

  17. Luminescent properties and structure of new CAPh-based lanthanide complexes [LnL3Q], containing additional bis-heterocyclic aromatic ligand-antenna 2-(1,3,4-oxadiazole-2-yl) pyridine

    Science.gov (United States)

    Yakovlev, Oleksii O.; Kariaka, Nataliia S.; Trush, Victor A.; Smola, Sergii S.; Siczek, Milosz; Amirkhanov, Vladimir M.

    2018-01-01

    The new lanthanide coordination compounds of general formula [LnL3Q], where Ln = Eu, Gd, Tb; L = dimethyl-N-trichloroacetylamidophosphate and Q = 2-(1,3,4-oxadiazole-2-yl)pyridine, have been synthesized and isolated in crystalline state with the purpose of finding new interesting optical materials. X-ray data reveal that complexes have molecular structure with numerous Van-der-Vaals contacts between molecules. All the ligands are coordinated in bidentate chelate manner, coordination polyhedron was interpreted as distored square antiprism (CN 8). The obtained complexes were investigated by means of IR, absorption and luminescence spectroscopy as well and thermal gravimetric analysis. It was found that complex [TbL3Q] is resistant to temperature of 200 °C. The Eu3+ and Tb3+ complexes exhibit bright metal-centered emission with decay time 1.65 and 1.74 ms respectively. Intrinsic quantum yield for [EuL3Q] equals 85% that is one of the highest values, known to date for CAPh based europium complexes.

  18. Evaluación del efecto de las artemisininas provenientes del extracto etanólico de Artemisia cina sobre L3 de Haemonchus contortus en una técnica de explantes abomasales

    Directory of Open Access Journals (Sweden)

    Rosa Isabel Higuera-Piedrahita

    2016-01-01

    Full Text Available El nuevo enfoque de control integrado de parásitos obliga a buscar alternativas que consideren el medioambiente, es decir, sostenibles y sustentables. El objetivo de este trabajo fue fraccionar el extracto etanólico de la planta Artemisia cina, obtener artemisininas y conocer el efecto de estas sobre la capacidad de asociación de las L3 de Haemonchus contortus en explantes abomasales. El extracto etanólico se fraccionó por medio de la metodología establecida para Artemisia japónica, y se identificaron las artemisininas por medio de cromatografía en capa fina, teniendo como referencia artemisininas comerciales. Las artemisininas se utilizaron sobre L3 desenvainada, se realizó la técnica de explantes abomasales por triplicado y se compararon así: levamisol (7.5 mg/ml, artemisinina comercial (1 mg/ml, agua y seis diferentes fracciones de A. cina a dosis de 1 mg/ml: Ac3k, Ac3b, Ac3a, Ac3h, Ac3i, Ac4b. No se obtuvieron diferencias significativas entre las fracciones de A. cina y artemisinina comercial (p>0.05. Se concluye que no existió efecto de las artemisininas obtenidas del extracto etanólico de A. cina sobre la capacidad de asociación de las L3 de H. contortus al tejido abomasal. Es importante continuar con más estudios de la artemisinina para determinar sobre qué fase del parásito afecta su viabilidad.

  19. Morphological and molecular characteristics of Malayfilaria sofiani Uni, Mat Udin & Takaoka n. g., n. sp. (Nematoda: Filarioidea) from the common treeshrew Tupaia glis Diard & Duvaucel (Mammalia: Scandentia) in Peninsular Malaysia.

    Science.gov (United States)

    Uni, Shigehiko; Mat Udin, Ahmad Syihan; Agatsuma, Takeshi; Saijuntha, Weerachai; Junker, Kerstin; Ramli, Rosli; Omar, Hasmahzaiti; Lim, Yvonne Ai-Lian; Sivanandam, Sinnadurai; Lefoulon, Emilie; Martin, Coralie; Belabut, Daicus Martin; Kasim, Saharul; Abdullah Halim, Muhammad Rasul; Zainuri, Nur Afiqah; Bhassu, Subha; Fukuda, Masako; Matsubayashi, Makoto; Harada, Masashi; Low, Van Lun; Chen, Chee Dhang; Suganuma, Narifumi; Hashim, Rosli; Takaoka, Hiroyuki; Azirun, Mohd Sofian

    2017-04-20

    The filarial nematodes Wuchereria bancrofti (Cobbold, 1877), Brugia malayi (Brug, 1927) and B. timori Partono, Purnomo, Dennis, Atmosoedjono, Oemijati & Cross, 1977 cause lymphatic diseases in humans in the tropics, while B. pahangi (Buckley & Edeson, 1956) infects carnivores and causes zoonotic diseases in humans in Malaysia. Wuchereria bancrofti, W. kalimantani Palmieri, Pulnomo, Dennis & Marwoto, 1980 and six out of ten Brugia spp. have been described from Australia, Southeast Asia, Sri Lanka and India. However, the origin and evolution of the species in the Wuchereria-Brugia clade remain unclear. While investigating the diversity of filarial parasites in Malaysia, we discovered an undescribed species in the common treeshrew Tupaia glis Diard & Duvaucel (Mammalia: Scandentia). We examined 81 common treeshrews from 14 areas in nine states and the Federal Territory of Peninsular Malaysia for filarial parasites. Once any filariae that were found had been isolated, we examined their morphological characteristics and determined the partial sequences of their mitochondrial cytochrome c oxidase subunit 1 (cox1) and 12S rRNA genes. Polymerase chain reaction (PCR) products of the internal transcribed spacer 1 (ITS1) region were then cloned into the pGEM-T vector, and the recombinant plasmids were used as templates for sequencing. Malayfilaria sofiani Uni, Mat Udin & Takaoka, n. g., n. sp. is described based on the morphological characteristics of adults and microfilariae found in common treeshrews from Jeram Pasu, Kelantan, Malaysia. The Kimura 2-parameter distance between the cox1 gene sequences of the new species and W. bancrofti was 11.8%. Based on the three gene sequences, the new species forms a monophyletic clade with W. bancrofti and Brugia spp. The adult parasites were found in tissues surrounding the lymph nodes of the neck of common treeshrews. The newly described species appears most closely related to Wuchereria spp. and Brugia spp., but differs from these in

  20. [Fe2L3]4+ Cylinders Derived from Bis(bidentate 2-Pyridyl-1,2,3-triazole “Click” Ligands: Synthesis, Structures and Exploration of Biological Activity

    Directory of Open Access Journals (Sweden)

    James D. Crowley

    2013-05-01

    Full Text Available A series of metallosupramolecular [Fe2L3](BF44 “click” cylinders have been synthesized in excellent yields (90%–95% from [Fe(H2O6](BF42 and bis(bidentate pyridyl-1,2,3-triazole ligands. All complexes were characterized by elemental analysis, IR, UV-vis, 1H-, 13C- and DOSY-NMR spectroscopies and, in four cases, the structures confirmed by X-ray crystallography. Molecular modeling indicated that some of these “click” complexes were of similar size and shape to related biologically active pyridylimine-based iron(II helicates and suggested that the “click” complexes may bind both duplex and triplex DNA. Cell-based agarose diffusion assays showed that the metallosupramolecular [Fe2L3](BF44 “click” cylinders display no antifungal activity against S. cerevisiae. This observed lack of antifungal activity appears to be due to the poor stability of the “click” complexes in DMSO and biological media.

  1. Full multiple scattering analysis of XANES at the Cd L3 and O K edges in CdO films combined with a soft-x-ray emission investigation

    Energy Technology Data Exchange (ETDEWEB)

    Demchenko, I. N.; Denlinger, J. D.; Chernyshova, M.; Yu, K. M.; Speaks, D. T.; Olalde-Velasco, P.; Hemmers, O.; Walukiewicz, W.; Derkachova, A.; Lawniczak-Jablonska, K.

    2010-07-05

    X-ray absorption near edge structure (XANES) at the cadmium L3 and oxygen K edges for CdO thin films grown by pulsed laser deposition method, is interpreted within the real-space multiple scattering formalism, FEFF code. The features in the experimental spectra are well reproduced by calculations for a cluster of about six and ten coordination shells around the absorber for L3 edge of Cd and K edge of O, respectively. The calculated projected electronic density of states is found to be in good agreement with unoccupied electronic states in experimental data and allows to conclude that the orbital character of the lowest energy of the conductive band is Cd-5s-O-2p. The charge transfer has been quantified and not purely ionic bonding has been found. Combined XANES and resonant inelastic x-ray scattering measurements allow us to determine the direct and indirect band gap of investigated CdO films to be {approx}2.4-eV and {approx}0.9-eV, respectively.

  2. Enrichment of variations in KIR3DL1/S1 and KIR2DL2/L3 among H1N1/09 ICU patients: an exploratory study.

    Directory of Open Access Journals (Sweden)

    David La

    Full Text Available BACKGROUND: Infection by the pandemic influenza A (H1N1/09 virus resulted in significant pathology among specific ethnic groups worldwide. Natural Killer (NK cells are important in early innate immune responses to viral infections. Activation of NK cells, in part, depend on killer-cell immunoglobulin-like receptors (KIR and HLA class I ligand interactions. To study factors involved in NK cell dysfunction in overactive immune responses to H1N1 infection, KIR3DL1/S1 and KIR2DL2/L3 allotypes and cognate HLA ligands of H1N1/09 intensive-care unit (ICU patients were determined. METHODOLOGY AND FINDINGS: KIR3DL1/S1, KIR2DL2/L3, and HLA -B and -C of 51 H1N1/09 ICU patients and 105 H1N1-negative subjects (St. Theresa Point, Manitoba were characterized. We detected an increase of 3DL1 ligand-negative pairs (3DL1/S1(+ Bw6(+ Bw4(-, and a lack of 2DL1 HLA-C2 ligands, among ICU patients. They were also significantly enriched for 2DL2/L3 ligand-positive pairs (PVA, P=0.024, Pc=0.047; Odds Ratio:2.563, CI95%:1.109-5.923, 3DL1*00101 (Ab>VA, PSTh, P=0.034, Pc=0.268, and 3DL1*029 (Ab>STh, P=0.039, Pc=0.301. Aboriginal patients ligand-positive for 3DL1/S1 and 2DL1 had the lowest probabilities of death (R(d (R(d=28%, compared to patients that were 3DL1/S1 ligand-negative (R(d=52% or carried 3DL1*029 (R(d=52%. Relative to Caucasoids (CA, two allotypes were enriched among non-aboriginal ICU patients (NAb: 3DL1*00401 (NAb>CA, P<0.001, Pc<0.001 and 3DL1*01502 (CAL3, and 2DL1 had the lowest probabilities of death (R(d=36%, compared to subjects with 3DL1*01502 (R(d=48% and/or 3DL1*00401 (R(d=58%. CONCLUSIONS: Specific KIR3DL1/S1 allotypes, 3DL1/S1 and 2DL1 ligand-negative pairs, and 2DL2/L3 ligand-positive pairs were enriched among ICU patients. This suggests a possible association with NK cell dysfunction in patients with overactive immune responses to H1N1/09, leading to

  3. MERIS_L3m_IOP

    Data.gov (United States)

    National Aeronautics and Space Administration — MERIS (Medium Resolution Imaging Spectrometer) is a programmable, medium-spectral resolution, imaging spectrometer operating in the solar reflective spectral range....

  4. MERIS_L3b_IOP

    Data.gov (United States)

    National Aeronautics and Space Administration — MERIS (Medium Resolution Imaging Spectrometer) is a programmable, medium-spectral resolution, imaging spectrometer operating in the solar reflective spectral range....

  5. MERIS_L3b_FLH

    Data.gov (United States)

    National Aeronautics and Space Administration — MERIS (Medium Resolution Imaging Spectrometer) is a programmable, medium-spectral resolution, imaging spectrometer operating in the solar reflective spectral range....

  6. MERIS_L3b_RRS

    Data.gov (United States)

    National Aeronautics and Space Administration — MERIS (Medium Resolution Imaging Spectrometer) is a programmable, medium-spectral resolution, imaging spectrometer operating in the solar reflective spectral range....

  7. MERIS_L3b_PAR

    Data.gov (United States)

    National Aeronautics and Space Administration — MERIS (Medium Resolution Imaging Spectrometer) is a programmable, medium-spectral resolution, imaging spectrometer operating in the solar reflective spectral range....

  8. MERIS_L3m_FLH

    Data.gov (United States)

    National Aeronautics and Space Administration — MERIS (Medium Resolution Imaging Spectrometer) is a programmable, medium-spectral resolution, imaging spectrometer operating in the solar reflective spectral range....

  9. MERIS_L3b_PIC

    Data.gov (United States)

    National Aeronautics and Space Administration — MERIS (Medium Resolution Imaging Spectrometer) is a programmable, medium-spectral resolution, imaging spectrometer operating in the solar reflective spectral range....

  10. MERIS_L3m_RRS

    Data.gov (United States)

    National Aeronautics and Space Administration — MERIS (Medium Resolution Imaging Spectrometer) is a programmable, medium-spectral resolution, imaging spectrometer operating in the solar reflective spectral range....

  11. MERIS_L3m_POC

    Data.gov (United States)

    National Aeronautics and Space Administration — MERIS (Medium Resolution Imaging Spectrometer) is a programmable, medium-spectral resolution, imaging spectrometer operating in the solar reflective spectral range....

  12. MERIS_L3m_CHL

    Data.gov (United States)

    National Aeronautics and Space Administration — MERIS (Medium Resolution Imaging Spectrometer) is a programmable, medium-spectral resolution, imaging spectrometer operating in the solar reflective spectral range....

  13. MERIS_L3m_PAR

    Data.gov (United States)

    National Aeronautics and Space Administration — MERIS (Medium Resolution Imaging Spectrometer) is a programmable, medium-spectral resolution, imaging spectrometer operating in the solar reflective spectral range....

  14. OCTS_L3b_PAR

    Data.gov (United States)

    National Aeronautics and Space Administration — On August 17, 1996, the Japanese Space Agency (NASDA - National Space Development Agency) launched the Advanced Earth Observing Satellite (ADEOS). ADEOS was in a...

  15. MERIS_L3m_KD

    Data.gov (United States)

    National Aeronautics and Space Administration — MERIS (Medium Resolution Imaging Spectrometer) is a programmable, medium-spectral resolution, imaging spectrometer operating in the solar reflective spectral range....

  16. MERIS_L3b_CHL

    Data.gov (United States)

    National Aeronautics and Space Administration — MERIS (Medium Resolution Imaging Spectrometer) is a programmable, medium-spectral resolution, imaging spectrometer operating in the solar reflective spectral range....

  17. MERIS_L3b_POC

    Data.gov (United States)

    National Aeronautics and Space Administration — MERIS (Medium Resolution Imaging Spectrometer) is a programmable, medium-spectral resolution, imaging spectrometer operating in the solar reflective spectral range....

  18. VIIRSN_L3m_PIC

    Data.gov (United States)

    National Aeronautics and Space Administration — The Visible and Infrared Imager/Radiometer Suite (VIIRS) is a multi-disciplinary instrument that is being flown on the Joint Polar Satellite System (JPSS) series of...

  19. V0l3No2

    African Journals Online (AJOL)

    consideration especially in childbearing women during pregnancy considering their easily susceptibility to ..... a result of the women's level of education, which serves as a significant predictor of initiating antenatal care. ... structure in most African cultures is patrilinear and patriacal. The social and economic dependence of.

  20. L2 and L3 integrated learning

    DEFF Research Database (Denmark)

    Hazel, Spencer; Wagner, Johannes

    2015-01-01

    This study offers an empirical account of the use of English in Danish-as-aforeign- language classroom settings. We will refer to English as the lingua franca – which in itself is a second language for the majority of the participants in the data – and to Danish as the target language. We conside...

  1. PODAAC-QSOSU-L3WC0

    Data.gov (United States)

    National Aeronautics and Space Administration — This high-resolution, gridded QuikSCAT scatterometer dataset with enhanced coastal coverage of the United States West Coast contains ocean surface wind and stress...

  2. MODIST_L3b_FLH

    Data.gov (United States)

    National Aeronautics and Space Administration — MODIS (or Moderate Resolution Imaging Spectroradiometer) is a key instrument aboard the Terra (EOS AM) and Aqua (EOS PM) satellites. Terra's orbit around the Earth...

  3. MODIST_L3m_ZLEE

    Data.gov (United States)

    National Aeronautics and Space Administration — MODIS (or Moderate Resolution Imaging Spectroradiometer) is a key instrument aboard the Terra (EOS AM) and Aqua (EOS PM) satellites. Terra's orbit around the Earth...

  4. MODISA_L3m_RRS

    Data.gov (United States)

    National Aeronautics and Space Administration — MODIS (or Moderate Resolution Imaging Spectroradiometer) is a key instrument aboard the Terra (EOS AM) and Aqua (EOS PM) satellites. Terra's orbit around the Earth...

  5. L2 and L3 integrated learning

    DEFF Research Database (Denmark)

    Hazel, Spencer; Wagner, Johannes

    2015-01-01

    implications of lingua franca interaction in target language classroom interactions, and show how in sequences where participants orient to linguistic issues in the target language, for example grammatical forms or lexical items, they often do this with reference to the lingua franca.......This study offers an empirical account of the use of English in Danish-as-a-foreign-language classroom settings. We will refer to English as the lingua franca - which in itself is a second language for the majority of the participants in the data - and to Danish as the target language. We consider...

  6. MODIST_L3b_GSM

    Data.gov (United States)

    National Aeronautics and Space Administration — MODIS (or Moderate Resolution Imaging Spectroradiometer) is a key instrument aboard the Terra (EOS AM) and Aqua (EOS PM) satellites. Terra's orbit around the Earth...

  7. VIIRSN_L3m_GSM

    Data.gov (United States)

    National Aeronautics and Space Administration — The Visible and Infrared Imager/Radiometer Suite (VIIRS) is a multi-disciplinary instrument that is being flown on the Joint Polar Satellite System (JPSS) series of...

  8. VIIRSN_L3b_GSM

    Data.gov (United States)

    National Aeronautics and Space Administration — The Visible and Infrared Imager/Radiometer Suite (VIIRS) is a multi-disciplinary instrument that is being flown on the Joint Polar Satellite System (JPSS) series of...

  9. MODIST_L3m_GSM

    Data.gov (United States)

    National Aeronautics and Space Administration — MODIS (or Moderate Resolution Imaging Spectroradiometer) is a key instrument aboard the Terra (EOS AM) and Aqua (EOS PM) satellites. Terra's orbit around the Earth...

  10. MODISA_L3b_GSM

    Data.gov (United States)

    National Aeronautics and Space Administration — MODIS (or Moderate Resolution Imaging Spectroradiometer) is a key instrument aboard the Terra (EOS AM) and Aqua (EOS PM) satellites. Terra's orbit around the Earth...

  11. MODISA_L3m_GSM

    Data.gov (United States)

    National Aeronautics and Space Administration — MODIS (or Moderate Resolution Imaging Spectroradiometer) is a key instrument aboard the Terra (EOS AM) and Aqua (EOS PM) satellites. Terra's orbit around the Earth...

  12. MERIS_L3b_KD

    Data.gov (United States)

    National Aeronautics and Space Administration — MERIS (Medium Resolution Imaging Spectrometer) is a programmable, medium-spectral resolution, imaging spectrometer operating in the solar reflective spectral range....

  13. MERIS_L3m_PIC

    Data.gov (United States)

    National Aeronautics and Space Administration — MERIS (Medium Resolution Imaging Spectrometer) is a programmable, medium-spectral resolution, imaging spectrometer operating in the solar reflective spectral range....

  14. Cognitive Approaches to L3 Acquisition

    Science.gov (United States)

    Garcia-Mayo, Maria del Pilar

    2012-01-01

    Multilingualism has established itself as an area of systematic research in linguistic studies over the last two decades. The multilingual phenomenon can be approached from different perspectives: educational, formal linguistic, neurolinguistic, psycholinguistic and sociolinguistic, among others. This article presents an overview of cognitive…

  15. OCTS_L3m_PIC

    Data.gov (United States)

    National Aeronautics and Space Administration — On August 17, 1996, the Japanese Space Agency (NASDA - National Space Development Agency) launched the Advanced Earth Observing Satellite (ADEOS). ADEOS was in a...

  16. L3 experiment's detector : BGO assembly hall

    CERN Multimedia

    CERN

    1987-01-01

    The detector is a multi-layered cylindrical set of different devices, each of them measuring physical quantities relevant to the reconstruction of the collision under study. The three main outer layers are the electro-magnetic calorimeter (also called BGO because it's made of Bismuth Germanium Oxide), the hadronic calorimeter (HCAL) and the muon detector.

  17. PODAAC-SEAAM-L3X00

    Data.gov (United States)

    National Aeronautics and Space Administration — The SeaWinds on ADEOS-II Level 3 ocean vector winds on a 0.25 degree grid with AMSR-E contain daily data from ascending and descending passes from the SeaWinds...

  18. Precursor B-Cell Acute Lymphoblastic Leukemia/Lymphoma with L3 Morphology, Philadelphia Chromosome, MYC Gene Translocation, and Coexpression of TdT and Surface Light Chains: A Case Report

    Directory of Open Access Journals (Sweden)

    Alicia C. Hirzel

    2013-01-01

    Full Text Available Acute lymphoblastic leukemia is predominantly found in children. It is a neoplasm of precursor cells or lymphoblasts committed to either a B- or T-cell lineage. The immature cells in B-acute lymphoblastic leukemia/lymphoma can be small or medium sized with scant or moderate cytoplasm and typically express B-cell markers such as CD19, cytoplasmic CD79a, and TdT without surface light chains. These markers, along with cytogenetic studies, are vital to the diagnosis, classification, and treatment of these neoplasms. We present an unusual case of a precursor B-cell ALL, in an 82-year-old woman, who presented with pancytopenia and widespread lymphadenopathy. The cells show L3 morphology (Burkitt-like lymphoma with coexpression of TdT and surface light chains in addition to an MYC gene translocation and Philadelphia chromosome.

  19. Efeito da mielografia no tempo de estudo por ressonância magnética de baixo campo em 69 cães na região T3-L3

    OpenAIRE

    Rocha, Leandro Xavier Resende

    2015-01-01

    Dissertação de Mestrado Integrado em Medicina Veterinária, Ciências Veterinárias A nível neurológico, a incidência de lesões medulares é muito comum na prática veterinária, sendo a hérnia discal o diagnóstico de maior ocorrência. Na coluna vertebral, a incidência das lesões ao nível toracolombar (T3-L3) é maior que nas regiões cervical, lombar e lombossagrada, sendo reportadas percentagens de incidência que rondam os 66 a 83% das lesões medulares. Os casos incluídos, após anamnese compl...

  20. HUMAN PARASITE SURVEY ON NASI AND BERAS ISLANDS ACEH PROVINCE, SUMATRA

    Directory of Open Access Journals (Sweden)

    E. E. Stafford

    2012-09-01

    Full Text Available Survey parasit usus dan darah manusia terhadap penduduk pulau-pulau Nasi/Beras Propinsi Aceh, Sumatra, telah diadakan dihulan Januari, 1975. Sebanyak 83 pulasan darah dari 67 pria dan 16 wanita, serta 87 contoh tinja diperoleh dari 52 pria dan 35 wanita. Brugia malayi microfilaria ditemukan dalam 3 atau 3 persen dari darah yang diperiksa dan juga parasitemia yang disebabkan oleh Plasmodium malariae 1 atau 1 persen dan P. falciparum 2 atau 2 persen. Trichuris trichiura (86 persen , merupakan parasit usus yang paling banyak ditemukan, diikuti oleh cacing tambang (77 persen, Ascaris lumbricoides (60 persen, Entamoeba histolyrica (11 per sen, H. coli (10 persen . Endolimax nana hanya 5 atau 6 persen dan Iodamoeba butschlii dan Giardia lamblia, masing-masing 3 persen. Tidak ada ditemukan Schistosoma japonicum atau pun ova cestoda diantara penduduk yang diperiksa.

  1. WormAssay: a novel computer application for whole-plate motion-based screening of macroscopic parasites.

    Directory of Open Access Journals (Sweden)

    Chris Marcellino

    2012-01-01

    Full Text Available Lymphatic filariasis is caused by filarial nematode parasites, including Brugia malayi. Adult worms live in the lymphatic system and cause a strong immune reaction that leads to the obstruction of lymph vessels and swelling of the extremities. Chronic disease leads to the painful and disfiguring condition known as elephantiasis. Current drug therapy is effective against the microfilariae (larval stage of the parasite, but no drugs are effective against the adult worms. One of the major stumbling blocks toward developing effective macrofilaricides to kill the adult worms is the lack of a high throughput screening method for candidate drugs. Current methods utilize systems that measure one well at a time and are time consuming and often expensive. We have developed a low-cost and simple visual imaging system to automate and quantify screening entire plates based on parasite movement. This system can be applied to the study of many macroparasites as well as other macroscopic organisms.

  2. Presence of Wolbachia endosymbionts in microfilariae of Wuchereria bancrofti (Spirurida: Onchocercidae from different geographical regions in India

    Directory of Open Access Journals (Sweden)

    Hoti SL

    2003-01-01

    Full Text Available In view of the recent discovery of rickettsial endosymbionts, Wolbachia in lymphatic filarial parasites, Wuchereria bancrofti and Brugia malayi and subsequently of their vital role in the survival and development of the latter, antibiotics such as tetracycline are being suggested for the treatment of lymphatic filariasis, by way of eliminating the endosymbiont. But, it is essential to assess their presence in parasites from areas endemic for lymphatic filariasis before such a new control tool is employed. In the present communication, we report the detection of Wolbachia endosymbionts in microfilariae of W. bancrofti parasites collected from geographically distant locations of India, such as Pondicherry (Union Territory, Calicut (Kerala, Jagadalpur (Madhya Pradesh, Thirukoilur (TamilNadu, Chinnanergunam (TamilNadu, Rajahmundry (Andhra Pradesh, and Varanasi (Uttar Pradesh, using Wolbachia specific 16S rDNA polymerase chain reaction.

  3. AcEST: BP912078 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_G09 402 Adiantum capillus-veneris mRNA. clone: YMU001_000012_G09. BP9...12078 CL2513Contig1 Show BP912078 Clone id YMU001_000012_G09 Library YMU01 Length 402 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_G09. Accession BP912078 Tissue type prothallium Developmental stag...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9...ein DDB_G0280... 30 3.7 sp|P90689|ACT_BRUMA Actin OS=Brugia malayi PE=1 SV=1 30 4.9 sp|Q7MG94|MALT_VIBVY HTH

  4. Parasitic diseases of the pleura.

    Science.gov (United States)

    Lal, Chitra; Huggins, John Terrill; Sahn, Steven A

    2013-05-01

    Parasitic infections are prevalent in certain parts of the world and may cause pleural involvement, which often goes unrecognized. Common parasites involving the pleura include Entamoeba histolytica, Echinococcus granulosus and Paragonimus westermani. Amebiasis can cause empyema with "anchovy sauce" pus, reactive pleural effusions and bronchopleural fistula with hydropneumothorax. Echinococcosis may result in pleural thickening, pneumothorax, secondary pleural hydatidosis and pleural effusions. Paragonimiasis may cause chylous and cholesterol pleural effusions, pleural thickening and pneumothorax. Less commonly, pulmonary eosinophilia, or Loeffler's syndrome, caused by Ascaris lumbricoides, Ancylostoma duodenale and Necator americanus and tropical pulmonary eosinophilia caused by Wuchereria bancrofti and Brugia malayi may involve the pleura. This article provides a comprehensive review of parasitic infections involving the pleura. A high index of suspicion in the appropriate clinical setting is required to facilitate prompt diagnosis and treatment of these diseases.

  5. WormAssay: a novel computer application for whole-plate motion-based screening of macroscopic parasites.

    Science.gov (United States)

    Marcellino, Chris; Gut, Jiri; Lim, K C; Singh, Rahul; McKerrow, James; Sakanari, Judy

    2012-01-01

    Lymphatic filariasis is caused by filarial nematode parasites, including Brugia malayi. Adult worms live in the lymphatic system and cause a strong immune reaction that leads to the obstruction of lymph vessels and swelling of the extremities. Chronic disease leads to the painful and disfiguring condition known as elephantiasis. Current drug therapy is effective against the microfilariae (larval stage) of the parasite, but no drugs are effective against the adult worms. One of the major stumbling blocks toward developing effective macrofilaricides to kill the adult worms is the lack of a high throughput screening method for candidate drugs. Current methods utilize systems that measure one well at a time and are time consuming and often expensive. We have developed a low-cost and simple visual imaging system to automate and quantify screening entire plates based on parasite movement. This system can be applied to the study of many macroparasites as well as other macroscopic organisms.

  6. STUDI ENDEMISITAS FILARIASIS DI WILAYAH KECAMATAN PEMAYUNG, KABUPATEN BATANGHARI PASCA PENGOBATAN MASSAL TAHAP III

    Directory of Open Access Journals (Sweden)

    Yahya Yahya

    2013-05-01

    Full Text Available Abstract Filariasis endemicity research in District Pemayung, Batanghari Regency Post-Mass Drug Administration Phase III has been implemented. The study aims to determine the prevalence of filariasis, microfilaria worm species, the periodicity, reservoir determination and evaluate the results of mass treatment activities that have been 3 times. The number of people who checked their blood preparation for the examination as many as 538. Blood sampling for the periodicity of the parasite examinations performed on 4 persons, each carried out blood sampling every 2 hours for 24 hours. People microfilariae with microfilariae positive number as many as 8 people to rate microfilariae (Mf rate 1.5%.. The highest parasite density of 17.493 per 20 cu mm of blood occurred at 1:00 am and decresing to 0,415 per 20 cu mm of blood at 07.00 am. The parasite was found in sub periodic nokturna 3 subjects and 1 subject was found only be found in the morning and afternoon. The results of examination of 12 cats and two monkeys were found two positive cats with Brugia malayi microfilariae. Cats that were examined and the positive was one house cat and one stray cat. The conclusion from this study showed that filariasis was still endemic with periodicity of microfilariae was sub periodic nokturna and was zoonotic. Recommendations of this study was that mass treatment  was done by giving the drug directly and took medicine in front of the officers, examination and treatment of microfilariae positive cats. Key words: microfilariae rate, periodicity, Brugia malayi, reservoir. Abstrak  Submit : 28-03-2012  Review : 04-04-2012 Review : 11-06-2012 revisi : 29–08-2012Penelitian untuk menentukan tingkat endemisitas filariasis di wilayah Kecamatan Pemayung, Kabupaten Batanghari Pasca Pengobatan Massal Tahap III telah dilaksanakan. Penelitian bertujuan untuk mengetahui prevalensi filariasis, mengetahui spesies cacing mikrofilaria, periodisitas mikrofilaria dan pemeriksaan

  7. AcEST: BP913130 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000026_G09 514 Adiantum capillus-veneris mRNA. clone: YMU001_000026_G09. BP91313...0 CL4114Contig1 Show BP913130 Clone id YMU001_000026_G09 Library YMU01 Length 514 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000026_G09. Accession BP913130 Tissue type prothallium Developmental stag...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91313...t_id A8QDS6 Definition tr|A8QDS6|A8QDS6_BRUMA Peptidase C13 family protein OS=Brugia malayi Align length 84

  8. Filariose linfática: doença potencialmente eliminável Lymphatic filariasis: a potentially eradicable disease

    Directory of Open Access Journals (Sweden)

    Gerusa Dreyer

    1997-09-01

    Full Text Available Os resultados obtidos com o uso de esquemas terapêuticos simples, como dose única anual ou bianual de Ivermectina (IV, Dietilcarbamazina (DEC sozinhas ou combinadas, têm sido surpreendentemente promissores na redução da infecção linfática causada pela Wuchereria bancrofti e Brugia malayi. Assim, perspectivas existem de eliminar a doença dos países endêmicos, se programas de controle forem empregados usando-se o tratamento em massa, complementado ou não pelo controle do vetor. Uma breve revisão é feita sobre cada droga em relação à eficácia e às reações adversas causadas pela morte dos diversos estágios do parasita no homem infectado.The recent demonstration that single-dose ivermectin, diethylcarbamazine, or a combination of these drugs can profoundly suppress Wuchereria bancrofti and Brugia malayi microfilaremia for periods of six months to two years has led to renewed hope that transmission can be interrupted and lymphatic filariasis eradicated. Based in part on the availability of these new chemotherapeutic tools, the International Task Force for Disease Eradication recently identified lymphatic filariasis as one of the few diseases that could potentially be eradicated. Thus, control programs based on mass treatment (whether supplemented or not by vector control have begun to be implemented in some endemic areas. We provide a brief review of available anti-filarial drugs for use in humans, including their tolerance and efficacy.

  9. Inhibition of Anchorage-Independent Proliferation and G0/G1 Cell-Cycle Regulation in Human Colorectal Carcinoma Cells by 4,7-Dimethoxy-5-Methyl-l,3-Benzodioxole Isolated from the Fruiting Body of Antrodia camphorate

    Directory of Open Access Journals (Sweden)

    Hsiu-Man Lien

    2011-01-01

    Full Text Available In this study, 4,7-dimethoxy-5-methyl-l,3-benzodioxole (SY-1 was isolated from three different sources of dried fruiting bodies of Antrodia camphorate (AC. AC is a medicinal mushroom that grows on the inner heartwood wall of Cinnamomum kanehirai Hay (Lauraceae, an endemic species that is used in Chinese medicine for its anti-tumor and immunomodulatory properties. In this study, we demonstrated that SY-1 profoundly decreased the proliferation of human colon cancer cells (COLO 205 through G0/G1 cell-cycle arrest (50–150 μM and induction of apoptosis (>150 μM. Cell-cycle arrest induced by SY-1 was associated with a significant increase in levels of p53, p21/Cip1 and p27/Kip1, and a decrease in cyclins D1, D3 and A. In contrast, SY-1 treatment did not induce significant changes in G0/G1 phase cell-cycle regulatory proteins in normal human colonic epithelial cells (FHC. The cells were cultured in soft agar to evaluate anchorage-independent colony formation, and we found that the number of transformed colonies was significantly reduced in the SY-1-treated COLO 205 cells. These findings demonstrate for the first time that SY-1 inhibits human colon cancer cell proliferation through inhibition of cell growth and anchorage-independent colony formation in soft agar. However, the detailed mechanisms of these processes remain unclear and will require further investigation.

  10. Inhibition of Anchorage-Independent Proliferation and G0/G1 Cell-Cycle Regulation in Human Colorectal Carcinoma Cells by 4,7-Dimethoxy-5-Methyl-l,3-Benzodioxole Isolated from the Fruiting Body of Antrodia camphorate.

    Science.gov (United States)

    Lien, Hsiu-Man; Lin, Hsiao-Wei; Wang, Ying-Jan; Chen, Li-Ching; Yang, Ding-Yah; Lai, Ya-Yun; Ho, Yuan-Soon

    2011-01-01

    In this study, 4,7-dimethoxy-5-methyl-l,3-benzodioxole (SY-1) was isolated from three different sources of dried fruiting bodies of Antrodia camphorate (AC). AC is a medicinal mushroom that grows on the inner heartwood wall of Cinnamomum kanehirai Hay (Lauraceae), an endemic species that is used in Chinese medicine for its anti-tumor and immunomodulatory properties. In this study, we demonstrated that SY-1 profoundly decreased the proliferation of human colon cancer cells (COLO 205) through G0/G1 cell-cycle arrest (50-150 μM) and induction of apoptosis (>150 μM). Cell-cycle arrest induced by SY-1 was associated with a significant increase in levels of p53, p21/Cip1 and p27/Kip1, and a decrease in cyclins D1, D3 and A. In contrast, SY-1 treatment did not induce significant changes in G0/G1 phase cell-cycle regulatory proteins in normal human colonic epithelial cells (FHC). The cells were cultured in soft agar to evaluate anchorage-independent colony formation, and we found that the number of transformed colonies was significantly reduced in the SY-1-treated COLO 205 cells. These findings demonstrate for the first time that SY-1 inhibits human colon cancer cell proliferation through inhibition of cell growth and anchorage-independent colony formation in soft agar. However, the detailed mechanisms of these processes remain unclear and will require further investigation.

  11. Artificial neural network models for early diagnosis of hepatocellular carcinoma using serum levels of α-fetoprotein, α-fetoprotein-L3, des-γ-carboxy prothrombin, and Golgi protein 73.

    Science.gov (United States)

    Li, Bo; Li, Boan; Guo, Tongsheng; Sun, Zhiqiang; Li, Xiaohan; Li, Xiaoxi; Chen, Lin; Zhao, Jing; Mao, Yuanli

    2017-10-06

    More than 70% of hepatocellular carcinoma (HCC) cases develop as a consequence of liver cirrhosis (LC). Here we have evaluated the diagnostic potential of four serum biomarkers, and developed models for HCC diagnosis and differentiation from LC patients. Serum levels of α-fetoprotein (AFP), AFP-L3, des-γ-carboxy prothrombin (DCP), and Golgi protein 73 (GP73) were analyzed in 114 advanced HCC patients, 81 early stage HCC patients, and 152 LC patients. Multilayer perceptron (MLP) and radial basis function (RBF) neural networks were used to construct the diagnostic models. Using all stages, HCC diagnostic models had a higher sensitivity (>70%) than the individual serum biomarkers, whereas only early stage HCC diagnostic models had a higher specificity (>80%). The early stage HCC diagnostic models could not be used as HCC screening tools due to their low sensitivity (about 40%). These results suggest that a combination of the two models might be used as a screening tool to distinguish early stage HCC patients from LC patients, thus improving prevention and treatment of HCC.

  12. A Novel Xenomonitoring Technique Using Mosquito Excreta/Feces for the Detection of Filarial Parasites and Malaria.

    Directory of Open Access Journals (Sweden)

    Nils Pilotte

    2016-04-01

    Full Text Available Given the continued successes of the world's lymphatic filariasis (LF elimination programs and the growing successes of many malaria elimination efforts, the necessity of low cost tools and methodologies applicable to long-term disease surveillance is greater than ever before. As many countries reach the end of their LF mass drug administration programs and a growing number of countries realize unprecedented successes in their malaria intervention efforts, the need for practical molecular xenomonitoring (MX, capable of providing surveillance for disease recrudescence in settings of decreased parasite prevalence is increasingly clear. Current protocols, however, require testing of mosquitoes in pools of 25 or fewer, making high-throughput examination a challenge. The new method we present here screens the excreta/feces from hundreds of mosquitoes per pool and provides proof-of-concept for a practical alternative to traditional methodologies resulting in significant cost and labor savings.Excreta/feces of laboratory reared Aedes aegypti or Anopheles stephensi mosquitoes provided with a Brugia malayi microfilaria-positive or Plasmodium vivax-positive blood meal respectively were tested for the presence of parasite DNA using real-time PCR. A titration of samples containing various volumes of B. malayi-negative mosquito feces mixed with positive excreta/feces was also tested to determine sensitivity of detection. Real-time PCR amplification of B. malayi and P. vivax DNA from the excreta/feces of infected mosquitoes was demonstrated, and B. malayi DNA in excreta/feces from one to two mf-positive blood meal-receiving mosquitoes was detected when pooled with volumes of feces from as many as 500 uninfected mosquitoes.While the operationalizing of excreta/feces testing may require the development of new strategies for sample collection, the high-throughput nature of this new methodology has the potential to greatly reduce MX costs. This will prove

  13. Differential Evolutionary Selection and Natural Evolvability Observed in ALT Proteins of Human Filarial Parasites.

    Directory of Open Access Journals (Sweden)

    Neil C Devoe

    Full Text Available The abundant larval transcript (ALT-2 protein is present in all members of the Filarioidea, and has been reported as a potential candidate antigen for a subunit vaccine against lymphatic filariasis. To assess the potential for vaccine escape or heterologous protection, we examined the evolutionary selection acting on ALT-2. The ratios of nonsynonymous (K(a to synonymous (K(s mutation frequencies (ω were calculated for the alt-2 genes of the lymphatic filariasis agents Brugia malayi and Wuchereria bancrofti and the agents of river blindness and African eyeworm disease Onchocerca volvulus and Loa loa. Two distinct Bayesian models of sequence evolution showed that ALT-2 of W. bancrofti and L. loa were under significant (P<0.05; P < 0.001 diversifying selection, while ALT-2 of B. malayi and O. volvulus were under neutral to stabilizing selection. Diversifying selection as measured by ω values was notably strongest on the region of ALT-2 encoding the signal peptide of L. loa and was elevated in the variable acidic domain of L. loa and W. bancrofti. Phylogenetic analysis indicated that the ALT-2 consensus sequences formed three clades: the first consisting of B. malayi, the second consisting of W. bancrofti, and the third containing both O. volvulus and L. loa. ALT-2 selection was therefore not predictable by phylogeny or pathology, as the two species parasitizing the eye were selected differently, as were the two species parasitizing the lymphatic system. The most immunogenic regions of L. loa and W. bancrofti ALT-2 sequence as modeled by antigenicity prediction analysis did not correspond with elevated levels of diversifying selection, and were not selected differently than predicted antigenic epitopes in B. malayi and O. volvulus. Measurements of ALT-2 evolvability made by χ2 analysis between alleles that were stable (O. volvulus and B. malayi and those that were under diversifying selection (W. bancrofti and L. loa indicated significant (P<0

  14. The nematode parasite Onchocerca volvulus generates the transforming growth factor-beta (TGF-beta).

    Science.gov (United States)

    Korten, Simone; Büttner, Dietrich W; Schmetz, Christel; Hoerauf, Achim; Mand, Sabine; Brattig, Norbert

    2009-09-01

    Transforming growth factor-beta (TGF-beta) is a highly conserved cytokine that has a well-known regulatory role in immunity, but also in organ development of most animal species including helminths. Homologous tgf-b genes and mRNA have been detected in the filaria Brugia malayi. The in situ protein expression is unknown for filariae. Therefore, we examined several filariae for the expression and localization of latent (stable) TGF-beta in adult and larval stages. A specific goat anti-human latency associated protein (LAP, TGF-beta 1) antibody, purified by affinity chromatography, was used for light and electron microscopic immunohistochemistry. Adult Onchocerca volvulus, Onchocerca gibsoni, Onchocerca ochengi, Onchocerca armillata, Onchocerca fasciata, Onchocerca flexuosa, Wuchereria bancrofti, Dirofilaria sp., B. malayi, and infective larvae of W. bancrofti reacted with the antibody. Labeling of worm tissues varied between negative and all degrees of positive reactions. Latent TGF-beta was strongly expressed adjacent to the cell membranes of the hypodermis, epithelia, and muscles and adjacent to many nuclei in all organs. TGF-beta was well expressed in worms without Wolbachia endobacteria eliminated by doxycycline treatment. Pleomorphic neoplasms in O. volvulus were also labeled. We conclude that latent TGF-beta protein is expressed by filariae independently of Wolbachia, possibly regulating worm tissue homeostasis.

  15. Operon conservation and the evolution of trans-splicing in the phylum Nematoda.

    Science.gov (United States)

    Guiliano, David B; Blaxter, Mark L

    2006-11-24

    The nematode Caenorhabditis elegans is unique among model animals in that many of its genes are cotranscribed as polycistronic pre-mRNAs from operons. The mechanism by which these operonic transcripts are resolved into mature mRNAs includes trans-splicing to a family of SL2-like spliced leader exons. SL2-like spliced leaders are distinct from SL1, the major spliced leader in C. elegans and other nematode species. We surveyed five additional nematode species, representing three of the five major clades of the phylum Nematoda, for the presence of operons and the use of trans-spliced leaders in resolution of polycistronic pre-mRNAs. Conserved operons were found in Pristionchus pacificus, Nippostrongylus brasiliensis, Strongyloides ratti, Brugia malayi, and Ascaris suum. In nematodes closely related to the rhabditine C. elegans, a related family of SL2-like spliced leaders is used for operonic transcript resolution. However, in the tylenchine S. ratti operonic transcripts are resolved using a family of spliced leaders related to SL1. Non-operonic genes in S. ratti may also receive these SL1 variants. In the spirurine nematodes B. malayi and A. suum operonic transcripts are resolved using SL1. Mapping these phenotypes onto the robust molecular phylogeny for the Nematoda suggests that operons evolved before SL2-like spliced leaders, which are an evolutionary invention of the rhabditine lineage.

  16. Operon conservation and the evolution of trans-splicing in the phylum Nematoda.

    Directory of Open Access Journals (Sweden)

    David B Guiliano

    2006-11-01

    Full Text Available The nematode Caenorhabditis elegans is unique among model animals in that many of its genes are cotranscribed as polycistronic pre-mRNAs from operons. The mechanism by which these operonic transcripts are resolved into mature mRNAs includes trans-splicing to a family of SL2-like spliced leader exons. SL2-like spliced leaders are distinct from SL1, the major spliced leader in C. elegans and other nematode species. We surveyed five additional nematode species, representing three of the five major clades of the phylum Nematoda, for the presence of operons and the use of trans-spliced leaders in resolution of polycistronic pre-mRNAs. Conserved operons were found in Pristionchus pacificus, Nippostrongylus brasiliensis, Strongyloides ratti, Brugia malayi, and Ascaris suum. In nematodes closely related to the rhabditine C. elegans, a related family of SL2-like spliced leaders is used for operonic transcript resolution. However, in the tylenchine S. ratti operonic transcripts are resolved using a family of spliced leaders related to SL1. Non-operonic genes in S. ratti may also receive these SL1 variants. In the spirurine nematodes B. malayi and A. suum operonic transcripts are resolved using SL1. Mapping these phenotypes onto the robust molecular phylogeny for the Nematoda suggests that operons evolved before SL2-like spliced leaders, which are an evolutionary invention of the rhabditine lineage.

  17. Review of Zoonotic Parasites in Medical and Veterinary Fields in the Republic of Korea

    Science.gov (United States)

    2009-01-01

    Zoonotic parasites are animal parasites that can infect humans. The major zoonotic protozoa in the Republic of Korea are Babesia bovis, Chilomastix mesnili, Cryptosporidium parvum, Endolimax nana, Entamoeba coli, Entamoeba hitolytica, Giardia lamblia, Iodamoeba bütschlii, Pneumocystis carinii, Sarcocystis cruzi, and Toxoplasma gondii. The major zoonotic helminths in Korea include trematodes, cestodes, and nematodes. Trematodes are Clonorchis sinensis, Echinostoma hortense, Echinostoma spp., Fasciola hepatica, Heterophyes nocens, Metagonimus yokogawai, and Paragonimus westermani. Cestodes are Diphyllobothrium latum, Dipylidium caninum, Echinococcus granulosus, Hymenolepis nana, Raillietina tetragona, sparganum (Spirometra spp.), Taenia saginata, T. solium, and T. asiatica. Nematodes are Ancylostoma caninum, Brugia malayi, Capillaria hepatica, Dirofilaria immitis, Gnathostoma dololesi, Gnathostoma spinigerum, Loa loa, Onchocerca gibsoni, Strongyloides stercoralis, Thelazia callipaeda, Trichinella spiralis, Trichostrongylus orientalis, Trichuris trichiura, and Trichuris vulpis. The one arthropod is Sarcoptes scabiei. Many of these parasites have disappeared or were in decline after the 1990's. Since the late 1990's, the important zoonotic protozoa have been C. parvum, E. nana, E. coli, E. hitolytica, G. lamblia, I. buetschlii, P. carinii and T. gondii. The important zoonotic helminths have been C. sinensis, H. nocens, M. yokogawai, P. westermani, D. latum, T. asiatica, sparganum, B. malayi, T. orientalis, T. callipaeda and T. spiralis. However, outbreaks of these parasites are only in a few endemic areas. The outbreaks of Enterobius vermicularis and head lice, human parasites, have recently increased in the kindergartens and primary schools in the Republic of Korea. PMID:19885329

  18. L-3-n-Butylphthalide Activates Akt/mTOR Signaling, Inhibits Neuronal Apoptosis and Autophagy and Improves Cognitive Impairment in Mice with Repeated Cerebral Ischemia-Reperfusion Injury.

    Science.gov (United States)

    Xu, Jing; Huai, Yaping; Meng, Nan; Dong, Yanhong; Liu, Zhijuan; Qi, Qianqian; Hu, Ming; Fan, Mingyue; Jin, Wei; Lv, Peiyuan

    2017-10-01

    L-3-n-Butylphthalide (L-NBP) exerts neuroprotective effects in animal models of cerebral ischemia, but its potential benefits in repeated cerebral ischemia-reperfusion (RCIR) injury remain unknown. We investigated the effect of L-NBP on cognitive impairment induced by RCIR in mice. Male C57Bl/6 mice received sham surgery or bilateral common carotid artery occlusion (3 times, 20 min each) and were orally administered preoperative L-NBP (30 mg/kg/day, 7 days), postoperative L-NBP (30 or 60 mg/kg/day, 28 days) or postoperative vehicle (28 days). Learning and memory were assessed by the Morris water maze task and step-down passive avoidance test. Nissl staining was used to identify pathologic changes in the hippocampal CA1 region. The expressions of proteins associated with signaling, apoptosis and autophagy were assessed by quantitative PCR and western blot. RCIR induced deficits in learning and memory that were alleviated by preoperative or postoperative L-NBP administration. Pathologic lesions in the hippocampal CA1 region induced by RCIR were less severe in mice treated with L-NBP. Preoperative or postoperative L-NBP administration in mice receiving RCIR promoted hippocampal expression of phospho-Akt and phospho-mTOR (suggesting activation of Akt/mTOR signaling), increased the Bcl-2/Bax ratio (indicating suppression of apoptosis) and reduced the LC3-II/LC3-I ratio (implying inhibition of autophagy). Preoperative or postoperative L-NBP administration also depressed hippocampal levels of beclin-1 mRNA (indicating suppression of autophagy). These findings suggest that the effect of L-NBP to alleviate learning and memory deficits in mice following RCIR may involve activation of Akt/mTOR signaling and regulation of the expressions of proteins related to apoptosis and autophagy.

  19. Cakupan Pemberian Obat Pencegahan Massal Filariasis di Kabupaten Sumba Barat Daya Tahun 2012-2013

    Directory of Open Access Journals (Sweden)

    Zahrotul Habibah

    2016-03-01

    Full Text Available Filariasis merupakan masalah kesehatan masyarakat terutama di Indonesia Timur antara lain di Kabupaten Sumba Barat Daya (SBD. Untuk mengeliminasi filariasis, WHO membuat program PemberianObat Pencegahan Masal (POPM dengan dietilkarbamazin sitrat dan albendazol setiap tahun selama 5tahun berturut-turut. Untuk mengetahui keberhasilan POPM, perlu dilakukan evaluasi cakupan POPM setiaptahun. Tujuan penelitian ini adalah mengetahui cakupan POPM di SBD pada tahun 2012-2013. Penelitanini menggunakan data POPM Dinas Kesehatan SBD pada tahun 2012 dan 2013. Cakupan POPM filariasisdihitung berdasarkan jumlah penduduk minum obat dibagi penduduk total dan jumlah penduduk sasaran.Target cakupan pengobatan penduduk sasaran adalah >85% dan dari penduduk total adalah  > 65%. Hasilpenelitian menunjukkan cakupan POPM filariasis berdasarkan penduduk total pada tahun 2012 adalah 1,96%dan tahun 2013 sebesar 1,13%. Cakupan POPM filariasis berdasarkan penduduk sasaran pada tahun 2012adalah 2,51% dan tahun 2013 adalah 1,35%. Disimpulkan bahwa cakupan POPM filariasis berdasarkanpenduduk sasaran dan penduduk total di SBD sangat rendah dan cakupan tahun 2013 lebih rendahdibandingkan tahun 2012. Kata kunci: W. bancrofti, B.malayi, B.timori, pemberian obat masal pencegahan, Sumba Barat Daya   Coverage of Mass Drugs Administration (MDA for Filariasis inSouth West Sumba on 2012-2013 AbstractFilariasis is a disease caused by Wuchereria bancrofti, Brugia malayi and Brugia timori. It is transmitted by mosquitos. It cause defect in patient’s physical condition, decrease social life, and increase health spending.WHO concepts a program to eliminate filariasis by Massal Drugs Administration (MDA of filariasis. It hasto be evaluated each year in five years by counting the coverage of MDA of filariasis in total population andtargeted population. This research used secondary data from Dinas Kesehatan in SBD to know the coverageof MDA of filariasis in SBD on 2012-2013. The coverage

  20. Lesión neurológica incompleta ASIA B secundario a fractura luxación de L3-L4 por traumatismo de alta energía en región lumbar

    Directory of Open Access Journals (Sweden)

    Gustavo Caldera Hernández

    2013-01-01

    Full Text Available En las fracturas luxaciones de la región lumbar, dos hechos anatómicos pueden ayudar al paciente a presentar un daño neurológico menor en comparación con los traumatismos en la región cervical o torácica, en primer lugar, la médula espinal en el adulto se extiende solo hasta el nivel del borde inferior de la primera vértebra lumbar, en segundo lugar, el gran tamaño del agujero vertebral en esta región da amplio espacio a las raíces de la cola de caballo, por lo tanto, la lesión nerviosa puede ser mínima en esta región, ya que en esta área se alojan raíces nerviosas con un gran espacio, menor contenido y mayor continente. En este estudio se presenta el caso de un hombre de 48 años de edad, trabajador de la construcción, el cual sufrió caída de una altura aproximada de 15 metros, golpeándose directamente sobre la región lumbar contra una viga, presentó dolor e incapacidad para movilizar las piernas; llevado con urgencia, una hora después del accidente, se analizó clínicamente. Se tomaron radiografías y tomografía, y se diagnosticó como fractura luxación L3-L4 con ASIA B. Intervenido tres horas después del accidente con reducción vía posterior y fijación transpedicular. Una semana después se realizó abordaje anterior. Progreso hacia ASIA C, 24 horas después de la primera cirugía. Tres meses después, paciente funcional con ASIA D y control de esfínteres. El propósito del autor es mostrar los resultados obtenidos mediante una intervención en las primeras horas del traumatismo, la cual ayudó a pasar de una lesión no funcional a una lesión funcional, casi con recuperación total.