Influência da hidrocinesioterapia no equilíbrio postural de idosas institucionalizadas

Directory of Open Access Journals (Sweden)

Estele Caroline Welter Meereis

2013-06-01

Full Text Available O objetivo deste estudo foi avaliar a influência de um programa de hidrocinesioterapia em piscina rasa no equilíbrio postural de idosas institucionalizadas. Participaram do estudo 8 idosas institucionalizadas com média de idade de 62,95 ± 2,87 anos. O equilíbrio postural foi avaliado por meio de uma plataforma de força. Foram realizadas 3 tentativas em cada condição do teste de organização sensorial (TOS previamente e posteriormente a intervenção de hidrocinesioterapia em piscina rasa. As variáveis analisadas foram: amplitude de deslocamento do centro de pressão (COP na direção ântero-posterior, médio-lateral e velocidade de deslocamento do COP. Foi aplicado o teste Wilcoxon para a comparação entre as avaliações pré e pós a intervenção. Foi observada uma melhora no controle postural após a intervenção, visto que ocorreu diminuição do deslocamento do centro de pressão, principalmente na direção ântero-posterior. Para o grupo de idosas institucionalizadas participantes deste estudo, a hidrocinesioterapia realizada em piscina rasa foi capaz de melhorar o equilíbrio postural.

Estudo comparativo do equilíbrio de crianças surdas e ouvintes Comparative study of balance on deaf and hearing children

Directory of Open Access Journals (Sweden)

Marcello Gonçalves de Azevedo

2009-01-01

Full Text Available OBJETIVO: comparar o equilíbrio estático, dinâmico e recuperado de crianças surdas e ouvintes. MÉTODOS: foram avaliadas 9 crianças surdas e 18 crianças ouvintes, de 9 a 12 anos, de ambos os sexos. Foram utilizados os seguintes testes: teste "do quatro" e de Romberg (equilíbrio estático, teste "passeio na trave" e de Unterberger (equilíbrio dinâmico, e giro de 180º (equilíbrio recuperado. RESULTADOS: em todos os testes, a maioria dos ouvintes apresentou equilíbrio estável, enquanto a maioria dos surdos apresentou equilíbrio instável recuperado. CONCLUSÃO: a análise dos resultados apontou para um desempenho melhor das crianças ouvintes, em relação às surdas, no que se refere ao equilíbrio estático, dinâmico e recuperado.PURPOSE: to compare the static, dynamic and recovered balance of deaf and hearing children. METHODS: nine deaf children and eighteen hearing children were evaluated (age nine to twelve, both sexes. To evaluate the static, dynamic and recovered balance, we used the "four" test, Romberg test, the "spend on the bridge" test, Unterberger test and 180º test, respectively. RESULTS: in all tests, most of hearing children showed steady balance and most of deaf children showed unstable recovered balance. CONCLUSION: the analysis of results led to a conclusion that hearing children have best performance than deaf children, regarding static, dynamic and recovered balance.

ASSOCIAÇÃO ENTRE O EQUILÍBRIO POSTURAL E INDICADORES ANTROPOMÉTRICOS EM ESCOLARES

Directory of Open Access Journals (Sweden)

Simone Lara

2017-11-01

Full Text Available RESUMO Objetivo: Analisar a associação entre o equilíbrio postural e indicadores antropométricos em escolares do primeiro ano do ensino fundamental. Métodos: Estudo transversal, descritivo e quantitativo que incluiu crianças regularmente matriculadas no primeiro ano do ensino fundamental, de ambos os sexos, na faixa etária de 6 a 7 anos. Foram excluídas as crianças com qualquer incapacidade física ou cognitiva, as que não participaram de todas as etapas de avaliação do estudo ou as que não conseguiram realizar a avaliação do equilíbrio postural. As crianças realizaram uma avaliação do equilíbrio por meio da posturografia dinâmica computadorizada (PDC, por meio dos testes de organização sensorial (TOSs em seis diferentes condições sensoriais. Para verificar os indicadores antropométricos, foram avaliadas as medidas de peso corporal e estatura, para posterior cálculo do índice de massa corporal (IMC, sendo este categorizado em quatro grupos: baixo peso, normal, sobrepeso e obesidade. Resultados: Foram incluídas 80 crianças (6,2±0,8 anos, sendo 47 meninas (58,8%. A análise dos indicadores antropométricos identificou 26,3% de escolares com sobrepeso e 15% com obesidade. As crianças apresentaram médias abaixo dos valores de referência considerados para sua faixa etária nas condições III e VI. Foi verificada associação negativa entre a condição V com o IMC e uma associação positiva entre os valores abaixo da normalidade na condição VI com o sobrepeso e a obesidade. Conclusões: Foram verificadas associações entre o excesso de peso corporal e valores abaixo da normalidade em algumas condições do equilíbrio, indicando que os indicadores antropométricos interferiram no equilíbrio postural das crianças.

Amino Acid Composition of Grape Cultivars ( Vitis Spp.) in Japan

OpenAIRE

Shiraishi, Shin-ichi; 白石, 眞一

1991-01-01

The concentration of free amino acids and other chemical constituents in 75 grape cultivars at maturity were examined. The amino acid concentrations were found to be in decreasing order of arginine, proline, threonine and alanine in Vitis vinifera cultivars and alanine, arginine, threonine and proline in Vitis labmsca cultivars. The concentration of total amino acid was 5,083 ,umol in ‘Campbell Early’ and 3,391 pmol in ‘Yates’, both Vitis labrusca and table grapes. The amounts of total amino ...

Comparing Wild American Grapes with Vitis vinifera: A Metabolomics Study of Grape Composition.

Science.gov (United States)

Narduzzi, Luca; Stanstrup, Jan; Mattivi, Fulvio

2015-08-05

We analyzed via untargeted UHPLC-ESI-Q-TOF-MS the metabolome of the berry tissues (skin, pulp, seeds) of some American Vitis species (Vitis cinerea, Vitis californica, Vitis arizonica), together with four interspecific hybrids, and seven Vitis vinifera cultivars, aiming to find differences in the metabolomes of the American Vitis sp. versus Vitis vinifera. Apart from the known differences, that is, more complex content of anthocyanins and stilbenoids in the American grapes, we observed higher procyanidin accumulation (tens to hundreds of times) in the vinifera skin and seeds in comparison to American berries, and we confirmed this result via phloroglucinolysis. In the American grapes considered, we did not detect the accumulation of pleasing aroma precursors (terpenoids, glycosides), whereas they are common in vinifera grapes. We also found accumulation of hydrolyzable tannins and their precursors in the skin of the wild American grapes, which has never been reported earlier in any of the species under investigation. Such information is needed to improve the design of new breeding programs, lowering the risk of retaining undesirable characteristics in the chemical phenotype of the offspring.

Characterization of a new pathovar of Agrobacterium vitis causing banana leaf blight in China.

Science.gov (United States)

Huang, Siliang; Long, Mengling; Fu, Gang; Lin, Shanhai; Qin, Liping; Hu, Chunjin; Cen, Zhenlu; Lu, Jie; Li, Qiqin

2015-01-01

A new banana leaf blight was found in Nanning city, China, during a 7-year survey (2003-2009) of the bacterial diseases on banana plants. Eight bacterial strains were isolated from affected banana leaves, and identified as an intraspecific taxon of Agrobacterium vitis based on their 16S rDNA sequence similarities with those of 37 randomly selected bacterial strains registered in GenBank database. The representative strain Ag-1 was virulent on banana leaves and shared similar growth and biochemical reactions with the reference strain IAM14140 of A. vitis. The strains causing banana leaf blight were denominated as A. vitis pv. musae. The traditional A. vitis strains virulent to grapevines were proposed to be revised as A. vitis pv. vitis. This is the first record of a new type of A. vitis causing banana leaf blight in China. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Lesão renal aguda por glicerol: efeito antioxidante da Vitis vinifera L Acute kidney injury by glycerol: antioxidant effect of Vitis vinifera L

Directory of Open Access Journals (Sweden)

Elisabete Cristina de Oliveira Martim

2007-09-01

Full Text Available JUSTIFICATIVA E OBJETIVOS: A lesão renal aguda (LRA é a complicação mais grave da rabdomiólise. Nessa síndrome, a liberação do pigmento heme desencadeia uma lesão que se caracteriza por vasoconstrição glomerular e toxicidade celular direta com provável componente oxidante. A renoproteção com antioxidantes tem demonstrado efeito satisfatório. As proantocianidinas são antioxidantes naturais encontradas no extrato da semente da uva. O objetivo deste estudo foi avaliar o efeito antioxidante da Vitis vinifera sobre a função renal de ratos submetidos à lesão induzida por rabdomiólise. MÉTODO: Foram utilizados ratos Wistar, machos e adultos pesando entre 250 e 300 g. A LRA foi induzida pela administração de glicerol 50% por via muscular. Os animais foram distribuídos em 4 grupos: grupo Salina (6 mL/kg de NaCl a 0,9%, por via intraperitoneal (dose única, Glicerol (6 mL/kg por via muscular metade da dose em cada região femoral, em dose única, grupo Vitis vinifera (3 mg/kg/dia, por via oral durante cinco dias e grupo Glicerol + Vitis vinifera que recebeu Vitis vinifera por cinco dias antes do glicerol. RESULTADOS: Foram avaliados a função renal (FR e o perfil oxidativo (peróxidos urinários FOX-2 e MDA-TBARS. O grupo glicerol de animais tratado com Vitis vinifera apresentou melhora da FR e redução dos níveis de peroxidação lipídica. CONCLUSÕES: Os resultados deste estudo confirmaram a ação antioxidante da Vitis vinifera na LRA induzida por glicerol.BACKGROUND AND OBJECTIVES: The Acute Kidney Injury (AKI is the most serious complication of rhabdomyolysis. In this syndrome, the delivery of heme pigment induces an injury that distinguishes itself by glomerular vasoconstriction and direct cellular toxicity with oxidative component. The renoprotection with antioxidants has demonstrated satisfactory effect. The proanthocyanidins are natural antioxidants found in the grape seed extract. The aim of this study was to

Efeitos da hidroterapia na recuperação do equilíbrio e prevenção de quedas em idosas

OpenAIRE

Resende,SM; Rassi,CM

2008-01-01

CONTEXTO: A hidroterapia é utilizada para tratar doenças reumáticas, ortopédicas e neurológicas. Na atualidade, é alvo de investigações na recuperação do equilíbrio em idosos. OBJETIVO: Avaliar o efeito de um programa de hidroterapia no equilíbrio e no risco de quedas em idosas. MÉTODOS: Trata-se de um estudo quase-experimental antes/depois sem grupo controle. Foram avaliadas 25 idosas por meio de duas escalas, a Escala de Equilíbrio de Berg e Timed Up & Go. Posteriormente, foram submetid...

Efeitos de um Programa de Pilates sobre o equilíbrio de suas praticantes no período pós-menopausa

Directory of Open Access Journals (Sweden)

Diogo do Carmo de Souza

2013-12-01

Full Text Available Objetiva-se avaliar os efeitos de um programa do método Pilates sobre o equilíbrio de mulheres pós-menopausa, com idades entre 58 a 60 anos praticantes de Pilates. Como metodologia, foi utilizada a Escala de Equilíbrio de Berg com 15 mulheres, na faixa etária de 58 a 60 anos em fase pós-menopausa, iniciantes na modalidade Pilates, e não portadoras de patologias ósteo-musculares e/ou sensório-motoras. Como resultados, houve um ganho de 6,9% no Grupo Estudo sobre o equilíbrio. Conclusão: Após três meses de prática com Pilates, as participantes apresentaram menor déficit de equilíbrio do que no pré-teste.

Sazonalidade da umidade de equilíbrio da madeira para o Estado de Mato Grosso

OpenAIRE

Adilson Pacheco de Souza; Diego Martins Stangerlin; Rafael Rodolfo de Melo; Eduardo Morgan Uliana

2017-01-01

Por ser um material orgânico, heterogêneo e higroscópico, a madeira pode apresentar variações dimensionais e deformações decorrentes da interação com o ambiente. Em uso ou nos processos de secagem, quando são atingidos os equilíbrios entre a madeira e o ar atmosférico, têm-se a obtenção da umidade de equilíbrio da madeira (UEM). Em função da elevada importância dessa matéria-prima para o Estado de Mato Grosso, torna-se fundamental conhecer a sazonalidade de UEM. O presente trabalho objetivou ...

Análise do equilíbrio em pacientes hemiparéticos após o treino com o programa Wii Fit

Directory of Open Access Journals (Sweden)

Luciana Barcala

Full Text Available OBJETIVO: A hemiparesia é um comprometimento parcial do hemicorpo que altera o equilíbrio, sendo este essencial para as atividades funcionais. OBJETIVO: Avaliar o equilíbrio em pacientes hemiparéticos submetidos ao treino de equilíbrio com o programa Wii Fit, que atuou como um recurso de biofeedback visual. MÉTODO: Foram selecionados 12 pacientes hemiparéticos pós AVE, 5 do sexo masculino e 7 do sexo feminino, com idade média de 58 ± 12,57 anos, divididos aleatoriamente em dois grupos. Um deles realizou a fisioterapia convencional (GC pelo período de uma hora, o outro realizou por trinta minutos e mais trinta minutos de treino de equilíbrio com auxílio do Wii Fit (GW, duas vezes por semana durante cinco semanas, completando dez sessões. O equilíbrio foi avaliado antes e após as intervenções, por meio da aplicação da Escala de Equilíbrio de Berg (EEB e pela estabilometria, que mensura a oscilação do centro de pressão (COP, nos eixos ântero-posterior (AP e médio-lateral (ML, por uma plataforma de pressão em duas condições: de olhos abertos (OA e olhos fechados (OF. RESULTADOS: De acordo com a EEB, os pacientes, tanto do GC quanto o do GW, obtiveram maior controle do equilíbrio estático e dinâmico. Na avaliação do COP no eixo ML, os indivíduos do GC e do GW tiveram diminuição na oscilação ML após a intervenção proposta para cada grupo, nas condições de OA e OF. No eixo AP do COP, o GC não teve diminuição na oscilação AP de OA e OF, e o GW apresentou diminuição na oscilação AP de OA e OF. CONLUSÃO: O presente estudo demonstra que a fisioterapia associada ao treino de equilíbrio com o Wii Fit apresenta resultados significantes na reabilitação dos indivíduos hemiparéticos, obtendo, assim, mais um recurso terapêutico na fisioterapia.

Function of VtPGIP in pathogenic fungus resistance of Vitis thunbergii

African Journals Online (AJOL)

In plants, polygalacturonase inhibitor proteins (PGIPs) are very important to inactivate polygalacturonases secreted by pathogens. Vitis thunbergii Sieb. et Zucc. polygalacturonase inhibitor proteins (VtPGIP) was first isolated from the wild grape Vitis thunbergii Sieb. et Zucc., which exhibits high resistance to disease. VtPGIP ...

The Inner Ear. About the Meeting between Cristina Campo, María Zambrano and Marius Schneider

Directory of Open Access Journals (Sweden)

Victoria Cirlot

2015-02-01

Full Text Available This text concernes the encounter, anecdotic as well as theoric, of CristinaCampo, María Zambrano and Marius Schneider. The author refers to the inklingsof the contact between them (the colaboration in Sur and Conoscenzareligiosa magazines, the frequenting of Campo and Schneider, the correspondencebetween her and Zambrano, nevertheless, she also signs the shared interestin the organ of hearing, in addition to the similarities of thought fromtheir respective disciplines: the symbolic approach to the auditive organ, itssuperiority over vision, the associations between music and word, the antithesisamong music and stone, the complementing between internal hearing anddestiny, as well as the need of an attentive audition to listen to the internal voice and one’s destiny. In the case of Cristina Campo, the musicality of herwriting style is also discussed.

On efeito do achatamento nos pontos de equilíbrio e na dinâmica de sistemas coorbitais

Science.gov (United States)

Mourão, D. C.; Winter, O. C.; Yokoyama, T.

2003-08-01

Neste trabalho analisamos o efeito do achatamento do corpo principal nos pontos de equilíbrio lagrangianos e na configuração de órbitas girino-ferradura. Enfatizamos os sistemas coorbitais de satélites de Saturno, pois se encontram em relativa proximidade com o planeta, em que o efeito do achatamento se torna mais evidente. O estudo é dividido em três etapas independentes. Na primeira fase analisamos as equações de movimento do problema restrito de três corpos considerando o efeito do achatamento, e através do balanceamento de forças buscamos a nova configuração dos pontos de equilíbrio lagrangianos. Concluímos, nesta etapa, que os pontos de equilíbrio estáveis apresentam um pequeno deslocamento definido pelo parâmetro de achatamento, não podendo ser mais representados por triângulos eqüiláteros. Aplicamos este resultado aos satélites coorbitais de Tetis e Dione, encontrando as posições de equilíbrio levemente deslocadas em relação ao caso sem achatamento. Na segunda fase visamos o sistema Saturno-Jano-Epimeteu, que por se tratar de um sistema de massas comparáveis, optamos por desenvolver as equações de Yoder et al (Icarus 53, pág 431-443, 1983), que permitem determinar os pontos de equilíbrio e a amplitude de oscilação angular das órbitas girino-ferradura para o problema não-restrito de três corpos, porém, no nosso estudo consideramos o efeito do achatamento do corpo principal nestas equações. Encontramos que a distância angular entre satélites, quando em posição de equilíbrio estável, diminui quanto maior for o parâmetro de achatamento do corpo principal. Além disso, a órbita de transição girino-ferradura possui largura angular menor em relação ao caso sem achatamento. Por fim, realizamos integrações numéricas para os casos reais de coorbitais de Saturno comparando com os resultados analíticos. Nestas integrações simulamos diversas órbitas girino-ferradura com diferentes parâmetros de achatamento

Lunar Geologic Mapping: A Preliminary Map of a Portion of the LQ-10 ("Marius") Quadrangle

Science.gov (United States)

Gregg, T. K. P.; Yingst, R. A.

2009-01-01

Since the first lunar mapping program ended in the 1970s, new topographical, multispectral, elemental and albedo imaging datasets have become available (e.g., Clementine, Lunar Prospector, Galileo). Lunar science has also advanced within the intervening time period. A new systematic lunar geologic mapping effort endeavors to build on the success of earlier mapping programs by fully integrating the many disparate datasets using GIS software and bringing to bear the most current understanding of lunar geologic history. As part of this program, we report on a 1:2,500,000-scale preliminary map of a subset of Lunar Quadrangle 10 ("LQ-10" or the "Marius Quadrangle," see Figures 1 and 2), and discuss the first-order science results. By generating a geologic map of this region, we can constrain the stratigraphic and geologic relationships between features, revealing information about the Moon s chemical and thermal evolution.

La France au Tsar : chanson patriotique créée par Marius Richard à la Scala, Henri Helme à Ba-ta-clan [illustration couleurs Donjean

OpenAIRE

François Bigot Éditeur , .; Daphy , Éliane

2010-01-01

La France au Tsar : chanson patriotique créée par Marius Richard à la Scala, Henri Helme à Ba-ta-clan ; paroles de Lucien Colonge, Musique de J. Claudel. [Illustration couleurs signée] Donjean. A la chanson populaire, Maison Bigot éditeur (sans cotage, sans ©, datation recherche en cours). Titre inconnu du catalogue BNF. Datation provisoire par année de dépôt médihal (2010)

Morphology, structure and ontogeny of trichomes of the grape genus (Vitis, Vitaceae

Directory of Open Access Journals (Sweden)

Zhi-Yao eMa

2016-05-01

Full Text Available Trichomes are widely distributed on surfaces of different organs in the grape genus Vitis and are of taxonomic utility. To explore the morphology, structure and ontogeny of Vitis trichomes, we investigated the diversity and distribution of trichomes in 34 species of Vitis. Two main types of trichomes in Vitis are documented: non-glandular and glandular. Within non-glandular trichomes, ribbon and simple trichomes are found on different vegetative plant organs. The morphology and ontogeny of these types of trichomes are further examined with light microscopy and scanning electron microscopy. The ultrastructure of the glandular trichomes is explored with transmission electron microscopy. The ribbon trichomes are twisted, greatly elongated and unicellular, and this trichome type may be a morphological synapomorphy of Vitis and its closest tropical relative Ampelocissus and Pterisanthes in Vitaceae. The simple trichomes are documented in most species sampled in the genus. The glandular trichomes are multicellular, non-vascularized and composed of both epidermis and subjacent layers. We show that prickles occurring along the stems and petioles of Vitis davidii are modified glandular trichomes. In our observation, the glandular trichomes of V. romanetii can secret mucilage and send out volatile substance so that many insects are often glued to glands. Transmission electron microscopy indicates that metabolic products accumulate in vacuoles, the cytoplasm and intercellular spaces. We infer that glandular trichomes and young prickles are involved in the secretion of these metabolic products and the intercellular spaces may be the places of temporary storage of these secretions.

Vitis phylogenomics: hybridization intensities from a SNP array outperform genotype calls.

Directory of Open Access Journals (Sweden)

Allison J Miller

Full Text Available Understanding relationships among species is a fundamental goal of evolutionary biology. Single nucleotide polymorphisms (SNPs identified through next generation sequencing and related technologies enable phylogeny reconstruction by providing unprecedented numbers of characters for analysis. One approach to SNP-based phylogeny reconstruction is to identify SNPs in a subset of individuals, and then to compile SNPs on an array that can be used to genotype additional samples at hundreds or thousands of sites simultaneously. Although powerful and efficient, this method is subject to ascertainment bias because applying variation discovered in a representative subset to a larger sample favors identification of SNPs with high minor allele frequencies and introduces bias against rare alleles. Here, we demonstrate that the use of hybridization intensity data, rather than genotype calls, reduces the effects of ascertainment bias. Whereas traditional SNP calls assess known variants based on diversity housed in the discovery panel, hybridization intensity data survey variation in the broader sample pool, regardless of whether those variants are present in the initial SNP discovery process. We apply SNP genotype and hybridization intensity data derived from the Vitis9kSNP array developed for grape to show the effects of ascertainment bias and to reconstruct evolutionary relationships among Vitis species. We demonstrate that phylogenies constructed using hybridization intensities suffer less from the distorting effects of ascertainment bias, and are thus more accurate than phylogenies based on genotype calls. Moreover, we reconstruct the phylogeny of the genus Vitis using hybridization data, show that North American subgenus Vitis species are monophyletic, and resolve several previously poorly known relationships among North American species. This study builds on earlier work that applied the Vitis9kSNP array to evolutionary questions within Vitis vinifera

Efeito de um plano de exercícios na plataforma Wii no equilíbrio de idosos institucionalizados

OpenAIRE

Pimentel, Maria Manuela da Silva

2015-01-01

Introdução – O envelhecimento está associado a uma diminuição na funcionalidade de todos os sistemas orgânicos. Um dos fatores que afeta a qualidade de vida nos idosos é a diminuição do equilíbrio que leva por vezes às quedas e consequentemente ao medo de cair, neste sentido, torna-se fundamental tentar atenuar esta degeneração progressiva. A plataforma Wii é um método de tecnologia moderna e pode ser utilizada para melhorar o equilíbrio nos idosos e assim permitir a estes uma melhor qualidad...

Equilíbrio corporal em crianças e adolescentes asmáticos e não asmáticos

Directory of Open Access Journals (Sweden)

Marta Cristina Rodrigues da Silva

2013-06-01

Full Text Available O objetivo foi analisar e comparar o equilíbrio corporal em crianças e adolescentes asmáticos e não asmáticos. Fizeram parte do grupo de estudos 24 sujeitos com idades de 7 a 14 anos divididos em dois grupos: grupo asmático e grupo controle. Para avaliação do equilíbrio corporal utilizou-se uma plataforma de força. Foram utilizadas as condições, olhos abertos e fechados com três tentativas aleatórias, com duração de 30 segundos cada uma. Os resultados apontaram diferença significativa entre os grupos, no teste de equilíbrio com olhos abertos apresentando maior amplitude de deslocamento na direção ântero-posterior (COPap (p = 0,04, e médio lateral (COPml (p = 0,02 no grupo asmático. Enquanto que no teste com olhos fechados a diferença foi significante apenas na amplitude de deslocamento ântero-posterior (COPap (p = 0,02 e Área de Elipse (p=0,03. Desse modo, a asma com suas limitações e consequências parece influenciar negativamente no equilíbrio corporal de seus portadores quando comparados com crianças sem a patologia e da mesma faixa etária.

Phenotypic and molecular characterization of Rhizobium vitis strains from vineyards in Turkey

Directory of Open Access Journals (Sweden)

Didem CANIK OREL

2016-05-01

Full Text Available Crown gall-affected grapevine samples were collected during 2009–2010 from major vineyards, located in different Turkish provinces. One hundred and three bacterial strains were obtained from 88 vineyards and 18 grapevine varieties; they were tumorigenic when inoculated in tobacco, sunflower and Datura stramonium plants and were identified as Rhizobium vitis using biochemical and physiological tests as well as PCR and specific primers. Nineteen R. vitis strains presented a number of anomalous biochemical and physiological characters. PCR and opine-specific primers revealed the presence of octopine/cucumopine-type plasmid in 82 R. vitis strains, nopaline-type plasmids in 18 strains and vitopine-type plasmids in three strains. Clonal relationship of strains was determined using Pulsed Field Gel Electrophoresis following digestion of genomic DNA with the restriction endonuclease PmeI. The greatest genetic diversity was found for the strains from Denizli, Ankara and Nevşehir provinces. Nopaline and vitopine-types of Rhizobium vitis were detected for the first time in Turkey.

Vääna-Viti hoolekandeküla = Vääna-Viti community setting group home / Tõnu Laigu

Index Scriptorium Estoniae

Laigu, Tõnu, 1956-

2015-01-01

Vääna-Viti hoolekandeküla Harku vallas Aiba tee 8/7, valminud 2013. Hoonete arhitektid Tõnu Laigu, Koit Ojaliiv, Mari Rass (QP Arhitektid OÜ), sisearhitektid Andres Labi, Janno Roos (Ruumilabor OÜ). 2014. aasta Kultuurkapitali Arhitektuuripreemia kandidaat

Phylogeny of the Ampelocissus-Vitis clade in Vitaceae supports the New World origin of the grape genus.

Science.gov (United States)

Liu, Xiu-Qun; Ickert-Bond, Stefanie M; Nie, Ze-Long; Zhou, Zhuo; Chen, Long-Qing; Wen, Jun

2016-02-01

The grapes and the close allies in Vitaceae are of great agronomic and economic importance. Our previous studies showed that the grape genus Vitis was closely related to three tropical genera, which formed the Ampelocissus-Vitis clade (including Vitis, Ampelocissus, Nothocissus and Pterisanthes). Yet the phylogenetic relationships of the four genera within this clade remain poorly resolved. Furthermore, the geographic origin of Vitis is still controversial, because the sampling of the close relatives of Vitis was too limited in the previous studies. This study reconstructs the phylogenetic relationships within the clade, and hypothesizes the origin of Vitis in a broader phylogenetic framework, using five plastid and two nuclear markers. The Ampelocissus-Vitis clade is supported to be composed of five main lineages. Vitis includes two described subgenera each as a monophyletic group. Ampelocissus is paraphyletic. The New World Ampelocissus does not form a clade and shows a complex phylogenetic relationship, with A. acapulcensis and A. javalensis forming a clade, and A. erdvendbergiana sister to Vitis. The majority of the Asian Ampelocissus species form a clade, within which Pterisanthes is nested. Pterisanthes is polyphyletic, suggesting that the lamellate inflorescence characteristic of the genus represents convergence. Nothocissus is sister to the clade of Asian Ampelocissus and Pterisanthes. The African Ampelocissus forms a clade with several Asian species. Based on the Bayesian dating and both the RASP and Lagrange analyses, Vitis is inferred to have originated in the New World during the late Eocene (39.4Ma, 95% HPD: 32.6-48.6Ma), then migrated to Eurasia in the late Eocene (37.3Ma, 95% HPD: 30.9-45.1Ma). The North Atlantic land bridges (NALB) are hypothesized to be the most plausible route for the Vitis migration from the New World to Eurasia, while intercontinental long distance dispersal (LDD) cannot be eliminated as a likely mechanism. Copyright © 2015

Avaliação angular do equilíbrio sagital em pacientes obesos

Directory of Open Access Journals (Sweden)

Alynson Larocca Kulcheski

2013-01-01

Full Text Available OBJETIVO: Tendo em vista a pouca quantidade de informações a respeito das alterações degenerativas e patológicas da coluna vertebral realizou-se este estudo com objetivo de avaliar e quantificar os valores angulares do equilíbrio sagital na população obesa. MÉTODOS: Foram medidos os ângulos de incidência pélvica (IP, versão pélvica (VP e declive sacral (DS. RESULTADOS: Foram avaliados 30 pacientes, sendo 19 do sexo feminino e 11 do sexo masculino, no ano de 2012 que aguardavam realização de cirurgia bariátrica. A média de idade foi de 33 anos. O IMC médio foi de 41 kg/m², sendo que o valor médio para os homens foi de 43 kg/m² e das mulheres 39 kg/m². O IP médio foi de 57°. O VP foi de 19°. O DS foi de 38°. O valor da incidência pélvica e da versão pélvica ficou em média acima do encontrado na população com índice de massa corporal normal. Já o valor do declive sacral encontra-se na média da população. CONCLUSÕES: Cada vez mais o equilíbrio sagital vem ganhando espaço na avaliação da coluna vertebral. Faz-se necessário literatura mais vasta e aumento do conhecimento médico das patologias e comorbidades que podem alterar o equilíbrio sagital em seus pacientes, como a obesidade.

Uudised : Lassmann Konservatooriumide Assotsiatsiooni juhatuses. Algab "Con brio 2000". Erkki-Sven Tüüri autorikontsert / Annika Koppel

Index Scriptorium Estoniae

Koppel, Annika

2000-01-01

P. Lassmann valiti Euroopa Konservatooriumide Assotsiatsiooni juhatuse liikmeks. Eesti noorte interpreetide konkurssfestivalist "Con brio 2000". Tallinna metodisti kirikus toimub 24. nov. E.-S. Tüüri autorikontsert

ANÁLISE DO DESEMPENHO FÍSICO E DO EQUILÍBRIO SOB INFLUÊNCIA DA CRIOTERAPIA EM ATLETAS DE FUTSAL

Directory of Open Access Journals (Sweden)

Thiago Rocha Freire

2015-12-01

Full Text Available Introdução Crioterapia é a aplicação de modalidades de frio com temperatura de 0ºC a 18,3ºC, podendo interferir no desempenho físico e equilíbrio, dependendo da capacidade do indivíduo em manter a estabilização, direcionar padrões de movimentos, controlar a postura e posição articular. Objetivo Avaliar o desempenho físico, a frequência cardíaca e o equilíbrio estático com olhos abertos, em atletas de futsal (futebol de salão, antes e depois da crioimersão nos membros inferiores. Métodos Trinta e dois indivíduos do gênero masculino participaram do estudo, distribuídos aleatoriamente em dois grupos: (A grupo controle, imersão em água a 24°C por 10 min; (B grupo intervenção, crioimersão em água com gelo a 10°C por 10 min. Os voluntários realizavam a avaliação do equilíbrio no baropodômetro, em seguida corriam em linha reta e em ziguezague por 100 m, entravam na crioimersão, terminando com uma nova avaliação. Foram analisados o desempenho físico, através dos tempos das corridas, a frequência cardíaca, por meio de um frequencímetro e o equilíbrio, através da baropodometria e estabilometria em apoio bipodal de olhos abertos. Resultados O desempenho físico foi alterado após a crioimersão quando das análises intra e intergrupos. A frequência cardíaca apresentou diferença ao comparar-se antes e após a crio, porém sem diferenças em comparação ao controle. O equilíbrio não foi alterado após a crioimersão e nem em comparação com o grupo controle. Conclusão A crioimersão prejudicou o desempenho físico, quando a atividade foi imediatamente após a mesma, sendo desta forma o gelo não aconselhável quando se deseja desempenho na atividade desportiva. Porém não apresentou interferência na frequência cardíaca e no equilíbrio de atletas de futsal, que podem não ter sido alterados devido ao tempo da crioimersão.

Alterações de equilíbrio postural e qualidade de vida em mulheres no ciclo gravídico puerperal

OpenAIRE

Eufrásio, Laiane Santos

2015-01-01

INTRODUÇÃO: O ciclo gravídico-puerperal causa inúmeras transformações na vida da mulher, sejam elas físicas, hormonais, emocionais ou sociais. Tais alterações podem afetar o equilíbrio postural e a qualidade de vida dessas mulheres na gravidez, podendo persistir no pós-parto. OBJETIVO: Analisar alterações no equilíbrio postural e qualidade de vida em mulheres na gravidez e no pós-parto. METODOLOGIA: Este estudo foi composto por 47 mulheres participantes do Curso para Gestant...

Análise do treinamento proprioceptivo no equilíbrio de atletas de futsal feminino

Directory of Open Access Journals (Sweden)

Fábio Oliveira Baldaço

Full Text Available OBJETIVO: O objetivo deste trabalho foi avaliar a eficiência de um protocolo de exercícios proprioceptivos no equilíbrio de atletas de futsal feminino. METODOLOGIA: A amostra foi composta por cinco atletas do time de futsal da Universidade Federal de Santa Maria (UFSM. Os treinamentos ocorreram três vezes por semana, durante um mês. As atletas foram avaliadas pré e pós-treinamento em uma plataforma de força no Laboratório de Biomecânica do Centro de Educação Física e Desportos da UFSM. RESULTADOS: Os resultados mostraram uma redução estatisticamente significativa na média e na amplitude do centro de pressão pré e pós-intervenção, na direção médio-lateral e condição olhos fechados, o que demonstra que houve maior controle do equilíbrio corporal na posição e condição solicitada. Não foram encontradas diferenças estatisticamente significativas nas variáveis do centro depressão na condição olhos abertos. Acredita-se que esse resultado esteja relacionado à dominância da aferência visual sobre a proprioceptiva, que pode ter interferido na avaliação das alterações proprioceptivas. CONCLUSÃO: O protocolo de propriocepção sugerido demonstrou maior controle de equilíbrio postural nas condições e na amostra avaliada.

Temperature dependence of refractive index and of electrical impedance of grape seed (Vitis vinifera, Vitis labrusca) oils extracted by Soxhlet and mechanical pressing

OpenAIRE

Vieira, D. S.; Menezes, M.; Gonçalves, G.; Mukai, H.; Lenzi, E. K.; Pereira, N. C.; Fernandes, P. R.G.

2015-01-01

In this report, the temperature dependence of the refractive index and electric impedance of vegetable oil grape seeds extracted from Vitis vinifera (v. Cabernet) and Vitis labrusca (v. Bordo) are investigated by means of experimental techniques. The seeds were collected from wineries located in two cities in the south of Brazil. In both extraction methods, the seeds were dried at 40.0 °C and at 80.0 °C, respectively, before the oil extraction. From optical microscopy and refractometry result...

Uudised : Marko Martini konkursiedu Kanadas. "Con brio" lõppkontserdile 6 esinejat. Tublid noored trompetistid / Joosep Sang

Index Scriptorium Estoniae

Sang, Joosep

2000-01-01

M. Martin pälvis II koha III Esther Honensi nim. pianistide konkursil Kanadas. Konkursi "Con brio" lõppvooru pääsejatest. N. ja J.Ots olid edukad I rahvusvahelisel noorte trompetistide konkursil Jekabpilsis Lätis

Isolation and Identification of the Indigenous Yeast Population during Spontaneous Fermentation of Isabella (Vitis labrusca L.) Grape Must

Science.gov (United States)

Raymond Eder, María L.; Reynoso, Cristina; Lauret, Santiago C.; Rosa, Alberto L.

2017-01-01

Grape must harbors a complex community of yeast species responsible for spontaneous alcoholic fermentation. Although there are detailed studies on the microbiota of Vitis vinifera L. grapes, less is known about the diversity and behavior of yeast communities present on fermenting grape must from other species of Vitis. In this work, we used a culture-dependent method to study the identity and dynamics of the indigenous yeast population present during the spontaneous fermentation of Isabella (Vitis labrusca L.) grape must. Alcoholic fermentation was conducted using standard enological practices, and the associated non-Saccharomyces and S. cerevisiae yeast community was analyzed using selective growth media and 5.8-ITS DNA sequencing. Candida californica, Candida hellenica, Starmerella bacillaris (synonym Candida zemplinina), Hanseniaspora uvarum, and Hanseniaspora vineae were the main non-Saccharomyces species identified on Isabella fermenting must. Issatchenkia hanoiensis, a yeast species rarely found on Vitis vinifera L. grapes, was also recognized on Isabella grape must. Candida azymoides, Candida californica and Pichia cecembensis, identified in this work on Isabella fermenting must, have not previously been found on Vitis vinifera L. grape must. Interestingly, C. azymoides, I. hanoiensis and P. cecembensis have recently been isolated from the surface of Vitis labrusca L. grapes from vineyards in the Azores archipelago, suggesting that specific Vitis-yeast species associations are formed independently of geographic origin. We suggest that C. azymoides, C. californica, and P. cecembensis are yeast species preferentially associated with Vitis labrusca L. grapes. Specific biological interactions between grapevines and yeast species may underlie the assembly of differential Vitis-microbial communities. PMID:28424672

O custo de bem-estar da inflação: cálculo tentativo com o uso de um modelo de equilíbrio geral

Directory of Open Access Journals (Sweden)

José W. Rossi

2008-03-01

Full Text Available O custo de bem-estar da inflação tem sido calculado usando-se basicamente dois tipos de abordagem: o do Equilíbrio Parcial e do Equilíbrio Geral. Apesar da abordagem do Equilíbrio Geral ser considerada analiticamente superior e que em alguns casos produz valores maiores do que com o uso da análise de Equilíbrio Parcial - por exemplo, Dotsey e Ireland (1996 para os Estados Unidos e Yoshino (2002 para o Brasil - há também vários exemplos nos quais são comparáveis os resultados com os dois procedimentos metodológicos - ver, por exemplo, Rossi (2003 com Equilíbrio Parcial contra Polato e Fava e Rocha (2003, com Equilíbrio Geral, ambos os estudos com aplicação ao caso brasileiro. A abordagem de Equilíbrio Geral deste estudo segue o procedimento metodológico de Abel (1997 e contempla certos aspectos não levados em conta em aplicações anteriores para o Brasil. Mais precisamente, o papel que a inflação tem no bem-estar do indivíduo em vista de a tributação incidir sobre os valores nominais, ao invés de valores reais, dos seus rendimentos.The welfare cost of inflation has been calculated using either a Partial Equilibrium approach or a General Equilibrium approach. Although the latter can be considered analytically superior generally producing higher results than those obtained by a Partial Equilibrium analysis - for instance, Dotsey and Ireland (1996 for the USA, and Yoshino, 2002, for Brazil, there are also many cases in which the results are comparable with the two approaches - see, for instance, Rossi (2003 using Partial Equilibrium against Polato e Fava and Rocha (2003 using General Equilibrium, both in application for Brazil.The application of a General Equilibrium analysis here follows Abel (1997's work and considers certain aspects not taken into account in previous studies applied to Brazil, more precisely, the role of inflation on the welfare of individuals in view of tax being levied on their nominal (rather than

ANÁLISE DO DESEMPENHO FÍSICO E DO EQUILÍBRIO SOB INFLUÊNCIA DA CRIOTERAPIA EM ATLETAS DE FUTSAL

OpenAIRE

Freire, Thiago Rocha; Santana, Mylena Maria Salgueiro; Farias Neto, Jader Pereira de; Grigoletto, Marzo Edir da Silva; Silva Júnior, Walderi Monteiro da

2015-01-01

Introdução Crioterapia é a aplicação de modalidades de frio com temperatura de 0ºC a 18,3ºC, podendo interferir no desempenho físico e equilíbrio, dependendo da capacidade do indivíduo em manter a estabilização, direcionar padrões de movimentos, controlar a postura e posição articular. Objetivo Avaliar o desempenho físico, a frequência cardíaca e o equilíbrio estático com olhos abertos, em atletas de futsal (futebol de salão), antes e depois da crioimersão nos membros inferiores. Métodos Tr...

An improved embryo-rescue protocol for hybrid progeny from seedless Vitis vinifera grapes × wild Chinese Vitis species.

Science.gov (United States)

Li, Gui Rong; Ji, Wei; Wang, Gang; Zhang, Jian Xia; Wang, Yue Jin

A highly efficient technique of embryo rescue is critical when using stenospermocarpic Vitis vinifera cultivars (female parents) to breed novel, disease-resistant, seedless grape cultivars by hybridizing with wild Chinese Vitis species (male parents) having many disease-resistance alleles. The effects of various factors on the improvement of embryo formation, germination, and plantlet development for seven hybrid combinations were studied. The results indicated that Beichun and Shuangyou were the best male parents. The best sampling time for ovule inoculation differed among the female parents. When hybrid ovules were cultured on a double-phase medium with five different solid medium types, percent embryo formation was highest (11.3-28.3%) on a modified MM3 medium. Percentages of embryo germination (15.4-55.4%) and plantlet development (11.15-44.6%) were all highest when embryos were cultured on Woody Plant Medium + 5.7 μM indole-3-acetic acid + 4.4 μM 6-benzylaminopurine + 1.4 μM gibberellic acid + 2% sucrose + 0.05% casein hydrolysate + 0.3% activated charcoal + 0.7% agar. In the absence of other amino acids, the addition of proline significantly increased embryo formation (36.1%), embryo germination (64.6%), and plantlet development (90.5%). A highly efficient protocol has been developed for hybrid embryo rescue from seedless V. vinifera grapes × wild Chinese Vitis species that results in a significant improvement in breeding efficiency for new disease-resistant seedless grapes.

Effects of irrigation on the seasonal abundance of Empoasca vitis in north-Italian vineyards.

Science.gov (United States)

Fornasiero, D; Duso, C; Pozzebon, A; Tomasi, D; Gaiotti, F; Pavan, F

2012-02-01

The effect of irrigation on the abundance of Empoasca vitis (Göthe) populations was investigated in four vineyards located in northeastern Italy. In two experiments, we compared leafhopper population densities in plots irrigated (micro-spray irrigation system) or nonirrigated. In another experiment, we studied the effect of various irrigation systems on E. vitis populations over two successive seasons. In particular, five treatments were compared: control (not irrigated), traditional drip system, three types of subirrigation varying in distance from the row (40, 135, and 95 cm). In this vineyard, stem water potential was monitored with a pressure chamber. E. vitis population densities were affected by irrigation, with higher densities of this pest recorded on irrigated vines. Highest E. vitis densities were detected in drip irrigation plots compared with nonirrigated plots where water stress was highest. Moderate water stress (subirrigation plots) was associated with intermediate leafhopper densities. Implications for integrated pest management are discussed.

Proteomics approach to identify unique xylem sap proteins in Pierce's disease-tolerant Vitis species.

Science.gov (United States)

Basha, Sheikh M; Mazhar, Hifza; Vasanthaiah, Hemanth K N

2010-03-01

Pierce's disease (PD) is a destructive bacterial disease of grapes caused by Xylella fastidiosa which is xylem-confined. The tolerance level to this disease varies among Vitis species. Our research was aimed at identifying unique xylem sap proteins present in PD-tolerant Vitis species. The results showed wide variation in the xylem sap protein composition, where a set of polypeptides with pI between 4.5 and 4.7 and M(r) of 31 kDa were present in abundant amount in muscadine (Vitis rotundifolia, PD-tolerant), in reduced levels in Florida hybrid bunch (Vitis spp., PD-tolerant) and absent in bunch grapes (Vitis vinifera, PD-susceptible). Liquid chromatography/mass spectrometry/mass spectrometry analysis of these proteins revealed their similarity to beta-1, 3-glucanase, peroxidase, and a subunit of oxygen-evolving enhancer protein 1, which are known to play role in defense and oxygen generation. In addition, the amount of free amino acids and soluble sugars was found to be significantly lower in xylem sap of muscadine genotypes compared to V. vinifera genotypes, indicating that the higher nutritional value of bunch grape sap may be more suitable for Xylella growth. These data suggest that the presence of these unique proteins in xylem sap is vital for PD tolerance in muscadine and Florida hybrid bunch grapes.

Relação entre testes funcionais e plataforma de força nas medidas de equilíbrio em atletas

Directory of Open Access Journals (Sweden)

Lucas Maciel Rabello

2014-06-01

Full Text Available INTRODUÇÃO: Poucos estudos correlacionaram as medidas de equilíbrio entre os principais testes funcionais e a plataforma de força em atletas. OBJETIVO: Determinar a relação entre três testes funcionais de equilíbrio com as principais medidas da plataforma de força em atletas. MÉTODO: Quinze atletas do sexo feminino praticantes de futebol de salão (futsal e handebol, com idades entre 13 a 17 anos participaram do estudo. As atletas realizaram três testes funcionais: 1 Star excursion balance test, 2 Salto lateral e 3 Figura em oito; além de um teste em apoio unipodal sobre uma plataforma de força com os olhos abertos durante 30 segundos. Os parâmetros do centro de pressão dos pés (COP foram calculados por análise estabilográfica. Para todos os testes (funcionais e plataforma, três tentativas foram realizadas e a média foi retida para as análises. RESULTADOS: As correlações entre os testes funcionais e a plataforma de força foram de r = 0,01 a -0,69 (fraca a moderada, dependendo da variável do COP. As melhores correlações (r = -0,69 foram encontradas entre o Star Excursion Balance Test de alcance e a área do COP, indicando que quanto maior a distância alcançada, melhor o equilíbrio. Segundo, uma correlação de fraca a moderada foi encontrada entre o teste da figura em oito e a área do COP (p. ex: r = 0.43. O teste de salto lateral não apresentou boa correlação com os obtidos na plataforma de força. CONCLUSÃO: Este estudo demonstrou que para a avaliação do equilíbrio em atletas de futsal e handebol feminino o teste Star Excursion Balance Test pode ser usados na ausência da plataforma de força para identificação de possíveis déficits de equilíbrio.

High-throughput sequencing data clarify evolutionary relationships among North American Vitis species and improve identification in USDA Vitis germplasm collections

Science.gov (United States)

Grapes are one of the most economically important berry crops worldwide, with the vast majority of production derived from the domesticated Eurasian species Vitis vinifera. Expansion of production into new areas, development of new cultivars, and concerns about adapting grapevines for changing clima...

Equilíbrio acído-base e a acidose metabólica da insuficiência renal crónica

OpenAIRE

Andrade, Sara Isabel Oliveira de Castro e

1999-01-01

Resumo da tese: O organismo mantém num equilíbrio dinâmico a composição e o volume de todos os compartimentos líquidos corporais, apesar de não bebermos sempre a mesma quantidade de líquidos e de não comermos sempre os mesmos alimentos. Mantém um equilíbrio entre as entradas e as saídas e, quando percebe que algo está mal, age, por intermédio dos seus órgâos sintonizados num integrado mecanismo de regulação, sem que sequer nos apercebamos. Mas quando o organismo fica doente, quando há algo qu...

Identification of transcripts involved in digestion, detoxification and immune response from transcriptome of Empoasca vitis (Hemiptera: Cicadellidae) nymphs.

Science.gov (United States)

Shao, En-Si; Lin, Gui-Fang; Liu, Sijun; Ma, Xiao-Li; Chen, Ming-Feng; Lin, Li; Wu, Song-Qing; Sha, Li; Liu, Zhao-Xia; Hu, Xiao-Hua; Guan, Xiong; Zhang, Ling-Ling

2017-01-01

Tea production has been significantly impacted by the false-eye leafhopper, Empoasca vitis (Göthe), around Asia. To identify the key genes which are responsible for nutrition absorption, xenobiotic metabolism and immune response, the transcriptome of either alimentary tracts or bodies minus alimentary tract of E. vitis was sequenced and analyzed. Over 31 million reads were obtained from Illumina sequencing. De novo sequence assembly resulted in 52,182 unigenes with a mean size of 848nt. The assembled unigenes were then annotated using various databases. Transcripts of at least 566 digestion-, 224 detoxification-, and 288 immune-related putative genes in E. vitis were identified. In addition, relative expression of highly abundant transcripts was verified through quantitative real-time PCR. Results from this investigation provide genomic information about E. vitis, which will be helpful in further study of E. vitis biology and in the development of novel strategies to control this devastating pest. Copyright © 2016 Elsevier Inc. All rights reserved.

VitiCanopy: A Free Computer App to Estimate Canopy Vigor and Porosity for Grapevine.

Science.gov (United States)

De Bei, Roberta; Fuentes, Sigfredo; Gilliham, Matthew; Tyerman, Steve; Edwards, Everard; Bianchini, Nicolò; Smith, Jason; Collins, Cassandra

2016-04-23

Leaf area index (LAI) and plant area index (PAI) are common and important biophysical parameters used to estimate agronomical variables such as canopy growth, light interception and water requirements of plants and trees. LAI can be either measured directly using destructive methods or indirectly using dedicated and expensive instrumentation, both of which require a high level of know-how to operate equipment, handle data and interpret results. Recently, a novel smartphone and tablet PC application, VitiCanopy, has been developed by a group of researchers from the University of Adelaide and the University of Melbourne, to estimate grapevine canopy size (LAI and PAI), canopy porosity, canopy cover and clumping index. VitiCanopy uses the front in-built camera and GPS capabilities of smartphones and tablet PCs to automatically implement image analysis algorithms on upward-looking digital images of canopies and calculates relevant canopy architecture parameters. Results from the use of VitiCanopy on grapevines correlated well with traditional methods to measure/estimate LAI and PAI. Like other indirect methods, VitiCanopy does not distinguish between leaf and non-leaf material but it was demonstrated that the non-leaf material could be extracted from the results, if needed, to increase accuracy. VitiCanopy is an accurate, user-friendly and free alternative to current techniques used by scientists and viticultural practitioners to assess the dynamics of LAI, PAI and canopy architecture in vineyards, and has the potential to be adapted for use on other plants.

VitiCanopy: A Free Computer App to Estimate Canopy Vigor and Porosity for Grapevine

Directory of Open Access Journals (Sweden)

Roberta De Bei

2016-04-01

Full Text Available Leaf area index (LAI and plant area index (PAI are common and important biophysical parameters used to estimate agronomical variables such as canopy growth, light interception and water requirements of plants and trees. LAI can be either measured directly using destructive methods or indirectly using dedicated and expensive instrumentation, both of which require a high level of know-how to operate equipment, handle data and interpret results. Recently, a novel smartphone and tablet PC application, VitiCanopy, has been developed by a group of researchers from the University of Adelaide and the University of Melbourne, to estimate grapevine canopy size (LAI and PAI, canopy porosity, canopy cover and clumping index. VitiCanopy uses the front in-built camera and GPS capabilities of smartphones and tablet PCs to automatically implement image analysis algorithms on upward-looking digital images of canopies and calculates relevant canopy architecture parameters. Results from the use of VitiCanopy on grapevines correlated well with traditional methods to measure/estimate LAI and PAI. Like other indirect methods, VitiCanopy does not distinguish between leaf and non-leaf material but it was demonstrated that the non-leaf material could be extracted from the results, if needed, to increase accuracy. VitiCanopy is an accurate, user-friendly and free alternative to current techniques used by scientists and viticultural practitioners to assess the dynamics of LAI, PAI and canopy architecture in vineyards, and has the potential to be adapted for use on other plants.

Estudo das isotermas de equilíbrio do farelo de soja Study of the equilibrium isotherms of soybean meal

Directory of Open Access Journals (Sweden)

Gianini R. Luz

2006-06-01

Full Text Available Este trabalho tem como objetivo estudar o comportamento das isotermas de equilíbrio do farelo de soja. Para tanto, foram realizados experimentos utilizando-se o método estático com soluções salinas saturadas a 50, 60 e 70ºC. Os dados obtidos foram ajustados às equações existentes na literatura, utilizando-se o software Statistica 6.0®. Os resultados indicam que a temperatura não exerce influência significativa sobre os valores da umidade de equilíbrio do farelo de soja na faixa de condições experimentais exploradas e que os modelos de HALSEY e de LUIKOV podem ser utilizados para prever a umidade de equilíbrio do farelo soja.This work has as aim to study the behavior of the isotherms of the soybean meal. Therefore, experiments had been carried out by using the static method with saturated salt solution at 50, 60 and 70ºC. The data had been adjusted to the equations of the literature, using Statistica software 6.0®. The results indicated that the temperature does not affect significantly the moisture equilibrium values of the soybean meal in the range of temperatures studied and that the LUIKOV and the HALSEY models can be used to foresee the moisture equilibrium of the soybean meal.

Comparison of odor-active compounds in grapes and wines from vitis vinifera and non-foxy American grape species.

Science.gov (United States)

Sun, Qun; Gates, Matthew J; Lavin, Edward H; Acree, Terry E; Sacks, Gavin L

2011-10-12

Native American grape (Vitis) species have many desirable properties for winegrape breeding, but hybrids of these non-vinifera wild grapes with Vitis vinifera often have undesirable aromas. Other than the foxy-smelling compounds in Vitis labrusca and Vitis rotundifolia , the aromas inherent to American Vitis species are not well characterized. In this paper, the key odorants in wine produced from the American grape species Vitis riparia and Vitis cinerea were characterized in comparison to wine produced from European winegrapes (V. vinifera). Volatile compounds were extracted by solid-phase microextraction (SPME) and identified by gas chromatography-olfactometry/mass spectrometry (GC-O/MS). On the basis of flavor dilution values, most grape-derived compounds with fruity and floral aromas were at similar potency, but non-vinifera wines had higher concentrations of odorants with vegetative and earthy aromas: eugenol, cis-3-hexenol, 1,8-cineole, 3-isobutyl-2-methoxypyrazine (IBMP), and 3-isopropyl-2-methoxypyrazine (IPMP). Elevated concentrations of these compounds in non-vinifera wines were confirmed by quantitative GC-MS. Concentrations of IBMP and IPMP were well above sensory threshold in both non-vinifera wines. In a follow-up study, IBMP and IPMP were surveyed in 31 accessions of V. riparia, V. rupestris, and V. cinerea. Some accessions had concentrations of >350 pg/g IBMP or >30 pg/g IPMP, well above concentrations reported in previous studies of harvest-ripe vinifera grapes. Methyl anthranilate and 2-aminoacetophenone, key odorants responsible for the foxiness of V. labrusca grapes, were undetectable in both the V. riparia and V. cinerea wines (<10 μg/L).

Grapevine (Vitis vinifera L.).

Science.gov (United States)

Torregrosa, Laurent; Vialet, Sandrine; Adivèze, Angélique; Iocco-Corena, Pat; Thomas, Mark R

2015-01-01

Grapevine (Vitis) is considered to be one of the major fruit crops in the world based on hectares cultivated and economic value. Grapes are used not only for wine but also for fresh fruit, dried fruit, and juice production. Wine is by far the major product of grapes, and the focus of this chapter is on wine grape cultivars. Grapevine cultivars of Vitis vinifera L. have a reputation for producing premium quality wines. These premium quality wines are produced from a small number of cultivars that enjoy a high level of consumer acceptance and are firmly entrenched in the market place because of varietal name branding and the association of certain wine styles and regions with specific cultivars. In light of this situation, grapevine improvement by a transgenic approach is attractive when compared to a classical breeding approach. The transfer of individual traits as single genes with a minimum disruption to the original genome would leave the traditional characteristics of the cultivar intact. However, a reliable transformation system is required for a successful transgenic approach to grapevine improvement. There are three criteria for achieving an efficient Agrobacterium-mediated transformation system: (1) the production of highly regenerative transformable tissue, (2) optimal cocultivation conditions for both grapevine tissue and Agrobacterium, and (3) an efficient selection regime for transgenic plant regeneration. In this chapter, we describe a grapevine transformation system that meets these criteria. We also describe a protocol for the production of transformed roots suitable for functional gene studies and for the production of semi-transgenic grafted plants.

Os testes de equilíbrio Alcance Funcional e “Timed Up and Go” e o risco de quedas em idosos

Directory of Open Access Journals (Sweden)

Maria Paula Silva Campos

2014-03-01

Full Text Available O risco de quedas aumenta com o envelhecimento, tornando-se problema de saúde pública. O estudo atual teve como objetivo identificar os fatores de risco de quedas em indivíduos idosos e analisar se os testes de equilíbrio, Teste de Alcance Funcional (TAF e “Timed Up and Go” (TUG, identificam aqueles com maior susceptibilidade a cair. Realizou-se estudo prospectivo, transversal e observacional, com 155 idosos (≥60 anos, sendo 131 mulheres e 24 homens, atendidos em hospital público de Brasília (DF. Estes idosos foram divididos em dois grupos: grupo 1, com os que referiram queda nos últimos 12 meses; e grupo 2, com aqueles que negaram queda no mesmo período. Foram aplicados, além de um questionário para identificar os fatores de risco de quedas, dois testes para avaliar o equilíbrio (TAF e TUG. A idade média dos idosos estudados foi de 70,65 ± 7,52 anos, sendo que 38,7% deles relataram queda nos últimos 12 meses. A incidência de quedas foi significativamente maior no sexo feminino, nos que relataram medo de queda e nos que usavam polifarmácia. Na análise multivariada, a polifarmácia foi o único fator de risco independente associado ao evento quedas. Os testes de equilíbrio TAF e TUG não se correlacionaram significativamente com a ocorrência de quedas. Concluiu-se que a polifarmácia foi o único fator de risco independente associado a quedas, e que os testes de equilíbrio TAF e TUG não identificaram os idosos com maior susceptibilidade a cair.

Efeito da preensão manual sobre o equilíbrio de judocas Effect of hand grip on the balance of judokas

Directory of Open Access Journals (Sweden)

Jonathan Ache Dias

2011-06-01

Full Text Available O objetivo deste estudo foi verificar se existe efeito da preensão manual máxima (o ato de realizar ou não a preensão sobre o controle do equilíbrio de judocas em postura restrita, além de verificar se existe correlação entre a força de preensão manual (FPM e o controle do equilíbrio. Foram avaliados sete judocas com um dinamômetro e uma plataforma estabilométrica sendo mensuradas, concomitantemente, a FPM e o centro de pressão (CP. Foi verificado que até 80% da variabilidade do CP pode ser atrelada a preensão manual indicando que a mesma gera perturbações no controle do equilíbrio. Entretanto, foram encontradas correlações (r = 0,348 até 0,816 entre a FPM e o deslocamento do CP. Com isso pode-se concluir que, apesar da preensão manual gerar perturbações no equilíbrio, seu comportamento parece estar relacionado com os movimentos do corpo realizados para manter o equilíbrio, indicando uma possível correlação entre esses fenômenos.The purpose of this study was to verify if there is an effect of maximum hand grip (the act of performing or not the hand grip on the balance control of judokas in a restrict posture, and also to verify if there is a correlation between the hand grip strength (HGS and the balance control. Seven judokas were evaluated with a dynamometer and a stabilometric force platform, being measured, at the same time, the HGS and the center of pressure (COP. It was found that up to 80% of the COP variability was related to the hand grip demonstrating that it generates perturbations to the balance control. However, It was found correlations (r = 0,348 to 0,816 between de HGS and de COP displacement. With that, it can be concluded that, despite the hand grip generating perturbation on the balance, its behavior appears to be related to the body movements performed to sustain balance, indicating a possible correlation between this phenomenons.

Determinação de dados experimentais de equilíbrio líquido-líquido para sistemas contendo éster metílico de ácidos graxos, glicerina bruta e metanol

OpenAIRE

Bastiani, Daniele de

2014-01-01

Dissertação (Mestrado) - Universidade Federal de Santa Catarina, Centro Tecnológico, Programa de Pós-Graduação em Engenharia de Alimentos, Florianópolis, 2014 Dados de equilíbrio líquido-líquido são fundamentais para predizer o comportamento de misturas. Com a inserção de combustíveis alternativos no mercado, como o biodiesel, estudos de equilíbrio nessa área têm aumentado, possibilitando melhorias na produção e purificação do mesmo. Recentes estudos apresentam dados de equilíbrio para sis...

Impacto do equilíbrio espinopélvico nos resultados clínicos e funcionais após artrodese instrumentada em doentes com espondilolistese degenerativa

Directory of Open Access Journals (Sweden)

Filipe Rodrigues Duarte

2013-01-01

Full Text Available OBJETIVO: Garantir o equilíbrio sagital e pélvico depois de correção cirúrgica de deformidade lombar tem sido alvo de atenção crescente na literatura. Estudos recentes demonstraram uma relação entre o equilíbrio espinopélvico e o resultado pós-operatório. Com a progressão da deformidade degenerativa, as alterações correspondentes dos parâmetros pélvicos são evidentes. Assim, os autores pretendem estudar a influência do equilíbrio espinopélvico nos resultados clínicos e funcionais após cirurgia de espondilolistese degenerativa (ED. MÉTODOS: Estudo retrospectivo. Amostra com 29 indivíduos com ED submetidos a descompressão e artrodese instrumentada entre 2006 e 2010. Média de idade 65,45 (± 8,15 anos. 20 mulheres e 9 homens. Acompanhamento médio - 2,1 anos. Avaliação clínica, funcional e radiológica. VAS, satisfação global, Oswestry Disability Index modificado. Cálculo de incidência pélvica, inclinação sacral, versão pélvica e lordose lombar. Dois grupos de estudo: A (n = 14: sem melhoria da versão pélvica (aumentada ou inalterada no pós-operatorio. B (n = 15: com melhoria da versão pélvica (diminuída. Estudo estatístico com SPSS®. RESULTADOS: A cirurgia é benéfica, reduz significativamente a dor e melhora a qualidade de vida. Os pacientes do grupo B (restituição do balanço original apresentam melhores resultados clínicos e funcionais (p < 0,05 e valores superiores de incidência pélvica relativamente ao grupo A. CONCLUSÃO: Este trabalho confirma a importância do equilíbrio espinopélvico como objetivo no planeamento cirúrgico e que a restituição do equilíbrio original parece obter melhores resultados.

Phenological behaviour of Vitis rotundifolia cultivars in Pinhais – PR / Comportamento fenológico de cultivares de Vitis rotundifolia em Pinhais – PR

Directory of Open Access Journals (Sweden)

Flávio Zanette

2010-04-01

Full Text Available The aim of this work was to characterize the phenological cycle of nine Vitis rotundifolia cultivars during the 2004/2005 season. The cultivars were Bontiful, Creek, Dixie, Magnolia, Magoon, Noble, Regale, Roanoke e Topsail. The experiment was performed on an orchard implanted in 1999 at the Canguiri Experimental Station of the Federal University of Paraná in Pinhais-PR. The phenology of two adult plants of each cultivar was monitored. The recorded phenological stages were: 1 Dormant bud; 2 Swollen bud; 3 Wool bud; 4 Green tip; 5 Bud burst (first leaf appearance; 6 Two to three leaves unfolded; 7 Five to six leaves unfolded; 8 Fully developed inflorescence; 9 Trace bloom (flowerhoods detached; 10 Full flowering (50% of the flowerhoods fallen; 11 Fruit set; 12 Groat-sized berries; 13 Pea-sized berries; 14 50% filled berries (beginning to touch berries; 15 Final size; 16 Color change; 17 Berries ripe for harvest; and 18 End of harvesting. A very long phenological cycle was observed when compared to species such as Vitis vinifera and Vitis labrusca. These evaluations allowed us to conclude that: a there is no difference in the phenological cycle periods between bronze and dark skinned cultivars; b cultivars presented desuniform wool bud to full flowering cycle, ranging from 25 days (‘Regale’ to 81 days (‘Creek’; c the cultivar Regale presented the longest cycle (203 days from full flowering to harvest and the cultivar Creek the shortest (136 days. The evaluated cultivars additionally presented desuniform ripening and a tendency to drop berries. O objetivo foi caracterizar o ciclo fenológico de nove cultivares de Vitis rotundifolia avaliadas na safra de 2004/2005. As cultivares estudadas foram as seguintes: Bontiful, Creek, Dixie, Magnolia, Magoon, Noble, Regale, Roanoke e Topsail. O trabalho foi realizado em um pomar do Setor de Fruticultura da Estação Experimental do Canguiri da Universidade Federal do Paraná, em Pinhais-PR, sendo que

Temperature dependence of refractive index and of electrical impedance of grape seed (Vitis vinifera, Vitis labrusca oils extracted by Soxhlet and mechanical pressing

Directory of Open Access Journals (Sweden)

Vieira, D. S.

2015-09-01

Full Text Available In this report, the temperature dependence of the refractive index and electric impedance of vegetable oil grape seeds extracted from Vitis vinifera (v. Cabernet and Vitis labrusca (v. Bordo are investigated by means of experimental techniques. The seeds were collected from wineries located in two cities in the south of Brazil. In both extraction methods, the seeds were dried at 40.0 °C and at 80.0 °C, respectively, before the oil extraction. From optical microscopy and refractometry results, one can see that the grape seed oil extracted by mechanical pressing shows a linear dependence between the refractive index and temperature and has no birefringent residues. From the fitting of the EIS (Electrical Impedance Spectroscopy data, an equivalent electric circuit composed of a parallel RC in series with a resistor is proposed. The circuit model is in good agreement with the experimental data and provides the electrical permittivity of the vegetable oils investigated.Se investiga mediante técnicas experimentales la dependencia del índice de refracción y la impedancia eléctrica de aceites vegetales extraídos de semillas de uva Vitis vinifera (v. Cabernet y Vitis labrusca (v. Bordo. Las semillas fueron recolectadas de bodegas situadas en dos ciudades al sur de Brasil. Antes de la extracción del aceite, mediante dos métodos de extracción, las semillas fueron secadas a 40,0 °C y 80,0 °C. De los resultados de refractometria y microscopía óptica, se comprueba que el aceite de semilla de uva extraída por prensado mecánico obedece a una relación lineal del índice de refracción con la temperatura y no presentan resíduos birrefringentes. Con los datos de impedancia eléctrica, se propone un circuito eléctrico equivalente formado por una resistencia y un condensador en paralelo, a su vez ligado a otra resistencia en serie. El modelo de circuito tiene una alta correlación con los datos experimentales y permite obtener la constante diel

A phylogenetic analysis of the grape genus (Vitis L.) reveals broad reticulation and concurrent diversification during neogene and quaternary climate change.

Science.gov (United States)

Wan, Yizhen; Schwaninger, Heidi R; Baldo, Angela M; Labate, Joanne A; Zhong, Gan-Yuan; Simon, Charles J

2013-07-05

Grapes are one of the most economically important fruit crops. There are about 60 species in the genus Vitis. The phylogenetic relationships among these species are of keen interest for the conservation and use of this germplasm. We selected 309 accessions from 48 Vitis species,varieties, and outgroups, examined ~11 kb (~3.4 Mb total) of aligned nuclear DNA sequences from 27 unlinked genes in a phylogenetic context, and estimated divergence times based on fossil calibrations. Vitis formed a strongly supported clade. There was substantial support for species and less for the higher-level groupings (series). As estimated from extant taxa, the crown age of Vitis was 28 Ma and the divergence of subgenera (Vitis and Muscadinia) occurred at ~18 Ma. Higher clades in subgenus Vitis diverged 16 - 5 Ma with overlapping confidence intervals, and ongoing divergence formed extant species at 12 - 1.3 Ma. Several species had species-specific SNPs. NeighborNet analysis showed extensive reticulation at the core of subgenus Vitis representing the deeper nodes, with extensive reticulation radiating outward. Fitch Parsimony identified North America as the origin of the most recent common ancestor of extant Vitis species. Phylogenetic patterns suggested origination of the genus in North America, fragmentation of an ancestral range during the Miocene, formation of extant species in the late Miocene-Pleistocene, and differentiation of species in the context of Pliocene-Quaternary tectonic and climatic change. Nuclear SNPs effectively resolved relationships at and below the species level in grapes and rectified several misclassifications of accessions in the repositories. Our results challenge current higher-level classifications, reveal the abundance of genetic diversity in the genus that is potentially available for crop improvement, and provide a valuable resource for species delineation, germplasm conservation and use.

Tempo de reação eletromiográfica em idosas caidoras e não-caidoras após desequilíbrio postural

Directory of Open Access Journals (Sweden)

Ligia Cristiane Santos Fonseca

2014-03-01

O tempo de reação eletromiográfica (TRE reflete a magnitude e a velocidade com que os músculos são ativados para realizar movimentos, evitar lesões ou posicionar uma articulação e pode ser avaliado após uma perturbação externa para análise do desempenho do controle postural e relacioná-lo com a possibilidade de quedas em idosos. O objetivo do estudo foi verificar o TRE dos músculos oblíquo interno (OI, reto femoral (RF, vasto lateral (VL, tibial anterior (TA, multífido (MU, glúteo máximo (GM, bíceps femoral (BF e gastrocnêmio lateral (GL em situações de perturbação do equilíbrio em idosos com e sem histórico de quedas. Para isso, foram avaliadas vinte e nove mulheres com 60 anos ou mais, fisicamente ativas e não-institucionalizadas e separadas em dois grupos de acordo com o relato de quedas nos 12 meses pregressos ao estudo: Grupo de Idosas Caidoras (GIC (n=13; 72,4 ± 8,0 anos e Grupo de Idosas Não-Caidoras (GINC (n=16; 67,8 ± 6,8 anos. O TRE dos músculos avaliados durante o teste de desequilíbrio postural anterior e posterior não foram significativamente diferentes entre os grupos. Os resultados sugerem que a ativação muscular dos músculos avaliados, tanto durante o desequilíbrio anterior quanto no desequilíbrio posterior, não podem ser considerados um fator determinante para quedas.

Comparative antistress effect of Vitis vinifera and Withania somnifera using unpredictable chronic mild stress model in rats

Directory of Open Access Journals (Sweden)

Manish Pal Singh

2016-07-01

Full Text Available Introduction: The human society has become complex. However, our physiological responses designed to cope with the ever-increasing adverse situations have not evolved appreciably during the past thousand years. The failure of successful adaptation during stressful situations has resulted in stress-related illnesses. Methods: The objective of the present study was to carry out a comparative assessment of anti-stress effect of Vitis vinifera and Withania somnifera using unpredictable chronic mild stress model in rats. Long-term exposure to multiple stressors can cause depression. The unpredictable chronic administration of various mild stresses, a procedure known as “unpredictable chronic mild stress”, is one of the best-validated rodent models to study stress in animals, for its good etiological and predictive validity. Result: Diazepam, Withania somnifera, Vitis vinifera administration dose dependently reversed the increase in immobility period in stressed rats. In the study of locomotion activity of rats in elevated plus maze apparatus, Stress treated control group rats showed less no of entries in open arm and also less time spent in open arm. Vitis vinifera treated (p<0.0001, Withania somnifera treated (p<0.0001 and Diazepam treated group showed (p<0.0001 no. of entries in open arms which were more than control group and stressed groups. Stressed group produce less average time spent in open arm as compared to treatment groups as Withania somnifera (p<0.05, Vitis vinifera and diazepam. Withania somnifera group showed significant antistress locomotry behaviour in rats. Administration of Vitis vinifera, Withania somnifera and diazepam during stress period restored the ambulatory behaviour of the rats which can be correlated with restoration of plasma corticosterone level. Finally, the results of the present study justified that Withania somnifera, Vitis vinifera and diazepam exhibited significant antistress activity in rats.

Effectiveness of a physiotherapeutic protocol for equilibrium with institutionalized elderly people Eficácia de um protocolo fisioterapêutico para equilíbrio em idosos institucionalizados

Directory of Open Access Journals (Sweden)

Mariane Negrão Serra dos Santos Lopes

2010-12-01

Full Text Available Equilibrium consists of keeping the gravity center within a support basis which provides more stability in the body segments during static and dynamic situations. The maintenance of body equilibrium in space is a complex phenomenon that depends on several structures, such as: motor system, proprioceptive sensitivity, vestibular system, visual system, cerebellum, among others. The fall is one of the main consequences of lack of equilibrium in the elderly. It is known that the physical therapy and the physical activity are important tools to prevent and/or reduce these deficits. The objective of this work was to verify the effectiveness of a physiotherapeutic program for institutionalized elderly people. Materials and methods: This is a prospective study of cohort, with seven institutionalized elderly people. The elderly who walked without orthosis, were obedient and understood verbal commands, were included. An initial evaluation of the respiratory, neurological and orthopedic systems was used, together with Tinetti’s Equilibrium and Mobility Scale. The treatment protocol consisted of 16 therapies. In each session, the warm up, stretching, strengthening, equilibrium training, walk training and relaxation were performed twice a week, with a 50-minute length each, for two months. The data were statistically evaluated through Wilcoxon test with a significance of p=0.03. Results showed an improvement in the equilibrium of the studied group. It will be suggested that the protocol used be implemented in the institution where it was conducted, what could reduce the risks inherent in the equilibrium deficit in the elderly. O equilíbrio consiste em manter o centro de gravidade dentro de uma base de suporte que proporcione maior estabilidade nos segmentos corporais durante situações estáticas e dinâmicas. A manutenção do equilíbrio do corpo no espaço é um fenômeno complexo que depende da integração de várias estruturas como: sistema motor

Identification of Agrobacterium vitis as a causal agent of grapevine crown gall in Serbia

Directory of Open Access Journals (Sweden)

Kuzmanović N.

2012-01-01

Full Text Available In 2010, a serious outbreak of crown gall disease was observed on grapevines (Vitis vinifera L. cv. Cabernet Sauvignon in several commercial vineyards located in the Vojvodina province, Serbia. Bacteria were isolated from the young tumor tissue on nonselective YMA medium and five representative strains were selected for further identification. Tumorigenic (Ti plasmid was detected in all strains by PCR using primers designed to amplify the virC pathogenicity gene, producing a 414-bp PCR product. The strains were identified as Agrobacterium vitis using differential physiological and biochemical tests, and a multiplex PCR assay targeting 23S rRNA gene sequences. In the pathogenicity assay, all strains induced characteristic symptoms on inoculated tomato and grapevine plants. They were less virulent on tomato plants in comparison to the reference strains of A. tumefaciens and A. vitis. [Ministarstva nauke Republike Srbije, br. III46008: Development of integrated management of harmful organisms in plant production in order to overcome resistance and to improve food quality and safety

Por uma pedagogia do equilíbrio For a pedagogy of balance

Directory of Open Access Journals (Sweden)

Kelley Cristine Gonçalves Dias Gasque

2008-04-01

Full Text Available Neste artigo, discute-se a Pedagogia como a ciência prática que vincula as atividades de ensino e aprendizagem a uma sólida fundamentação científica, explicando e prescrevendo saberes e procedimentos de intervenção e desenvolvimento da Educação. Analisa-se de modo crítico uma visão fisicalista que reduz a Pedagogia a um programa de treinamento técnico sem objeto nem métodos próprios. É apresentada uma nova cosmovisão que reconhece o equilíbrio entre razão e experiência, considerando a importância da experiência na construção de novos conhecimentos, mediante o resgate da evolução histórica do conceito e o seu papel na aprendizagem e, conseqüentemente, na formação dos docentes. Ressalta-se igualmente que a consciência da experiência pode ser uma forma de tornar o ser humano responsável eticamente pelo ciclo de produção científica, pois as modificações ou transformações propiciadas pela ciência ocorrem em um mundo inseparável do ser no qual se insere a mente. Por isso, a discussão sobre experiência envolve, também, além dos aspectos cognitivos, a dimensão ética da ação humana. Nesse contexto, emerge a Pedagogia do Equilíbrio, que se constitui na simbiose das categorias complexas da totalidade, do movimento, da tensão e da superação na Educação. Conclui-se que a Pedagogia do Equilíbrio se funda não apenas na certeza de premissas e normas da reflexão racional ou da teorização científica, mas em seu equilíbrio com outros inúmeros fatores fundados em valores e princípios éticos que permitem ao ser humano empreender sua trajetória de conscientização e emancipação, visando a um mundo 'inédito mas viável', inspirado na utopia freiriana.We discuss in this article Pedagogy as a practical science that links the teaching and learning activities to a solid scientific foundation explaining and prescribing knowledges and procedures for intervening in, and developing, education. We analyze

Comparison of Insecticide Susceptibilities of Empoasca vitis (Hemiptera: Cicadellidae) from Three Main Tea-Growing Regions in China.

Science.gov (United States)

Wei, Qi; Yu, Hua-Yang; Niu, Chun-Dong; Yao, Rong; Wu, Shun-Fan; Chen, Zhuo; Gao, Cong-Fen

2015-06-01

Empoasca vitis (Göthe) is an important insect pest in tea-growing areas of China, and chemical control is the main tactic for the management of this pest. Due to the pressure of increasing insecticide resistance and more stringent food safety regulations, development of sound IPM strategies for E. vitis is an urgent matter. This study comparatively evaluated four field populations of E. vitis from three different tea-growing regions in China for their susceptibilities to eight insecticides using a simple leaf-dip methodology. E. vitis was found to be most sensitive to indoxacarb (LC505 mg/liter) and sophocarpidine (LC50>95 mg/liter, a botanical pesticide) regardless of populations. Population (geographical) variations were higher for indoxacarb and imidacloprid than other compounds. Judging by the 95% fiducial limits of LC50 values, all populations had similar susceptibilities to chlorfenapyr, bifenthrin, and acetamiprid or imidacloprid. Correlation analysis suggested that chlorfenapyr and indoxacarb or isoprocarb may have a high risk of cross resistance. Considering potency (LC50) and maximum residual levels, chlorfenapyr and bifenthrin are good insecticide options followed by acetamiprid and indoxacarb. These results provide valuable information to intelligently select insecticides for IPM programs that are efficacious against E. vitis while also managing insecticide resistance and maximum residual levels for tea production in China. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Flowering in Vitis: Conversion of tendrils into inflorescences and bunches of grapes.

Science.gov (United States)

Srinivasan, C; Mullins, M G

1979-01-01

Inflorescences and fruits with viable seeds were produced in place of tendrils in plants of Vitis vinifera L. cv. "Muscat of Alexandria" and in a staminate hybrid grapevine (Vitis vinifera x V. rupestris Scheele) following repeated applications of 10-20 μl of 50-200 μM 6-(benzylamino)-9-(2-tetrahydropyranyl)-9H-purine (PBA) to apices. Young leaves, shoot tips and axillary buds were removed before the PBA treatments were commenced. The number and weight of berries produced by inflorescences derived from tendrils was closely correlated with the number and area of leaves retained. When application of PBA was continued after floral initiation there was formation of fused flowers and cleistogamous pollination.

H-1-NMR Fingerprinting of Vaccinium vitis-idaea Flavonol Glycosides

NARCIS (Netherlands)

Riihinen, K.R.; Mihaleva, V.V.; Gödecke, T.; Soininen, P.; Laatikainen, R.; Vervoort, J.; Lankin, D.C.; Pauli, G.F.

2013-01-01

Introduction - The fruits of Vaccinium vitis-idaea L. are a valuable source of biologically active flavonoid derivatives. For studies focused on the purification of its quercetin glycosides (QGs) and related glycosides from plants and for the purpose of biological studies, the availability of

Efeitos de diferentes modalidades de treinamento físico e do hábito de caminhar sobre o equilíbrio funcional de idosos

Directory of Open Access Journals (Sweden)

Carla Helrigle

Full Text Available INTRODUÇÃO: As alterações do equilíbrio corporal estão entre as queixas mais comuns da população idosa e constituem um problema médico de grande relevância. OBJETIVO: Comparar a influência da prática de diferentes modalidades de treinamento físico e do hábito de caminhar sobre o equilíbrio funcional de idosos residentes em Jataí, Goiás. MATERIAIS E MÉTODOS: Fizeram parte desta pesquisa 135 idosos divididos em cinco grupos de acordo com o hábito de caminhar e com a modalidade de treinamento físico praticada: sedentários inativos (n = 39, sedentários ativos (n = 37, hidroginástica (n = 25, musculação (n = 10 e caminhada (n = 24. O equilíbrio funcional foi avaliado a partir do resultado atingido na Escala de Equilíbrio de Berg (EEB. Os dados foram expressos em valores de média e desvio do erro padrão e comparados entre si por meio da Análise de Variância One-Way seguida do teste post-hoc Tukey (p < 0,05, utilizando-se o software SPSS 12.0. RESULTADOS: Os idosos sedentários inativos e ativos atingiram valores de 48,89 ± 0,87 e 52,45 ± 0,47, respectivamente na EEB. Os idosos treinados praticantes de hidroginástica obtiveram escore de 54,04 ± 0,33, os praticantes de musculação 53 ± 0,52 e os praticantes de caminhada de 53,45 ± 0,51. A análise estatística mostrou que tanto os indivíduos sedentários ativos quanto os idosos treinados obtiveram maior valor atingido na EEB em comparação com os sedentários inativos (p < 0,05. Não foram observadas diferenças estatísticas entre os diferentes grupos de idosos treinados e nem destes com o grupo de idosos sedentários ativos. CONCLUSÃO: Tanto o hábito de caminhar quanto a prática regular da caminhada, da musculação e da hidroginástica por mais de seis meses, aumentam o equilíbrio funcional dos idosos.

Tea green leafhopper, Empoasca vitis, chooses suitable host plants by detecting the emission level of (3Z)-hexenyl acetate.

Science.gov (United States)

Xin, Z-J; Li, X-W; Bian, L; Sun, X-L

2017-02-01

Green leaf volatiles (GLVs) have been reported to play an important role in the host-locating behavior of several folivores that feed on angiosperms. However, next to nothing is known about how the green leafhopper, Empoasca vitis, chooses suitable host plants and whether it detects differing emission levels of GLV components among genetically different tea varieties. Here we found that the constitutive transcript level of the tea hydroperoxide lyase (HPL) gene CsiHPL1, and the amounts of (Z)-3-hexenyl acetate and of total GLV components are significantly higher in tea varieties that are susceptible to E. vitis (Enbiao (EB) and Banzhuyuan (BZY)) than in varieties that are resistant to E. vitis (Changxingzisun (CX) and Juyan (JY)). Moreover, the results of a Y-tube olfactometer bioassay and an oviposition preference assay suggest that (Z)-3-hexenyl acetate and (Z)-3-hexenol offer host and oviposition cues for E. vitis female adults. Taken together, the two GLV components, (Z)-3-hexenol and especially (Z)-3-hexenyl acetate, provide a plausible mechanism by which tea green leafhoppers distinguish among resistant and susceptible varieties. Future research should be carried out to obtain the threshold of the above indices and then assess their reasonableness. The development of practical detection indices would greatly improve our ability to screen and develop tea varieties that are resistant to E. vitis.

Desequilíbrio e co-regulação em situação de ensino-aprendizagem: análise segundo o conceito de ação comunicativa (Habermas

Directory of Open Access Journals (Sweden)

Simão Lívia Mathias

2000-01-01

Full Text Available As situações de ensino-aprendizagem, tomadas da perspectiva de desenvolvimento implicam um entrejogo de ações verbais dos atores, dirigidas tanto às ações do outro ator como ao objeto de conhecimento. Nesta perspectiva são fundamentais o desequilíbrio e a co-regulação da interação, bem como a emergência de novos conhecimentos. O objetivo deste trabalho é explorar o conceito de ação comunicativa (Habermas para descrever o desequilíbrio e a co-regulação cognitivas em uma situação de ensino-aprendizagem. Deste referencial, analisou-se um diálogo professora - aluna, buscando-se caracterizar cada ação verbal do diálogo de acordo com Habermas. A seguir, relacionou-se cada ação comunicativa com sua conseqüência para a interação, em termos de desequilíbrio ou co-regulação. Esta análise permitiu descrever a dinâmica das ações comunicativas que, através de sucessivos desequilíbrios e co-regulações, criaram condições para restruturação do campo semântico nos atores e para emergência de novos conhecimentos sobre o objeto.

O equilíbrio do capital e a sua intensidade: pontos da filosofia neopatrimonialista

Directory of Open Access Journals (Sweden)

Rodrigo Antônio Chaves da Silva

2007-11-01

Full Text Available O equilíbrio do capital é um estado funcional, ou de movimento das partes patrimoniais em prol dos lucros ou de alcance dos objetivos empresariais. A relatividade das funções sistemáticas do patrimônio aponta a razão da intensidade do equilíbrio, o grau em que o mesmo consegue se manter, isto é, a sua vitalidade no tempo de sua existência na continuidade aziendal. O objetivo do presente estudo, em caráter intervencionista, é mostrar os efeitos desta relação, de modo que uma análise avançada garanta profícua e zelosa consultoria contábil para uma administração patrimonial segura e coerente. O artigo discute este problema, que traduz uma das partes da teoria do Neopatrimonialismo Filosófico e que agrega valor à proposta do Neopatrimonialismo. The equilibrium of the capital is a state by function, or of movement fromthe parts of patrimonies with objective us profits, or reach by undertakerintection. The relativity of the function sistematicys by patrimonydesmontrate the reason by equilibrium intensity, of dimension to maintainhimself, of vitality by time patrimony of social existence. The objective thisstudy by character of intervetion is to desmontrate that efects this relations,of the analysis advance guarantee a useful and zealous orientationaccountants of the a management patrimony coherent and security. Thearticle discuss this problem that translate a by parts from the teory by Neopatrimonial philosophic by aggregate value by proposal of doctrine Neopatrimonial.

Genetic relatedness and recombination analysis of Allorhizobium vitis strains associated with grapevine crown gall outbreaks in Europe.

Science.gov (United States)

Kuzmanović, N; Biondi, E; Bertaccini, A; Obradović, A

2015-09-01

To analyse genetic diversity and epidemiological relationships among 54 strains of Allorhizobium vitis isolated in Europe during an 8-year period and to assess the relative contribution of mutation and recombination in shaping their diversity. By using random amplified polymorphic DNA (RAPD) PCR, strains studied were distributed into 12 genetic groups. Sequence analysis of dnaK, gyrB and recA housekeeping genes was employed to characterize a representative subcollection of 28 strains. A total of 15 different haplotypes were found. Nucleotide sequence analysis suggested the presence of recombination events in A. vitis, particularly affecting dnaK locus. Although prevalence of mutation over recombination was found, impact of recombination was about two times greater than mutation in the evolution of the housekeeping genes analysed. The RAPD analysis indicated high degree of genetic diversity among the strains. However, the most abundant RAPD group was composed of 35 strains, which could lead to the conclusion that they share a common origin and were distributed by the movement of infected grapevine planting material as a most common way of crossing long distances. Furthermore, it seems that recombination is acting as an important driving force in the evolution of A. vitis. As no substantial evidence of recombination was detected within recA gene fragment, this phylogenetic marker could be reliable to characterize phylogenetic relationships among A. vitis strains. We demonstrated clear epidemiological relationship between majority of strains studied, suggesting a need for more stringent phytosanitary measures in international trade. Moreover, this is the first study to report recombination in A. vitis. © 2015 The Society for Applied Microbiology.

Comparação entre testes de equilíbrio de campo e plataforma de força Comparison between field balance tests and force platform

Directory of Open Access Journals (Sweden)

Renata Alyne Czajka Sabchuk

2012-12-01

Full Text Available Vários testes de equilíbrio têm sido utilizados para identificar o controle postural e o risco de quedas em idosos. Entretanto, não se sabe quais testes refletem mais efetivamente a capacidade em manter o equilíbrio. O objetivo deste estudo foi comparar um conjunto de testes de campo de equilíbrio (TC com os testes de posturografia em plataforma de força (PF e verificar se esses testes são capazes de discriminar diferenças no equilíbrio entre jovens e idosos. Participaram do estudo 21 jovens (21,7 ± 2,0 anos e 18 idosos (69,3 ± 7,0 anos de ambos os gêneros. Os TC foram: escala de equilíbrio de Berg (BBS, escala de equilíbrio orientado pelo desempenho, (POMA, alcance funcional (AF e levantar e caminhar cronometrado (TUGT. As variáveis analisadas na PF foram: amplitude de deslocamento nas direções anteroposterior (AMP-AP e médio-lateral (AMP-ML e trajetória do centro de pressão (TRAJ-CP. Os sujeitos foram avaliados em cinco condições durante 60s cada. Uma ANOVA one-way foi aplicada para determinar diferenças nos testes de equilíbrio entre grupos (jovens x idosos. Além disso, o teste de correlação de Spearman foi aplicado para identificar a associação entre os TC e PF. Os TC foram capazes de diferenciar jovens de idosos (p Several balance tests have been used to identify postural control and the risk of falls in the elderly. However, it is not known which tests better reflect effectively the ability to maintain balance. The objective of this study was to compare a number of field tests (FT designed to determine balance with stabilometric tests using force platforms (FP to determine whether these tests are able to discriminate differences in balance between young and older adults. Twenty-one young (21.7±2.0 years and 18 older adults (69.3±7.0 years of both genders volunteered to participate in the study. The field tests were: Berg Balance Scale (BBS, Performance Oriented Mobility Assessment (POMA, Functional Reach (FR

Equilíbrio estático da criança com baixa visão por meio de parâmetros estabilométricos

Directory of Open Access Journals (Sweden)

Márcio Rodrigues de Matos

Full Text Available INTRODUÇÃO: A visão é considerada um dos mais importantes meios de captação das informações do ambiente, sendo fundamental para o processo de desenvolvimento da criança. OBJETIVOS: Cientes da participação da visão na manutenção do equilíbrio e no desenvolvimento biopsicossocial do ser humano e considerando os fatores decorrentes da perda ou limitação visual, esta pesquisa objetivou analisar o equilíbrio em postura ortostática de crianças com baixa visão, de faixa etária de 8 a 11 anos, de ambos os sexos (grupo experimental, comparando com o equilíbrio de crianças normais de ambos os sexos e mesma faixa etária (grupo controle, por meio de parâmetros estabilométricos. MATERIAIS E MÉTODOS: Para a obtenção das oscilações posturais (deslocamento radial e velocidade de deslocamento foi utilizada uma plataforma estabilométrica. RESULTADOS: Considerando-se os índices (média e desvio padrão de deslocamento radial apresentados pelos grupos experimental e controle, observou-se que não houve diferença significante na condição olhos fechados (p > 0,05. Já na condição olhos abertos, houve maior deslocamento radial do grupo experimental em relação ao grupo controle (p < 0,05. Analisando-se os índices (média e desvio padrão de velocidade de deslocamento entre os grupos controle e experimental, observou-se que em ambas as condições (olhos abertos e olhos fechados o grupo controle apresentou maior velocidade de deslocamento quando comparado ao grupo experimental (p < 0,01. CONCLUSÃO: A partir dos resultados apresentados, concluímos que a baixa visão parece influenciar negativamente a estabilidade em postura ortostática, bem como a velocidade de ajuste postural, prejudicando o equilíbrio corporal.

Umidade de equilíbrio de painéis de madeira Equilibrium moisture content of wood panels

Directory of Open Access Journals (Sweden)

Graciane Angélica da Silva

2005-08-01

Full Text Available Este estudo teve como objetivo a determinação da umidade de equilíbrio de painéis de madeira numa câmara de climatização e comparação dos seus valores com os obtidos através da equação de Nelson. O trabalho foi desenvolvido na Unidade Experimental de Produção de Painéis de Madeira da Universidade Federal de Lavras. Foram utilizadas amostras de aglomerado, compensado multilaminado e sarrafeado, chapa dura, OSB (Oriented Strand Board , MDF (Medium Density Fiberboard, HDF (High Density Fiberboard, madeira-cimento e madeira-pl��stico, sendo esses produtos de escala industrial e experimental. As dimensões dos corpos-de-prova foram de 2,60 cm de largura por 2,60 cm de comprimento. As espessuras foram aquelas mais utilizadas comercialmente de cada produto, sendo utilizadas cinco repetições por painel. Os corpos-de-prova foram pesados e levados para uma câmara de climatização, onde foram submetidos a diferentes condições de umidade relativa (90, 80, 70, 60, 50 e 40% e uma temperatura constante de 30 ºC. Determinaram-se a histerese e a umidade de equilíbrio, que variaram de 40 a 90%. Os resultados indicaram que a equação de Nelson se mostrou eficiente na estimativa da umidade de equilíbrio e que não existe em média diferença de histerese entre os produtos estudados, mostrando que todos apresentam a mesma estabilidade dimensional. Observou-se, também, que o revestimento dos painéis não afetou a umidade de equilíbrio.This study aimed at determining the equilibrium moisture content of wood panels in a climatization chamber and comparing the values of equilibrium moisture content found with those given by Nelson's equation. The research was developed at the Experimental Unit of Wood Panel Production of the Universidade Federal de Lavras. Samples of particleboard, plywood, hardboard, OSB (Oriented Strand Board, MDF (Medium Density Fiberboard, HDF (High Density Fiberboard, cement wood and plastic wood were taken both from

Phenolic profiles and antioxidant properties of young wines made from Yan73 (Vitis vinifera L.) and Cabernet Sauvignon (Vitis vinifera L.) grapes treated by 24-epibrassinolide.

Science.gov (United States)

Xu, Fan; Luan, Li-Ying; Zhang, Zhen-Wen; Huo, Shan-Shan; Gao, Xiang; Fang, Yu-Lin; Xi, Zhu-Mei

2014-07-14

The grape berries of two varieties, Yan73 (Vitis vinifera L.) and Cabernet Sauvignon (CS) (Vitis vinifera L.) were treated with 0.40 mg/L 24-epibrassinolide (EBR), 1.00 mg/L brassinazole (Brz), and deionized water (control), at the veraison period. The EBR treatment significantly increased total phenolic content (TPC), total tannin content (TTC) and total anthocyanin content (TAC) of Yan73 and CS wines, whereas Brz treatment decreased TPC, total flavonoid content (TFC), TAC in the two wines. Moreover, the content of most of the phenolic compounds identified by HPLC-DAD/ESI-MS in EBR-treated wines was significantly higher than that in control. The antioxidant capacities, which determined using DPPH, ABTS and HRSA methods, of the wines were increased by EBR treatment as well. There was a good correlation between the antioxidant capacity and phenolic content. The results demonstrated that EBR could enhance the phenolic compounds and antioxidant capacity of Yan73 and CS wines, but the effects may vary by different cultivars.

Diversity of Aspergillus section Nigri on the surface of Vitis labrusca and its hybrid grapes

DEFF Research Database (Denmark)

Ferranti, Larissa de Souza; Fungaro, Maria Helena P; Massi, Fernanda Pelisson

2018-01-01

This study investigated the presence of Aspergillus species belonging to Aspergillus section Nigri on Vitis labrusca and its hybrid grapes grown in Brazil. The ability of the fungi isolates to produce ochratoxin A (OTA) and fumonisin B2 (FB2) as well as the presence of these mycotoxins in the gra......This study investigated the presence of Aspergillus species belonging to Aspergillus section Nigri on Vitis labrusca and its hybrid grapes grown in Brazil. The ability of the fungi isolates to produce ochratoxin A (OTA) and fumonisin B2 (FB2) as well as the presence of these mycotoxins...

Relationship between force platform and two functional tests for measuring balance in the elderly Relação entre plataforma de força e dois testes funcionais para medidas de equilíbrio em idosos

Directory of Open Access Journals (Sweden)

André W. O. Gil

2011-12-01

Full Text Available BACKGROUND: Clinical and laboratory methods have been developed to assess the different dimensions of postural control with the aim to increase the clinical relevance of decisions about balance deficit. Objectives: The purpose of this study was to correlate the force platform measurements with two functional tests used to evaluate balance in elderly. METHODS: A total of 124 physically independent elderly volunteers participated in this study. Subjects performed the following three tests: 1 a traditional functional balance test, named the one-leg standing test, which measures the time in seconds at this position; 2 a functionalagility/dynamic balance test, which quantifies the total time in seconds that a subject canstand up from a chair and move as quickly as possible around two cones; and 3 an unipodal balance test on a force platform. RESULTS: The one-leg standing test yielded a mean of 12 seconds (SD=9 s, while the mean time observed in the functional agility/dynamic balance test was 26 seconds (SD=6 s. The correlations between the balance parameters of force platform and two functional tests varied between -0.28 and 0.20, which shows a weak association between them. CONCLUSIONS: Our results support the idea that these functional tests do not necessarily furnish the same information regarding balance mechanisms as the force platform. This study contributes to the evaluation of balance in elderly and suggests that functional tests should be used with caution especially in regards to the purposes of the research and when conducting clinical assessments of the elderly.CONTEXTUALIZAÇÃO: Diferentes métodos clínicos e laboratoriais têm sido desenvolvidos para avaliar as dimensões do controle postural a fim de aumentar a relevância clínica nas decisões quanto ao déficit de equilíbrio. Objetivos: Correlacionar as medidas de plataforma de força com dois testes funcionais usados para avaliar o equilíbrio em idosos. MÉTODOS: Cento e vinte

Efeitos de metais pesados sobre o controle central do equilíbrio hidroeletrolítico

OpenAIRE

Silva, Emílio de Castro; Fregoneze, Josmara

2002-01-01

p. 116-123 O presente artigo revisa, comenta e sumariza os dados obtidos e publicados anteriormente pelo Laboratório de Neurociências do Instituto de Ciências da Saúde (UFBA) sobre a ação de metais pesados sobre o controle do equilíbrio hidroeletrolítico em animais de laboratório (ratos). Basicamente, os trabalhos do grupo têm demonstrado que a administração central aguda de chumbo e cádmio em ratos provoca um significativo efeito de inibição da ingestão de água (antidips...

Quality of life in patients with vitiligo: a cross-sectional study based on Vitiligo Quality of Life index (VitiQoL).

Science.gov (United States)

Hedayat, Kosar; Karbakhsh, Mojgan; Ghiasi, Maryam; Goodarzi, Azadeh; Fakour, Yousef; Akbari, Zahra; Ghayoumi, Afsaneh; Ghandi, Narges

2016-06-07

Vitiligo is a multi-factorial pigmentary skin disorder. Recently, the importance of emotional and psychological issues is proposed in incidence, progression, relapse and remission of vitiligo. There are limited studies conducted in developing countries, which assess life quality of patients with vitiligo. The aim of this study was the application and evaluation of a disease-specific quality of life index in Iranian patients, for the first time. This cross-sectional biphasic study was conducted on 25 patients as a pilot and another 173 patients as the main study group, in Razi Hospital, Tehran, Iran, 2013-2014. Persian version of Vitiligo Quality of Life index (VitiQoL) was developed with backward-forward method. Based on the pilot study, the validity and reliability were assessed. The Vitiligo Area and Score Index (VASI), VitiQoL, and their relationship, demographic and clinical characteristic of patients were measured. The Mean and standard deviation of the VitiQoL score was 30.5 ± 14.5 (range 0-60 in Persian version). There was a significant relationship between VASI score and VitiQoL (p = 0.015, r = 0.187). Confirmatory factor analysis revealed three important factors within VitiQoL: participation limitation, stigma, and behavior. In subscale analysis based on behavior factor, female patients had poorer quality of life (p = 0.02). Concomitant psychiatric problems, e.g. anxiety and depression, were not associated with QOL; however, they were near to being meaningful (p = 0.06, r = 0.14). VitiQoL is a valid index in estimating life quality of vitiligo patients and has proper relation to disease severity. Focusing on patient's life quality is an important entity in the management of vitiligo patients; relevant supportive group-based consultations and therapies are also important arms when approaching vitiligo.

Molekulare Charakterisierung von Glykosyltransferasen in Vitis vinifera

OpenAIRE

Frotscher, Johanna

2014-01-01

Terpenoide spielen eine wichtige Rolle für das Aroma von Weinbeeren (Vitis vinifera). Glykosyltransferasen katalysieren die Übertragung von Zuckerresten auf Terpenoide, was diese geruchlos werden lässt. Um die verantwortlichen Enzyme zu identifizieren wurde deren Genfamilie in silico untersucht, 15 Kandidatengene ausgewählt, deren Transkription analysiert und die Ergebnisse mit Terpenoidprofilen verglichen. Dadurch konnten fünf Gene ausgewählt werden, deren offener Leserahmen sequenziert wurd...

Genetic Analysis of East Asian Grape Cultivars Suggests Hybridization with Wild Vitis.

Science.gov (United States)

Goto-Yamamoto, Nami; Sawler, Jason; Myles, Sean

2015-01-01

Koshu is a grape cultivar native to Japan and is one of the country's most important cultivars for wine making. Koshu and other oriental grape cultivars are widely believed to belong to the European domesticated grape species Vitis vinifera. To verify the domesticated origin of Koshu and four other cultivars widely grown in China and Japan, we genotyped 48 ancestry informative single nucleotide polymorphisms (SNPs) and estimated wild and domesticated ancestry proportions. Our principal components analysis (PCA) based ancestry estimation revealed that Koshu is 70% V. vinifera, and that the remaining 30% of its ancestry is most likely derived from wild East Asian Vitis species. Partial sequencing of chloroplast DNA suggests that Koshu's maternal line is derived from the Chinese wild species V. davidii or a closely related species. Our results suggest that many traditional East Asian grape cultivars such as Koshu were generated from hybridization events with wild grape species.

Phenolic Profiles and Antioxidant Properties of Young Wines Made from Yan73 (Vitis vinifera L. and Cabernet Sauvignon (Vitis vinifera L. Grapes Treated by 24-Epibrassinolide

Directory of Open Access Journals (Sweden)

Fan Xu

2014-07-01

Full Text Available The grape berries of two varieties, Yan73 (Vitis vinifera L. and Cabernet Sauvignon (CS (Vitis vinifera L. were treated with 0.40 mg/L 24-epibrassinolide (EBR, 1.00 mg/L brassinazole (Brz, and deionized water (control, at the veraison period. The EBR treatment significantly increased total phenolic content (TPC, total tannin content (TTC and total anthocyanin content (TAC of Yan73 and CS wines, whereas Brz treatment decreased TPC, total flavonoid content (TFC, TAC in the two wines. Moreover, the content of most of the phenolic compounds identified by HPLC-DAD/ESI-MS in EBR-treated wines was significantly higher than that in control. The antioxidant capacities, which determined using DPPH, ABTS and HRSA methods, of the wines were increased by EBR treatment as well. There was a good correlation between the antioxidant capacity and phenolic content. The results demonstrated that EBR could enhance the phenolic compounds and antioxidant capacity of Yan73 and CS wines, but the effects may vary by different cultivars.

Sazonalidade da umidade de equilíbrio da madeira para o Estado de Mato Grosso

Directory of Open Access Journals (Sweden)

Adilson Pacheco de Souza

2017-01-01

Full Text Available Por ser um material orgânico, heterogêneo e higroscópico, a madeira pode apresentar variações dimensionais e deformações decorrentes da interação com o ambiente. Em uso ou nos processos de secagem, quando são atingidos os equilíbrios entre a madeira e o ar atmosférico, têm-se a obtenção da umidade de equilíbrio da madeira (UEM. Em função da elevada importância dessa matéria-prima para o Estado de Mato Grosso, torna-se fundamental conhecer a sazonalidade de UEM. O presente trabalho objetivou estimar a UEM da madeira, pelo modelo de Simpson, para 30 municípios do Estado de Mato Grosso, distribuídos nas diferentes regiões de planejamento do Zoneamento Sócio-Econômico Ecológico do Estado. Os dados meteorológicos foram obtidos da Rede de Estações Meteorológicas Automáticas do Instituto Nacional de Meteorologia, entre 2006 e 2012. A UEM foi estimada diariamente, com posterior obtenção das médias mensais. Na estação seca ocorreram variações da UEM entre 5,08 e 9,57% e no período chuvoso entre 8,58 e 13,49%. Nos meses de janeiro, fevereiro e março ocorrem os maiores valores de UEM no estado. As condições ambientais durante o período seco (julho a setembro favorecem a secagem natural da madeira serrada, por condicionarem uma secagem mais rápida.

Varietal Distributions of Stilbenes in Grape Cane of Vitis vinifera L.

Czech Academy of Sciences Publication Activity Database

Soural, I.; Balík, J.; Vrchotová, Naděžda; Tříska, Jan

2017-01-01

Roč. 20, č. 1 (2017), s. 11-14 ISSN 1335-2563 R&D Projects: GA MŠk(CZ) LO1415; GA MŠk(CZ) LD14038 Institutional support: RVO:86652079 Keywords : Vitis vinifera L. * varieties * grape canes * stilbenes * distribution Subject RIV: EH - Ecology, Behaviour OBOR OECD: Environmental sciences (social aspects to be 5.7)

Genetic Analysis of East Asian Grape Cultivars Suggests Hybridization with Wild Vitis.

Directory of Open Access Journals (Sweden)

Nami Goto-Yamamoto

Full Text Available Koshu is a grape cultivar native to Japan and is one of the country's most important cultivars for wine making. Koshu and other oriental grape cultivars are widely believed to belong to the European domesticated grape species Vitis vinifera. To verify the domesticated origin of Koshu and four other cultivars widely grown in China and Japan, we genotyped 48 ancestry informative single nucleotide polymorphisms (SNPs and estimated wild and domesticated ancestry proportions. Our principal components analysis (PCA based ancestry estimation revealed that Koshu is 70% V. vinifera, and that the remaining 30% of its ancestry is most likely derived from wild East Asian Vitis species. Partial sequencing of chloroplast DNA suggests that Koshu's maternal line is derived from the Chinese wild species V. davidii or a closely related species. Our results suggest that many traditional East Asian grape cultivars such as Koshu were generated from hybridization events with wild grape species.

Anatomía de leño de Maytenus vitis-idaea y M. viscifolia (Celastraceae

Directory of Open Access Journals (Sweden)

Ana María Giménez

2012-12-01

Full Text Available Es objetivo del trabajo describir el leño de Maytenus vitis-idaea Griseb. y M. viscifolia Griseb. (Celastraceae y determinar rasgos ecoanatómicos. Las muestras fueron recolectadas del bosque natural en la localidad Guampacha, Sierras de Guasayán, Santiago del Estero, Argentina (distrito chaqueño serrano. Cinco individuos de cada especie fueron seleccionados al azar, obteniéndose una rodaja a 0.3 m. En las descripciones del leño se usó la terminología del Comité de Nomenclatura de IAWA. Los rasgos fundamentales del leño de Maytenus se resumen en: poros pequeños, numerosos, vasos pequeños, miembros de vasos cortos y anillos de crecimiento angostos. El leño de las dos especies estudiadas se caracteriza por presentar porosidad difusa a semicircular, anillos de crecimiento tipo 5b; poros numerosos y pequeños, parénquima axial de distribución apotraqueal en bandas discontinuas de una sola hilera de células, con tendencia a reticulado; escaso paratraqueal unilateral y difuso en agregados, radios heterogéneos; presencia de fibrotraqueidas. Las principales diferencias anatómicas radican en el tipo de poros, fundamentalmente solitarios en M. vitis-idaea y la presencia de radios de mayor longitud en M. viscifolia. Ambas maderas presentan rasgos xerofiticos notorios.Wood anatomy of Maytenus vitis-idaea. y M. viscifolia (Celastraceae. Is objective of this study to describe the wood anatomy of Maytenus vitis-idaea Griseb. and M. viscifolia Griseb. (Celastraceae and to determine ecoanatomy features. The samples were collected from natural forest in Guampacha, Guasayán, Santiago del Estero, Argentina (Chaco Serrano district. Five individuals were randomly selected; being obtained a track to 0.3 m. IAWA Committee on Nomenclature terminology was used in wood descriptions. Xylem features of Maytenus be summarized as: numerous small pores, short vessel members and growth rings narrow. The wood of the two species were characterized by diffuse to

Evaluation of powdery mildew-resistance of grape germplasm and rapid amplified polymorphic DNA markers associated with the resistant trait in Chinese wild Vitis.

Science.gov (United States)

Zhang, J; Zhang, Y; Yu, H; Wang, Y

2014-05-09

The resistance of wild Vitis germplasm, including Chinese and American wild Vitis and Vitis vinifera cultivars, to powdery mildew (Uncinula necator Burr.) was evaluated for two consecutive years under natural conditions. Most of the Chinese and North American species displayed a resistant phenotype, whereas all of the European species were highly susceptible. The Alachua and Conquistador accessions of Vitis rotundifolia species, which originated in North America, were immune to the disease, while Baihe-35-1, one of the accessions of Vitis pseudoreticulata, showed the strongest resistance among all Chinese accessions evaluated. Three rapid amplified polymorphic DNA (RAPD) markers, OPW02-1756, OPO11-964, and OPY13-661, were obtained after screening 520 random primers among various germplasm, and these markers were found to be associated with powdery mildew resistance in Baihe-35-1 and in some Chinese species, but not in any European species. Analysis of F₁ and F₂ progenies of a cross between resistant Baihe-35-1 and susceptible Carignane (V. vinifera) revealed that the three RAPD markers were linked to the powdery resistant trait in Baihe-35-1 plants. Potential applications of the identified RAPD markers for gene mapping, marker-assisted selection, and breeding were investigated in 168 F₂ progenies of the same cross. Characterization of the resistant phenotype of the selected F₂ seedlings for breeding a new disease-resistant grape cultivar is in progress.

Resistance evaluation of Chinese wild Vitis genotypes against Botrytis cinerea and different responses of resistant and susceptible hosts to the infection.

Science.gov (United States)

Wan, Ran; Hou, Xiaoqing; Wang, Xianhang; Qu, Jingwu; Singer, Stacy D; Wang, Yuejin; Wang, Xiping

2015-01-01

The necrotrophic fungus Botrytis cinerea is a major threat to grapevine cultivation worldwide. A screen of 41 Vitis genotypes for leaf resistance to B. cinerea suggested species independent variation and revealed 18 resistant Chinese wild Vitis genotypes, while most investigated V. vinifera, or its hybrids, were susceptible. A particularly resistant Chinese wild Vitis, "Pingli-5" (V. sp. [Qinling grape]) and a very susceptible V. vinifera cultivar, "Red Globe" were selected for further study. Microscopic analysis demonstrated that B. cinerea growth was limited during early infection on "Pingli-5" before 24 h post-inoculation (hpi) but not on Red Globe. It was found that reactive oxygen species (ROS) and antioxidative system were associated with fungal growth. O[Formula: see text] accumulated similarly in B. cinerea 4 hpi on both Vitis genotypes. Lower levels of O[Formula: see text] (not H2O2) were detected 4 hpi and ROS (H2O2 and O[Formula: see text]) accumulation from 8 hpi onwards was also lower in "Pingli-5" leaves than in "Red Globe" leaves. B. cinerea triggered sustained ROS production in "Red Globe" but not in "Pingli-5" with subsequent infection progresses. Red Globe displayed little change in antioxidative activities in response to B. cinerea infection, instead, antioxidative activities were highly and timely elevated in resistant "Pingli-5" which correlated with its minimal ROS increases and its high resistance. These findings not only enhance our understanding of the resistance of Chinese wild Vitis species to B. cinerea, but also lay the foundation for breeding B. cinerea resistant grapes in the future.

Efeitos da hidroterapia na recuperação do equilíbrio e prevenção de quedas em idosas Effects of hydrotherapy in balance and prevention of falls among elderly women

Directory of Open Access Journals (Sweden)

SM Resende

2008-02-01

Full Text Available CONTEXTO: A hidroterapia é utilizada para tratar doenças reumáticas, ortopédicas e neurológicas. Na atualidade, é alvo de investigações na recuperação do equilíbrio em idosos. OBJETIVO: Avaliar o efeito de um programa de hidroterapia no equilíbrio e no risco de quedas em idosas. MÉTODOS: Trata-se de um estudo quase-experimental antes/depois sem grupo controle. Foram avaliadas 25 idosas por meio de duas escalas, a Escala de Equilíbrio de Berg e Timed Up & Go. Posteriormente, foram submetidas a um programa de hidroterapia para equilíbrio, de baixa a moderada intensidade, que consistiu de três fases: fase de adaptação ao meio aquático, fase de alongamento e fase de exercícios estáticos e dinâmicos para equilíbrio. O programa foi aplicado durante 12 semanas, sendo duas sessões semanais com 40 minutos de duração cada sessão. As idosas foram reavaliadas após a sexta e a 12ª semanas do programa de hidroterapia. Os dados foram analisados estatisticamente pelo teste t, para amostras pareadas, e pelo teste de Wilcoxon. RESULTADOS: A hidroterapia promoveu aumento significativo do equilíbrio das idosas, avaliado por meio da Escala de Equilíbrio de Berg (pBACKGROUND: Hydrotherapy is used to treat rheumatic, orthopedic and neurological disorders. It has been the subject of investigations regarding balance recovery in elderly people. OBJECTIVE: To evaluate the effect of a hydrotherapy program for balance, in relation to the risk of falls in elderly women. METHODS: This was a quasi-experimental before/after study without a control group. Twenty-five elderly women were evaluated using two scales: the Berg Balance Scale and Timed Up & Go. The subjects underwent, subsequently, a low to moderate intensity hydrotherapy program for balance, which consisted of three phases: a phase of adaptation to the aquatic environment, a stretching phase and a phase of static and dynamic balance exercises. The program was applied for 12 weeks, with

Influence of shoot topping on yield and quality of Vitis vinifera L.

African Journals Online (AJOL)

STORAGESEVER

2008-10-20

Oct 20, 2008 ... Key words: Vitis vinifera L., shoot topping, yield, quality, canopy management, shoot topping, fruit set, yield components, fruit .... Sensory characteristics were under the interaction effect of year and topping level. Berry weight was influenced separately by the year and topping (Table 2 and 3). Yield per vine ...

Experiência de treinamento com Nintendo Wii sobre a funcionalidade, equilíbrio e qualidade de vida de idosas

Directory of Open Access Journals (Sweden)

Letícia Aparecida Calderão Sposito

2013-06-01

Full Text Available O objetivo desse relato de experiência foi analisar a funcionalidade, equilíbrio e qualidade de vida em duas idosas não institucionalizadas, após serem submetidas a um protocolo de treinamento em Realidade Virtual composto por nove sessões com duração de 50 minutos cada e frequência de três vezes por semana. Para tanto, utilizou-se os jogos do software Wii Fit, bem como o acessório Balance Board do console Nintendo Wii, a partir de um programa de treinamento elaborado fundamentado em diretrizes gerais de agência de saúde, tais como o Colégio Americano de Medicina do Esporte (ASCM. A avaliação da funcionalidade foi realizada com o uso dos Testes de Aptidão Física para Idosos (TAFI, o equilíbrio foi avaliado com a Escala de Berg e a qualidade de vida foi mensurada com o questionário SF-36. Os resultados apontaram melhora nos valores absolutos de todos os testes analisados, permitindo concluir acerca do potencial do programa de treinamento elaborado para a melhora da independência funcional de idosos. Esperamos que este estudo auxilie pesquisadores a dar continuidade à pesquisa e às ações envolvendo o uso do Nintendo Wii como ferramenta assistiva a idosos.

Efeito de agrotóxicos sobre Calepitrimerus vitis (Nalepa, 1905 (Acari: Eriophyidae na região da campanha do Rio Grande do Sul

Directory of Open Access Journals (Sweden)

Paulo Ricardo Ebert Siqueira

2012-03-01

Full Text Available O Rio Grande do Sul apresenta a maior área de cultivo de videiras no Brasil; neste Estado, a Região da Campanha possui características edafoclimáticas adequadas à produção de cultivares viníferas de origem europeia e apresentou, na primeira década deste milênio, significativa expansão de área. A partir de 2005, o ácaro-da-ferrugem-da-videira, Calepitrimerus vitis, passou a ser encontrado com frequência nos vinhedos da Campanha. Nos países onde esta espécie está estabelecida, reduções significativas na produção de uva são observadas, e a necessidade de controle é constante, não havendo, até o momento, produtos autorizados no Brasil para o controle de C. vitis. O presente trabalho objetivou avaliar diversos agrotóxicos quanto à eficiência de controle de C. vitis em um vinhedo comercial, na região da Campanha do Rio Grande do Sul. O experimento foi conduzido durante os anos de 2008 e 2009, comparando o nível de infestação nas plantas através do emprego de armadilhas adesivas. No ano de 2008, a eficiência de controle durante o outono não diferiu da testemunha. O emprego de enxofre em uma única pulverização no outono, ou em duas pulverizações, sendo uma no outono e outra na primavera, controlou eficientemente C. vitis na primavera. Os acaricidas abamectina e espirodiclofeno foram eficientes no controle de C. vitis na primavera, tanto com uma única pulverização, como com duas pulverizações, sendo uma no outono e outra na primavera. No outono de 2009, os tratamentos com espirodiclofeno e cihexatina foram eficientes no controle de C. vitis. O ácaro-da-ferrugem-da-videira é controlado eficientemente com pulverizações de cihexatina, enxofre ou espirodiclofeno no outono ou durante a primavera com abamectina, enxofre ou espirodiclofeno.

A host-specific biological control of grape crown gall by Agrobacterium vitis strain F2/5: its regulation and population dynamics.

Science.gov (United States)

Kaewnum, Supaporn; Zheng, Desen; Reid, Cheryl L; Johnson, Kameka L; Gee, Jodi C; Burr, Thomas J

2013-05-01

Nontumorigenic Agrobacterium vitis strain F2/5 is able to prevent crown gall caused by tumorigenic A. vitis on grape but not on other plant species such as tobacco. Mutations in a quorum-sensing transcription factor, aviR, and in caseinolytic protease (clp) component genes clpA and clpP1 resulted in reduced or loss of biological control. All mutants were complemented; however, restoration of biological control by complemented clpA and clpP1 mutants was dependent on the copy number of vector that was used as well as timing of application of the complemented mutants to grape wounds in relation to inoculation with pathogen. Mutations in other quorum-sensing and clp genes and in a gene associated with polyketide synthesis did not affect biological control. It was determined that, although F2/5 inhibits transformation by tumorigenic A. vitis strains on grape, it does not affect growth of the pathogen in wounded grape tissue over time.

Phylogeography and population structure of the grape powdery mildew fungus, Erysiphe necator, from diverse Vitis species

Directory of Open Access Journals (Sweden)

Brewer Marin

2010-09-01

Full Text Available Abstract Background The grape powdery mildew fungus, Erysiphe necator, was introduced into Europe more than 160 years ago and is now distributed everywhere that grapes are grown. To understand the invasion history of this pathogen we investigated the evolutionary relationships between introduced populations of Europe, Australia and the western United States (US and populations in the eastern US, where E. necator is thought to be native. Additionally, we tested the hypothesis that populations of E. necator in the eastern US are structured based on geography and Vitis host species. Results We sequenced three nuclear gene regions covering 1803 nucleotides from 146 isolates of E. necator collected from the eastern US, Europe, Australia, and the western US. Phylogeographic analyses show that the two genetic groups in Europe represent two separate introductions and that the genetic groups may be derived from eastern US ancestors. Populations from the western US and Europe share haplotypes, suggesting that the western US population was introduced from Europe. Populations in Australia are derived from European populations. Haplotype richness and nucleotide diversity were significantly greater in the eastern US populations than in the introduced populations. Populations within the eastern US are geographically differentiated; however, no structure was detected with respect to host habitat (i.e., wild or cultivated. Populations from muscadine grapes, V. rotundifolia, are genetically distinct from populations from other Vitis host species, yet no differentiation was detected among populations from other Vitis species. Conclusions Multilocus sequencing analysis of the grape powdery mildew fungus is consistent with the hypothesis that populations in Europe, Australia and the western US are derived from two separate introductions and their ancestors were likely from native populations in the eastern US. The invasion history of E. necator follows a pattern

NMR metabolomics of esca disease-affected Vitis vinifera cv. Alvarinho leaves.

Science.gov (United States)

Lima, Marta R M; Felgueiras, Mafalda L; Graça, Gonçalo; Rodrigues, João E A; Barros, António; Gil, Ana M; Dias, Alberto C P

2010-09-01

Esca is a destructive disease that affects vineyards leading to important losses in wine production. Information about the response of Vitis vinifera plants to this disease is scarce, particularly concerning changes in plant metabolism. In order to study the metabolic changes in Vitis plants affected by esca, leaves from both infected and non-affected cordons of V. vinifera cv. Alvarinho (collected in the Vinho Verde region, Portugal) were analysed. The metabolite composition of leaves from infected cordons with visible symptoms [diseased leaves (dl)] and from asymptomatic cordons [healthy leaves (hl)] was evaluated by 1D and 2D (1)H-nuclear magnetic resonance (NMR) spectroscopy. Principal component analysis (PCA) of the NMR spectra showed a clear separation between dl and hl leaves, indicating differential compound production due to the esca disease. NMR/PCA analysis allowed the identification of specific compounds characterizing each group, and the corresponding metabolic pathways are discussed. Altogether, the study revealed a significant increase of phenolic compounds in dl, compared with hl, accompanied by a decrease in carbohydrates, suggesting that dl are rerouting carbon and energy from primary to secondary metabolism. Other metabolic alterations detected comprised increased levels of methanol, alanine, and gamma-aminobutyric acid in dl, which might be the result of the activation of other defence mechanisms.

Equilíbrio trabalho-vida : o papel do Estado e das organizações na Europa (2007/2017)

OpenAIRE

Moura, Sofia Cristina Cachatra

2017-01-01

Mestrado em Gestão de Recursos Humanos O presente estudo baseou-se na recolha e análise de estudos empíricos, sobre as políticas e práticas organizacionais e do Estado que visam o Equilíbrio Trabalho-Vida, na Europa, nos últimos dez anos, tendo como grelha de análise os modelos de conciliação trabalho-família identificados na revisão de literatura. Países com modelos mais tradicionais (e.g. conservador e mediterrâneo) concentram-se em estudos mais macro existindo uma superioridade dos ...

Various Extraction Methods for Obtaining Stilbenes from Grape Cane of Vitis vinifera L

Czech Academy of Sciences Publication Activity Database

Soural, I.; Vrchotová, Naděžda; Tříska, Jan; Balík, J.; Horník, Štěpán; Cuřínová, Petra; Sýkora, Jan

2015-01-01

Roč. 20, č. 4 (2015), s. 6093-6112 ISSN 1420-3049 R&D Projects: GA MŠk(CZ) LD14038 Institutional support: RVO:67179843 ; RVO:67985858 Keywords : Vitis vinifera L * grape cane * stilbenes * accelerated solvent extraction ( ASE ) * microwave-assisted extraction (MAE) * LC-MS Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.465, year: 2015

Bioaccumulation of heavy metals and ecophysiological responses to heavy metal stress in selected populations of Vaccinium myrtillus L. and Vaccinium vitis-idaea L.

Science.gov (United States)

Kandziora-Ciupa, Marta; Nadgórska-Socha, Aleksandra; Barczyk, Gabriela; Ciepał, Ryszard

2017-09-01

The aim of this study was to determine the concentrations of heavy metals (Cd, Pb, Zn, Fe, and Mn) in soil, and their bioavailability and bioaccumulation in Vaccinium myrtillus L. and Vaccinium vitis-idaea L. organs. Analysis also concerned the physiological responses of these plants from three polluted sites (immediate vicinity of a zinc smelter in Miasteczko Śląskie, ArcelorMittal Poland S.A. iron smelter in Dąbrowa Górnicza-Łosień, and Jaworzno III power plant in Jaworzno) and one pseudo-control site (Pazurek nature reserve in Jaroszowiec Olkuski). All of the sites are situated in the southern parts of Poland in the Śląskie or Małopolskie provinces. The contents of proline, non-protein thiols, glutathione, ascorbic acid, and the activity of superoxide dismutase and guaiacol peroxidase in the leaves of Vaccinium myrtillus L. and Vaccinium vitis-idaea L. were measured. In soil, the highest levels of Cd, Pb, and Zn (HNO 3 extracted and CaCl 2 extracted) were detected at the Miasteczko Śląskie site. At all sites a several times lower concentration of the examined metals was determined in the fraction of soil extracted with CaCl 2 . Much higher Cd, Pb, Zn and Fe concentrations were found in V. myrtillus and V. vitis-idaea grown at the most polluted site (located near the zinc smelter) in comparison with cleaner areas; definitely higher bioaccumulation of these metals was found in lingonberry organs. Additionally, we observed a large capability of bilberry to accumulate Mn. Antioxidant response to heavy metal stress also differed between V. myrtillus and V. vitis-idaea. In V. myrtillus we found a positive correlation between the level of non-protein thiols and Cd and Zn concentrations, and also between proline and these metals. In V. vitis-idaea leaves an upward trend in ascorbic acid content and superoxide dismutase activity accompanied an increase in Cd, Pb, and Zn concentrations. At the same time, the increased levels of all tested metals in the leaves

The synthesis and accumulation of resveratrol are associated with veraison and abscisic acid concentration in Beihong (Vitis vinifera × Vitis amurensis berry skin

Directory of Open Access Journals (Sweden)

Junfang Wang

2016-11-01

Full Text Available Resveratrols are polyphenolic secondary metabolites that can benefit human health, and only occur in a few plant families including Vitaceae. It has been reported that abscisic acid (ABA can induce veraison (the onset of grape berry ripening and may induce the accumulation of resveratrol in berry skin. However, the relationships between ABA, veraison, the accumulation of anthocyanins and the accumulation of resveratrol in the berry are poorly understood. This study attempted to answer this question through an investigation of the effect of applied ABA and fluridone (a synthetic inhibitor of ABA on the biosynthesis and accumulation of ABA, anthocyanin and resveratrol in Beihong (Vitis vinifera × Vitis amurensis berry skin. Under natural conditions, resveratrol concentration was very low before 91 DAA (days after anthesis, i.e. 2 weeks after veraison, however, it increased sharply from this point to 126 DAA (maturity. Exogenous ABA applications all resulted in an increase in berry skin ABA and anthocyanin concentration, irrespective of the developmental stage at which the treatment occurred (20 and 10 d pre-veraison，veraison or 7 d post-veraison, thereby advancing veraison. In contrast, resveratrol concentration increased only when ABA was applied at 10 d pre-veraison or at veraison. As a result, the accumulation of resveratrol was associated with veraison in grape berry skin and this accumulation, together with that of anthocyanins, was associated with ABA concentration. The response of resveratrol biosynthesis in the berry skin to manipulation of ABA varied during berry development and was less sensitive to ABA than the response of anthocyanin biosynthesis.

The Synthesis and Accumulation of Resveratrol Are Associated with Veraison and Abscisic Acid Concentration in Beihong (Vitis vinifera × Vitis amurensis) Berry Skin

Science.gov (United States)

Wang, Junfang; Wang, Shuqin; Liu, Guotian; Edwards, Everard J.; Duan, Wei; Li, Shaohua; Wang, Lijun

2016-01-01

Resveratrols are polyphenolic secondary metabolites that can benefit human health, and only occur in a few plant families including Vitaceae. It has been reported that abscisic acid (ABA) can induce veraison (the onset of grape berry ripening) and may induce the accumulation of resveratrol in berry skin. However, the relationships between ABA, veraison, the accumulation of anthocyanins and the accumulation of resveratrol in the berry are poorly understood. This study attempted to answer this question through an investigation of the effect of applied ABA and fluridone (a synthetic inhibitor of ABA) on the biosynthesis and accumulation of ABA, anthocyanin, and resveratrol in Beihong (Vitis vinifera × Vitis amurensis) berry skin. Under natural conditions, resveratrol concentration was very low before 91 DAA (days after anthesis), i.e., 2 weeks after veraison, however, it increased sharply from this point to 126 DAA (maturity). Exogenous ABA applications all resulted in an increase in berry skin ABA and anthocyanin concentration, irrespective of the developmental stage at which the treatment occurred (20 and 10 days pre-veraison, veraison or 7 days post-veraison), thereby advancing veraison. In contrast, resveratrol concentration increased only when ABA was applied at 10 days pre-veraison or at veraison. As a result, the accumulation of resveratrol was associated with veraison in grape berry skin and this accumulation, together with that of anthocyanins, was associated with ABA concentration. The response of resveratrol biosynthesis in the berry skin to manipulation of ABA varied during berry development and was less sensitive to ABA than the response of anthocyanin biosynthesis. PMID:27857716

Estudo do equilíbrio líquido – líquido em sistemas aquosos bifásicos formados por polietilenoglicol (1500, 3350 e 6000), sais de fosfato e água em diferentes temperaturas

OpenAIRE

Silva, Angélica Siqueira da

2014-01-01

No presente trabalho, foram estudados os dados de equilíbrio de fases dos sistemas aquosos bifásicos formados por polietilenoglicol (1500, 3350 e 6000) + fosfato monobásico e dibásico de sódio (pH 7) + água. Estudou-se o efeito da variação da temperatura (10, 25 e 40°C) bem como da massa molar sobre os dados de equilíbrio. Para o PEG 3350 observou-se um aumento da área bifásica com diminuição da temperatura, mostrando que a formação do sistema aquoso bifásico é exotérmico. Para o PEG 1500 e 6...

Method validation for determination of metals in Vitis labrusca L. grapevine leaf extracts by inductively coupled plasma mass spectrometry (ICP-MS

Directory of Open Access Journals (Sweden)

LIANE V.V. BOKOWSKI

Full Text Available ABSTRACT Vitis labrusca L. is the main species used for wine and juice production in Brazil. The grapevine leaves can be used both as functional foods and as cheapest sources for the extraction of phenolic compounds. Besides the antioxidant activity, grapevine leaves exhibited significant anti-inflammatory activity. Therefore, the aim of this study was to develop and validate an analytical methodology to determine the metals selenium (96Se, chromium (53Cr, nickel (62Ni, cadmium (111Cd and lead (206Pb in 30 samples of grapevine leaf extracts (Vitis labrusca, Bordo cultivar using inductively coupled plasma mass spectrometry (ICP-MS. To obtain the grapevine leaf extracts the samples were milled, weighed and digested in microwave oven with nitric acid. The method showed linearity, precision, accuracy and limits of quantification and detection acceptable for INMETRO protocol validation of analytical methods. Therefore, the method using ICP-MS was developed and validated to determine metals concentrations in grapevine leaves of Vitis labrusca L. and the proposed method could be applied in routine analytical laboratory.

Molecular profiling of Vitis vinifera Chardonnay obtained by somatic embryogenesis

Directory of Open Access Journals (Sweden)

Christophe Bertsch

2003-12-01

Full Text Available With the help of microsatellite profiling, we showed that Vitis vinifera Chardonnay clone 96 is a periclinal chimera plant which is composed at least of two distinct cell layers. Performing somatic embryogenesis allowed us to separate the two cell layers and to regenerate L1 plants. These regenerated L1 plants did not show phenotypic differences to the parental clone when grown in greenhouse conditions, suggesting therefore that the phenotype of Chardonnay 96 did not result of an interaction between the two distinct cell layers L1 and L2.

Equilíbrio ácido-base e hidroeletrolítico em eqüinos com cólica

OpenAIRE

Di Filippo,Paula Alessandra; Santana,Aureo Evangelista; Pereira,Gener Tadeu

2008-01-01

Foram utilizados setenta eqüinos distribuídos em três grupos experimentais, G1 (vinte eqüinos hígidos), G2 (vinte e cinco eqüinos com cólica, os quais passaram por tratamento clínico ou cirúrgico e sobreviveram) e G3 (vinte e cinco eqüinos com cólica, os quais passaram por tratamento clínico ou cirúrgico e foram a óbito ou foram sacrificados). Amostras de sangue foram obtidas em dez diferentes momentos, mediante punção da jugular, para estudo do equilíbrio ácido-base e hidroeletrolítico. Os e...

A novel emulsion-forming arabinogalactan gum from the stems of Frost grape (Vitis riparia Michx.)

Science.gov (United States)

A novel arabinogalactan polysaccharide (FGP) is described that is produced in large quantities from the cut stems of Frost grape (Vitis riparia Michx.). The sugar composition consists of L-arabinofuranose (L-Araf, 55.2 %) and D-galactopyranose (D-Galp 30.1%), with smaller components of D-xylose (11....

Presence and uses of wild grapevine (Vitis spp. in the central region of Veracruz in Mexico

Directory of Open Access Journals (Sweden)

Juan Guillermo Cruz-Castillo

2009-06-01

Significance and impact of study: The exploration of Vitis spp. in the area studied raises the possibility of finding new hybrids or multi-hybrids between species. Wild grapevines could be used to produce natural products that could be sold on the market.

Polyamines and adventitious root formation in Vitis vinifera L.

Directory of Open Access Journals (Sweden)

Laurence Geny

2002-06-01

Full Text Available The effects of polyamines were examined for growth and polyamine contents in cultings, callus and primary adventitious roots of Vitis vinifera L. Variations in free, conjugated and wall-bound polyamines in cuttings were observed during rhizogenesis. The main polyamines in cuttings were conjugated polyamines while in callus and primary adventitious roots they were free polyamines. Exogenous polyamine addition did not modify the total number of roots per cutting but increased the mean size and number of long roots. Moreover, exogenous polyamines increased polyamine levels in callus and roots, particurlarly wall-bound and conjugated polyamines. The involvement of these classes of polyamines in morphogenic processes is discussed.

Equilíbrio e ciclos Equilibrium and cycles

Directory of Open Access Journals (Sweden)

Matheus Albergaria de Magalhães

2005-12-01

Full Text Available A agenda de pesquisa relacionada a modelos de ciclos reais de negócios (Real-Business-Cycle models - RBC apresentou um crescimento exponencial desde seu surgimento, no início da década de 1980. Os modelos iniciais do gênero partiam de economias simplificadas, sem imperfeições, buscando explicar as oscilações de curto prazo da economia (ciclos a partir de um arcabouço de equilíbrio geral walrasiano. Atualmente, modelos RBC são amplamente usados na macroeconomia, com uma ênfase especial na análise dos aspectos quantitativos das flutuações econômicas. O objetivo do presente artigo é, portanto, realizar uma resenha da primeira fase da agenda RBC. Apesar dos diversos resultados controversos obtidos, é provável que a principal contribuição dessa agenda seja de cunho metodológico, uma vez que a pesquisa daí advinda afetou profundamente as formas de modelagem macroeconômica vigentes hoje em dia.The research agenda related to Real-Business-Cycle models (RBC has shown a remarkable growth since its beginning, in the eighties. The first models of this kind departed from simple economies without imperfections and tried to explain short-run macroeconomic movements (cycles from Walrasian general-equilibrium settings. Nowadays, RBC models are widely used in Macroeconomics, with a special emphasis on the quantitative aspects of economic fluctuations. The main goal of this paper is to provide a survey of the first stage of the RBC research agenda, since there is not a systematic survey of this literature available in Portuguese. Although there are several controversial results related to RBC models, its main contribution seems to be methodological, since these models had a profound impact on current macroeconomic modeling.

Genome-wide identification of WRKY family genes and their response to cold stress in Vitis vinifera

Science.gov (United States)

WRKY transcription factors are one of the largest families of transcriptional regulators in plants. WRKY genes are not only found to play significant roles in biotic and abiotic stress response, but also regulate growth and development. Grapevine (Vitis vinifera) production is largely limited by str...

SECAGEM NATURAL DE GERGELIM E DETERMINAÇÃO DA UMIDADE DE EQUILÍBRIO

Directory of Open Access Journals (Sweden)

Francisco de Assis Cardoso Almeida

1999-12-01

Full Text Available RESUMO A secagem natural consistiu na exposição das plantas à luz solar. Este processo foi conduzido até que as sementes atingissem teor de umidade de aproximadamente 6% b.u. Os teores de umidade de equilíbrio foram determinados utilizando-se soluções de ácido sulfúrico, com 98% de pureza, para uma faixa de umidade relativa de 17 a 85%. As amostras eram armazenadas em potes herméticos contendo as respectivas soluções e levadas a incubadoras com temperatura controlada de 20, 30 e 40º C ± 1º C. Para o ajuste das isotermas de sorção foram testados os modelos de BET, GAB, Halsey e Oswin, com a finalidade de se obter os seus coeficientes por meio de regressão não linear. Ante os resultados, concluiu-se a necessidade de 35 dias para as sementes atingirem a umidade de 6,1% b.u. e o modelo GAB foi o que se ajustou melhor aos dados experimentais.

The novel gene VpPR4-1 from Vitis pseudoreticulata increases powdery mildew resistance in transgenic Vitis vinifera L.

Directory of Open Access Journals (Sweden)

Lingmin eDai

2016-05-01

Full Text Available Pathogenesis-related proteins (PRs can lead to increased resistance of the whole plant to pathogen attack. Here, we isolate and characterize a PR-4 protein from a wild Chinese grape Vitis pseudoreticulata which shows greatly elevated transcription following powdery mildew infection. Its expression profiles under a number of abiotic stresses were also investigated. The PR-4 gene was overexpressed in regenerated V. vinifera cv. Red Globe via Agrobacterium tumefaciens-mediated transformation and verified by the Western blot. The transgenic grapevines exhibited higher expression levels of PR-4 protein content than wild-type vines and also repressed the growth of powdery mildew. The PR gene responds differently to different stresses in the PR-4 transformants. This study demonstrates that PR-4 protein in grapes plays a vital role in defense against powdery mildew invasion.

Competitividade da cadeia produtiva viti-vinícola do RS

OpenAIRE

Triches, Vinícius

2007-01-01

Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro Sócio-Econômico. Programa de Pós-Graduação em Economia. No presente trabalho é analisada a competitividade da cadeia produtiva viti-vinícola gaúcha, líder no Brasil. Para tanto, utilizou-se como embasamento teórico a noção de cadeias produtivas, competitividade em cadeias produtivas e a Economia dos Custos de Transação. Assim, visou-se verificar, dentro de cinco níveis de análise, as principais características, peculia...

Análise comparativa do equilíbrio unipodal de atletas de ginástica rítmica Comparative analysis of one-foot balance in rhythmic gymnastics athletes

Directory of Open Access Journals (Sweden)

Leonardo Shigaki

2013-04-01

Full Text Available INTRODUÇÃO: A ginástica rítmica (GR requer alto nível de qualidade física; assim, o bom desempenho é dependente da força e resistência muscular, coordenação motora e equilíbrio postural. OBJETIVO: Desenvolver uma análise comparativa do equilíbrio unipodal de atletas de GR. MÉTODOS: Foram avaliadas dez atletas de GR, do sexo feminino, por meio de uma plataforma de força em apoio unipodal e testes funcionais de equilíbrio (Side Hop Test e Figure of Eight Hop Teste. Para a plataforma, os parâmetros do Centro de Pressão (COP nas direções anteroposterior e mediolateral foram utilizados para análise, enquanto para os testes funcionais, o tempo-segundos de performance. RESULTADOS: Diferença significativa (p = 0,01 foi encontrada entre os membros inferiores no parâmetro de frequência média na direção mediolateral, no qual o membro inferior não dominante apresentou maior estabilidade postural do que o dominante. Para os testes funcionais não houve diferença significativa entre os membros. CONCLUSÃO: A diferença encontrada no controle do equilíbrio na direção mediolateral pode estar relacionada às diferenças nas ações musculares da região do quadril, na qual durante a prática do esporte para estabilização, manutenção do tronco e execução de manobras com os membros inferiores estão presentes. Estes resultados indicam a necessidade de um programa de reequilíbrio e estabilização pélvica para as atletas analisadas no intuito de preservar a simetria muscular dos membros para o bom desempenho esportivo.INTRODUCTION: Rhythmic gymnastics requires a high level of physical quality; therefore, good performance depends on muscular strength and endurance, motor coordination and postural balance. OBJECTIVE: To develop a comparative analysis of postural balance in rhythmic gymnasts. METHODS: 10 female rhythmic gymnasts were evaluated by a force platform on one foot and balance functional tests (Side Hop Test and

Estudo longitudinal do equilíbrio postural e da capacidade aeróbica de idosos independentes Balance and aerobic capacity of independent elderly: a longitudinal cohort study

Directory of Open Access Journals (Sweden)

Giovanna A. Lima

2011-08-01

Full Text Available OBJETIVO: Avaliar a variação da capacidade aeróbica e do equilíbrio postural em idosos independentes por um período de três anos. MÉTODOS: A capacidade aeróbica dos voluntários foi avaliada por meio do Teste de Caminhada de 6 minutos (TC6; o equilíbrio postural, por meio da Escala de Equilíbrio de Berg (EEB; o número de quedas foi registrado por autorrelato e o nível de atividade física, pelo Questionário Internacional de Atividade Física (IPAQ - versão longa. As avaliações realizadas em 2008 foram comparadas às realizadas em 2005. RESULTADOS: Não houve diferença na pontuação da EEB e no número de quedas dos idosos avaliados (p>0,05. Houve diminuição da distância percorrida entre as duas avaliações, sendo que os voluntários percorreram 52,46±8,4 metros a menos na segunda avaliação. O IPAQ evidenciou aumento de indivíduos considerados ativos na segunda avaliação (83,3%. CONCLUSÃO: O presente estudo demonstrou que o equilíbrio postural, avaliado pela EEB, não se alterou nos idosos independentes e ativos no período de três anos. Nesse mesmo momento, observou-se uma redução da distância percorrida, avaliada pelo TC6.OBJECTIVE: To evaluate the variation in aerobic capacity and postural balance of independents elderly for a period of three years. METHODS: The aerobic capacity of the volunteers was assessed using a six minutes walk test (6MWT, the postural balance was assessed using the Berg Balance Scale (BBS, the number of falls was self-reported and physical activity level was assessed using the International Physical Activity Questionnaire (IPAQ - long version. Evaluations undertaken in 2008 were compared to those performed in 2005. RESULTS: There were no differences in balance and number of falls between 2008 and 2005 (p>0.05. There was a decrease in aerobic capacity over time of 52.46±8.4 meters walked. The IPAQ showed an increase in physical activity on the second evaluation (83.3%. CONCLUSION: The

Dinâmica populacional de Calepitrimerus vitis (Nalepa (Acari: eriophyidae em cultivares de videira na região da campanha do Rio Grande do Sul

Directory of Open Access Journals (Sweden)

Paulo Ricardo Ebert Siqueira

2013-06-01

Full Text Available Na Região da Campanha do Rio Grande do Sul, o ácaro-da-ferrugem-da-videira, Calepitrimerus vitis (Nalepa (Acari: Eriophyidae, é encontrado com frequência em vinhedos de cultivares europeias, desde a safra de 2004/2005, causando bronzeamento nas folhas. A dinâmica populacional de C. vitis nas cultivares Chardonnay e Merlot foi avaliada em vinhedo comercial localizado no município de Dom Pedrito, na região da Campanha, durante os anos agrícolas de 2005/2006 e 2006/2007, por meio de amostragem realizada em folhas das posições basal, intermediária e apical de ramos de produção. O pico populacional de C. vitis ocorre entre o final de fevereiro e o início de março, sendo seguido de forte declínio populacional. A infestação variou de intensidade entre as cultivares de acordo com o ano, sendo a cultivar Chardonnay mais infestada no primeiro ano, e Merlot, no segundo. Folhas na posição basal, mediana e apical apresentam níveis similares de infestação. Uma correlação positiva foi encontrada entre o número de C. vitis na face abaxial das folhas e o percentual de folhas com infestação.

Crystallization, X-ray diffraction analysis and preliminary structure determination of the polygalacturonase PehA from Agrobacterium vitis

International Nuclear Information System (INIS)

Vordtriede, Paul B.; Yoder, Marilyn D.

2008-01-01

The acidic polygalacturonase PehA from A. vitis has been crystallized. A molecular-replacement solution indicated a right-handed parallel β-helix fold. Polygalacturonases are pectate-degrading enzymes that belong to glycoside hydrolase family 28 and hydrolyze the α-1,4 glycosidic bond between neighboring galacturonasyl residues of the homogalacturonan substrate. The acidic polygalacturonase PehA from Agrobacterium vitis was overexpressed in Escherichia coli, where it accumulated in the periplasmic fraction. It was purified to homogeneity via a two-step chromatography procedure and crystallized using the hanging-drop vapour-diffusion technique. PehA crystals belonged to space group P2 1 , with unit-cell parameters a = 52.387, b = 62.738, c = 149.165 Å, β = 89.98°. Crystals diffracted to 1.59 Å resolution and contained two molecules per asymmetric unit. An initial structure determination by molecular replacement indicated a right-handed parallel β-helix fold

Regulation of Long-Chain N-Acyl-Homoserine Lactones in Agrobacterium vitis

OpenAIRE

Hao, Guixia; Burr, Thomas J.

2006-01-01

Homologs of quorum-sensing luxR and luxI regulatory genes, avsR and avsI, were identified in Agrobacterium vitis strain F2/5. Compared to other LuxI proteins from related species, the deduced AvsI shows the greatest identity to SinI (71%) from Sinorhizobium meliloti Rm1021. AvsR possesses characteristic autoinducer binding and helix-turn-helix DNA binding domains and shares a high level of identity with SinR (38%) from Rm1021. Site-directed mutagenesis of avsR and avsI was performed, and both...

Identification and Expression Profiles of Six Transcripts Encoding Carboxylesterase Protein in Vitis flexuosa Infected with Pathogens

Directory of Open Access Journals (Sweden)

Md. Zaherul Islam

2016-08-01

Full Text Available Plants protect themselves from pathogen attacks via several mechanisms, including hypersensitive cell death. Recognition of pathogen attack by the plant resistance gene triggers expression of carboxylesterase genes associated with hypersensitive response. We identified six transcripts of carboxylesterase genes, Vitis flexuosa carboxylesterase 5585 (VfCXE5585, VfCXE12827, VfCXE13132, VfCXE17159, VfCXE18231, and VfCXE47674, which showed different expression patterns upon transcriptome analysis of V. flexuosa inoculated with Elsinoe ampelina. The lengths of genes ranged from 1,098 to 1,629 bp, and their encoded proteins consisted of 309 to 335 amino acids. The predicted amino acid sequences showed hydrolase like domains in all six transcripts and contained two conserved motifs, GXSXG of serine hydrolase characteristics and HGGGF related to the carboxylesterase family. The deduced amino acid sequence also contained a potential catalytic triad consisted of serine, aspartic acid and histidine. Of the six transcripts, VfCXE12827 showed upregulated expression against E. ampelina at all time points. Three genes (VfCXE5585, VfCXE12827, and VfCXE13132 showed upregulation, while others (VfCXE17159, VfCXE18231, and VfCXE47674 were down regulated in grapevines infected with Botrytis cinerea. All transcripts showed upregulated expression against Rhizobium vitis at early and later time points except VfCXE12827, and were downregulated for up to 48 hours post inoculation (hpi after upregulation at 1 hpi in response to R. vitis infection. All tested genes showed high and differential expression in response to pathogens, indicating that they all may play a role in defense pathways during pathogen infection in grapevines.

Physical, rheological, functional and film properties of a novel emulsifier: Frost grape polysaccharide (FGP) from Vitis riparia Michx

Science.gov (United States)

A novel emulsifier, Frost grape polysaccharide (FGP), isolated from natural exudate of the species Vitis riparia Michx, was physically and rheologically characterized. The determination of the physical, structural, thermodynamic, emulsification, film, and rheological properties of FGP provide essent...

Host-location behavior of the tea green leafhopper Empoasca vitis Göthe (Hemiptera: Cicadellidae): olfactory and visual effects on their orientation.

Science.gov (United States)

Zhang, X; Pengsakul, T; Tukayo, M; Yu, L; Fang, W; Luo, D

2017-09-25

The tea green leafhopper, Empoasca vitis Göthe, is one of the most serious pests in tea growing areas. This study investigated the roles played by olfaction and vision in host orientation behavior. The compound eye of E. vitis was found to be a photopic eye; few olfactory sensilla were found on the antennae, while abundant gustatory sensilla were recorded on the mouthparts. Three opsin genes (EV_LWop, EV_UVop, EV_Bop) were isolated and found to be mainly expressed in the compound eye compared with other parts of the body. Immunolocalization indicated that the opsins mainly located in the different regions of rhabdom. The transcription levels of EV_LWop, EV_Bop and EV_UVop were reduced by 77.3, 70.0 and 40.0%, respectively, by RNA interference induced by being fed a special RNA-rich diet for 6 days. The rate of tropism to host color was effectively impaired by 67.6 and 29.5% in the dsEV_LWop and dsEV_Bop treatment groups, but there was no significant change in the dsEV_UVop group. The determination of the cause of the tropism indicated that odors from the host over long distances were unable to attract E. vitis and were only detected when the insects were close to the host. The developed compound eye of E. vitis plays a leading role in host location, and the long-wavelength opsin significantly affects the tropism to host color; the lack of olfactory sensilla results in long-distance odors not being able to be detected until the insect is near to the host-plant. The understanding of these behavioral mechanisms, especially the importance of opsin genes is expected to be useful for pest management.

Hidroterapia no equilíbrio dinâmico e nas atividades de vida diária de pacientes com neurotoxoplasmose associada à Síndrome da Imunodeficiência Adquirida

Directory of Open Access Journals (Sweden)

Larissa de Salgado de Oliveira

2016-05-01

Full Text Available Introdução: Por comprometer as células de defesa do organismo, o Vírus da Imunodeficiência Humana torna o indivíduo vulnerável ao aparecimento de diversas doenças, entre elas a neurotoxoplasmose. Objetivo: Verificar a influência de um protocolo de hidroterapia no equilíbrio dinâmico e nas atividades de vida diária de pacientes com neurotoxoplasmose associada à Síndrome da Imunodeficiência Adquirida (SIDA. Métodos: Participaram 15 voluntários, três (20% do sexo feminino e 12 (80% do masculino, com média de idade de 37,44±5,5 anos e diagnóstico de neurotoxoplasmose decorrente da SIDA, cadastrados na Unidade de Referência Especializada em Doenças Infectocontagiosas Parasitárias Especiais. Foram submetidos à avaliação do equilíbrio dinâmico pelo Índice de Marcha Dinâmico e à avaliação das atividades de vida diária pelo Índice de Barthel, pré- e pós-hidroterapia, em piscina à temperatura média de 35°C, três vezes por semana em dias alternados, durante 50 minutos, totalizando oito semanas, ou seja, 24 sessões. Foi utilizado o teste de Shapiro-Wilk para análise de variâncias do Índice de Marcha Dinâmica e do Índice de Barthel, e o teste t de Student para as comparações pré e pós-tratamento e nível de significância de   α=0.05. Resultados: O equilíbrio dinâmico, considerando o escore total, apresentou significância estatística (p<0,0001, quando comparado pós-teste (20,3±2,5 em relação ao pré-teste (13,2±3,2. Quanto às atividades de vida diária, foi evidenciado valor estatisticamente significante (p=0,049 no pós-teste (98,8±2.2 quando comparado ao pré-teste (95,6±3.9. Conclusão: Neste estudo, o protocolo de hidroterapia melhorou o equilíbrio dinâmico e as atividades de vida diária de pacientes com neurotoxoplasmose associada à SIDA.

Wineries Evaluation of Costs and Benefits of Sustainability Certification Program: The Case of Terra Vitis in France.

Science.gov (United States)

Jourjon, Frederique; Chou, Hsia-Chi; Gezart, Anna; Kadison, Amy E; Martinat, Lea; Pomarici, Eugenio; Vecchio, Riccardo

2016-01-01

The current paper analyses the evaluation of the costs and benefits of French wineries (N=69) participating in the sustainability program Terra Vitis, a widespread environmental certification scheme within the French wine industry. An online questionnaire was sent to all Terra Vitis participants, in order to analyse the evaluation of economic costs and benefits (together with environmental benefits) as perceived by wineries. Our findings reveal that older participants in the scheme (over 5 years), firms with higher export share (>40% of annual turnover) and cooperative wineries tend to be keener to assign a positive evaluation to the benefits/costs ratio in both the vineyard and the winery. In the context of increasing concerns regarding the economic and environmental performance of the French agricultural sector, such findings and also the patent research could be useful for policy makers and entrepreneurs in defining mainstream normative and corporate strategies. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.

The Vitis vinifera sugar transporter gene family: phylogenetic overview and macroarray expression profiling

Directory of Open Access Journals (Sweden)

Atanassova Rossitza

2010-11-01

Full Text Available Abstract Background In higher plants, sugars are not only nutrients but also important signal molecules. They are distributed through the plant via sugar transporters, which are involved not only in sugar long-distance transport via the loading and the unloading of the conducting complex, but also in sugar allocation into source and sink cells. The availability of the recently released grapevine genome sequence offers the opportunity to identify sucrose and monosaccharide transporter gene families in a woody species and to compare them with those of the herbaceous Arabidopsis thaliana using a phylogenetic analysis. Results In grapevine, one of the most economically important fruit crop in the world, it appeared that sucrose and monosaccharide transporter genes are present in 4 and 59 loci, respectively and that the monosaccharide transporter family can be divided into 7 subfamilies. Phylogenetic analysis of protein sequences has indicated that orthologs exist between Vitis and Arabidospis. A search for cis-regulatory elements in the promoter sequences of the most characterized transporter gene families (sucrose, hexoses and polyols transporters, has revealed that some of them might probably be regulated by sugars. To profile several genes simultaneously, we created a macroarray bearing cDNA fragments specific to 20 sugar transporter genes. This macroarray analysis has revealed that two hexose (VvHT1, VvHT3, one polyol (VvPMT5 and one sucrose (VvSUC27 transporter genes, are highly expressed in most vegetative organs. The expression of one hexose transporter (VvHT2 and two tonoplastic monosaccharide transporter (VvTMT1, VvTMT2 genes are regulated during berry development. Finally, three putative hexose transporter genes show a preferential organ specificity being highly expressed in seeds (VvHT3, VvHT5, in roots (VvHT2 or in mature leaves (VvHT5. Conclusions This study provides an exhaustive survey of sugar transporter genes in Vitis vinifera and

Efeito de um programa progressivo de exercícios de reabilitação funcional e de orientação de auto cuidado sobre a dor, mobilidade e equilíbrio em portadores de artrite reumatóide

OpenAIRE

Carolina Mendes do Carmo

2009-01-01

Introdução: Dor e deformidade nos pés são queixas comuns na Artrite Reumatóide (AR) promovendo alterações no equilíbrio e na mobilidade funcional. A informação somatossensorial dos pés e tornozelos para a regulação da postura e manutenção do equilíbrio tem sido discutida na literatura e apregoa-se que a integridade do pé e da sua informação sensorial são fundamentais para a estabilidade postural. Os programas propostos neste trabalho para estes pacientes integram atenção para a dor e para as ...

Data on antioxidant activity in grapevine (Vitis vinifera L.) following cryopreservation by vitrification

OpenAIRE

María Fernanda Lazo-Javalera; Martín Ernesto Tiznado-Hernández; Irasema Vargas-Arispuro; Elisa Valenzuela-Soto; María del Carmen Rocha-Granados; Marcos Edel Martínez-Montero; Marisela Rivera-Domínguez

2015-01-01

Cryopreservation is used for the long-term conservation of plant genetic resources. This technique very often induces lethal injury or tissue damage. In this study, we measured indicators of viability and cell damage following cryopreservation and vitrification-cryopreservation in Vitis vinifera L. axillary buds cv. ?Flame seedless? stored in liquid nitrogen (LN) for: three seconds, one hour, one day, one week and one month; after LN thawed at 38??C for three minutes. The enzymatic activity o...

Differences in the Phenolic Composition and Antioxidant Properties between Vitis coignetiae and Vitis vinifera Seeds Extracts

Directory of Open Access Journals (Sweden)

Ryszard Amarowicz

2013-03-01

Full Text Available Phenolic compounds were extracted from European and Japanese grapevine species (Vitis vinifera and V. coignetiae seeds using 80% methanol or 80% acetone. The total content of phenolic compounds was determined utilizing Folin-Ciocalteu’s phenol reagent, while the content of tannins was assayed by the vanillin and BSA precipitation methods. Additionally, the DPPH free radical and ABTS cation radical scavenging activities and the reduction power of the extracts were measured. The HPLC method was applied to determine the phenolic compounds, such as phenolic acids and catechins. The seeds contained large amounts of tannins and gallic acid and observable quantities of catechins, p-coumaric, ferulic and caffeic acids. The dominant form of phenolic acids in the extracts was the ester-bound form. The content of total phenolics was higher in the European grape V. vinifera seeds, which also contained more tannins, catechins and phenolic acids, except for caffeic acid. Extracts from V. vinifera seeds showed better radical scavenger properties and stronger reducing power. The total contents of phenolic compounds and tannins in acetone extracts were higher than in methanolic extracts. Acetone extracts also exhibited stronger antiradical properties as well as stronger reducing power.

Balance in Parkinson's disease patients changing the visual input Equilíbrio na doença de Parkinson alterando as informações visuais

Directory of Open Access Journals (Sweden)

Hamlet Suarez

2011-10-01

Full Text Available The description of the postural responses in Parkinson's disease patients when visual information changes from a stable to a moving visual field analyzing the impact on balance in these patients. METHODS (CLINICAL: Limits of Stability, Body center of pressure and balance functional reserve were measured by means of the force platform in 24 Parkinson´s patients in stages 1 and 2 of the Boher classification and 19 volunteers as a control group. Both groups were stimulated with 1-Static visual field and 2-horizontal optokinetic stimulation using a virtual reality system. Postural responses were analyzed using the inverted pendulum as mathematical model. RESULTS: While the control group didn't show significant differences on the postural control between the two sensory conditions (COP p=0.0017, BFR p=0.0025, Parkinson's patients presented significant differences in the area of the center of pressure and the balance functional reserve values between static visual field and optokinetic stimulation. (COP p=0.0017, BFR p=0.0025. CONCLUSIONS: The results support the hypothesis about the influence of the changes in the visual information in triggering balance control disorders in Parkinson's patients. It is discussed the interest of these fact in the assessment and the rehabilitation programs of this disease.Descrição das respostas posturais em pacientes com doença de Parkinson quando a informação visual muda de um campo visual estável para um móvel, analisando o impacto do equilíbrio nesses pacientes. MÉTODOS (CLÍNICO: Limites de estabilidade, centro de pressão corporal e reserva funcional do equilíbrio foram medidos em uma plataforma de força em 24 pacientes com doença de Parkinson nos estágios 1 e 2 da classificação de Boher e em 19 voluntários de um grupo controle. Ambos os grupos foram estimulados a partir de um campo visual estático e dois estímulos optocinéticos horizontais, usando-se um sistema de realidade virtual. As

Antibacterial Actions and Potential Phototoxic Effects of Volatile oils of Foeniculum sp. (fennel, Salvia sp. (sage, Vitis sp. (grape, Lavandula sp. (lavender

Directory of Open Access Journals (Sweden)

Elif Ayse Erdogan Eliuz

2016-09-01

Full Text Available In the present study, the volatile compounds of essential oil of Foeniculum vulgare (fennel, Salvia officinalis (sage, Vitis vinifera (grape, Lavandula angustifolia (lavender were analysed by gas chromatography-mass spectrometry (GC-MS using the Nist and Willey libraries. It was determined that the main components of Foeniculum sp. were anethole (41.11%, carvacrol (9.18%. whereas main components of Salvia sp were 1.8 cineole (34.09%, caryophyllene (10.95%, camphor (9.44%, α-pinene (8.42%. Vitis sp. contained linoleic acid (36.98%, 2,4-decadienal (30.79%. Finally, volatile component of Lavandula sp. was linalool (33.57%, linalyl acetate (30.74%. Photoxic antibacterial activity of volatile oil of those plants against Escherichia coli (ATCC 25293, Klebsiella pneumoniae (10031, Salmonella thyphimurium, Bacillus subtilis (ATCC 6633, Staphylococcus aureus (ATCC 25925, Enterococcus feacalis (ATCC 29212 were examined by using disc diffusion method. We demonstrated that volatile oil effectively can be activated by a standard LED light. In vitro, significant phototoxicity was demonstrated by volatile oil of Foeniculum sp. and Vitis sp. (P < 0.05, while minor phototoxicity was induced by Lavandula sp. Therefore, volatile oil of plant can be considered as a potential photosensitizer in the photochemical therapy.

Análise Comparativa do Equilíbrio Quase Estático entre Praticantes de Muay-Thai de Diferentes Níveis de Aprendizado

OpenAIRE

Brigida, Patricia Aparecida; Possamai, Fernando; Nascimento Júnior, José Roberto Andrade do; Jacob, Weslei; Oliveira, Daniel Vicentini de

2016-01-01

Este estudo teve como objetivo analisar e comparar o equilíbrio quase estático de praticantes de Muay-Thai de diferentes níveis de aprendizado. Trata-se de um estudo transversal, no qual a amostra foi constituída de 20 praticantes de Muay-Thai, sendo 10 do Grupo Iniciante e 10 do Grupo Avançado de aprendizagem da modalidade. O instrumento utilizado para a coleta de dados foi a plataforma de força da marca EMG System do Brasil, modelo Biomec 4000. O protocolo aplicado foi a Estabilometria. Cad...

Equilíbrio líquido-vapor de solventes na presença de solutos não voláteis

OpenAIRE

Parente, Bruno Miguel Ramos

2009-01-01

Neste trabalho estudou-se o efeito da adição de alguns sais e líquidos iónicos no equilíbrio líquido-vapor (ELV) de algumas misturas importantes na indústria química, tais como etanol + água, 1-propanol + água, 2-propanol + água, acetona + metanol, acetato de metilo + metanol e clorofórmio + etanol. O conjunto de solutos não voláteis estudados é formado por Ca(NO3)2, CuCl2, NaI, KI, LiNO3, LiCl, NaSCN, KCH3COO, CaCl2, [BMIM][Cl] e [EMIM][triflate]. Em primeiro lugar, realizo...

Rescate de embriones para la obtención de vitroplantas de vid (Vitis vinífera L.

Directory of Open Access Journals (Sweden)

César Augusto Hernández Rendón

2013-07-01

Full Text Available Título en ingles: Embryos rescue for the obtaining of grapevine (Vitis vinifera L. vitroplants Resumen: Este trabajo es la primera fase de un macroproyecto sobre la optimización de un protocolo para la obtención de metabolitos secundarios de interés comercial mediante la utilización de suspensiones celulares de Vid (Vitis vinífera L.. Se investigó el rescate de embriones como alternativa para la obtención de vitroplantas de vid (Vitis vinífera L.. El material vegetal utilizado se obtuvo de frutos de vid variedad Red Globe comerciales. Las semillas se desinfectaron sumergiéndolas en 5 g/l de ácido dicloroisocianúrico (NaDCC por 15 min y luego en 2 g/l de Benomyl® por 15 min, con una efectividad del 92%. Se realizaron diferentes tratamientos para la obtención de plántulas utilizando semillas como explantes, las cuales se cultivaron en el medio Murashige Skoog suplementado con diferentes concentraciones de ácido indolacético (AIA en combinación con ácido giberélico (AG3 y kinetina (K sin obtener respuesta favorable para la germinación. Como alternativa, se extrajeron semillas inmaduras de frutos de la planta y se colocaron en el mismo medio  pero suplementado con 100 mg/l de polivinilpirrolidona (PVP, 0.35 mg/l de AG3 y 1.75 mg/l de AIA por un mes. Posteriormente, se abrieron las semillas y se realizó el rescate de embriones, sembrándolos bajo condiciones de oscuridad por ocho días en los medios de cultivo Murashige Skoog 1 y 2 modificados, encontrando la formación de vitroplantas en un 40% al mes de cultivo.   Abstract: This work is the first phase of a macroproyect about the optimization of a protocol for the obtaining of secondary metabolites of commercial interest by means of the use of cellular suspensions of Vitis vinífera L. The embryos rescue was investigated as alternative for the obtaining of grapevine (Vitis vinífera L. vitroplants. The vegetable material used was obtained from commercial fruits of

BENEFÍCIOS DA EQUOTERAPIA NO EQUILÍBRIO DE UM INDIVIDUO HEMIPARÉTICO PÓS TRAUMATISMO CRANIOENCEFÁLCO: ESTUDO DE CASO

OpenAIRE

Patias, Cristiane Grandotto; Hammes, Sidinei Both; Mürmann, Cinara Valency Enéas

2012-01-01

O Trauma Crânio Encefálico (TCE) é uma doença do Sistema Nervoso Central, causada por uma agressão de força física diretamente no crânio. O local da lesão, bem como a extensão da mesma, determina as manifestações clínicas que o indivíduo irá apresentar como a hemiparesia. Este estudo tem como objetivo verificar os efeitos do treino de equilíbrio através da Equoterapia em um paciente com Hemiparesia direita decorrente de TCE. Método: Foi realizado avaliação pré e pós terapia, através da Escala...

Influenza A (H1N1) neuraminidase inhibitors from Vitis amurensis

DEFF Research Database (Denmark)

Nguyen, Ngoc Anh; Dao, Trong Tuan; Tung, Bui Thanh

2011-01-01

Recently, a novel H1N1 influenza A virus (H1N1/09 virus) was identified and considered a strong candidate for a novel influenza pandemic. As part of an ongoing anti-influenza screening programme on natural products, eight oligostilbenes were isolated as active principles from the methanol extract...... of Vitis amurensis. This manuscript reports the isolation, structural elucidation, and anti-viral activities of eight compounds on various neuraminidases from influenza A/PR/8/34 (H1N1), novel swine-origin influenza A (H1N1), and oseltamivir-resistant novel H1N1 (H274Y) expressed in 293T cells...

Safety assessment of Vitis vinifera (grape)-derived ingredients as used in cosmetics.

Science.gov (United States)

Fiume, Monice M; Bergfeld, Wilma F; Belsito, Donald V; Hill, Ronald A; Klaassen, Curtis D; Liebler, Daniel C; Marks, James G; Shank, Ronald C; Slaga, Thomas J; Snyder, Paul W; Andersen, F Alan

2014-01-01

The Cosmetic Ingredient Review Expert Panel (Panel) assessed the safety of 24 Vitis vinifera (grape)-derived ingredients and found them safe in the present practices of use and concentration in cosmetics. These ingredients function in cosmetics mostly as skin-conditioning agents, but some function as antioxidants, flavoring agents, and/or colorants. The Panel reviewed the available animal and clinical data to determine the safety of these ingredients. Additionally, some constituents of grapes have been assessed previously for safety as cosmetic ingredients by the Panel, and others are compounds that have been discussed in previous Panel safety assessments. © The Author(s) 2014.

vitisFlower®: Development and Testing of a Novel Android-Smartphone Application for Assessing the Number of Grapevine Flowers per Inflorescence Using Artificial Vision Techniques.

Science.gov (United States)

Aquino, Arturo; Millan, Borja; Gaston, Daniel; Diago, María-Paz; Tardaguila, Javier

2015-08-28

Grapevine flowering and fruit set greatly determine crop yield. This paper presents a new smartphone application for automatically counting, non-invasively and directly in the vineyard, the flower number in grapevine inflorescence photos by implementing artificial vision techniques. The application, called vitisFlower(®), firstly guides the user to appropriately take an inflorescence photo using the smartphone's camera. Then, by means of image analysis, the flowers in the image are detected and counted. vitisFlower(®) has been developed for Android devices and uses the OpenCV libraries to maximize computational efficiency. The application was tested on 140 inflorescence images of 11 grapevine varieties taken with two different devices. On average, more than 84% of flowers in the captures were found, with a precision exceeding 94%. Additionally, the application's efficiency on four different devices covering a wide range of the market's spectrum was also studied. The results of this benchmarking study showed significant differences among devices, although indicating that the application is efficiently usable even with low-range devices. vitisFlower is one of the first applications for viticulture that is currently freely available on Google Play.

vitisFlower®: Development and Testing of a Novel Android-Smartphone Application for Assessing the Number of Grapevine Flowers per Inflorescence Using Artificial Vision Techniques

Directory of Open Access Journals (Sweden)

Arturo Aquino

2015-08-01

Full Text Available Grapevine flowering and fruit set greatly determine crop yield. This paper presents a new smartphone application for automatically counting, non-invasively and directly in the vineyard, the flower number in grapevine inflorescence photos by implementing artificial vision techniques. The application, called vitisFlower®, firstly guides the user to appropriately take an inflorescence photo using the smartphone’s camera. Then, by means of image analysis, the flowers in the image are detected and counted. vitisFlower® has been developed for Android devices and uses the OpenCV libraries to maximize computational efficiency. The application was tested on 140 inflorescence images of 11 grapevine varieties taken with two different devices. On average, more than 84% of flowers in the captures were found, with a precision exceeding 94%. Additionally, the application’s efficiency on four different devices covering a wide range of the market’s spectrum was also studied. The results of this benchmarking study showed significant differences among devices, although indicating that the application is efficiently usable even with low-range devices. vitisFlower is one of the first applications for viticulture that is currently freely available on Google Play.

Avaliação da temperatura do motor de indução trifásico submetido a desequilíbrio de tensão

OpenAIRE

Almeida, Maria Leonor Silva de

2013-01-01

A Qualidade da Energia Elétrica está associada ao grupo de fatores capazes de alterar, ou até mesmo comprometer as características das tensões de alimentação fornecidas aos consumidores. Desse conjunto de elementos, destaca-se o desequilíbrio de tensão, cuja presença causa sobreaquecimentos elevados e, consequentemente, possíveis reduções na vida útil dos equipamentos. Em decorrência da importância do tema, atualmente, muitas pesquisas têm sido desenvolvidas destinadas à identificação dos efe...

Environmental Factors Correlated with the Metabolite Profile of Vitis vinifera cv. Pinot Noir Berry Skins along a European Latitudinal Gradient

Czech Academy of Sciences Publication Activity Database

Del-Castillo-Alonso, M. Á.; Castagna, A.; Csepregi, K.; Hideg, É.; Jakab, G.; Jansen, M. A. K.; Jug, T.; Llorens, L.; Mátai, A.; Martínez-Lüscher, J.; Monforte, L.; Neugart, S.; Olejníčková, Julie; Ranieri, A.; Schödl-Hummel, K.; Schreiner, M.; Soriano, G.; Teszlák, P.; Tittmann, S.; Urban, Otmar; Verdaguer, D.; Zipoli, G.; Martínez-Abaigar, J.; Núñez-Olivera, E.

2016-01-01

Roč. 64, č. 46 (2016), s. 8722-8734 ISSN 0021-8561 Institutional support: RVO:67179843 Keywords : berry skins * Europe * hydroxylation ratios * latitudinal gradient * phenolic composition * solar radiation * ultraviolet radiation * Vitis vinifera cv. Pinot Noir Subject RIV: EH - Ecology, Behaviour Impact factor: 3.154, year: 2016

Colaspis caligula, a new species found in association with Vitis vinifera (L.) crops in Argentina (Coleoptera: Chrysomelidae).

Science.gov (United States)

Agrain, Federico A; Cabrera, Nora; Holgado, Miriam G; Vicchi, Franco R

2016-09-05

Some species of Colaspis Fabricius are well-known pests of several crops in Argentina. In this contribution, we describe a new species within this genus: Colaspis caligula n. sp., found in association with Vitis vinifera (Linnaeus) crops. We provide descriptions and illustrations of the mature larva, pupa and adult, as well as notes on its diagnostic characters, life cycle, and the damages produced to the plants.

Data on antioxidant activity in grapevine (Vitis vinifera L.) following cryopreservation by vitrification.

Science.gov (United States)

Lazo-Javalera, María Fernanda; Tiznado-Hernández, Martín Ernesto; Vargas-Arispuro, Irasema; Valenzuela-Soto, Elisa; Rocha-Granados, María Del Carmen; Martínez-Montero, Marcos Edel; Rivera-Domínguez, Marisela

2015-12-01

Cryopreservation is used for the long-term conservation of plant genetic resources. This technique very often induces lethal injury or tissue damage. In this study, we measured indicators of viability and cell damage following cryopreservation and vitrification-cryopreservation in Vitis vinifera L. axillary buds cv. "Flame seedless" stored in liquid nitrogen (LN) for: three seconds, one hour, one day, one week and one month; after LN thawed at 38 °C for three minutes. The enzymatic activity of catalase (CAT) and superoxide dismutase (SOD), as well as the amount of malondialdehyde (MDA), total protein and viability were assayed.

Data on antioxidant activity in grapevine (Vitis vinifera L. following cryopreservation by vitrification

Directory of Open Access Journals (Sweden)

María Fernanda Lazo-Javalera

2015-12-01

Full Text Available Cryopreservation is used for the long-term conservation of plant genetic resources. This technique very often induces lethal injury or tissue damage. In this study, we measured indicators of viability and cell damage following cryopreservation and vitrification-cryopreservation in Vitis vinifera L. axillary buds cv. “Flame seedless” stored in liquid nitrogen (LN for: three seconds, one hour, one day, one week and one month; after LN thawed at 38 °C for three minutes. The enzymatic activity of catalase (CAT and superoxide dismutase (SOD, as well as the amount of malondialdehyde (MDA, total protein and viability were assayed.

Eficácia de tratamento fisioterapêutico no equilíbrio estático e dinâmico de pacientes com doença de Parkinson Effectiveness of a physical therapy treatment on static and dynamic balance of subjects with Parkinson's disease

Directory of Open Access Journals (Sweden)

Gustavo Christofoletti

2010-09-01

Full Text Available Distúrbios de equilíbrio são um dos sinais mais prevalentes na doença de Parkinson (DP, que contribuem para a perda da independência funcional dos sujeitos acometidos. O objetivo deste trabalho foi verificar a eficácia de um programa de treinamento fisioterapêutico específico sobre o equilíbrio estático e dinâmico de pacientes com DP. Vinte e três pacientes com DP idiopática, divididos em dois grupos, experimental e controle, foram avaliados pela escala de equilíbrio funcional de Berg e pelo teste de levantar e caminhar cronometrado (timed up & go. O grupo experimental foi submetido a uma seqüência de exercícios fisioterapêuticos de estimulação motora e cognitiva, com freqüência de três atendimentos semanais durante seis meses. Após o tratamento, foi constatada uma melhora significativa do equilíbrio dos pacientes do grupo experimental em relação ao controle (pBalance disorders are one of the most prevalent signs in Parkinson's disease (PD and are commonly associated to loss of independence. The aim of this study was to assess the effectiveness of a specific physical therapy training program on PD patients' static and dynamic balance. This controlled clinical trial assessed 23 patients with idiopathic PD, divided into experimental and control groups, by means of the Berg balance scale and the timed up-&-go test. The experimental group was submitted to a six-month protocol of physiotherapy exercises emphasising motor and cognitive function at the rate of three one-hour sessions per week. After treatment, results showed a significant improvement (p<0.05 in PD subjects' balance as compared to control group in both tests. The proposed physical therapy protocol of associated motor and cognitive stimuli thus proved effective in improving static and dynamic balance in subjects with Parkinson's disease.

The Rhizosphere Bacterial Microbiota of Vitis vinifera cv. Pinot Noir in an Integrated Pest Management Vineyard

OpenAIRE

Novello, Giorgia; Gamalero, Elisa; Bona, Elisa; Boatti, Lara; Mignone, Flavio; Massa, Nadia; Cesaro, Patrizia; Lingua, Guido; Berta, Graziella

2017-01-01

Microorganisms associated with Vitis vinifera (grapevine) can affect its growth, health and grape quality. The aim of this study was to unravel the biodiversity of the bacterial rhizosphere microbiota of grapevine in an integrated pest management vineyard located in Piedmont, Italy. Comparison between the microbial community structure in the bulk and rhizosphere soil (variable: space) were performed. Moreover, the possible shifts of the bulk and rhizosphere soil microbiota according to two ph...

Análise da concordância entre instrumentos de avaliação do equilíbrio corporal em idosos Analysis of agreement of assessment tools of body balance in the elderly

Directory of Open Access Journals (Sweden)

Aline H Karuka

2011-12-01

Full Text Available CONTEXTUALIZAÇÃO: Diagnosticar os parâmetros clínicos associados com as quedas em idosos tornou-se um grande desafio para a comunidade científica. Apesar da existência de diversos instrumentos direcionados à avaliação do equilíbrio corporal em idosos, ainda é escasso o número de trabalhos que investigaram e discutiram a concordância entre os diversos métodos. OBJETIVO: Analisar a correlação entre alguns testes usados para avaliar o equilíbrio corporal no idoso. MÉTODOS: Tratou-se de um estudo transversal, observacional, realizado com 30 voluntárias idosas comunitárias, hígidas, com diferentes níveis de condicionamento físico. Foram utilizados o Teste de Alcance Funcional Anterior (TAF, a Escala de Equilíbrio de Berg (EEB, o teste Timed Up and Go (TUG e o Teste de Equilíbrio de Tinetti (Performance Oriented Mobility Assessment - POMA. A correlação dos dados foi realizada por meio da aplicação do Coeficiente de Correlação de Spearman, com nível de significância de 5% (pBACKGROUND: The diagnosis of clinical parameters associated with falls in the elderly has become a major challenge for the scientific community. Despite the existence of several tools aiming to assess body balance in the elderly, it is still scarce the number of studies that have investigated and discussed the agreement between different methods. OBJECTIVE: To analyze the correlation between tests used to assess the body balance in the elderly. METHODS: This was a cross-sectional, observational study conducted with 30 healthy female community-dwelling elderly volunteers with different levels of physical conditioning. The Functional Reach Test (FRT, the Berg Balance Scale (BBS, the Timed Up and Go (TUG and the Performance-Oriented Mobility Assessment of Balance (POMA were used. The data analysis was performed by using the Spearmam's rank correlation coefficient, with a significance level of 5% (p<0.05. RESULTS: There was positive and moderate

Characterisation of the oxygen fluxes in the division, elongation and mature zones of Vitis roots: influence of oxygen availability.

Science.gov (United States)

Mancuso, Stefano; Boselli, Maurizio

2002-03-01

Oxygen fluxes into and from root cells of Vitis rupestris (flooding sensitive), V. riparia (flooding tolerant) and V. vinifera (medium tolerance to flooding) were measured under different levels of O2 availability using a recently developed polarographic O2-selective, vibrating-microelectrode system. The system enables fluxes to be measured with a spatial resolution of 2-3 microm and a temporal resolution of 10 s. No difference in root porosity was found among the genotypes when grown for 30 days in an aerated solution. Under normoxic conditions, O2 influx was characterised by two distinct peaks, one in the division zone and the other in the elongation zone of the roots. This pattern was found in all three species studied, although the fluxes showed a different magnitude. The peak in the elongation zone coincided with maximum relative elemental growth rates. When the energetics of the cell was disturbed by cyanide, both growth and oxygen O2 influxes ceased at the same time. Under hypoxic conditions, V. riparia plants showed a precise strategy directed toward the maintenance of enough O2 for the respiratory needs of mitosis in the apical meristem of the roots. Thus, whereas in the division zone of V. rupestris and V. vinifera, at bulk O2 concentrations of 0.094 mol x m(-3), the O2 influx was reduced by 70.5 and 38.5%, respectively, for V. riparia no variation in the O2 influx was detected down to bulk O2 concentrations of 0.078 mol x m(-3). Moreover, in accordance with the different tolerances of the plants, the Vitis genotypes were found to differ in their radial O2 loss from the adventitious roots when in an O2-free environment. The results are discussed in terms of possible mechanisms of response to anoxia in Vitis species with different tolerances to flooding.

Análise da pressão plantar e do equilíbrio postural em diferentes fases da gestação

OpenAIRE

Ribas, SI; Guirro, ECO

2007-01-01

OBJETIVO: Analisar a pressão plantar e o equilíbrio postural nos três trimestres de gravidez, bem como a correlação com as características antropométricas. METODOLOGIA: 60 voluntárias com idade média de 23,3 ± 5,5 anos, sendo 15 mulheres em cada grupo: não-gestantes (C), primeiro (1T), segundo (2T) e terceiro trimestre (3T). A avaliação foi efetuada por meio de plataforma de pressão na posição bipodal com os olhos abertos. As variáveis analisadas nos pés direito e esquerdo foram: pico de pres...

VvWRKY13 enhances ABA biosynthesis in Vitis vinifera

Directory of Open Access Journals (Sweden)

JIe Hao

2017-06-01

Full Text Available Abscisic acid (ABA plays critical roles in plant growth and development as well as in plants’ responses to abiotic stresses. We previously isolated VvWRKY13, a novel transcription factor, from Vitis vinifera (grapevine, and here we present evidence that VvWRKY13 may regulate ABA biosynthesis in plants. When VvWRKY13 was ectopically expressed in Arabidopsis, the transgenic lines showed delayed seed germination, smaller stomatal aperture size, and several other phenotypic changes, indicating elevated ABA levels in these plants. Sequence analysis of several genes that are involved in grapevine ABA synthetic pathway identified WRKY-specific binding elements (W-box or W-like box in the promoter regions. Indeed, transient overexpression of VvWRKY13 in grapevine leaves significantly increased the transcript levels of ABA synthetic pathway genes. Taken together, we conclude that VvWRKY13 may promote ABA production by activating genes in the ABA synthetic pathway.

Physiological behaviors and recovery responses of four Galician grapevine (Vitis vinifera L. ) cultivars under water stress

OpenAIRE

Islam, M.; Berrios, J.

2012-01-01

Gas exchange parameters and chlorophyll fluorescence of four pot grown Galician grapevines (Vitis vinifera L. cv. Albariño, Brancellao, Godello and Treixadura) were examined under different levels of water stress in greenhouse. After extreme stress, gas exchange recovery responses were evaluated. Average ΨPD for control and stressed plants were -0.4MPa and -1.45MPa respectively. All varieties showed gradual declining of all gas exchange parameters (gs, E and A) with increasing of stress perio...

Equilíbrio, coordenação e agilidade de idosos submetidos à prática de exercícios físicos resistidos Balance, coordination and agility of older individuals submitted to physical resisted exercises practice

Directory of Open Access Journals (Sweden)

Andressa da Silva

2008-04-01

Full Text Available OBJETIVOS: Avaliar o equilíbrio, a coordenação e a agilidade dos idosos submetidos a exercícios físicos. MÉTODOS: 61 idosos do gênero masculino, com idades entre os 60-75 anos, designados aleatoriamente para um grupo de exercícios resistidos com carga progressiva (n=39 ou para um controle submetido a exercícios sem carga (n=22. O grupo exercício resistido participou de um programa de 24 semanas, com 3 visitas por semana, em dias não consecutivos. Foram avaliados após o término do treinamento, pela Escala de Equilíbrio de Berg, do Teste de Tinetti e do Timed UP & GO. RESULTADOS: Comparando-se os dois grupos verificou-se um melhor desempenho estatisticamente significativo para o grupo experimental em relação ao controle para os testes Timed "Up & Go". (p=0,02 e para o Tinetti Total (p=0.046 e para o Tinetti marcha (p=0.029. Desta forma, não encontramos diferença na Escala de Equilíbrio de Berg e no teste de Tinetti equilíbrio. CONCLUSÃO: O programa de treinamento de força durante 24 semanas mostrou-se favorável na melhora dos desempenhos funcional e motores de idosos.OBJECTIVES: To evaluate balance, coordination and agility of older subjects submitted to physical exercise. METHODS: 61 male older subjects, aged between 60-75 years, randomly assigned to a resisted exercises with gradual load (n=39 group or to a control group submitted to exercise without load (n=22. The resisted exercise group participated in a 24 week-program, with 3 weekly visits, in not consecutive days. After the training ending, they were evaluated through the Berg Balance Scale and the Tinetti and Timed UP & GO tests. RESULTS: Comparing the two groups, better statistical significant performance was verified for the experimental group for the Timed "Up & Go" (p=0.02, for the Total Tinetti (p=0.046 and for the Tinetti gait tests (p=0.029. Therefore, we did not find difference in the Berg Balance Scale or in the Tinetti balance test. CONCLUSION: The

A thaumatin-like genomic sequence identification in Vitis vinifera l., stormy wines and musts based on direct pcr

Directory of Open Access Journals (Sweden)

Jana Žiarovská

2018-03-01

Full Text Available Normal 0 21 false false false MicrosoftInternetExplorer4 Direct polymerase chain reaction method was use to amplify a thaumatin-like sequence of Vitis vinifera L. in grapes as well as in stormy wines and musts. Thaumatin-like proteins (TLPs of Vitis vinifera possess beside its function in abiotic and biotic stress response another one - they are able to cause protein haze in wine unless removed prior to bottling. Direct PCR is an approach where omission of DNA extraction is typical prior the amplification of the target site of plant genome. Crude extract or small pieces of plant tissues are used in the analysis directly without steps of extraction and purification of gDNA. The biological material that was used in analysis was collected during August - October 2017 in local stores and winery Sabo and comprises from cultivars Iršai, Muškát, Savignon Blanc, Svätovavrinecké, Dornfelder and Pálava. Direct PCR was performed by a cutted piece of grape tissue and a dilution buffer was use in 1:2 for stormy wine or must, respectively. Direct amplification of thaumatin-like protein sequence of Vitis vinifera was performed along with the control reactions with the primers for conserved region of plant chloroplast. Possitive amplification of thaumatin-like allergen sequence resulted in 570 bp amplicon. The most abundant amplicons were amplified in stormy wines, followed by musts and the amplicons from grapes were weaker when comparing them to others. The amplicon specificity checking of obtained PCR product of thaumatin-like allergen was performed by restriction cleavage by Psi I and resulted in restriction amplicons of the 80 bp, 81 bp, 94 bp and 315 bp in length. Confirmation of the amplicon specificity by restriction cleavage support the potential of direct PCR to become a reproducible method that will be fully applicable in routine analysis of not only plant genomes in the future, but it was demonstrated, that it works in liquids, too.  

Identification of microRNAs from Amur grape (Vitis amurensis Rupr.) by deep sequencing and analysis of microRNA variations with bioinformatics.

Science.gov (United States)

Wang, Chen; Han, Jian; Liu, Chonghuai; Kibet, Korir Nicholas; Kayesh, Emrul; Shangguan, Lingfei; Li, Xiaoying; Fang, Jinggui

2012-03-29

MicroRNA (miRNA) is a class of functional non-coding small RNA with 19-25 nucleotides in length while Amur grape (Vitis amurensis Rupr.) is an important wild fruit crop with the strongest cold resistance among the Vitis species, is used as an excellent breeding parent for grapevine, and has elicited growing interest in wine production. To date, there is a relatively large number of grapevine miRNAs (vv-miRNAs) from cultivated grapevine varieties such as Vitis vinifera L. and hybrids of V. vinifera and V. labrusca, but there is no report on miRNAs from Vitis amurensis Rupr, a wild grapevine species. A small RNA library from Amur grape was constructed and Solexa technology used to perform deep sequencing of the library followed by subsequent bioinformatics analysis to identify new miRNAs. In total, 126 conserved miRNAs belonging to 27 miRNA families were identified, and 34 known but non-conserved miRNAs were also found. Significantly, 72 new potential Amur grape-specific miRNAs were discovered. The sequences of these new potential va-miRNAs were further validated through miR-RACE, and accumulation of 18 new va-miRNAs in seven tissues of grapevines confirmed by real time RT-PCR (qRT-PCR) analysis. The expression levels of va-miRNAs in flowers and berries were found to be basically consistent in identity to those from deep sequenced sRNAs libraries of combined corresponding tissues. We also describe the conservation and variation of va-miRNAs using miR-SNPs and miR-LDs during plant evolution based on comparison of orthologous sequences, and further reveal that the number and sites of miR-SNP in diverse miRNA families exhibit distinct divergence. Finally, 346 target genes for the new miRNAs were predicted and they include a number of Amur grape stress tolerance genes and many genes regulating anthocyanin synthesis and sugar metabolism. Deep sequencing of short RNAs from Amur grape flowers and berries identified 72 new potential miRNAs and 34 known but non-conserved mi

Identification of microRNAs from Amur grape (vitis amurensis Rupr. by deep sequencing and analysis of microRNA variations with bioinformatics

Directory of Open Access Journals (Sweden)

Wang Chen

2012-03-01

Full Text Available Abstract Background MicroRNA (miRNA is a class of functional non-coding small RNA with 19-25 nucleotides in length while Amur grape (Vitis amurensis Rupr. is an important wild fruit crop with the strongest cold resistance among the Vitis species, is used as an excellent breeding parent for grapevine, and has elicited growing interest in wine production. To date, there is a relatively large number of grapevine miRNAs (vv-miRNAs from cultivated grapevine varieties such as Vitis vinifera L. and hybrids of V. vinifera and V. labrusca, but there is no report on miRNAs from Vitis amurensis Rupr, a wild grapevine species. Results A small RNA library from Amur grape was constructed and Solexa technology used to perform deep sequencing of the library followed by subsequent bioinformatics analysis to identify new miRNAs. In total, 126 conserved miRNAs belonging to 27 miRNA families were identified, and 34 known but non-conserved miRNAs were also found. Significantly, 72 new potential Amur grape-specific miRNAs were discovered. The sequences of these new potential va-miRNAs were further validated through miR-RACE, and accumulation of 18 new va-miRNAs in seven tissues of grapevines confirmed by real time RT-PCR (qRT-PCR analysis. The expression levels of va-miRNAs in flowers and berries were found to be basically consistent in identity to those from deep sequenced sRNAs libraries of combined corresponding tissues. We also describe the conservation and variation of va-miRNAs using miR-SNPs and miR-LDs during plant evolution based on comparison of orthologous sequences, and further reveal that the number and sites of miR-SNP in diverse miRNA families exhibit distinct divergence. Finally, 346 target genes for the new miRNAs were predicted and they include a number of Amur grape stress tolerance genes and many genes regulating anthocyanin synthesis and sugar metabolism. Conclusions Deep sequencing of short RNAs from Amur grape flowers and berries identified 72

Frost Grape Polysaccharide (FGP), an emulsion-forming arabinogalactan gum from the stems of native North American grape species Vitis riparia Michx

Science.gov (United States)

A new arabinogalactan is described that is produced in large quantity from the cut stems of the North American grape species Vitis riparia (Frost grape). The sugar composition consists of L-arabinofuranose (L-Araf, 55.2 %) and D-galactopyranose (D-Galp 30.1%), with smaller components of D-xylose (11...

Good quality Vitis RNA obtained from an adapted DNA isolation protocol

Directory of Open Access Journals (Sweden)

Isabel Baiges

2003-03-01

Full Text Available Grapevine is a woody plant, whose high carbohydrate and phenolic compound contents usually interferes with nucleic acid isolation. After we tried several protocols for isolating RNA from the Vitis rootstock Richter- 110 (R-110 with little or no success, we adapted a method reported to be satisfactory for grapevine DNA isolation, to extract RNA. With slight protocol modifications, we succeeded to obtain polysaccharide- and phenolic-free RNA preparations from all vegetative tissues, without excessive sample handling. RNA isolated by the reported method permitted to obtain highly pure mRNA (messenger RNA to construct a cDNA (complementary DNA library and allowed gene transcription analysis by reverse Northern, which guarantees RNA integrity. This method may also be suitable for other plant species with high polysaccharide or phenolic contents.

Comparative expression profiling in grape (Vitis vinifera berries derived from frequency analysis of ESTs and MPSS signatures

Directory of Open Access Journals (Sweden)

Cook Douglas R

2008-05-01

Full Text Available Abstract Background Vitis vinifera (V. vinifera is the primary grape species cultivated for wine production, with an industry valued annually in the billions of dollars worldwide. In order to sustain and increase grape production, it is necessary to understand the genetic makeup of grape species. Here we performed mRNA profiling using Massively Parallel Signature Sequencing (MPSS and combined it with available Expressed Sequence Tag (EST data. These tag-based technologies, which do not require a priori knowledge of genomic sequence, are well-suited for transcriptional profiling. The sequence depth of MPSS allowed us to capture and quantify almost all the transcripts at a specific stage in the development of the grape berry. Results The number and relative abundance of transcripts from stage II grape berries was defined using Massively Parallel Signature Sequencing (MPSS. A total of 2,635,293 17-base and 2,259,286 20-base signatures were obtained, representing at least 30,737 and 26,878 distinct sequences. The average normalized abundance per signature was ~49 TPM (Transcripts Per Million. Comparisons of the MPSS signatures with available Vitis species' ESTs and a unigene set demonstrated that 6,430 distinct contigs and 2,190 singletons have a perfect match to at least one MPSS signature. Among the matched sequences, ESTs were identified from tissues other than berries or from berries at different developmental stages. Additional MPSS signatures not matching to known grape ESTs can extend our knowledge of the V. vinifera transcriptome, particularly when these data are used to assist in annotation of whole genome sequences from Vitis vinifera. Conclusion The MPSS data presented here not only achieved a higher level of saturation than previous EST based analyses, but in doing so, expand the known set of transcripts of grape berries during the unique stage in development that immediately precedes the onset of ripening. The MPSS dataset also revealed

Efeitos da nintendo wiifit vs whole body vibration em complemento à fisioterapia no equilíbrio e mobilidade de uma população idosa

OpenAIRE

Antunes, Ana Sofia Cupido

2012-01-01

Objectivos: Desenvolver desenho de estudo para avaliar os efeitos de um programa de exercícios realizados na WBV, na Plataforma WiiFit® e no solo, na promoção do equilíbrio e da mobilidade num grupo de idosos e verificar quais as alterações mais significativas. Metodologia: Estudo pré-experimental com duração de 12 semanas, três grupos de intervenção e um de controlo que serão constituídos por N ≥30. Utilizada uma amostra por conveniência de idades compreendidas entre os 65 e 84 anos de idade...

Impacto do agachamento em superfície estável e instável sobre o equilíbrio estático e dinâmico de idosos

Directory of Open Access Journals (Sweden)

P.C.R. Silva

2017-12-01

Full Text Available Resumo: Objetivo: O objetivo do presente estudo foi investigar o efeito agudo de uma única série de agachamento realizado em uma superfície estável e outra instável sobre o equilíbrio estático e dinâmico de idosos. Método: O estudo do tipo experimental contou com 30 idosos (66.4 ± 6.2 anos de ambos os sexos. Os idosos foram submetidos aos testes de apoio tandem (equilíbrio estático, com e sem privação visual, e ao Four Square Step Test (equilíbrio dinâmico. Em seguida, de forma aleatória, os idosos foram divididos em 2 grupos, onde um grupo executou 10 repetições de agachamento em superfície estável e outro grupo em superfície instável. Após um minuto, os idosos realizaram novamente os testes de equilíbrio. Sete dias após, os idosos realizaram o mesmo procedimento, no entanto, inverteram o tipo de superfície do agachamento. O teste de Wilcoxon foi utilizado para comparar os valores pré e pós‐intervenção. O nível de significância adotado foi de p < 0.05. Resultados: No teste de equilíbrio estático, somente na situação com privação visual foram encontradas diferenças significativas, tanto após o agachamento estável (p = 0.015 como no instável (p = 0.003. Já no equilíbrio dinâmico, apenas após o agachamento instável foi observada diferença significativa (p = 0.026. Ambas as diferenças representam melhoras no desempenho dos testes. Conclusão: Conclui‐se que a intervenção em superfície instável apresentou melhores impactos no desempenho do equilíbrio dos idosos do presente estudo. Desta forma, ressaltamos a importância da avaliação do equilíbrio na população idosa, para assim direcionar um programa de treinamento mais adequado para essa população. Resumen: Objetivo: El objetivo del presente estudio fue investigar el efecto

Estudo dos equilíbrios de monossacarídeos com os íons vanadila(IV) e zinco (II) em solução aquosa

OpenAIRE

Guiotoku, Marcela

2002-01-01

Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro de Ciências Físicas e Matemáticas. Programa de Pós-Graduação em Química. Estudo dos equilíbrios de monossacarídeos (ác. D-Glicônico, D-galactono-1,4-lactona, D-Ribono-1,4lactona e 2-deoxi-D-Glicopiranose em solução aquosa. Análise dos complexos formados através de titulação potenciométrica e para o ác. D-Glicônico, medidas de RPE. Estudo do efeito hipoglicêmico do complexo entre ác. D-Glicônico e o íon vanadila tanto ...

Genome-wide evolutionary characterization and expression analyses of major latex protein (MLP) family genes in Vitis vinifera.

Science.gov (United States)

Zhang, Ningbo; Li, Ruimin; Shen, Wei; Jiao, Shuzhen; Zhang, Junxiang; Xu, Weirong

2018-04-27

The major latex protein/ripening-related protein (MLP/RRP) subfamily is known to be involved in a wide range of biological processes of plant development and various stress responses. However, the biological function of MLP/RRP proteins is still far from being clear and identification of them may provide important clues for understanding their roles. Here, we report a genome-wide evolutionary characterization and gene expression analysis of the MLP family in European Vitis species. A total of 14 members, was found in the grape genome, all of which are located on chromosome 1, where are predominantly arranged in tandem clusters. We have noticed, most surprisingly, promoter-sharing by several non-identical but highly similar gene members to a greater extent than expected by chance. Synteny analysis between the grape and Arabidopsis thaliana genomes suggested that 3 grape MLP genes arose before the divergence of the two species. Phylogenetic analysis provided further insights into the evolutionary relationship between the genes, as well as their putative functions, and tissue-specific expression analysis suggested distinct biological roles for different members. Our expression data suggested a couple of candidate genes involved in abiotic stresses and phytohormone responses. The present work provides new insight into the evolution and regulation of Vitis MLP genes, which represent targets for future studies and inclusion in tolerance-related molecular breeding programs.

The relationships between consumer liking, sensory and chemical attributes of Vitis vinifera L. cv. Pinotage wines elaborated with different Oenococcus oeni starter cultures

DEFF Research Database (Denmark)

Malherbe, Sulette; Menichelli, Elena; du Toit, Maret

2013-01-01

BackgroundMalolactic fermentation (MLF) mediated by lactic acid bacteria (LAB) has been shown to modulate chemical and sensory attributes of wine. This study investigated the relation between consumer liking, chemical and sensory attributes of Vitis vinifera L. cv. Pinotage wines that were made o...... attributes can influence consumer liking. Selection of an MLF starter culture can thus potentially be used to develop specific wine styles. (c) 2013 Society of Chemical Industry......BackgroundMalolactic fermentation (MLF) mediated by lactic acid bacteria (LAB) has been shown to modulate chemical and sensory attributes of wine. This study investigated the relation between consumer liking, chemical and sensory attributes of Vitis vinifera L. cv. Pinotage wines that were made...... over two vintages by four different lactic acid Oenococcus oeni starter cultures as well as a control treatment where MLF was prevented. ResultsDescriptive analysis showed that the sensory attributes buttery, caramel, vegetative flavour, fruity and nutty aroma differed significantly between the wines...

Genome-wide Identification and Expression Analysis of the CDPK Gene Family in Grape, Vitis spp.

Science.gov (United States)

Zhang, Kai; Han, Yong-Tao; Zhao, Feng-Li; Hu, Yang; Gao, Yu-Rong; Ma, Yan-Fei; Zheng, Yi; Wang, Yue-Jin; Wen, Ying-Qiang

2015-06-30

Calcium-dependent protein kinases (CDPKs) play vital roles in plant growth and development, biotic and abiotic stress responses, and hormone signaling. Little is known about the CDPK gene family in grapevine. In this study, we performed a genome-wide analysis of the 12X grape genome (Vitis vinifera) and identified nineteen CDPK genes. Comparison of the structures of grape CDPK genes allowed us to examine their functional conservation and differentiation. Segmentally duplicated grape CDPK genes showed high structural conservation and contributed to gene family expansion. Additional comparisons between grape and Arabidopsis thaliana demonstrated that several grape CDPK genes occured in the corresponding syntenic blocks of Arabidopsis, suggesting that these genes arose before the divergence of grapevine and Arabidopsis. Phylogenetic analysis divided the grape CDPK genes into four groups. Furthermore, we examined the expression of the corresponding nineteen homologous CDPK genes in the Chinese wild grape (Vitis pseudoreticulata) under various conditions, including biotic stress, abiotic stress, and hormone treatments. The expression profiles derived from reverse transcription and quantitative PCR suggested that a large number of VpCDPKs responded to various stimuli on the transcriptional level, indicating their versatile roles in the responses to biotic and abiotic stresses. Moreover, we examined the subcellular localization of VpCDPKs by transiently expressing six VpCDPK-GFP fusion proteins in Arabidopsis mesophyll protoplasts; this revealed high variability consistent with potential functional differences. Taken as a whole, our data provide significant insights into the evolution and function of grape CDPKs and a framework for future investigation of grape CDPK genes.

Desequilíbrios musculares entre flexores dorsais e plantares do tornozelo após tratamento conservador e acelerado da ruptura do tendão calcâneo

OpenAIRE

Mayer,Alexandre; Frasson,Viviane Bortoluzzi; Ott,Rafael; Fortuna,Rafael de Oliveira; Vaz,Marco Aurélio

2010-01-01

A ruptura do tendão calcâneo (TC) reduz a sobrecarga mecânica dos flexores plantares (FP) do tornozelo. Essa alteração muda o equilíbrio natural entre os FP e flexores dorsais (FD) do tornozelo. O objetivo do estudo foi avaliar as razões isocinéticas concêntricas convencionais de torque de pacientes submetidos a tratamento cirúrgico de ruptura aguda do TC após dois protocolos diferentes de reabilitação. Após procedimento cirúrgico para reconstrução do TC, a amostra foi dividida de forma inten...

Structural characterization of lignin from grape stalks (Vitis vinifera L.).

Science.gov (United States)

Prozil, Sónia O; Evtuguin, Dmitry V; Silva, Artur M S; Lopes, Luísa P C

2014-06-18

The chemical structure of lignin from grape stalks, an abundant waste of winemaking, has been studied. The dioxane lignin was isolated from extractive- and protein-free grape stalks (Vitis vinifera L.) by modified acidolytic procedure and submitted to a structural analysis by wet chemistry (nitrobenzene and permanganate oxidation (PO)) and spectroscopic techniques. The results obtained suggest that grape stalk lignin is an HGS type with molar proportions of p-hydroxyphenyl (H), guaiacyl (G) and syringyl (S) units of 3:71:26. Structural analysis by (1)H and (13)C NMR spectroscopy and PO indicates the predominance of β-O-4' structures (39% mol) in grape stalk lignin together with moderate amounts of β-5', β-β, β-1', 5-5', and 4-O-5' structures. NMR studies also revealed that grape lignin should be structurally associated with tannins. The condensation degree of grape stalks lignin is higher than that of conventional wood lignins and lignins from other agricultural residues.

Isolation and characterization of polymorphic microsatellite loci in the green leafhopper Empoasca vitis Goethe (Homoptera).

Science.gov (United States)

Papura, D; Giresse, X; Chauvin, B; Caron, H; Delmotte, F; VAN Helden, M

2009-05-01

Eight dinucleotide microsatellite loci were isolated and characterized within the green leafhopper Empoasca vitis (Goethe) using an enrichment cloning procedure. Primers were tested on 171 individuals collected in the southwest of France from the vine plants. The identified loci were polymorphic, with allelic diversity ranging from two to 18 alleles per locus. Observed heterozygosities were from 0.021 to 0.760. These microsatellite markers should prove to be a useful tool for estimating the population genetic structure, host-plant specialization and migration capacity of this insect. © 2009 The Authors. Journal compilation © 2009 Blackwell Publishing Ltd.

Avaliação do equilíbrio estático e dinâmico de idosas praticantes de hidroginástica e ginástica

OpenAIRE

Almeida, Ana Paula Pessoa Veloso de; Veras, Renato Peixoto; Doimo, Leonice Aparecida

2010-01-01

Este estudo avaliou o equilíbrio estático e dinâmico e valências motoras relacionadas em idosas praticantes de ginástica e hidroginástica. Participaram 31 mulheres na modalidade hidroginástica (GH, 69,32 ± 6,57 anos) e 28 na ginástica (GG; 65,57 ± 7,67 anos), com no mínimo seis meses de prática e frequência mínina de três vezes na semana. Foram realizadas medidas de estatura (cm), peso (kg) e circunferências de cintura, quadril e abdome (cm) e cálculos do índice de massa corporal (IMC) e rela...

Yeast biodiversity from Vitis vinifera L., subsp. sylvestris (Gmelin Hegi to face up the oenological consequences of climate change

Directory of Open Access Journals (Sweden)

Puig-Pujol Anna

2016-01-01

Full Text Available The impact of climate change in the viticulture is affecting the quality of grapes and their wines. As consequence, climatic variations are producing a mismatch between technological and phenolic maturity and are affecting the microbiota's ecology, biodiversity and their metabolism in vineyard, grape, must and wine. However, there are natural resources that can help to mitigate the effects of global warming. It has been noticed that grapes from female plants of wild vines (Vitis vinifera subsp. sylvestris have very appropriate characteristics to face up this problem: later maturing, high acidity, high polyphenol content,…A molecular study of 819 strains isolated at the end of spontaneous fermentations of grapes of Vitis vinifera subsp. sylvestris grapevines from 30 locations in northern of Spain revealed 8 different genera and 18 different species. 71,5% of the yeasts were classified as non-Saccharomycesand 28,5% were identified as Saccharomyces cerevisiae. This latter specie was characterized at strain level, classifying 30 different groups, 6 of which as the majority from 2 up to 4 different locations. These findings demonstrate a wide diversity of yeast microbiota in wild grapes that will allow a yeast selection for the wine industry in a scenario of climate change.

The Novel Gene VpPR4-1 from Vitis pseudoreticulata Increases Powdery Mildew Resistance in Transgenic Vitis vinifera L.

Science.gov (United States)

Dai, Lingmin; Wang, Dan; Xie, Xiaoqing; Zhang, Chaohong; Wang, Xiping; Xu, Yan; Wang, Yuejin; Zhang, Jianxia

2016-01-01

Pathogenesis-related proteins (PRs) can lead to increased resistance of the whole plant to pathogen attack. Here, we isolate and characterize a PR-4 protein (VpPR4-1) from a wild Chinese grape Vitis pseudoreticulata which shows greatly elevated transcription following powdery mildew infection. Its expression profiles under a number of abiotic stresses were also investigated. Powdery mildew, salicylic acid, and jasmonic acid methyl ester significantly increased the VpPR4-1 induction while NaCl and heat treatments just slightly induced VpPR4-1 expression. Abscisic acid and cold treatment slightly affected the expression level of VpPR4-1. The VpPR4-1 gene was overexpressed in 30 regenerated V. vinifera cv. Red Globe via Agrobacterium tumefaciens-mediated transformation and verified by the Western blot. The 26 transgenic grapevines exhibited higher expression levels of PR-4 protein content than wild-type vines and six of them were inoculated with powdery mildew which showed that the growth of powdery mildew was repressed. The powdery mildew-resistance of Red Globe transformed with VpPR4-1 was enhanced inoculated with powdery mildew. Moreover, other powdery mildew resistant genes were associated with feedback regulation since VpPR4-1 is in abundance. This study demonstrates that PR-4 protein in grapes plays a vital role in defense against powdery mildew invasion.

Quando a fase de equilíbrio pode ser suprimida nos exames de tomografia computadorizada de abdome? What is the real role of the equilibrium phase in abdominal computed tomography?

Directory of Open Access Journals (Sweden)

Priscila Silveira Salvadori

2013-04-01

Full Text Available OBJETIVO: Avaliar a necessidade de realização da fase de equilíbrio nos exames de tomografia computadorizada de abdome. MATERIAIS E MÉTODOS: Realizou-se estudo retrospectivo, transversal e observacional, avaliando 219 exames consecutivos de tomografia computadorizada de abdome com contraste intravenoso, realizados num período de três meses, com diversas indicações clínicas. Para cada exame foram emitidos dois pareceres, um avaliando o exame sem a fase de equilíbrio (primeira análise e o outro avaliando todas as fases em conjunto (segunda análise. Ao final de cada avaliação, foi estabelecido se houve mudança nos diagnósticos principais e secundários, entre a primeira e a segunda análise. Foi utilizada a extensão do teste exato de Fisher para avaliar a modificação dos diagnósticos principais (p 0,999. Com relação aos diagnósticos secundários, cinco exames (2,3% foram modificados. CONCLUSÃO: Para indicações clínicas como estadiamento tumoral, abdome agudo e pesquisa de coleção abdominal, a fase de equilíbrio não acrescenta contribuição diagnóstica expressiva, podendo ser suprimida dos protocolos de exame.OBJECTIVE: To evaluate the role of the equilibrium phase in abdominal computed tomography. MATERIALS AND METHODS: A retrospective, cross-sectional, observational study reviewed 219 consecutive contrast-enhanced abdominal computed tomography images acquired in a three-month period, for different clinical indications. For each study, two reports were issued - one based on the initial analysis of non-contrast-enhanced, arterial and portal phases only (first analysis, and a second reading of these phases added to the equilibrium phase (second analysis. At the end of both readings, differences between primary and secondary diagnoses were pointed out and recorded, in order to measure the impact of suppressing the equilibrium phase on the clinical outcome for each of the patients. The extension of the exact Fisher

In Vitro Propagarion and Cryopreservation of Important Grape Cultivars (Vitis Vinifera L. and Rootstocks

Directory of Open Access Journals (Sweden)

F. CELEBI TOPRAK

2014-06-01

Full Text Available Grape (Vitis vinifera L. is among the most important species that is cultivated almost all around the world. There are over one thousand varieties that are grown for raisin, fresh consumption and wine making purposes. The grape germplasm resources are generally maintained as whole plants under field conditions. The traditional way of germplasm preservation is very risky due to natural uncertainties. In vitro technologies can help producing healthy propagation materials free from viroids, viruses, bacteria, phytoplasmas, fungi, and nematodes. When combined with cryopreservation technologies in vitro preservation systems can allow safe protection and propagation of valuable Vitis genetic resources. In this study, 12 commercial cultivar and two rootstock materials were tested for the applicability of long term preservation by in vitro clonal propagation and cryopreservation techniques. Axillary shoot tips collected from newly emerging shoots were placed in Magenda boxes containing 30 g/l sucrose on MS medium and cultured in a growth chamber adjusted to 16 h ligth/25o C and 8 h dark/17o C. All grape genotypes tested responded well to this application and produced healthy root and shoots. Shoot explants from these in vitro stocks were subcultured in every three months for one year. Apical dome explants excised from in vitro grape plants were stored in liquid nitrogen for cryopreservation. Genotypes varied in their responses to cryopservation treatment. Five genotypes showed shoot or callus formation. Regenerated shoots continued to grow and produced normal shoots and roots, but no plants could be developed from calli. Flow cytometry analysis of regenerants from continuous subculture and cryopreservation did not show any chromosome number abnormalities. In vitro micropropagation is an excellent choice for a long-term conservation of grape germplasm, which allows access to actively growing plant materials without seasonal restriction. Such cultures are

Molecular cloning and biochemical characterization of the UDP-glucose: flavonoid 3-O-glucosyltransferase from Concord grape (Vitis labrusca).

Science.gov (United States)

Hall, Dawn; Yuan, Xiao Xin; Murata, Jun; De Luca, Vincenzo

2012-02-01

Glucosylation of anthocyanidin substrates at the 3-O-position is crucial for the red pigmentation of grape berries and wine. The gene that encodes the enzyme involved in this reaction has been cloned from Vitis labrusca cv. Concord, heterologously expressed, and the recombinant enzyme (rVL3GT) was characterized. VL3GT has 96% amino acid sequence identity with Vitis vinifera VV3GT and groups phylogenetically with several other flavonoid 3-O-glycosyltransferases. In vitro substrate specificity studies and kinetic analyses of rVL3GT indicate that this enzyme preferentially glucosylates cyanidin as compared with quercetin. Crude protein extracts from several Concord grape tissues were assayed for glucosyltransferase activity with cyanidin and quercetin as acceptor substrates. A comparison of the VL3GT activities toward with these substrates showed that the 3GT enzyme activity is consistent with the expression of VL3GT in these tissues and is coincident with the biosynthesis of anthocyanins in both location and developmental stages. Enzyme activities in grape mesocarp, pre-veraison exocarp, leaf, flower bud, and flower tissues glucosylated quercetin but not cyanidin at high rates, suggesting the presence of additional enzymes which are able to glucosylate the 3-O-position of flavonols with higher specificity than anthocyanidins. Copyright © 2011 Elsevier Ltd. All rights reserved.

Identifikation von „Qualitäts“-Chromosomen in Vitis zur Frühdiagnose von Weinqualität

OpenAIRE

Braun, Franziska

2017-01-01

Im 19. Jh. wurden die heute im Weinbau wichtigsten Pathogene von Nordamerika nach Europa eingeschleppt. Zu ihrer Bekämpfung werden in der Rebenzüchtung amerikanische und asiatische Wildarten als Donoren für Resistenzen genutzt. Sie werden mit der europäischen Kulturrebe Vitis vinifera gekreuzt, um Resistenzen und hohe Qualität zu kombinieren. Die Rebenzüchtung wird erheblich durch die lange Generationsdauer, mehrere Kreuzungen mit wechselnden Qualitätssorten, sowie einer arbeitsaufwändigen Ev...

Análise do equilíbrio estático e de deformidades nos pés de crianças com paralisia cerebral Analysis of static balance and deformities on feet of children with cerebral palsy

Directory of Open Access Journals (Sweden)

Thaís Delamuta Ayres da Costa

2011-06-01

Full Text Available O presente estudo analisou, por meio de um sistema de baropodometria, os tipos de pé, a influência da visão no equilíbrio estático na postura ortostática e a distribuição da pressão plantar em 16 crianças, de 6 a 15 anos, com diagnóstico de paralisia cerebral. Os resultados indicaram que o pé valgo foi o mais comum dentre os tipos de paralisia cerebral estudadas, diparesia espástica, hemiparesia espástica direita, hemiparesia espástica esquerda e ataxia; o equilíbrio estático na postura ortostática de olhos vendados apresentou maior instabilidade do que quando com os olhos abertos; a distribuição de pressão plantar não apresentou significância estatística e não houve correlação significativa entre a idade e as variáveis de equilíbrio e de distribuição da pressão plantar. Desse modo, conclui-se que a visão é um fator importante no controle postural de crianças com paralisia cerebral.The present study analyzed through baropodometry system, the feet's types, the vision's influence during static balance on orthostatic posture and the plantar pressure distribution in 16 children, aged from 6 to 15 years-old with diagnostic of cerebral palsy. We noted that the valgus foot was more common on the sample studied, diparetic spastic, hemiparetic spastic right, and hemiparetic spastic left and ataxic; the static balance on orthostatic posture with closed eyes was more instable compared to the orthostatic posture with opened eyes. In relation to the distribution of plantar pressure, we did not observe statistical significance and there was no correlation between age and the balance's variables and the plantar pressure's distribution. Therefore, we concluded that the vision is an important factor on postural control in children with cerebral palsy.

Characterization of a putative grapevine Zn transporter, VvZIP3, suggests its involvement in early reproductive development in Vitis vinifera L

Directory of Open Access Journals (Sweden)

Gainza-Cortés Felipe

2012-07-01

Full Text Available Abstract Background Zinc (Zn deficiency is one of the most widespread mineral nutritional problems that affect normal development in plants. Because Zn cannot passively diffuse across cell membranes, it must be transported into intracellular compartments for all biological processes where Zn is required. Several members of the Zinc-regulated transporters, Iron-regulated transporter-like Protein (ZIP gene family have been characterized in plants, and have shown to be involved in metal uptake and transport. This study describes the first putative Zn transporter in grapevine. Unravelling its function may explain an important symptom of Zn deficiency in grapevines, which is the production of clusters with fewer and usually smaller berries than normal. Results We identified and characterized a putative Zn transporter from berries of Vitis vinifera L., named VvZIP3. Compared to other members of the ZIP family identified in the Vitis vinifera L. genome, VvZIP3 is mainly expressed in reproductive tissue - specifically in developing flowers - which correlates with the high Zn accumulation in these organs. Contrary to this, the low expression of VvZIP3 in parthenocarpic berries shows a relationship with the lower Zn accumulation in this tissue than in normal seeded berries where its expression is induced by Zn. The predicted protein sequence indicates strong similarity with several members of the ZIP family from Arabidopsis thaliana and other species. Moreover, VvZIP3 complemented the growth defect of a yeast Zn-uptake mutant, ZHY3, and is localized in the plasma membrane of plant cells, suggesting that VvZIP3 has the function of a Zn uptake transporter. Conclusions Our results suggest that VvZIP3 encodes a putative plasma membrane Zn transporter protein member of the ZIP gene family that might play a role in Zn uptake and distribution during the early reproductive development in Vitis vinifera L., indicating that the availability of this micronutrient

VTCdb: a gene co-expression database for the crop species Vitis vinifera (grapevine).

Science.gov (United States)

Wong, Darren C J; Sweetman, Crystal; Drew, Damian P; Ford, Christopher M

2013-12-16

Gene expression datasets in model plants such as Arabidopsis have contributed to our understanding of gene function and how a single underlying biological process can be governed by a diverse network of genes. The accumulation of publicly available microarray data encompassing a wide range of biological and environmental conditions has enabled the development of additional capabilities including gene co-expression analysis (GCA). GCA is based on the understanding that genes encoding proteins involved in similar and/or related biological processes may exhibit comparable expression patterns over a range of experimental conditions, developmental stages and tissues. We present an open access database for the investigation of gene co-expression networks within the cultivated grapevine, Vitis vinifera. The new gene co-expression database, VTCdb (http://vtcdb.adelaide.edu.au/Home.aspx), offers an online platform for transcriptional regulatory inference in the cultivated grapevine. Using condition-independent and condition-dependent approaches, grapevine co-expression networks were constructed using the latest publicly available microarray datasets from diverse experimental series, utilising the Affymetrix Vitis vinifera GeneChip (16 K) and the NimbleGen Grape Whole-genome microarray chip (29 K), thus making it possible to profile approximately 29,000 genes (95% of the predicted grapevine transcriptome). Applications available with the online platform include the use of gene names, probesets, modules or biological processes to query the co-expression networks, with the option to choose between Affymetrix or Nimblegen datasets and between multiple co-expression measures. Alternatively, the user can browse existing network modules using interactive network visualisation and analysis via CytoscapeWeb. To demonstrate the utility of the database, we present examples from three fundamental biological processes (berry development, photosynthesis and flavonoid biosynthesis

Efeito de exercícios terapêuticos no equilíbrio de mulheres com osteoartrite de joelho: uma revisão sistemática The effects of therapeutic exercise on the balance of women with knee osteoarthritis: a systematic review

Directory of Open Access Journals (Sweden)

Andressa Silva

2012-02-01

Full Text Available OBJETIVO: Fornecer evidências relacionadas ao efeito de exercícios terapêuticos sobre o equilíbrio de mulheres com osteoartrite (OA de joelho. MÉTODOS: A busca foi realizada nas bases de dados Pubmed, Medline, Lilacs, SciELO, ISI web of knowledge, PEDro e Colaboração Cochrane. Foram utilizadas as palavras-chave: knee, balance, women, rehabilitation em combinação com osteoarthritis. Foram selecionados ensaios clínicos aleatórios e controlados dos últimos dez anos, em língua inglesa, portuguesa e espanhola. Para verificar a qualidade dos ensaios clínicos selecionados, aplicou-se a Escala PEDro. RESULTADOS: Encontrou-se um total de 20 estudos a partir da busca eletrônica. Desses, apenas nove satisfizeram os critérios de inclusão e foram analisados integralmente. A avaliação da qualidade metodológica dos nove estudos incluídos permitiu classificar oito deles como de alta qualidade metodológica. Os métodos e as intervenções para o equilíbrio variaram amplamente, no entanto a maioria dos estudos encontrou melhora significativa no equilíbrio de mulheres com OA de joelho. CONCLUSÃO: Como os estudos incluídos nesta revisão sistemática têm uma alta qualidade metodológica, pode-se concluir que os exercícios terapêuticos utilizados pelos estudos melhoraram o equilíbrio de mulheres com OA de joelho.OBJECTIVE: The objective of this review was to examine evidence regarding the effects of therapeutic exercise on the balance of women with knee osteoarthritis (OA. METHODS: The search was conducted in Pubmed, Medline, Lilacs, SciELO, ISI web of knowledge, PEDro and the Cochrane Collaboration. We used the keywords: "knee", "balance", "women" and "rehabilitation" in combination with "osteoarthritis". We selected randomized controlled clinical trials published in English, Portuguese and Spanish over the last 10 years. To verify the methodological quality of selected clinical trials, the PEDro Scale was applied. RESULTS: A total of

An Sfp-type PPTase and associated polyketide and nonribosomal peptide synthases in Agrobacterium vitis are essential for induction of tobacco hypersensitive response and grape necrosis.

Science.gov (United States)

Zheng, Desen; Burr, Thomas J

2013-07-01

An Sfp-type phosphopantetheinyl transferase (PPTase) encoding gene F-avi5813 in Agrobacterium vitis F2/5 was found to be required for the induction of a tobacco hypersensitive response (HR) and grape necrosis. Sfp-type PPTases are post-translation modification enzymes that activate acyl-carry protein (ACP) domains in polyketide synthases (PKS) and peptidyl-carrier protein (PCP) domains of nonribosomal peptide synthases (NRPS). Mutagenesis of PKS and NRPS genes in A. vitis led to the identification of a PKS gene (F-avi4330) and NRPS gene (F-avi3342) that are both required for HR and necrosis. The gene immediately downstream of F-avi4330 (F-avi4329) encoding a predicted aminotransferase was also found to be required for HR and necrosis. Regulation of F-avi4330 and F-avi3342 by quorum-sensing genes avhR, aviR, and avsR and by a lysR-type regulator, lhnR, was investigated. It was determined that F-avi4330 expression is positively regulated by avhR, aviR, and lhnR and negatively regulated by avsR. F-avi3342 was found to be positively regulated by avhR, aviR, and avsR and negatively regulated by lhnR. Our results suggest that a putative hybrid peptide-polyketide metabolite synthesized by F-avi4330 and F-avi3342 is associated with induction of tobacco HR and grape necrosis. This is the first report that demonstrates that NRPS and PKS play essential roles in conferring the unique ability of A. vitis to elicit a non-host-specific HR and host-specific necrosis.

O uso de técnicas para auxiliar a flexibilidade e equilíbrio em adolescentes portadores de paralisia cerebral: o relato de três casos Use of techniques to increase flexibility and equilibrium in adolescents with cerebral palsy: report of three case studies

Directory of Open Access Journals (Sweden)

Katia Carpetieri Ferrarezi

2000-05-01

Full Text Available Esta pesquisa teve por objetivo descrever os testes e o tratamento pediátrico de paralisia cerebral espástica em fase de independência motora para a flexibilidade dos membros inferiores e para o desenvolvimento do aumento no tempo de equilíbrio. Foram selecionados, para participar deste estudo, 3 sujeitos com paralisia cerebral em fase de independência motora. Sujeito 1 do sexo masculino, 12 anos, diplégico espástico; sujeito 2 do sexo masculino, 13 anos, hemiplegia direita espástica; sujeito 3 do sexo feminino, 10 anos, hemiplegia espástica esquerda. A metodologia usada para a avaliação foi o teste de “sentar e alcançar”, a goniometria e o teste de equilíbrio. O procedimento é composto em 16 semanas, com sessões individuais de 30 minutos, duas vezes por semana. Para conseguir flexibilidade dos membros inferiores, foi usado o método de facilitação neuromuscular proprioceptiva, e para estímulos proprioceptivos e vestibulares (equilíbrio foram usados saltos no mini-trampolim. O resultado obtido com o tratamento proposto foi um ganho na flexibilidade, medido pelo teste de "sentar e alcançar" de 30% para o sujeito 1, 40% para o sujeito 2 e 40 % para o sujeito 3, e o ganho obtido com o tempo de equilíbrio foi de 160% para o sujeito 1, 100% para o sujeito 2 e 500% para o sujeito 3The aim of this paper is to describe the tests and pediatric treatment of motor-independent spastic cerebral palsy to increase lower-limbs flexibility and equilibrium time. Three subjects were selected for the experiment: a twelve-year-old boy with spastic diplegia, a thirteen-year-old boy with right spastic hemiplegia and a ten-year-old girl with left spastic hemiplegia. The evaluation methodology consisted of sit-and-reach test, goniometry and equilibrium test. The treatment procedure consisted of two weekly individual 30-minute sessions covering a period of 16 weeks. Proprioceptive neuromuscular facilitation method was used to increase lower

Differentiation of Vitis vinifera varieties by MALDI-MS analysis of the grape seed proteins.

Science.gov (United States)

Pesavento, Ivana Chiara; Bertazzo, Antonella; Flamini, Riccardo; Vedova, Antonio Dalla; De Rosso, Mirko; Seraglia, Roberta; Traldi, Pietro

2008-02-01

Until now the study of pathogenic related proteins in grape juice and wine, performed by ESI-MS, LC/ESI-MS, and MALDI/MS, has been proposed for differentiation of varieties. In fact, chitinases and thaumatin-like proteins persist through the vinification process and cause hazes and sediments in bottled wines. An additional instrument, potentially suitable for the grape varieties differentiation, has been developed by MALDI/MS for the grape seed protein analysis. The hydrosoluble protein profiles of seeds extract from three different Vitis vinifera grape (red and white) varieties were analyzed and compared. In order to evaluate the environmental conditions and harvest effects, the seed protein profiles of one grape variety from different locations and harvests were studied. (c) 2008 John Wiley & Sons, Ltd.

Ácidos grasos y parámetros de calidad del aceite de semilla de uva silvestre (Vitis spp.

Directory of Open Access Journals (Sweden)

O. Franco-Mora

2015-01-01

Full Text Available México es centro de origen de varias especies de Vitis. La gran mayoría de ellas no son empleadas en la agricultura e industrias derivadas. Como parte de la exploración de su potencial agroindustrial se identificó y cuantificó a los ácidos grasos del aceite de semilla de vid silvestre (Vitis spp. de frutos de Temascaltepec, México y de la accesión E-201, cultivada en Zumpahuacán, México. El contenido promedio de aceite en la semilla fue de 16,7%, encontrando ácido linoleico (71,5%, oleico (17,2%, palmítico (6,6% y esteárico (4,3%. En el aceite obtenido en vides de Temascaltepec se determinó índice de yodo (57,9 g/100 g, índice de saponificación (170,7 mg/g e índice de peroxidos (30 mEq/kg, valores relacionados posiblemente al contenido de ácidos grasos insaturados. Sin embargo, ese mismo grado de insaturación no concordó con el punto de humeo observado (211 °C, lo cual posiblemente está relacionado con el contenido de ácidos palmítico y esteárico. El aceite de semilla de vid silvestre cumple parcialmente con los estándares establecidos para el aceite de semilla de V. vinifera, lo cual implica su potencial culinario, agroindustrial y cosmetológico.

Xylella fastidiosa requires polygalacturonase for colonization and pathogenicity in Vitis vinifera grapevines.

Science.gov (United States)

Roper, M Caroline; Greve, L Carl; Warren, Jeremy G; Labavitch, John M; Kirkpatrick, Bruce C

2007-04-01

Xylella fastidiosa is the causal agent of Pierce's disease of grape, an economically significant disease for the grape industry. X. fastidiosa systemically colonizes the xylem elements of grapevines and is able to breach the pit pore membranes separating xylem vessels by unknown mechanisms. We hypothesized that X. fastidiosa utilizes cell wall degrading enzymes to break down pit membranes, based on the presence of genes involved in plant cell wall degradation in the X. fastidiosa genome. These genes include several beta-1,4 endoglucanases, several xylanases, several xylosidases, and one polygalacturonase (PG). In this study, we demonstrated that the pglA gene encodes a functional PG. A mutant in pglA lost pathogenicity and was compromised in its ability to systemically colonize Vitis vinifera grapevines. The results indicate that PG is required for X. fastidiosa to successfully infect grapevines and is a critical virulence factor for X. fastidiosa pathogenesis in grapevine.

EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA); Scientific Opinion on the substantiation of health claims related to oligomeric procyanidins (OPCs) from grape (Vitis vinifera L.) seeds and improvement of visual adaptation to the dark (ID 680) pursuant to Article 13(1) of Regulation

DEFF Research Database (Denmark)

Tetens, Inge

claims in relation to oligomeric procyanidins (OPCs) from grape (Vitis vinifera L.) seeds and improvement of visual adaptation to the dark. The scientific substantiation is based on the information provided by the Member States in the consolidated list of Article 13 health claims and references that EFSA...... has received from Member States or directly from stakeholders. The food constituent that is the subject of the health claim is oligomeric procyanidins (OPCs) from grape (Vitis vinifera L.) seeds. The Panel considers that OPCs from grape (Vitis vinifera L.) seeds are sufficiently characterised....... The claimed effect is “ocular system: OPCs play an important role in the structure and physiological functions of cornea, OPCs protect the cornea and improve visual adaptation to low luminances”. The target population is assumed to be the general population. In the context of the proposed wordings...

Distribution of 14C-photosynthetate in the shoot of Vitis vinifera L. cv Cabernet Sauvignon: Pt. II

International Nuclear Information System (INIS)

Hunter, J.J.; Visser, J.H.

1988-01-01

The effect of partial defoliation of Vitis vinifera L. cv Cabernet Sauvignon on the distribution of photosynthetates, originating in leaves in different positions on the shoot at berry set, pea size, veraison and ripeness stages, was investigated. Partial defoliation (33% and 66%) resulted in a higher apparent photosynthetic effectivity for all the remaining leaves on the shoot. The pattern of distribution of photosynthetates would seem to stay the same between the defoliation treatments. The control vines were found to carry excess foliage. Optimal photosynthetic activity of all the leaves on the vine was therefore not reached

Modulation of protein phosphorylation, N-glycosylation and Lys-acetylation in grape (Vitis vinifera) mesocarp and exocarp owing to Lobesia botrana infection

DEFF Research Database (Denmark)

Melo-Braga, Marcella N; Verano-Braga, Thiago; León, Ileana R

2012-01-01

Grapevine (Vitis vinifera) is an economically important fruit crop that is subject to many types of insect and pathogen attack. To better elucidate the plant response to Lobesia botrana pathogen infection, we initiated a global comparative proteomic study monitoring steady-state protein expressio...... resistance response protein 206. This study represents a substantial step toward the understanding of protein and PTMs-mediated plant-pathogen interaction shedding light on the mechanisms underlying the grape infection....

Transcriptomic analysis of grape (Vitis vinifera L. leaves after exposure to ultraviolet C irradiation.

Directory of Open Access Journals (Sweden)

Huifen Xi

Full Text Available BACKGROUND: Only a small amount of solar ultraviolet C (UV-C radiation reaches the Earth's surface. This is because of the filtering effects of the stratospheric ozone layer. Artificial UV-C irradiation is used on leaves and fruits to stimulate different biological processes in plants. Grapes are a major fruit crop and are grown in many parts of the world. Research has shown that UV-C irradiation induces the biosynthesis of phenols in grape leaves. However, few studies have analyzed the overall changes in gene expression in grape leaves exposed to UV-C. METHODOLOGY/PRINCIPAL FINDINGS: In the present study, transcriptional responses were investigated in grape (Vitis vinifera L. leaves before and after exposure to UV-C irradiation (6 W·m-2 for 10 min using an Affymetrix Vitis vinifera (Grape Genome Array (15,700 transcripts. A total of 5274 differentially expressed probe sets were defined, including 3564 (67.58% probe sets that appeared at both 6 and 12 h after exposure to UV-C irradiation but not before exposure. A total of 468 (8.87% probe sets and 1242 (23.55% probe sets were specifically expressed at these times. The probe sets were associated with a large number of important traits and biological pathways, including cell rescue (i.e., antioxidant enzymes, protein fate (i.e., HSPs, primary and secondary metabolism, and transcription factors. Interestingly, some of the genes involved in secondary metabolism, such as stilbene synthase, responded intensely to irradiation. Some of the MYB and WRKY family transcription factors, such as VvMYBPA1, VvMYB14, VvMYB4, WRKY57-like, and WRKY 65, were also strongly up-regulated (about 100 to 200 fold. CONCLUSIONS: UV-C irridiation has an important role in some biology processes, especially cell rescue, protein fate, secondary metabolism, and regulation of transcription.These results opened up ways of exploring the molecular mechanisms underlying the effects of UV-C irradiation on grape leaves and have

Transcriptomic analysis of grape (Vitis vinifera L.) leaves after exposure to ultraviolet C irradiation.

Science.gov (United States)

Xi, Huifen; Ma, Ling; Liu, Guotian; Wang, Nian; Wang, Junfang; Wang, Lina; Dai, Zhanwu; Li, Shaohua; Wang, Lijun

2014-01-01

Only a small amount of solar ultraviolet C (UV-C) radiation reaches the Earth's surface. This is because of the filtering effects of the stratospheric ozone layer. Artificial UV-C irradiation is used on leaves and fruits to stimulate different biological processes in plants. Grapes are a major fruit crop and are grown in many parts of the world. Research has shown that UV-C irradiation induces the biosynthesis of phenols in grape leaves. However, few studies have analyzed the overall changes in gene expression in grape leaves exposed to UV-C. In the present study, transcriptional responses were investigated in grape (Vitis vinifera L.) leaves before and after exposure to UV-C irradiation (6 W·m-2 for 10 min) using an Affymetrix Vitis vinifera (Grape) Genome Array (15,700 transcripts). A total of 5274 differentially expressed probe sets were defined, including 3564 (67.58%) probe sets that appeared at both 6 and 12 h after exposure to UV-C irradiation but not before exposure. A total of 468 (8.87%) probe sets and 1242 (23.55%) probe sets were specifically expressed at these times. The probe sets were associated with a large number of important traits and biological pathways, including cell rescue (i.e., antioxidant enzymes), protein fate (i.e., HSPs), primary and secondary metabolism, and transcription factors. Interestingly, some of the genes involved in secondary metabolism, such as stilbene synthase, responded intensely to irradiation. Some of the MYB and WRKY family transcription factors, such as VvMYBPA1, VvMYB14, VvMYB4, WRKY57-like, and WRKY 65, were also strongly up-regulated (about 100 to 200 fold). UV-C irridiation has an important role in some biology processes, especially cell rescue, protein fate, secondary metabolism, and regulation of transcription.These results opened up ways of exploring the molecular mechanisms underlying the effects of UV-C irradiation on grape leaves and have great implications for further studies.

Influência da fadiga no equilíbrio do pé de apoio de jogadores de futebol Influence of fatigue on balance of foot support of football players

Directory of Open Access Journals (Sweden)

Wakson Batista de Morais Gomes

2013-03-01

Full Text Available O objetivo do presente estudo foi investigar a influencia da fadiga no equilíbrio do pé de apoio no momento do chute em jogadores de futebol. Participaram desta pesquisa 19 atletas de futebol divididos em dois grupos: grupo exaustão (GEX que realizou um esforço com carga incremental até a exaustão em esteira rolante, e o grupo controle (GCE realizou um esforço leve-constante de forma continua em esteira rolante. Antes e após os protocolos foram avaliados parâmetros de equilíbrio estático em apoio unipodal, utilizando uma plataforma de força. O GEX apresentou aumento da área de deslocamento do centro de pressão (COP (p The aim of this study was to investigate the influence of fatigue on the balance of the support leg kick in soccer players. 19 soccer players were divided randomly into two groups: group exhauston (GEX, underwent an effort with incremental load at exhaustion on a treadmill, and the control group (GCE underwent effort with constant lower load. Parameters of static balance in single support (one foot were evaluated before and after the protocols, using a force platform (AMTI OR6-5. The GEX showed enlargement of the displacement of center of pressure (COP (p < 0.05 after exhaustion, for the right foot. The maximum displacement of the antero posterior center of pressure of the right leg of the GEX incresead significantly (p < 0.05 after exhaustion in relation to resting values. In conclusion, fatigue can impair the ability to keep balance for the support leg in soccer players. Mainly on support to the foot that is not the usual support for the kick.

Desequilíbrio hormonal e disfunção menstrual em atletas de ginástica rítmica

Directory of Open Access Journals (Sweden)

Sabrina Macedo Hott Coelho

2015-09-01

Full Text Available ResumoObjetivou-se avaliar a magnitude das alterações de hormônios reguladores do ciclo menstrual (CM e testosterona de atletas de ginástica rítmica (GR de alto rendimento, em período pré-competitivo para a Olimpíada de Beijing. Foram realizadas coletas de sangue em 4 momentos, com intervalos de 7 dias. Os hormônios estrogênio, progesterona, luteinizante (LH, folículo estimulante (FSH e testosterona foram mensurados por quimioluminescência. As atletas (n = 7 relataram disfunção menstrual e houve expressiva variação hormonal intra e entre indivíduos. Das amostras de estrogênio, 65% ficaram abaixo do valor referencial clínico, enquanto que as concentrações de progesterona e LH ficaram próximas ao limite inferior. Para FSH e testosterona, 10% e 30% das amostras, respectivamente, ficaram abaixo do referencial. Conclui-se que atletas de alto rendimento em GR apresentam maior risco de desequilíbrio hormonal e disfunção menstrual, o que inspira necessidade de atenção clínica.

Desenvolvimento e estudos de estabilidade de cremes e géis contendo sementes e extratos do bagaço da uva Isabel (Vitis labrusca L.

Directory of Open Access Journals (Sweden)

JOãO RONALDO N. FERREIRA

2010-12-01

Full Text Available No cenário mundial, inúmeras indústrias de cosméticos buscam a inovação, utilizando-se de matérias-primas de origens diversificadas, principalmente oriundas de vegetais, representando uma alternativa de substituição de materiais sintéticos por naturais. Com esse intuito, no presente estudo, realizou-se o desenvolvimento e a avaliação da estabilidade de emulsões e géis contendo extratos e sementes do bagaço da uva Isabel (Vitis labrusca L., uma espécie de uva rica em compostos fenólicos e flavonoides com grande atividade antioxidante. Com isso, buscou-se evidenciar o período em que os produtos mantiveram suas propriedades físico-químicas, frente a variações climáticas forçadas em estudos acelerados, durante o período de armazenamento. Foram preparados cremes contendo 5 e 10% de extrato glicólico do bagaço da uva e géis contendo 10% de sementes trituradas, sendo acondicionados em condições ambientais distintas e avaliados, através de testes físico-químicos, no período de 60 dias. Durante esse período, não foram evidenciados sinais de instabilidade físico-química nos cremes analisados frente às condições testadas. No entanto, o gel apresentou leve alteração da cor e do odor, sugerindo a necessidade de estabilização físico-química de seus constituintes naturais com a adição de antioxidantes. Palavras-chave: Antioxidante. Esfoliante. Estabilidade. Uva Isabel. Vitis labrusca L. ABSTRACT Development and testing of the stability of creams and gels containing extracts of the pomace and seeds of Isabel grapes (Vitis labrusca L. Numerous cosmetic companies around the world seek innovation, using raw materials of various origins, mainly derived from plants, as natural alternatives to synthetic materials. With this in mind, this study was carried out to develop and test the stability of emulsions and gels, respectively containing extracts of pomace and seeds of Isabel grape (Vitis labrusca L., a

Characterization of Vitis vinifera L. Cv. Carménère grape and wine proanthocyanidins.

Science.gov (United States)

Fernández, Katherina; Kennedy, James A; Agosin, Eduardo

2007-05-02

A formal compositional study of the proanthocyanidins of Vitis vinifera L. cv. Carménère was conducted in this work. We first characterized the polymeric proanthocyanidins of Carménère skins, seeds, and wines. In addition, the wine astringency was analyzed and compared with Cabernet Sauvignon. Although Carménère wines had a higher proanthocyanidin concentration and mean degree of polymerization than Cabernet Sauvignon wines, the former wines were perceived as less astringent. The low seed/skin proportion in Carménère wines as compared to other varieties, as evidenced by the reduced number of seeds per berry and the higher amount of epigallocatechin subunits of Carménère wine proanthocyanidins, could explain this apparent paradox.

Molecular cloning and functional characterization of the anthocyanidin reductase gene from Vitis bellula.

Science.gov (United States)

Zhu, Yue; Peng, Qing-Zhong; Li, Ke-Gang; Xie, De-Yu

2014-08-01

Anthocyanidin reductase (ANR) is an NADPH-/NADH-dependent enzyme that transfers two hydrides to anthocyanidins to produce three types of isomeric flavan-3-ols. This reductase forms the ANR pathway toward the biosynthesis of proanthocyanidins (PAs, which are also called condensed tannins). Here, we report cloning and functional characterization of an ANR (called VbANR) homolog from the leaves of Vitis bellula, a newly developed grape crop in southern China. The open reading frame (ORF) of VbANR is 1,017 bp in length and encodes 339 amino acids. A phylogenetic analysis and an alignment using 17 sequences revealed that VbANR is approximately 99.9 % identical to the ANR homolog from Vitis vinifera. The VbANR ORF is fused to the Trx gene containing a His-tag in the pET32a(+) vector to obtain a pET32a(+)-VbANR construct for expressing the recombinant VbANR. In vitro enzyme assays show that VbANR converts cyanidin, delphinidin, and pelargonidin to their corresponding flavan-3-ols. Enzymatic products include 2S,3R-trans- and 2R,3R-cis-flavan-3-ols isomers, such as (-)-catechin and (-)-epicatechin. In addition, the third compound that is observed from the enzymatic products is most likely a 2S,3S-cis-flavan-3-ol. To analyze the kinetics and optimize pH and temperature values, a UV spectrometry method was developed to quantify the concentrations of total enzymatic products. The optimum pH and temperature values are 4.0 and 40 °C, respectively. The K m , K cat, V max, and K cat/K m values for pelargonidin and delphinidin were similar. In comparison, VbANR exhibits a slightly lower affinity to cyanidin. VbANR uses both NADPH and NADH but prefers to employ NADPH. GFP fusion and confocal microscopy analyses revealed the cytosolic localization of VbANR. The overexpression of VbANR in ban mutants reconstructed the biosynthetic pathway of PAs in the seed coat. These data demonstrate that VbANR forms the ANR pathway, leading to the formation of three types of isomeric flavan-3-ols

Factors affecting distribution and mobility of trace elements (Cu, Pb, Zn) in a perennial grapevine (Vitis vinifera L.) in the Champagne region of France

Energy Technology Data Exchange (ETDEWEB)

Chopin, E.I.B. [GEGENA EA 3795, University of Reims Champagne-Ardenne, 2 esplanade Roland Garros, 51100 Reims (France)], E-mail: edithchopin@softhome.net; Marin, B.; Mkoungafoko, R.; Rigaux, A. [GEGENA EA 3795, University of Reims Champagne-Ardenne, 2 esplanade Roland Garros, 51100 Reims (France); Hopgood, M.J. [Department of Soil Science, School of Human and Environmental Sciences, University of Reading, Whiteknights, Reading, RG6 6DW (United Kingdom); Delannoy, E.; Cances, B.; Laurain, M. [GEGENA EA 3795, University of Reims Champagne-Ardenne, 2 esplanade Roland Garros, 51100 Reims (France)

2008-12-15

Soil and Vitis vinifera L. (coarse and fine roots, leaves, berries) concentration and geochemical partitioning of Cu, Pb and Zn were determined in a contaminated calcareous Champagne plot to assess their mobility and transfer. Accumulation ratios in roots remained low (0.1-0.4 for Cu and Zn, <0.05 for Pb). Differences between elements resulted from vegetation uptake strategy and soil partitioning. Copper, significantly associated with the oxidisable fraction (27.8%), and Zn with the acid soluble fraction (33.3%), could be mobilised by rhizosphere acidification and oxidisation, unlike Pb, essentially contained in the reducible fraction (72.4%). Roots should not be considered as a whole since the more reactive fine roots showed higher accumulation ratios than coarse ones. More sensitive response of fine roots, lack of correlation between chemical extraction results and vegetation concentrations, and very limited translocation to aerial parts showed that fine root concentrations should be used when assessing bioavailability. - Soil Cu, Pb and Zn concentration and partitioning were combined to accumulation ratio to study the transfer of trace element from soil to Vitis vinifera L. roots and aerial parts in a contaminated vineyard plot.

Factors affecting distribution and mobility of trace elements (Cu, Pb, Zn) in a perennial grapevine (Vitis vinifera L.) in the Champagne region of France

International Nuclear Information System (INIS)

Chopin, E.I.B.; Marin, B.; Mkoungafoko, R.; Rigaux, A.; Hopgood, M.J.; Delannoy, E.; Cances, B.; Laurain, M.

2008-01-01

Soil and Vitis vinifera L. (coarse and fine roots, leaves, berries) concentration and geochemical partitioning of Cu, Pb and Zn were determined in a contaminated calcareous Champagne plot to assess their mobility and transfer. Accumulation ratios in roots remained low (0.1-0.4 for Cu and Zn, <0.05 for Pb). Differences between elements resulted from vegetation uptake strategy and soil partitioning. Copper, significantly associated with the oxidisable fraction (27.8%), and Zn with the acid soluble fraction (33.3%), could be mobilised by rhizosphere acidification and oxidisation, unlike Pb, essentially contained in the reducible fraction (72.4%). Roots should not be considered as a whole since the more reactive fine roots showed higher accumulation ratios than coarse ones. More sensitive response of fine roots, lack of correlation between chemical extraction results and vegetation concentrations, and very limited translocation to aerial parts showed that fine root concentrations should be used when assessing bioavailability. - Soil Cu, Pb and Zn concentration and partitioning were combined to accumulation ratio to study the transfer of trace element from soil to Vitis vinifera L. roots and aerial parts in a contaminated vineyard plot

Berry Shriveling Significantly Alters Shiraz (Vitis vinifera L.) Grape and Wine Chemical Composition.

Science.gov (United States)

Šuklje, Katja; Zhang, Xinyi; Antalick, Guillaume; Clark, Andrew C; Deloire, Alain; Schmidtke, Leigh M

2016-02-03

Berry shriveling is an often reported occurrence in the Shiraz (Vitis vinifera L.) cultivar. This study investigated the effect of berry shriveling occurring in a high yielding (18.6 ± 1.6 kg/vine) Shiraz vineyard in relation to a temporal investigation of grape and wine composition using three harvest dates. Berry shriveling resulted in delayed total soluble solids and amino acid accumulation into the berry, however differences between treatments diminished or became smaller by the third harvest date. Similarly, ethyl esters of fatty acids and higher alcohol acetates were lower in wines from shriveled berries from the first two harvests; anthocyanins were reduced in wines from shriveled berries at all harvest dates, whereas terpenes were unaltered. Wines made from shriveled berries had higher γ-nonalactone and β-damascenone concentrations. This study provides novel information on the chemical alterations of grapes and wines made from grapes affected by shriveling.

UJI AKTIVITAS ANTIOKSIDAN MENGGUNAKAN RADIKAL 1,1-DIFENIL-2- PIKRILHIDRAZIL DAN PENETAPAN KANDUNGAN FENOLIK TOTAL FRAKSI ETIL ASETAT EKSTRAK ETANOL BUAH ANGGUR BALI (Vitis vinifera L.

Directory of Open Access Journals (Sweden)

Mikhael Gustandy

2016-04-01

Full Text Available Abstract: This research was conducted to determine the antioxidant activity of ethyl acetat fraction of extract of Balinesse grape (Vitis vinifera L. using free radical and determine the total phenolic content. Balinesse grape was extracted with ethanol and then fractionated using ethyl acetate. Free radical scavenging activity was tested by measuring the DPPH radical scavenging activity. Total phenolic content was determined using the Folin-Ciocalteau method measured the concentration of phenolic content in gallic acid total equivalents using unit's mg/g. The mean IC50 value for DPPH radical scavenging activity of the ethyl acetat fraction of ethanolic extract of Balinesse grape was found to be 36.55 ± 0.09 µg/mL. The phenolic content was ranging from 3.23 ± 0.02 mg gallic acid equivalents per gram of ethyl acetat fraction of ethanolic extract of Balinesse grape. Keywords: antioxidants, Balinesse grape (Vitis vinifera L., fraction of ethyl acetat, DPPH, total phenolic content.

Actividades económicas primarias predominantes en la Reserva Paisajística Nor Yauyos Cochas, Perú. Caso: distritos de Huancaya, Alis y Vitis

Directory of Open Access Journals (Sweden)

Wilfredo Bulege Gutiérrez

2011-12-01

Full Text Available Objetivos: Determinar las actividades económicas primarias predominantes en los distritos de Huancaya, Alis y Vitis de la provincia de Yauyos, región Lima, ubicados en la zona de aprovechamiento directo de la Reserva Paisajística Nor Yauyos Cochas. Métodos: Es una investigación de tipo básica, alcance descriptiva, diseño transversal, en el proceso de recolección de datos se aplicó un cuestionario estructurado a una muestra no probabilística de 79 personas con edades mayores a 18 años entre varones y mujeres de los distritos de Huancaya, Alis y Vitis, quienes participaron en un evento académico sobre “Econegocios para el desarrollo” organizado por Grupo de Proyección Social “Eco-negocios” de la Universidad Continental, este mismo instrumento se aplicó a personas ubicadas circunstancialmente en la vía pública de los mencionados distritos hasta completar el tamaño muestral de 79. Resultados: El 42% manifiesta que se dedica principalmente a la agricultura; 37%, a la ganadería; 5%, a la acuicultura; 5%, a la artesanía y un 11% a otras actividades entre las cuales se puede identificar el comercio, servicios turísticos, minería, etc. Las personas cuya actividad principal es la agricultura manifestaron que el 44% de su producción es maíz; 28%, papa; 23%, trigo y 5% otros productos. Las personas dedicadas a la ganadería manifestaron que el 41%, cría camélidos; 28%, vacunos; 14%, ovinos y un 17%, otros. Conclusiones: La población de los distritos de Huancaya, Alis y Vitis dedican como una de sus actividades económicas de mayor predominancia a la agricultura, luego la ganadería, siendo este un indicador importanteque caracteriza a estos distritos como zonas con una economía basada en actividades primarias, es decir extractiva de recursos naturales y aprovechada prioritariamente para autoconsumo y su comercialización.

A boa-fé nos contratos relacionais : análise da solução cooperativa para a preservação do equilíbrio nos contratos bancários

OpenAIRE

Pessoa, Carlos Levi Costa

2013-01-01

Aplicação da teoria relacional e as soluções cooperativas para a preservação do equilíbrio nos contratos bancários. A pesquisa visa a analisar a teoria relacional, demonstrando a interação entre o princípio da boa-fé e as soluções cooperativas para harmonização dos conflitos nos contratos de longa duração. A partir de estudos dessa doutrina estrangeira, pretende-se evidenciar as novas técnicas negociais adotadas nas relações bancárias de consumo, mais aptas a atender às atuais transformações ...

Políticas de precificação do setor de saneamento urbano no Brasil: as evidências do equilíbrio de baixo nível

Directory of Open Access Journals (Sweden)

Ricardo Coelho de Faria

2005-09-01

Full Text Available O artigo analisa a existência do Equilíbrio de Baixo Nível no setor de saneamento urbano brasileiro, de acordo com o modelo de Spiller e Savedoff (1999. Neste tipo de equilíbrio existe um círculo vicioso entre o oportunismo do governo, preços abaixo dos custos de fornecimento, ausência de investimentos e a baixa qualidade dos serviços de utilidade pública. A exemplo de outros países da América Latina, os resultados demonstram que, com poucas exceções, a qualidade dos serviços de abastecimento urbano de água e de esgotamento sanitário no Brasil é de baixo nível. Este resultado está associado ao modelo ins-titucional e regulatório adotado. No entanto, as particularidades no caso brasileiro deixam mais evidente que o baixo nível está também associado às condições econômicas, uma vez que os estados e municípios de maior renda possuem serviços de alta qualidade, independentemente do sistema regulatório.The existence of a low level equilibrium balance in the supply of urban sewage services is analysed in this essay. The low level equilibrium hypothesis is related to the model by Spiller e Savedoff (1999 for Latin American countries. In their view, government opportunism and populism lead towards prices below costs of providing sewage service in developing countries. This is the starting point of a vicious circle, leading towards low quality of public utility services. Like other countries in Latin America, data for Brazil demonstrate that, with few exceptions, the low level equilibrium of water and sewage supply services in urban areas. However, some particularities in the Brazilian reality suggest that this low level equilibrium may be explained in economic terms. It is shown that wealthier states and municipalities provide high quality services, regardless of the regulatory system.

Historical introgression of the downy mildew resistance gene Rpv12 from the Asian species Vitis amurensis into grapevine varieties.

Directory of Open Access Journals (Sweden)

Silvia Venuti

Full Text Available The Amur grape (Vitis amurensis Rupr. thrives naturally in cool climates of Northeast Asia. Resistance against the introduced pathogen Plasmopara viticola is common among wild ecotypes that were propagated from Manchuria into Chinese vineyards or collected by Soviet botanists in Siberia, and used for the introgression of resistance into wine grapes (Vitis vinifera L.. A QTL analysis revealed a dominant gene Rpv12 that explained 79% of the phenotypic variance for downy mildew resistance and was inherited independently of other resistance genes. A Mendelian component of resistance-a hypersensitive response in leaves challenged with P. viticola-was mapped in an interval of 0.2 cM containing an array of coiled-coil NB-LRR genes on chromosome 14. We sequenced 10-kb genic regions in the Rpv12(+ haplotype and identified polymorphisms in 12 varieties of V. vinifera using next-generation sequencing. The combination of two SNPs in single-copy genes flanking the NB-LRR cluster distinguished the resistant haplotype from all others found in 200 accessions of V. vinifera, V. amurensis, and V. amurensis x V. vinifera crosses. The Rpv12(+ haplotype is shared by 15 varieties, the most ancestral of which are the century-old 'Zarja severa' and 'Michurinets'. Before this knowledge, the chromosome segment around Rpv12(+ became introgressed, shortened, and pyramided with another downy mildew resistance gene from North American grapevines (Rpv3 only by phenotypic selection. Rpv12(+ has an additive effect with Rpv3(+ to protect vines against natural infections, and confers foliar resistance to strains that are virulent on Rpv3(+ plants.

Extração, secagem por atomização e microencapsulamento de antocianinas do bagaço da uva "Isabel" (Vitis labrusca Extraction, spray drying and microencapsulating of 'Isabel' grape (Vitis labrusca bagasse anthocyanin

Directory of Open Access Journals (Sweden)

Eunice Valduga

2008-10-01

Full Text Available Objetivou-se obter neste trabalho um corante natural (antocianina, na forma de pó a partir do bagaço de uva da cultivar "Isabel" (Vitis labrusca, onde foram realizados estudos de extração e encapsulamento. Empregou-se o método de extração por imersão mediante técnica de planejamento experimental, onde as variáveis avaliadas foram pH da solução de extração (1-2, volume de etanol (100-250 mL, tempo de extração (3-7 h e temperatura de extração (15-35ºC. A concentração máxima de antocianinas totais obtidas foi de 300 mg/100 g de bagaço de uva (umidade 5% nos níveis inferiores de pH (1,0 e tempo (3 horas e superiores de temperatura (35ºC e volume de etanol (250 mL. Os extratos foram secos por atomização. A melhor condição para o encapsulamento e a secagem foi quando utilizaram-se proporções iguais de maltodextrina e goma arábica.This work had the aim of obtaining a natural pigment (anthocyanin at powder form from 'Isabel' grape bagasse (Vitis labrusca, studying the extraction and encapsulating steps one applied the method of extraction by immersion by experimental design technique, when the factors investigated were pH of the extraction solution (1-2, volume of ethanol (100-250 mL, extraction time (3-7 h and extraction temperature (15-35 °C. The maximum concentration of total anthocyanin was 300 mg/100g of grape bagasse (5% moisture at the lower levels of pH (1.0 and time (3 h, and at upper levels of temperature (35ºC and amount of ethanol (250 mL. The extracts were dried by a spray process. The best condition for encapsulating and drying was obtained when equal amounts of maltodextrin and Arabic gum were used.

Study of Leaf Metabolome Modifications Induced by UV-C Radiations in Representative Vitis, Cissus and Cannabis Species by LC-MS Based Metabolomics and Antioxidant Assays

Directory of Open Access Journals (Sweden)

Guillaume Marti

2014-09-01

Full Text Available UV-C radiation is known to induce metabolic modifications in plants, particularly to secondary metabolite biosynthesis. To assess these modifications from a global and untargeted perspective, the effects of the UV-C radiation of the leaves of three different model plant species, Cissus antarctica Vent. (Vitaceae, Vitis vinifera L. (Vitaceae and Cannabis sativa L. (Cannabaceae, were evaluated by an LC-HRMS-based metabolomic approach. The approach enabled the detection of significant metabolite modifications in the three species studied. For all species, clear modifications of phenylpropanoid metabolism were detected that led to an increased level of stilbene derivatives. Interestingly, resveratrol and piceid levels were strongly induced by the UV-C treatment of C. antarctica leaves. In contrast, both flavonoids and stilbene polymers were upregulated in UV-C-treated Vitis leaves. In Cannabis, important changes in cinnamic acid amides and stilbene-related compounds were also detected. Overall, our results highlighted phytoalexin induction upon UV-C radiation. To evaluate whether UV-C stress radiation could enhance the biosynthesis of bioactive compounds, the antioxidant activity of extracts from control and UV-C-treated leaves was measured. The results showed increased antioxidant activity in UV-C-treated V. vinifera extracts.

Geochemical behaviour of rare earths in Vitis vinifera grafted onto different rootstocks and growing on several soils

International Nuclear Information System (INIS)

Censi, P.; Saiano, F.; Pisciotta, A.; Tuzzolino, N.

2014-01-01

The geochemical behaviour of lanthanides and yttrium (Rare Earth Elements, REEs) has been investigated mainly in geological systems where these elements represent the best proxies of processes involving the occurrence of an interface between different media. This behaviour is assessed according to features recorded in sequences of REE concentrations along the REE series normalised with respect to a reference material. In this study, the geochemical behaviour of REE was investigated in different parts of Vitis vinifera specimens grown off-soil, on soils of different nature and grafted onto several rootstocks in order to evaluate effects induced by these changes. The results indicated that roots are the plant organs where REEs are preferentially concentrated, in particular elements from Sm to Ho (middle REE, MREE) whereas Eu enrichments occur in aerial parts. The geochemical behaviour of REE suggests that MREE enrichments in roots are due to preferential MREE interactions with biological membranes or to surface complexation with newly formed phosphates. Eu-positive anomalies suggest that Eu 3+ can form stable organic complexes in place of Ca 2+ in several biological processes in xylem fluids. The possibility that Eu mobility in these fluids can be enhanced by its reductive speciation as Eu 2+ cannot be ruled out. The assessment of the geochemical behaviour of REE according to the theory of the Tetrad Effect carried out confirms that REEs coming from soil are scavenged onto root tissues or mineral surfaces whereas their behaviour in aerial parts of V. vinifera is driven by dissolved complexation. - Highlights: • REE behaviour is driven by scavenging onto authigenic solids or membranes in roots. • REE behaviour is driven by dissolved complexation in aerial plant parts. • Positive Eu anomalies are a consequence of the REE translocation by xylem fluids. • Significant REE tetrad effects are observed in Vitis vinifera plants

Efeitos dos exercícios resistidos sobre o equilíbrio e a funcionalidade de idosos saudáveis: artigo de atualização Effects of resistance training on balance and functional ability in healthy elderly: an update

Directory of Open Access Journals (Sweden)

Marina Lorenzi Monteiro de Araújo

2010-09-01

Full Text Available A diminuição da força muscular com o envelhecimento e os baixos níveis de atividade física contribuem para défices funcionais e de equilíbrio. Esta revisão sistemática teve como objetivo analisar os estudos que correlacionaram o treino resistido (TR isolado, o equilíbrio e a função de idosos saudáveis. A busca nas bases do Google Acadêmico e na BVS levou à seleção de 35 estudos controlados. O TR isolado mostrou ser relevante para a função dos idosos (90% dos estudos devido sobretudo ao ganho de força e mobilidade. Exercícios de baixa e moderada intensidade tiveram melhores resultados sobre a função de idosas, frágeis e sedentários. Em relação ao equilíbrio, apesar da inconsistência dos dados, o TR parece exercer efeitos positivos, sobretudo devido a fatores neuromusculares. Estudos com parâmetros de treino e amostra uniformes são necessários para melhor comparação dos resultados, sobretudo em idosos com padrão funcional elevado.Muscle strength decrease in aging and low physical activity levels may be an indicator of balance deficits and functional limitations. The purpose of this systematic review was to assess the effects of resistance training (RT alone on balance performance and functional capacity in healthy elderly. The search in Google Scholar and BVS led to selecting 35 controlled trials. The RT alone showed to have positive effects (90% of the studies on functional tasks in elderly, associated with increases in strength and mobility. Moderate and low-intensity exercise could produce functional capacity benefits in older women, frail and sedentary elderly. Despite the inconsistency of data, resistance training appears to exert positive effects on balance, especially through neuromuscular factors. Standardization of methodology and homogeneity of sampling may ensure greater comparability of results, especially among elderly with high physical functional level.

Treatment strategies for high resveratrol induction in Vitis vinifera L. cell suspension culture

Directory of Open Access Journals (Sweden)

Thu V. Vuong

2014-06-01

Full Text Available Bioprocesses capable of producing large scales of resveratrol at nutraceutical grade are in demand. This study herein investigated treatment strategies to induce the production of resveratrol in Vitis vinifera L. cell suspension cultures. Among seven investigated elicitors, jasmonic acid (JA, salicylic acid, β-glucan (GLU, and chitosan enhanced the production of intracellular resveratrol manyfold. The combined treatment of JA and GLU increased extracellular resveratrol production by up to tenfold. The application of Amberlite XAD-7 resin for in situ removal and artificial storage of secreted resveratrol further increased resveratrol production by up to four orders of magnitude. The level of resveratrol produced in response to the combined treatment with 200 g/L XAD-7, 10 μM JA and 1 mg/mL GLU was approximately 2400 mg/L, allowing the production of resveratrol at an industrial scale. The high yield of resveratrol is due to the involvement of a number of mechanisms working in concert.

Les réseaux professionnels : facteur clé pour l'innovation et les performances dans le secteur viti-vinicole ?

OpenAIRE

Touzard, Jean-Marc

2011-01-01

L'article fait le point sur les recherches qui étudient le rôle des " réseaux professionnels " dans les processus d'innovation du secteur viti-vinicole. Après un rappel des définitions et méthodes d'analyse de ces réseaux, les résultats de recherches sont présentées dans quatre domaines : le changement de pratiques au vignoble, la construction de nouveaux marchés, l'innovation dans les caves coopératives, les relations avec les institutions de recherche. Les résultats montrent comment des for...

European Ethnopharmaceuticals for Self-Medication in Japan: Review Experience of Vitis vinifera L., Folium Extract and Vitex agnus-castus L., Fructus Extract as OTC Drugs.

Science.gov (United States)

Hoshino, Tatsuro; Muto, Nanami; Tsukada, Shinsuke; Nakamura, Takatoshi; Maegawa, Hikoichiro

2018-01-06

Since the publication of "Application Guideline for Western Traditional Herbal Medicines as OTC Drugs" in 2007, only two European ethnopharmaceuticals, Vitis vinifera L., folium extract (Antistax) and Vitex agnus-castus L., fructus extract (Prefemin), have been approved as OTC drugs in Japan. In this review, we describe the current regulation of Western ethnopharmaceuticals in Japan, summarize our regulatory experiences and discuss the scientific and regulatory issues involved.

Response of “Red Globe” (Vitis vinifera L. to cane girdling

Directory of Open Access Journals (Sweden)

Soltekin Oğuzhan

2015-01-01

Full Text Available The effect of cane girdling on skin colour, harvest date, yield, and some quality characteristics of Vitis vinifera L. cv. Red Globe table grape variety, was measured over two growing seasons, 2013–2014, at the facility of Manisa Viticulture Research Station in Turkey. Cane girdling was performed on the spurs after first bud was left from the bottom and 4 mm-wide ring of bark was completely removed with a doubleded knife at veraison period. Statistical analyses showed that total soluble solid content, berry width, berry length, colour parameters, CIRG index and anthocyanin content of the Red Globe was significantly affected by the girdling treatment in both years, 2013 and 2014. In addition it was detected that any effect of girdling treatments cannot be determined statistically significant on total yield, marketable yield, total phenolics, titrable acidity, pH and 50 berry weight. Total and marketable yields of girdled vines had higher value although they weren’t statistically significant. Furthermore it was observed on girdled vines 7 and 11 days earliness compare to the control vines in 2013 and 2014, respectively.

Frieze: Getting beneath the Surface of the Past in Aestheticist Painting and Literature

DEFF Research Database (Denmark)

Østermark-Johansen, Lene

2010-01-01

Artiklen ser på frisen som æstetisk form i malerier af Albert Moore, Lawrence Alma-Tadema og Frederick Leighton og kæder dette sammen med frisen som gennemgående motiv i Walter Paters roman Marius the Epicurean (1885).......Artiklen ser på frisen som æstetisk form i malerier af Albert Moore, Lawrence Alma-Tadema og Frederick Leighton og kæder dette sammen med frisen som gennemgående motiv i Walter Paters roman Marius the Epicurean (1885)....

Characterization of polyphenols and antioxidant potential of white grape pomace byproducts (Vitis vinifera L.).

Science.gov (United States)

González-Centeno, María Reyes; Jourdes, Michael; Femenia, Antoni; Simal, Susana; Rosselló, Carmen; Teissedre, Pierre-Louis

2013-11-27

A detailed assessment of the total phenolic and total tannin contents, the monomeric and oligomeric flavan-3-ol composition, the proanthocyanidin profile, and the antioxidant potential of the grape pomace byproducts (considered as a whole, both skins and seeds), derived from four white grape varieties (Vitis vinifera L.), was performed. Significant differences (p grape pomace byproducts were observed among the different grape varieties studied. For the first time in the literature, the particular flavan-3-ol composition of the four grape varieties investigated was described for the whole fraction of their grape pomace byproducts. The phenolic composition and antioxidant capacity of grape pomaces were compared to those of their corresponding stems. The global characterization of these white grape varieties provided a basis for an integrated exploitation of both winemaking byproducts as potential, inexpensive, and easily available sources of bioactive compounds for the pharmaceutical, cosmetic, and food industries.

Effects of two sources of tannins (Quercus L. and Vaccinium vitis idaea L. on rumen microbial fermentation: an in vitro study

Directory of Open Access Journals (Sweden)

Adam Cieslak

2014-04-01

Full Text Available The aim of the experiment was to determine the effect of different sources of tannins on the in vitro rumen fermentation with focus on methane production. In the experiment, a rumen simulation system (RUSITEC equipped with 4 fermenters (1 L was used in three replicated runs (6 d of adaptation and 4 d of sampling to study the effects of Quercus cortex extract (QC, Vaccinium vitis idaea (VVI dried leaf extract and a mixture of VVI/QC on rumen microbial fermentation. Fermenters were fed 10.9 g/d of dry matter (DM of a 600:400 forage:concentrate diet. Treatments were control, QC (2.725 mL, VVI leaves 0.080 g and mixture of QC/VVI (1.362 mL+0.040 g and were randomly assigned to fermenters within periods. The equivalent of 2.5 g of tannins/kg dietary DM from three sources of tannins was evaluated. All tannin sources decreased CH4 and ammonia concentrations, as well as protozoa and methanogen counts (P<0.001. Vaccinium vitis idaea and QC/VVI tended (P=0.005 to reduce the acetate to propionate ratio. There were no changes in nutrient digestion. Results suggest that these sources of tannins, especially VVI have the potential to reduce rumen CH4 production and ammonia concentration without negative effects on in vitro DM digestibility, total volatile fatty acids and pH.

Colonization of Vitis vinifera by a Green Fluorescence Protein-Labeled, gfp-Marked Strain of Xylophilus ampelinus, the Causal Agent of Bacterial Necrosis of Grapevine

OpenAIRE

Grall, Sophie; Manceau, Charles

2003-01-01

The dynamics of Xylophilus ampelinus were studied in Vitis vinifera cv. Ugni blanc using gfp-marked bacterial strains to evaluate the relative importance of epiphytic and endophytic phases of plant colonization in disease development. Currently, bacterial necrosis of grapevine is of economic importance in vineyards in three regions in France: the Cognac, Armagnac, and Die areas. This disease is responsible for progressive destruction of vine shoots, leading to their death. We constructed gfp-...

European Ethnopharmaceuticals for Self-Medication in Japan: Review Experience of Vitis vinifera L., Folium Extract and Vitex agnus-castus L., Fructus Extract as OTC Drugs

Directory of Open Access Journals (Sweden)

Tatsuro Hoshino

2018-01-01

Full Text Available Since the publication of “Application Guideline for Western Traditional Herbal Medicines as OTC Drugs” in 2007, only two European ethnopharmaceuticals, Vitis vinifera L., folium extract (Antistax and Vitex agnus-castus L., fructus extract (Prefemin, have been approved as OTC drugs in Japan. In this review, we describe the current regulation of Western ethnopharmaceuticals in Japan, summarize our regulatory experiences and discuss the scientific and regulatory issues involved.

Application of fungistatics in soil reduces N uptake by an arctic ericoid shrub (Vaccinium vitis-idaea)

Energy Technology Data Exchange (ETDEWEB)

Walker, J.F.; Johnson, L.; Simpson, N.B.; Bill, M.; Jumpponen, A.

2009-11-01

In arctic tundra soil N is highly limiting, N mineralization is slow and organic N greatly exceeds inorganic N. We studied the effects of fungistatics (azoxystrobin [Quadris{reg_sign}] or propiconazole [Tilt{reg_sign}]) on the fungi isolated from ericaceous plant roots in vitro. In addition to testing the phytotoxicity of the two fungistatics we also tested their effects on growth and nitrogen uptake of an ericaceous plant (Vaccinium uliginosum) in a closed Petri plate system without root-associated fungi. Finally, to evaluate the fungistatic effects in an in vivo experiment we applied fungistatics and nitrogen isotopes to intact tundra soil cores from Toolik Lake, Alaska, and examined the ammonium-N and glycine-N use by Vaccinium vitis-idaea with and without fungistatics. The experiments on fungal pure cultures showed that Tilt{reg_sign} was more effective in reducing fungal colony growth in vitro than Quadris{reg_sign}, which was highly variable among the fungal strains. Laboratory experiments aiming to test the fungistatic effects on plant performance in vitro showed that neither Quadris{reg_sign} nor Tilt{reg_sign} affected V. uliginosum growth or N uptake. In this experiment V. uliginosum assimilated more than an order of magnitude more ammonium-N than glycine-N. The intact tundra core experiment provided contrasting results. After 10 wk of fungistatic application in the growth chamber V. vitis-idaea leaf %N was 10% lower and the amount of leaf {sup 15}N acquired was reduced from labeled ammonium (33%) and glycine (40%) during the 4 d isotope treatment. In contrast to the in vitro experiment leaf {sup 15}N assimilation from glycine was three times higher than from {sup 15}NH{sub 4} in the treatments that received no-fungistatics. We conclude that the function of the fungal communities is essential to the acquisition of N from organic sources and speculate that N acquisition from inorganic sources is mainly inhibited by competition with complex soil microbial

Efectividad del cepillo iónico basado en dióxido de titanio en comparación con el cepillo vitis junior en la eliminación de placa bacteriana en niños de 8 a 10 años del Colegio Weberbauer Schule

OpenAIRE

Conte Pujalt, Giacomo; Olivares Espinoza, Jimmy

2011-01-01

Objetivo. Determinar la efectividad del cepillo iónico basado en dióxido de titanio comparándolo con el cepillo Vitis Junior en la remoción de placa bacteriana en niños de 8 a 10 años del colegio Weberbauer Schule. Material y método. El estudio se realizó en un grupo de 30 niños, los cuales se comportaron como grupo control y experimental, ya que se trabajó con ellos en dos oportunidades diferentes. En la primera se realizó el cepillado con el cepillo Vitis Junior mediante la técnica...

Infestation of grape Vitis vinifera by Ceratitis capitata (Wiedemann) (Diptera: Tephritidae) in sub-medium Sao Francisco valley, Brazil

Energy Technology Data Exchange (ETDEWEB)

Habibe, Tuffi C.; Viana, Rodrigo E.; Damasceno, Itala Cruz; Malavasi, Aldo [Biofabrica Moscamed Brasil, Juazeiro, BA (Brazil). Distrito Industrial do Sao Francisco; Nascimento, Antonio S., E-mail: antnasc@cnpmf.embrapa.b [EMBRAPA Mandioca e Fruticultura Tropical, Cruz das Almas, BA (Brazil); Paranhos, Beatriz A.J.; Haji, Francisca Nemaura P., E-mail: bjodao@cpatsa.embrapa.b [EMBRAPA Semi-Arido, Petrolina, PE (Brazil); Carvalho, Raimundo S. [Agencia de Defesa Agropecuaria da Bahia (ADAB), Salvador, BA (Brazil)

2006-07-01

The objective of this study was to assess the infestation level in grapes, Vitis vinifera, by the medfly,Ceratitis capitata in the Sao Francisco River Valley. The adult population was monitored with Jackson trap baited with trimedlure. Samples of grapes for larval infestation assessment were taken along three months, with a total of 116 kg. The average FTD (flies/trap/day) for medfly males was 0.26. The number of pupae obtained from the fruit samples was 471; 287 adults emerged (60.4%), all Ceratitis capitata. The infestation level was 4.0 pupa/kg of fresh fruit. We conclude that grape is a medfly host in SFV, occasionally causing high damage to production. (author)

Infestation of grape Vitis vinifera by Ceratitis capitata (Wiedemann) (Diptera: Tephritidae) in sub-medium Sao Francisco valley, Brazil

International Nuclear Information System (INIS)

Habibe, Tuffi C.; Viana, Rodrigo E.; Damasceno, Itala Cruz; Malavasi, Aldo; Paranhos, Beatriz A.J.; Haji, Francisca Nemaura P.; Carvalho, Raimundo S.

2006-01-01

The objective of this study was to assess the infestation level in grapes, Vitis vinifera, by the medfly,Ceratitis capitata in the Sao Francisco River Valley. The adult population was monitored with Jackson trap baited with trimedlure. Samples of grapes for larval infestation assessment were taken along three months, with a total of 116 kg. The average FTD (flies/trap/day) for medfly males was 0.26. The number of pupae obtained from the fruit samples was 471; 287 adults emerged (60.4%), all Ceratitis capitata. The infestation level was 4.0 pupa/kg of fresh fruit. We conclude that grape is a medfly host in SFV, occasionally causing high damage to production. (author)

Efecto de la concentración de sacarosa en la producción de antocianinas a partir de cultivos celulares de Vitis vinifera L. var. red globe

Directory of Open Access Journals (Sweden)

Antonieta Miñano

2013-06-01

Full Text Available El cultivo de Vitis vinifera «vid» constituye una de las actividades agrícolas de mayor importancia en nuestra alimentación y en la medicina por presentar unos compuestos bioactivos llamados antocianinas conocidas por tener propiedades antioxidantes, anticancerígenas y cardiotónicas. Con la finalidad de aportar con una alternativa diferente a su extracción tradicional se estableció un sistema de cultivos celulares en suspensión con el propósito de determinar la concentración óptima de sacarosa para obtener mayor producción de antocianinas a partir de cultivos celulares de Vitis vinifera «vid» var. red globe. Se adicionaron diferentes concentraciones de sacarosa (0 mM, 58 mM, 132 mM y 175 mM al medio de cultivo basal (MB suplementado con concentraciones separadas de ácido naftalenacético y kinetina como medio inductor (MI. El contenido de antocianinas aumentó a medida que se incrementó la concentración de sacarosa (132 mM en el medio de cultivo, encontrándose diferencias significativas entre los tratamientos.

Vitis vinifera juice ameliorates depression-like behavior in mice by modulating biogenic amine neurotransmitters

Directory of Open Access Journals (Sweden)

Muhammad Aslam

2015-12-01

Full Text Available The advantageous effects of Vitis vinifera juice on depressive model mice were examined utilizing a blend of behavioral evaluations and biogenic amine neurotransmitter estimations. During the behavioral evaluations, immobility time on the forced swimming test and tail suspension test were measured in unstressed and immobilization-induced stressed mice. V. vinifera juice (4 mL/kg and 8 mL/kg and fluoxetine (20 mg/kg produced a significant decrease in immobility time of both unstressed and stressed mice when compared with their respective saline-treated control groups in both paradigms. Neurotransmitters were measured using high-performance liquid chromatography with electrochemical detector. V. vinifera juice raised the levels of both serotonin (p<0.001 and noradrenalin (p<0.001 in brain tissue. These outcomes give significant mechanistic insights into the protective effect of V. vinifera juice against depressive disorders. Our results showed that V. vinifera juice could relieve depressive manifestations in the rodent model of depression.

Fine structure and spectral index measurements in natural uranium - graphite lattices; Mesures fines dans des reseaux a graphite

Energy Technology Data Exchange (ETDEWEB)

Cogne, F; Journet, J [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

1964-07-01

The experiments described in this report have been carried out for the most part in the critical facility MARIUS, and a few during the start up of the EDF-1 power reactor. The first part deals with the fine structure measurements made in various lattices and with their analysis. Integration over the neutron spectrum of the mono-kinetic disadvantage factor derived by the A.B.H method yields results in good agreement with the experiments. The second part deals with spectral indexes measurements (Pu/U, In/Mn) made at room temperature in MARIUS. Comparison are made of experiments with calculations using various thermalization models. Experiments carried out at higher temperatures in EDF-1 are also described. (authors) [French] Les mesures decrites dans ce rapport ont ete faites pour la plupart dans l'empilement critique MARIUS sur des reseaux a graphite-uranium naturel. Une premiere partie traite des mesures de structure fine faites dans differents reseaux et de leur interpretation. On montre en particulier qu'une integration sur le spectre d'un calcul monocinetique type A.B.H. rend bien compte des experiences. Dans une deuxieme partie, on donne les resultats de mesures d'indices de spectre Pu/U et In/Mn faites sur des reseaux froids a MARIUS et leur comparaison avec les differents modeles de calculs de thermalisation. On donne egalement les resultats de quelques mesures en temperature effectuees lors du demarrage du reacteur EDF-1. (auteurs)

Genetic analysis of Vitis interspecific hybrids occurring in vineyards of the Czech Republic

International Nuclear Information System (INIS)

Jana, R.; Andrea, S.; Radek, S.; Baranek, M.

2016-01-01

SSR analysis of 18 unknown uncultured Vitis genotypes planted in an area mostly dedicated to viticulture in the Czech Republic was performed in this work. The aim of this study was to identify analysed samples by comparing their SSR profiles with described standards and classify their mutual relationships based on their distribution in obtained dendrogram. Results show that 50 percent of unknown genotypes belongs to old American interspecific cultivar Noah and 11 percent belong to another old American cultivar Isabella. The rest of analysed genotypes remain unidentified, but three of them suggest relatedness with Noah cultivar, one genotype shows relatednessto Isabella cultivar. From practical point of view the most interesting ones are three genotypes, which were clearly clustered with the genotypes of cultural varities (botanically V. vinifera L.) used as standard. Based on this it is then possible to assume that those genotypes probably originated from crossing of non-V. vinifera genotype specimen with unknown cultural variety. Potential importance of analysed hybrids for further investigation and breeding, especialy in an eco-friendly viticulture, is also discussed. (author)

Cloning, expression, purification and crystallization of dihydrodipicolinate synthase from the grapevine Vitis vinifera

International Nuclear Information System (INIS)

Atkinson, Sarah C.; Dogovski, Con; Newman, Janet; Dobson, Renwick C. J.; Perugini, Matthew A.

2011-01-01

Dihydrodipicolinate synthase from the common grapevine V. vinifera has been cloned, expressed, purified and crystallized in the presence of the substrate pyruvate by in-drop hexahistidine-tag cleavage. A diffraction data set has been collected to a resolution of 2.2 Å. Dihydrodipicolinate synthase (DHDPS) catalyses the first committed step of the lysine-biosynthesis pathway in bacteria, plants and some fungi. This study describes the cloning, expression, purification and crystallization of DHDPS from the grapevine Vitis vinifera (Vv-DHDPS). Following in-drop cleavage of the hexahistidine tag, cocrystals of Vv-DHDPS with the substrate pyruvate were grown in 0.1 M Bis-Tris propane pH 8.2, 0.2 M sodium bromide, 20%(w/v) PEG 3350. X-ray diffraction data in space group P1 at a resolution of 2.2 Å are presented. Preliminary diffraction data analysis indicated the presence of eight molecules per asymmetric unit (V M = 2.55 Å 3 Da −1 , 52% solvent content). The pending crystal structure of Vv-DHDPS will provide insight into the molecular evolution in quaternary structure of DHDPS enzymes

Anthocyanin characteristics of wines in Vitis germplasms cultivated in southern China

Directory of Open Access Journals (Sweden)

Guo CHENG

2017-10-01

Full Text Available Abstract The anthocyanin profiles and CIELAB color values of nine wines in Vitis germplasms from southern China were compared. The results showed that the anthocyanin composition of wines from one hybrid between V. vinifera and V. labrusca (‘Moldova’, two V. labrusca varieties (‘Conquistador’ and ‘Saint-Croix’, one V. quinquangularis variety (‘Yeniang No.2’, one hybrid between V. quinquangularis and V. vinifera (‘NW196’, one V. davidii variety (‘Xiangniang No.1’ and one V. rotundifolia variety (‘Noble’ were dominated by anthocyanidin 3,5-O-diglucosides. All these were quite different from V. vinifera wines (‘Cabernet Sauvignon’ and ‘Marselan’, which were characterized by the monoglucoside and pyranoanthocyanins. 3',4',5'-substituted anthocyanins were dominant in the wines of all varieties, except ‘Noble’ wine. ‘Yeniang No.2’ (V. quinquangularis had the highest acid, total anthocyanin concentration, and showed a more intense pigmentation with a higher proportion and concentration of coumaroylated anthocyanins. In the colorimetric analysis, ‘Yeniang No.2’ (V. quinquangularis wine showed the most saturated red colors, followed by ‘NW196’ (V. quinquangularis. The detected chromatic characteristics of these wines were basically in accordance with their sensory evaluation.

Metabolic changes of Vitis vinifera berries and leaves exposed to Bordeaux mixture.

Science.gov (United States)

Martins, Viviana; Teixeira, António; Bassil, Elias; Blumwald, Eduardo; Gerós, Hernâni

2014-09-01

Since the development of Bordeaux mixture in the late 1800's, copper-based fungicides have been widely used against grapevine (Vitis vinifera L.) diseases, mainly in organic but also in conventional viticulture; however their intensive use has raised phytotoxicity concerns. In this study, the composition of grape berries and leaves upon Bordeaux mixture treatment was investigated during the fructification season by a metabolomic approach. Four applications of Bordeaux mixture till 3 weeks before harvest were performed following the regular management practices of organic viticulture. Results showed that the copper-based treatment affected the content in sugars, organic acids, lipids and flavan-3-ols of grapes and leaves at specific developmental stages. Nonetheless, the levels of sucrose, glucose and fructose, and of tartaric and malic acids were not significantly affected in mature grapes. In contrast, a sharp decrease in free natural amino acids was observed, together with a reduction in protein content and in mineral nitrogen forms. The treatment with Bordeaux mixture increased by 7-fold the copper levels in tissue extracts from surface-washed mature berries. Copyright © 2014 Elsevier Masson SAS. All rights reserved.

Diagnóstico microbiológico da Vitis lambrusca comercializada em estabelecimentos formais e feiras livres em João Pessoa, Paraíba

Directory of Open Access Journals (Sweden)

Anderson Guedes Dantas

2017-10-01

Full Text Available A uva é umas das principais frutas dentre as mais consumidas no Brasil, sendo assim o seu comércio apresenta grande importância para o crescimento econômico do país. Este cultivo tem maior produção nas serras gaúchas onde a combinação entre clima e solo favoráveis à Vitis lambrusca. Apesar dos vários benefícios oferecidos pela uva, ela também pode trazer riscos para à saúde quando ingerida de forma inadequada. Sendo assim, a análise microbiológica da uva mostra as possíveis contaminações adquiridas desde o plantio até a distribuição para o consumidor. O presente trabalho teve como objetivo avaliar microbiologicamente a Vitis lambrusca (uva Isabel, simulando o consumo direto em estabelecimentos formais e feiras livres no município de João Pessoa. As amostras para análises foram adquiridas em 11 pontos aleatórios observando os principais indicadores: Salmonella sp. e Escherichia coli. Verificou-se que 63,63% das amostras apresentaram-se contaminadas, portanto, impróprias para o consumo humano, mostrando assim que a ingestão das mesmas sem uma a devida sanitização oferece riscos a saúde humana.

Phylogenetic analyses of Vitis (Vitaceae) based on complete chloroplast genome sequences: effects of taxon sampling and phylogenetic methods on resolving relationships among rosids.

Science.gov (United States)

Jansen, Robert K; Kaittanis, Charalambos; Saski, Christopher; Lee, Seung-Bum; Tomkins, Jeffrey; Alverson, Andrew J; Daniell, Henry

2006-04-09

The Vitaceae (grape) is an economically important family of angiosperms whose phylogenetic placement is currently unresolved. Recent phylogenetic analyses based on one to several genes have suggested several alternative placements of this family, including sister to Caryophyllales, asterids, Saxifragales, Dilleniaceae or to rest of rosids, though support for these different results has been weak. There has been a recent interest in using complete chloroplast genome sequences for resolving phylogenetic relationships among angiosperms. These studies have clarified relationships among several major lineages but they have also emphasized the importance of taxon sampling and the effects of different phylogenetic methods for obtaining accurate phylogenies. We sequenced the complete chloroplast genome of Vitis vinifera and used these data to assess relationships among 27 angiosperms, including nine taxa of rosids. The Vitis vinifera chloroplast genome is 160,928 bp in length, including a pair of inverted repeats of 26,358 bp that are separated by small and large single copy regions of 19,065 bp and 89,147 bp, respectively. The gene content and order of Vitis is identical to many other unrearranged angiosperm chloroplast genomes, including tobacco. Phylogenetic analyses using maximum parsimony and maximum likelihood were performed on DNA sequences of 61 protein-coding genes for two datasets with 28 or 29 taxa, including eight or nine taxa from four of the seven currently recognized major clades of rosids. Parsimony and likelihood phylogenies of both data sets provide strong support for the placement of Vitaceae as sister to the remaining rosids. However, the position of the Myrtales and support for the monophyly of the eurosid I clade differs between the two data sets and the two methods of analysis. In parsimony analyses, the inclusion of Gossypium is necessary to obtain trees that support the monophyly of the eurosid I clade. However, maximum likelihood analyses place

Phylogenetic analyses of Vitis (Vitaceae based on complete chloroplast genome sequences: effects of taxon sampling and phylogenetic methods on resolving relationships among rosids

Directory of Open Access Journals (Sweden)

Alverson Andrew J

2006-04-01

Full Text Available Abstract Background The Vitaceae (grape is an economically important family of angiosperms whose phylogenetic placement is currently unresolved. Recent phylogenetic analyses based on one to several genes have suggested several alternative placements of this family, including sister to Caryophyllales, asterids, Saxifragales, Dilleniaceae or to rest of rosids, though support for these different results has been weak. There has been a recent interest in using complete chloroplast genome sequences for resolving phylogenetic relationships among angiosperms. These studies have clarified relationships among several major lineages but they have also emphasized the importance of taxon sampling and the effects of different phylogenetic methods for obtaining accurate phylogenies. We sequenced the complete chloroplast genome of Vitis vinifera and used these data to assess relationships among 27 angiosperms, including nine taxa of rosids. Results The Vitis vinifera chloroplast genome is 160,928 bp in length, including a pair of inverted repeats of 26,358 bp that are separated by small and large single copy regions of 19,065 bp and 89,147 bp, respectively. The gene content and order of Vitis is identical to many other unrearranged angiosperm chloroplast genomes, including tobacco. Phylogenetic analyses using maximum parsimony and maximum likelihood were performed on DNA sequences of 61 protein-coding genes for two datasets with 28 or 29 taxa, including eight or nine taxa from four of the seven currently recognized major clades of rosids. Parsimony and likelihood phylogenies of both data sets provide strong support for the placement of Vitaceae as sister to the remaining rosids. However, the position of the Myrtales and support for the monophyly of the eurosid I clade differs between the two data sets and the two methods of analysis. In parsimony analyses, the inclusion of Gossypium is necessary to obtain trees that support the monophyly of the eurosid I clade

Variability in the content of trans-resveratrol, trans-ε-viniferin and r2-viniferin in grape cane of seven Vitis vinifera L. varieties during a three-year study

Czech Academy of Sciences Publication Activity Database

Tříska, Jan; Vrchotová, Naděžda; Balík, J.; Soural, I.; Sotolář, R.

2017-01-01

Roč. 22, č. 6 (2017), č. článku 928. ISSN 1420-3049 R&D Projects: GA MŠk(CZ) LO1415; GA MŠk(CZ) LD14038 Institutional support: RVO:67179843 Keywords : stilbenes * Vitis vinifera L * grape cane * Moravian wine region Subject RIV: EH - Ecology, Behaviour OBOR OECD: Environmental sciences (social aspects to be 5.7) Impact factor: 2.861, year: 2016

Studies of outer planet satellites, Mercury and Uranus

Science.gov (United States)

Mckinnon, William B.; Schenk, Paul M.

1987-01-01

Arguments were made, based on geometry, for both an impact and an internal origin for the ancient, partially preserved furrow system of Ganymede. It was concluded that furrows were not concentric, but could be impact related if multiringed structures on icy satellites are initially noncircular. The geometry of the Valhalla ring structure on Callisto was examined in order to assess the circularity of an unmodified ring system. The Ganymede furrow system was remapped to make use of improvements in coordinate control. The least-squares center of curvature for all furrows in the Marius and Galileao Regio is -20.7, and 179.2 degrees. Furrows in Marius and Galileo Regio are reasonably concentric, and are much more circular than previously estimated. The perceived present nonalignment of the assumed originally concentric furrows were used to argue for large-scale lateral motion of dark terrain blocks in Ganymede's crust, presumably in association with bright terrain formation., The overall alignment of furrows as well as the inherent scatter in centers of curvature from subregions of Galileo and Marius do not support this hypothesis.

Antioxidant and antiproliferative activities of twenty-four Vitis vinifera grapes.

Directory of Open Access Journals (Sweden)

Zhenchang Liang

Full Text Available Grapes are rich in phytochemicals with many proven health benefits. Phenolic profiles, antioxidant and antiproliferative activities of twenty-four selected Vitis vinifera grape cultivars were investigated in this study. Large ranges of variation were found in these cultivars for the contents of total phenolics (95.3 to 686.5 mg/100 g and flavonoids (94.7 to 1055 mg/100 g and antioxidant activities (oxygen radical absorbance capacity 378.7 to 3386.0 mg of Trolox equivalents/100 g and peroxylradical scavenging capacity14.2 to 557 mg of vitamin C equivalents/100 g, cellular antioxidant activities (3.9 to 139.9 µmol of quercetin equivalents/100 g without PBS wash and 1.4 to 95.8 µmol of quercetin equivalents /100 g with PBS wash and antiproliferative activities (25 to 82% at the concentrations of 100 mg/mL extracts.The total antioxidant activities were significantly correlated with the total phenolics and flavonoids. However, no significant correlations were found between antiproliferative activities and total phenolics or total flavonoids content. Wine grapes and color grapes showed much higher levels of phytochemicals and antioxidant activities than table grapes and green/yellow grapes. Several germplasm accessions with much high contents of phenolics and flavonoids, and total antioxidant activity were identified. These germplasm can be valuable sources of genes for breeding grape cultivars with better nutritional qualities of wine and table grapes in the future.

Efeitos de um programa de atividade física nas funções cognitivas, equilíbrio e risco de quedas em idosos com demência de Alzheimer Effects of physical activity on cognitive functions, balance and risk of falls in elderly patients with Alzheimer's dementia

Directory of Open Access Journals (Sweden)

Salma S. S. Hernandez

2010-02-01

Full Text Available OBJETIVO: Analisar os efeitos de um programa de atividade física regular, sistematizado e supervisionado sobre as funções cognitivas, equilíbrio e risco de quedas de idosos com demência de Alzheimer (DA. MÉTODOS: Dezesseis idosos com idade média de 78,5±6,8 anos foram alocados em dois grupos: grupo intervenção (GI; n=9 e grupo rotina (GR; n=7. O GI praticou seis meses de atividade física sistematizada, e ambos os grupos foram avaliados por meio dos seguintes testes: Mini Exame do Estado Mental (MEEM, Escala de Equilíbrio Funcional de Berg (EEFB, Timed Up and Go (TUG e de Agilidade e Equilíbrio Dinâmico (AGILEQ da bateria da American Alliance for Health Recreation and Dance (AAHPERD. RESULTADOS: Houve interação estatisticamente significativa (ANOVA two way; F1,14=32,07; p=0,01 entre grupos e momentos para o teste AGILEQ. O teste U Mann Whitney apontou diferenças significantes intergrupos (p=0,03 apenas no momento pós-intervenção para o TUG avaliado em passos e para a EEFB; portanto sem mostrar diferença significante no TUG, EEFB e MEEM no momento pré intervenção, bem como no momento pós-intervenção para o TUG em segundos e para o MEEM. Na análise intragrupo, o teste de Wilcoxon mostrou piora significativa no MEEM, TUG e EEFB do GR, mas não do GI. O coeficiente de Spearman mostrou correlação significativa entre os resultados do MEEM e AGILEQ. CONCLUSÕES: A atividade física parece representar uma importante abordagem não farmacológica, beneficiando as funções cognitivas e o equilíbrio com diminuição do risco de quedas. Além disto, a agilidade e o equilíbrio estão associados com funções cognitivas em idosos com DA.OBJECTIVE: To analyze the effects of regular, systematic and supervised activity on the cognitive functions, balance and risk of falls of elderly patients with Alzheimer's Dementia (AD. METHODS: Sixteen elderly patients (mean age 78.5±6.8 years were divided into two groups: intervention group

Estudo do equilíbrio líquido-líquido nos sistemas ternários biodiesel de óleo de palma+etanol+glicerina e biodiesel de óleo de palma+etanol+água

OpenAIRE

Enio Gomes de Azevedo Rocha

2012-01-01

Resumo: O biodiesel é uma fonte de energia renovável promissora e é do interesse das matrizes energéticas brasileiras e mundiais em razão da futura escassez de combustíveis fósseis, e das considerações ambientais sobre a diminuição das emissões poluentes. Este trabalho objetiva a produção de biodiesel etílico a partir de óleo de palma da região amazônica, e a determinação experimental e modelagem termodinâmica de dados de equilíbrio líquido-líquido em sistemas ternários compostos por biodiese...

Investigation of the distribution and season regularity of resveratrol in Vitis amurensis via HPLC-DAD-MS/MS.

Science.gov (United States)

Ji, Mei; Li, Qiang; Ji, Hua; Lou, Hongxiang

2014-01-01

This study aims to investigate the change trend of resveratrol contents in different tissues of Vitis amurensis Rupr. during the different seasons in a year. A rapid and sensitive method using high-performance liquid chromatography coupled with diode array detection and tandem mass spectrometry was developed. Resveratrol is mainly distributed in the rhizomes and roots of grape plants. It is also found in leaves and vines, but to a lesser extent. Resveratrol contents are augmented gradually in rhizomes and roots from January to September, and then decrease until January of the following year. During grape ripening, grape skins are also an available source of resveratrol. In conclusion, V. amurensis is a rich source of resveratrol. The distribution of resveratrol in V. amurensis reported in this study can contribute to the future application of resveratrol. Copyright © 2013 Elsevier Ltd. All rights reserved.

Grape (Vitis vinifera) extracts protect against radiation-induced oxidative stress and DNA damage

International Nuclear Information System (INIS)

Singha, Indrani; Das, Subir Kumar; Saxena, S.; Gautam, S.

2016-01-01

Ionizing radiation (IR) causes oxidative stress through the overwhelming generation of reactive oxygen species (ROS) in the living cells leading further to the oxidative damage to biomolecules. Grapes (Vitis vinifera) contain several bioactive phytochemicals and are the richest source of antioxidant. In this study, we investigated and compared in vitro antioxidant activity and DNA damage protective property of the grape extracts of four different cultivars, including the Thompson seedless, Flame seedless, Kishmish chorni and Red globe. The activities of ascorbic acid oxidase and catalase significantly (p<0.01) differed among extracts within the same cultivar, while that of peroxidase and polyphenol oxidase did not differ significantly among extracts of any cultivar. In vitro antioxidant activities were assessed by ferric-reducing antioxidant power (FRAP) assay and ABTS. The superoxide radical-scavenging activity was higher in the seed as compared to the skin or pulp of the same cultivar. DNA damage was evaluated in acellular system using pBR322 plasmid relaxation. Grape extract was able to effectively scavenge free radicals in vitro. It could significantly prevent radiation-induced DNA damage. Furthermore, the protective action of grape depends on the source of extract and type of the cultivars. (author)

Evaluating the Polyphenol Profile in Three Segregating Grape (Vitis vinifera L. Populations

Directory of Open Access Journals (Sweden)

Alberto Hernández-Jiménez

2013-01-01

Full Text Available This paper explores the characteristics of the anthocyanin and flavonol composition and content in grapes from plants resulting from intraspecific crosses of Vitis vinifera varieties Monastrell × Cabernet Sauvignon, Monastrell × Syrah, and Monastrell × Barbera, in order to acquire information for future breeding programs. The anthocyanin and flavonol compositions of twenty-seven hybrids bearing red grapes and 15 hybrids bearing white grapes from Monastrell × Syrah, 32 red and 6 white from Monastrell × Cabernet Sauvignon, and 13 red from Monastrell × Barbera have been studied. Among the intraspecific crosses, plants with grapes presenting very high concentrations of anthocyanins and flavonols were found, indicating a transgressive segregation for this character, and this could lead to highly colored wines with an increased benefits for human health. As regards the qualitative composition of anthocyanins and flavonols, the hydroxylation pattern of the hybrids that also may influence wine color hue and stability presented intermediate values to those of the parentals, indicating that values higher than that showed by the best parental in this respect will be difficult to obtain. The results presented here can be helpful to acquire information for future breeding efforts, aimed at improving fruit quality through the effects of flavonoids.

Sleep disorders and starting time to school impair balance in 5-year-old children Distúrbios do sono, período escolar e equilíbrio em crianças com 5 anos de idade

Directory of Open Access Journals (Sweden)

Cristiane Aparecida Moran

2005-09-01

Full Text Available OBJECTIVE: To verify if sleep disorders and differents starting time to school have impaired motor skills in 5-year-old children. METHOD: Cross-sectional design consisting of 132 children with sleep disorders and 136 normal controls of the public school in the city of São Paulo. The group with sleep disorders was identified based on a questionnaire, and motor tests for global motor coordination, fine motor coordination, perceptual-motor coordination, and static and dynamic balance were applied in all children. RESULTS: In the static balance test, more specifically in the sharpened Romberg (Tandem test, 34% of boys from the study group, who studied in the morning, failed the test (p OBJETIVO: Verificar se distúrbios do sono e diferentes períodos escolares comprometem as habilidades motoras de crianças de 5 anos. MÉTODO: Realizou-se estudo transversal com 132 crianças com distúrbio do sono e 136 controles normais de escolas públicas da cidade de São Paulo. Foram utilizados questionários para distúrbios do sono e testes para coordenação motora global, motora fina, percepto-motora, equilíbrio estático e dinâmico. RESULTADOS: No teste de equilíbrio estático, mais especificamente na prova pé ante pé, 34% dos meninos do grupo estudo, que estudavam no período da manhã, falharam no teste (p < 0,05. Na prova de apoio monopodal, 62% dos meninos do grupo estudo, que estudavam no período da manhã, falharam no teste (p < 0,05. CONCLUSÃO: Este estudo sugere que os distúrbios do sono podem interagir com o período escolar e alterar a performance motora, principalmente de meninos que estudam no período da manhã.

Identification of two novel powdery mildew resistance loci, Ren6 and Ren7, from the wild Chinese grape species Vitis piasezkii.

Science.gov (United States)

Pap, Dániel; Riaz, Summaira; Dry, Ian B; Jermakow, Angelica; Tenscher, Alan C; Cantu, Dario; Oláh, Róbert; Walker, M Andrew

2016-07-29

Grapevine powdery mildew Erysiphe necator is a major fungal disease in all grape growing countries worldwide. Breeding for resistance to this disease is crucial to avoid extensive fungicide applications that are costly, labor intensive and may have detrimental effects on the environment. In the past decade, Chinese Vitis species have attracted attention from grape breeders because of their strong resistance to powdery mildew and their lack of negative fruit quality attributes that are often present in resistant North American species. In this study, we investigated powdery mildew resistance in multiple accessions of the Chinese species Vitis piasezkii that were collected during the 1980 Sino-American botanical expedition to the western Hubei province of China. A framework genetic map was developed using simple sequence repeat markers in 277 seedlings of an F1 mapping population arising from a cross of the powdery mildew susceptible Vitis vinifera selection F2-35 and a resistant accession of V. piasezkii DVIT2027. Quantitative trait locus analyses identified two major powdery mildew resistance loci on chromosome 9 (Ren6) and chromosome 19 (Ren7) explaining 74.8 % of the cumulative phenotypic variation. The quantitative trait locus analysis for each locus, in the absence of the other, explained 95.4 % phenotypic variation for Ren6, while Ren7 accounted for 71.9 % of the phenotypic variation. Screening of an additional 259 seedlings of the F1 population and 910 seedlings from four pseudo-backcross populations with SSR markers defined regions of 22 kb and 330 kb for Ren6 and Ren7 in the V. vinifera PN40024 (12X) genome sequence, respectively. Both R loci operate post-penetration through the induction of programmed cell death, but vary significantly in the speed of response and degree of resistance; Ren6 confers complete resistance whereas Ren7 confers partial resistance to the disease with reduced colony size. A comparison of the kinetics of induction of powdery

Genomic DNA-based absolute quantification of gene expression in Vitis.

Science.gov (United States)

Gambetta, Gregory A; McElrone, Andrew J; Matthews, Mark A

2013-07-01

Many studies in which gene expression is quantified by polymerase chain reaction represent the expression of a gene of interest (GOI) relative to that of a reference gene (RG). Relative expression is founded on the assumptions that RG expression is stable across samples, treatments, organs, etc., and that reaction efficiencies of the GOI and RG are equal; assumptions which are often faulty. The true variability in RG expression and actual reaction efficiencies are seldom determined experimentally. Here we present a rapid and robust method for absolute quantification of expression in Vitis where varying concentrations of genomic DNA were used to construct GOI standard curves. This methodology was utilized to absolutely quantify and determine the variability of the previously validated RG ubiquitin (VvUbi) across three test studies in three different tissues (roots, leaves and berries). In addition, in each study a GOI was absolutely quantified. Data sets resulting from relative and absolute methods of quantification were compared and the differences were striking. VvUbi expression was significantly different in magnitude between test studies and variable among individual samples. Absolute quantification consistently reduced the coefficients of variation of the GOIs by more than half, often resulting in differences in statistical significance and in some cases even changing the fundamental nature of the result. Utilizing genomic DNA-based absolute quantification is fast and efficient. Through eliminating error introduced by assuming RG stability and equal reaction efficiencies between the RG and GOI this methodology produces less variation, increased accuracy and greater statistical power. © 2012 Scandinavian Plant Physiology Society.

The proteins of the grape (Vitis vinifera L.) seed endosperm: fractionation and identification of the major components.

Science.gov (United States)

Gazzola, Diana; Vincenzi, Simone; Gastaldon, Luca; Tolin, Serena; Pasini, Gabriella; Curioni, Andrea

2014-07-15

In the present study, grape (Vitis vinifera L.) seed endosperm proteins were characterized after sequential fractionation, according to a modified Osborne procedure. The salt-soluble fraction (albumins and globulins) comprised the majority (58.4%) of the total extracted protein. The protein fractions analysed by SDS-PAGE showed similar bands, indicating different solubility of the same protein components. SDS-PAGE in non-reducing and reducing conditions revealed the polypeptide composition of the protein bands. The main polypeptides, which were similar in all the grape varieties analysed, were identified by LC-MS/MS as homologous to the 11S globulin-like seed storage proteins of other plant species, while a monomeric 43 kDa protein presented high homology with the 7S globulins of legume seeds. The results provide new insights about the identity, structure and polypeptide composition of the grape seed storage proteins. Copyright © 2014 Elsevier Ltd. All rights reserved.

Distribution of 14C-photosynthetate in the shoot of Vitis vinifera L. cv Cabernet Sauvignon: Pt. I

International Nuclear Information System (INIS)

Hunter, J.J.; Visser, J.H.

1988-01-01

The distribution of photosynthetates, originating in leaves of different parts of the shoot of Vitis vinifera L. cv Cabernet Sauvignon at berry set, pea size, veraison and ripeness stages, was investigated. Specific photosynthetic activity of the 14 CO 2 -treated leaves gradually decreased during the season. Photosynthetates were hoarded in the leaves at berry set, but were increasingly diverted to the bunches after that. The apical leaves displayed the highest photosynthesis. The leaves opposite and below the bunches accumulated very little photosynthetates, especially from veraison to ripeness. Redistribution of photosynthetates among the basal, middle and apical leaves was generally very restricted at all stages. Multidirectional distribution from the site of application of 14 CO 2 occurred at berry set stage, while from pea size to ripeness photosynthetates were mainly translocated basipetally. Highest accumulation in the bunches occurred at veraison, while the basal leaves were primarily used to nourish the bunch

Drought adaptation strategies of four grapevine cultivars (Vitis vinifera L.: modification of the properties of the leaf area

Directory of Open Access Journals (Sweden)

María Gómez-del-Campo

2003-09-01

Full Text Available This essay studies the morphological and anatomical properties of the leaves of Garnacha tinta, Tempranillo, Chardonnay and Airén grapevines in order to discover the drought adaptation strategies present in Vitis vinifera L. The grapevines were grown under two water availability conditions: water limitation and non-water limitation. There was a significantly lower development of leaf area under conditions of water limitation compared to non-water limitation due to a reduction in the size of main and lateral shoot leaves, and a smaller number of leaves on lateral shoots. The development of the leaf area under water limitation conditions occurred on earlier dates than under non-water limitation conditions. Significantly lower stomatal density was observed under water limitation conditions rather than non-water limitation conditions exclusively in the Airén cultivar.

Ethanolic Extract of Vitis thunbergii Exhibits Lipid Lowering Properties via Modulation of the AMPK-ACC Pathway in Hypercholesterolemic Rabbits

Directory of Open Access Journals (Sweden)

Chun-Hsu Pan

2012-01-01

Full Text Available Vitis thunbergii (VT is a wild grape that has been shown to provide various cardioprotective effects. The present study was designed to examine whether a VT extract could reduce serum lipid levels and prevent atherogenesis in a hypercholesterolemic rabbit model. At the end of an 8-week study, our results showed that a VT extract supplement markedly suppressed the serum levels of cholesterol and low-density lipoprotein, reduced lipid accumulation in liver tissues, and limited aortic fatty streaks. Our findings suggest that the VT extract activated AMPK (5′-adenosine monophosphate-activated protein kinase with subsequent inhibition of the activation of ACC (acetyl-CoA carboxylase. Our results suggest that this VT extract could be further developed as a potential lipid-lowering agent and as a natural health food to prevent atherogenesis.

Práticas Intervencionistas e Seus Efeitos sobre o Comércio Internacional de Soja: uma análise a partir de um Modelo de Equilíbrio Geral Computável e da Teoria dos Jogos

Directory of Open Access Journals (Sweden)

Eduardo Rodrigues Sanguinet

Full Text Available Resumo: Este trabalho objetivou analisar o comércio bilateral entre Brasil e os principais atuantes na comercialização internacional da soja - Argentina, Estados Unidos e China - com a pretensão de verificar como a prática de determinadas ações de intervenção na agricultura e no comércio influenciam mudanças no panorama do comércio dessa commodity. Nesse sentido, simularam-se cenários elaborados a partir de práticas comerciais adotadas por esses países, cujos resultados de equilíbrio foram obtidos com o Modelo de Equilíbrio Geral Global Trade Analysis Project (GTAP e analisados a partir da Teoria dos Jogos. Esses resultados foram utilizados para construir a matriz de payoffs, associadas às estratégias comerciais dos países que eram os jogadores. Os resultados permitiram verificar que as políticas de incentivo à produção são formas eficazes de os governos tornarem seus países mais competitivos e obterem ganhos comerciais sobre, ou em conjunto, com os demais. Observou-se que a China pode se tornar um importante concorrente para os exportadores de soja, dependendo da política adotada pelo governo e as instituições chinesas. Concluiu-se que o acesso a mercados é a principal fonte de ganhos de comércio para os produtos do complexo de soja e que a eliminação das tarifas às importações desses produtos traz ganhos expressivos para o Brasil, os Estados Unidos e a Argentina, além das formas de subsidiar a produção e/ou as exportações.

Poly(lactic-co-glycolic) acid nanoparticles uptake by Vitis vinifera and grapevine-pathogenic fungi

International Nuclear Information System (INIS)

Valletta, Alessio; Chronopoulou, Laura; Palocci, Cleofe; Baldan, Barbara; Donati, Livia; Pasqua, Gabriella

2014-01-01

Poly(lactic-co-glycolic) acid (PLGA)-based NPs are currently considered among the most promising drug carriers, nevertheless their use in plants has never been investigated. In this work, for the first time, we demonstrated the ability of PLGA NPs to cross the plant cell wall and membrane of Vitis vinifera cell cultures and grapevine-pathogenic fungi. By means of fluorescence microscopy, we established that PLGA NPs can enter in grapevine leaf tissues through stomata openings and that they can be absorbed by the roots and transported to the shoot through vascular tissues. TEM analysis on cultured cells showed that NPs ≤ 50 nm could enter cells, while bigger ones remained attached to the cell wall. Viability tests demonstrated that PLGA NPs were not cytotoxic for V. vinifera-cultured cells. The cellular uptake of PLGA NPs by some important grapevine-pathogenic fungi has also been observed, thus suggesting that PLGA NPs could be used to deliver antifungal compounds within fungal cells. Overall the results reported suggest that such NPs may play a key role in future developments of agrobiotechnologies, as it is currently happening in biomedicine

Poly(lactic-co-glycolic) acid nanoparticles uptake by Vitis vinifera and grapevine-pathogenic fungi

Energy Technology Data Exchange (ETDEWEB)

Valletta, Alessio [“Sapienza” University of Rome, Department of Environmental Biology (Italy); Chronopoulou, Laura; Palocci, Cleofe, E-mail: cleofe.palocci@uniroma1.it [“Sapienza” University of Rome, Department of Chemistry (Italy); Baldan, Barbara [University of Padua, Department of Biology (Italy); Donati, Livia; Pasqua, Gabriella [“Sapienza” University of Rome, Department of Environmental Biology (Italy)

2014-12-15

Poly(lactic-co-glycolic) acid (PLGA)-based NPs are currently considered among the most promising drug carriers, nevertheless their use in plants has never been investigated. In this work, for the first time, we demonstrated the ability of PLGA NPs to cross the plant cell wall and membrane of Vitis vinifera cell cultures and grapevine-pathogenic fungi. By means of fluorescence microscopy, we established that PLGA NPs can enter in grapevine leaf tissues through stomata openings and that they can be absorbed by the roots and transported to the shoot through vascular tissues. TEM analysis on cultured cells showed that NPs ≤ 50 nm could enter cells, while bigger ones remained attached to the cell wall. Viability tests demonstrated that PLGA NPs were not cytotoxic for V. vinifera-cultured cells. The cellular uptake of PLGA NPs by some important grapevine-pathogenic fungi has also been observed, thus suggesting that PLGA NPs could be used to deliver antifungal compounds within fungal cells. Overall the results reported suggest that such NPs may play a key role in future developments of agrobiotechnologies, as it is currently happening in biomedicine.

EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA); Scientific Opinion on the substantiation of a health claim related to Vitis vinifera L. seeds extract and maintenance of normal venous blood flow pursuant to Article 13(5) of Regulation (EC) No 1924/2006

DEFF Research Database (Denmark)

Tetens, Inge

Following an application from Nutrilinks Sarl, submitted pursuant to Article 13(5) of Regulation (EC) No 1924/2006 via the Competent Authority of Belgium, the Panel on Dietetic Products, Nutrition and Allergies (NDA) was asked to deliver an opinion on the scientific substantiation of a health claim...... related to Vitis vinifera L. seeds extract and maintenance of normal venous blood flow. The Panel considers that the food constituent, which is the subject of the health claim, is sufficiently characterised. The claimed effect, maintenance of normal venous blood flow, is a beneficial physiological effect...... and did not measure venous blood flow, the Panel considers that no conclusions can be drawn from these studies for the scientific substantiation of the claim. The Panel concludes that a cause and effect relationship has not been established between the consumption of Vitis vinifera L. seeds extract...

The composition of cell walls from grape skin in Vitis vinifera intraspecific hybrids.

Science.gov (United States)

Apolinar-Valiente, Rafael; Gómez-Plaza, Encarna; Terrier, Nancy; Doco, Thierry; Ros-García, José María

2017-09-01

Monastrell is a red grape cultivar adapted to the dry environmental conditions of Murcia, SE Spain. Its berries seem to be characterized by a rigid cell wall structure, which could make difficult the winemaking process. Cabernet Sauvignon cultivar is used to complement Monastrell wines in this region owing to its high phenolic content with high extractability. This study explores the skin cell wall composition of grapes from plants resulting from intraspecific crosses of Vitis vinifera cultivars Monastrell × Cabernet Sauvignon. Moreover, the morphology of the cell wall material (CWM) from some representative samples was visualized by transmission optical microscopy. The total sugar content of CWM from nine out of ten genotypes of the progeny was lower than that from Monastrell. Seven out of ten genotypes showed lower phenolic content than Cabernet Sauvignon. The CWM from nine out of ten hybrids presented lower protein content than that from Monastrell. This study confirms that skin cell walls from Monastrell × Cabernet Sauvignon hybrid grapes presented major differences in composition compared with their parents. These data could help in the development of new cultivars adapted to the dry conditions of SE Spain and with a cell wall composition favouring extractability. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

Physical, Rheological, Functional, and Film Properties of a Novel Emulsifier: Frost Grape Polysaccharide from Vitis riparia Michx.

Science.gov (United States)

Hay, William T; Vaughn, Steven F; Byars, Jeffrey A; Selling, Gordon W; Holthaus, Derek M; Price, Neil P J

2017-10-04

A novel emulsifier, Frost grape polysaccharide (FGP), isolated from natural exudate of the species Vitis riparia Michx, was physically and rheologically characterized. The determination of the physical, structural, thermodynamic, emulsification, film, and rheological properties of FGP provide essential details for the commercial adoption of this novel plant polysaccharide. FGP is capable of producing exceptionally stable emulsions when compared with the industrially ubiquitous gum arabic (GA). The FGP isolate contained a negligible amount of nitrogen (0.03%), indicating that it does not contain an associated glycoprotein, unlike GA. Solutions of FGP have a high degree of thermostability, displaying no loss in viscosity with temperature cycling and no thermal degradation when held at 90 °C. FGP is an excellent film former, producing high tensile strength films which remain intact at temperatures up to 200 °C. This work identified a number of potential food and pharmaceutical applications where FGP is significantly superior to GA.

A Desigualdade Pode Afetar a Eficiência do Sistema Financeiro? Um Modelo de Equilíbrio em Dois Períodos com Fricções na Intermediação Financeira.

Directory of Open Access Journals (Sweden)

Wenersamy Ramos de Alcântara

2015-03-01

Full Text Available Este trabalho apresenta um modelo de equilíbrio que mostra um canal através do qual a desigualdade na distribuição de riqueza pode afetar o desenvolvimento do sistema financeiro. Na presença de fricções, nominalmente: um limite à proporção de dívida nos projetos financiados pelos bancos e um tamanho mínimo dos projetos disponíveis na economia, mostramos que a desigualdade pode afetar o volume intermediado pelo sistema financeiro e consequentemente, considerando ganhos de escala, sua eficiência. Simulações com diversas parametrizações revelam uma relação não linear e não monotônica entre desigualdade e eficiência do sistema financeiro, medida pelo spread entre captação e concessão de empréstimos.

Equilíbrio postural de atletas remadores Equilibrio postural de atletas remadores Postural balance in rowing athletes

Directory of Open Access Journals (Sweden)

Taian de Mello Martins Vieira

2006-06-01

Full Text Available A influência do condicionamento físico no equilíbrio postural por um período prolongado ainda não está esclarecida. O objetivo deste estudo foi comparar parâmetros estabilométricos em testes de longa duração entre atletas remadores e um grupo de indivíduos saudáveis, não-atletas, que permaneceram de pé sobre uma plataforma de força durante 31 minutos. A cada cinco minutos de teste era apresentada uma escala modificada de Borg para pontuar o nível de desconforto. Os parâmetros estudados foram: desvio-padrão, velocidade média e freqüência média dos deslocamentos lateral e ântero-posterior, e a área elíptica do deslocamento do centro de pressão no plano da plataforma. O grupo dos atletas não apresentou diferenças significativas nos parâmetros durante todo o teste. O grupo controle apresentou valores significativamente mais elevados na área elíptica e a velocidade média da metade do teste em diante. Os atletas apresentaram valores significativamente menores para escala de Borg, representando maior resistência ao desconforto gerado pela atividade. Com base nos resultados, sugere-se que as alterações estabilométricas apresentadas pelo grupo de não-atletas sejam decorrentes de processos fisiológicos periféricos e que o condicionamento físico parece ser um fator importante na manutenção do equilíbrio estático por período prolongado.La influencia del condicionamiento físico en el equilibrio postural por un periodo prolongado todavía no está aclarado. El objetivo de este estudio ha sido comparar parámetros estabilométricos en tests de larga duración entre atletas remadores y un grupo de individuos saludables, no atletas, que permanecieron de pie sobre una plataforma de fuerza durante 31 minutos. A cada cinco minutos de prueba era presentada una escala modificada de Borg para puntuar el nivel de incomodidad. Los parámetros estudiados fueron: desvío padrón, velocidad media y frecuencia media de los

Grapes ( Vitis vinifera) drying by semitransparent photovoltaic module (SPVM) integrated solar dryer: an experimental study

Science.gov (United States)

Tiwari, Sumit; Tiwari, G. N.

2018-06-01

In present research paper, semi-transparent photovoltaic module (SPVM) integrated greenhouse solar drying system has been used for grapes ( Vitis vinifera) drying. Based on hourly experimental information namely solar intensity, moisture evaporated, ambient air temperature, grape surface temperatures, relative humidity and greenhouse air temperature etc. heat and mass transfer coefficient for the SPVM drying system have been evaluated. It has been seen that the convective heat transfer coefficients for grapes found between 3.1-0.84 W/m2 K. Also, there is a fair agreement between theoretical and practical mass transfer (moisture evaporated) during drying of grapes with a correlation coefficient (r) and root mean square percentage deviation (e) of 0.88 and 11.56 respectively. Further, nonlinear regression procedure has been used to fit various drying models namely Henderson and Pabis model, Newton's model, and Page's model. From the analysis, it was found that Page's model is best fitted for grapes drying in SPV greenhouse as well as open sun drying. Further, net electrical energy, thermal energy and equivalent thermal energy were found to be 3.61, 17.66 and 27.15 kWh during six days of drying respectively.

The impact of high temperatures on Vitis vinifera cv. Semillon grapevine performance and berry ripening

Directory of Open Access Journals (Sweden)

Dennis H Greer

2013-12-01

Full Text Available The heat event that occurred in many parts of Australia in 2009 was the worst on record for the past decade, with air temperatures exceeding 40oC for 14 days. Our aim was to assess the impacts of this heat event on vine performance, including ripening, yield and gas exchange of Vitis vinifera cv. Semillon grown in a Riverina vineyard. To assess the affect of high temperatures on Semillon grapevines, the vines were covered with a protective layer to reduce radiant heating and were compared with vines exposed to ambient conditions. The heat event had major effects on ripening; reducing the rate by 50% and delaying harvest ripeness and causing a high incidence of berry shrivel and sunburn. Yield was not affected. Photosynthesis was reduced 35% by the heat event while transpiration increased nearly 3-fold and was accounted for by increased stomatal conductance. The conclusion of this study was that heat events delayed ripening in Semillon berries and caused a significant reduction in berry quality. Strategies to minimise the radiant load during heat events are required and this study has confirmed a protective layer can reduce canopy temperatures and enhance berry quality.

Grapes (Vitis vinifera) drying by semitransparent photovoltaic module (SPVM) integrated solar dryer: an experimental study

Science.gov (United States)

Tiwari, Sumit; Tiwari, G. N.

2017-12-01

In present research paper, semi-transparent photovoltaic module (SPVM) integrated greenhouse solar drying system has been used for grapes (Vitis vinifera) drying. Based on hourly experimental information namely solar intensity, moisture evaporated, ambient air temperature, grape surface temperatures, relative humidity and greenhouse air temperature etc. heat and mass transfer coefficient for the SPVM drying system have been evaluated. It has been seen that the convective heat transfer coefficients for grapes found between 3.1-0.84 W/m2 K. Also, there is a fair agreement between theoretical and practical mass transfer (moisture evaporated) during drying of grapes with a correlation coefficient (r) and root mean square percentage deviation (e) of 0.88 and 11.56 respectively. Further, nonlinear regression procedure has been used to fit various drying models namely Henderson and Pabis model, Newton's model, and Page's model. From the analysis, it was found that Page's model is best fitted for grapes drying in SPV greenhouse as well as open sun drying. Further, net electrical energy, thermal energy and equivalent thermal energy were found to be 3.61, 17.66 and 27.15 kWh during six days of drying respectively.

Herança e desequilíbrio de ligação em sete locos isoenzimáticos de Cecropia pachystachya. Inheritance and linkage disequilibrium in sevem isozymes loci of Cecropia pachystachya.

Directory of Open Access Journals (Sweden)

Luciano Arruda RIBAS

2004-12-01

Full Text Available Seis sistemas enzimáticos (ACP,G6PDH, IDH, PGI, PGM e SKDH, codificandosete locos polimórficos (Acp-3, G6pdh-1, Idh-1,Pgi-2, Pgm-1, Pgm-2 e Skdh-1, foram investigadospara a herança e desequilíbrio de ligação emCecropia pachystachya Trec. A herança mendelianafoi confirmada para todos os locos avaliados.Desvios significativos da razão de segregaçãoesperada 1:1 foram detectados apenas em umaprogênies de árvore heterozigótica. O desequilíbriode ligação foi examinado para 21 pares de locosisoenzimáticos, não sendo detectados desequilíbriosentre nenhum deles e, assim, estes podem serutilizados em subseqüentes estudos do sistemade reprodução, diversidade e estrutura genética deC. pachystachya.

Parâmetros bioquímicos para avaliação da função renal e do equilíbrio hidroeletrolítico em bezerras sadias, da raça Holandesa, no primeiro mês de vida

OpenAIRE

Fernando José Benesi; Clarisse Simões Coelho; Marta Lizandra do Rêgo Leal; Regina Mieko Sakata Mirandola; Júlio Augusto Naylor Lisbôa

2005-01-01

Para o estabelecimento dos valores de referência de variáveis bioquímicas utilizadas na avaliação da função renal e do equilíbrio hidroeletrolítico de bezerras sadias, da raça Holandesa, no primeiro mês de vida, utilizou-se amostras de soro sangüíneo de 300 animais, distribuídos por 15 grupos experimentais, de acordo com o tempo de vida pós-nascimento. Considerou-se na análise dos resultados a influência do fator etário. As concentrações de uréia sérica apresentaram oscilações, atingindo um v...

Resveratrols in grape berry skins and leaves in vitis germplasm.

Science.gov (United States)

Wang, Lijun; Xu, Man; Liu, Chunyan; Wang, Junfang; Xi, Huifen; Wu, Benhong; Loescher, Wayne; Duan, Wei; Fan, Peige; Li, Shaohua

2013-01-01

Resveratrol is an important stilbene that benefits human health. However, it is only distributed in a few species including grape and is very expensive. At present, grape has been an important source resveratrol. However, the details are scarce on resveratrol distribution in different Vitis species or cultivars. The composition and content of resveratrols were investigated by HPLC for assessing genotypic variation in berry skins and leaves of 75 grape cultivars, belonging to 3 species and 7 interspecific hybrids. Trans-resveratrol, cis-piceid and trans-piceid were detected in berry skins and leaves, but cis-resveratrol was not. Resveratrol content largely varied with genetic background as well as usage. In most cultivars, total resveratrol including the above three compounds was higher in berry skins than leaves. In berry skins of most cultivars and leaves of almost all cultivars, cis-piceid was the most abundant resveratrol; trans-resveratrol and trans-piceid were minor components. Some specific cultivars were found with extremely high levels of trans-resveratrol, cis- piceid, trans-piceid or total resveratrols in berry skins or leaves. In skins and leaves, rootstock cultivars had a higher content of total resveratrols, and the cultivated European type cultivars and their hybrids with V. labrusca had relatively low totals. There were no significant correlations of the amounts of total resveratrols or any individual resveratrol between berry skins and leaves. All 75 cultivars can be divided into four groups based on the composition of resveratrols and their concentration by principal component analysis. Resveratrol content of grape berries and leaves varied largely with their genetic background and usage. Rootstock cultivars had a higher content of total resveratrols than the other germplasm. Total resveratrols were lower in leaves than berry skins in most cultivars. Cis-piceid was the most abundant resveratrol in most cultivars, and trans-res and trans-pd were

Evolution and expression analysis of the grape (Vitis vinifera L.) WRKY gene family.

Science.gov (United States)

Guo, Chunlei; Guo, Rongrong; Xu, Xiaozhao; Gao, Min; Li, Xiaoqin; Song, Junyang; Zheng, Yi; Wang, Xiping

2014-04-01

WRKY proteins comprise a large family of transcription factors that play important roles in plant defence regulatory networks, including responses to various biotic and abiotic stresses. To date, no large-scale study of WRKY genes has been undertaken in grape (Vitis vinifera L.). In this study, a total of 59 putative grape WRKY genes (VvWRKY) were identified and renamed on the basis of their respective chromosome distribution. A multiple sequence alignment analysis using all predicted grape WRKY genes coding sequences, together with those from Arabidopsis thaliana and tomato (Solanum lycopersicum), indicated that the 59 VvWRKY genes can be classified into three main groups (I-III). An evaluation of the duplication events suggested that several WRKY genes arose before the divergence of the grape and Arabidopsis lineages. Moreover, expression profiles derived from semiquantitative PCR and real-time quantitative PCR analyses showed distinct expression patterns in various tissues and in response to different treatments. Four VvWRKY genes showed a significantly higher expression in roots or leaves, 55 responded to varying degrees to at least one abiotic stress treatment, and the expression of 38 were altered following powdery mildew (Erysiphe necator) infection. Most VvWRKY genes were downregulated in response to abscisic acid or salicylic acid treatments, while the expression of a subset was upregulated by methyl jasmonate or ethylene treatments.

Stable MSAP markers for the distinction of Vitis vinifera cv Pinot noir clones.

Science.gov (United States)

Ocaña, Juan; Walter, Bernard; Schellenbaum, Paul

2013-11-01

Grapevine is one of the most economically important fruit crops. Molecular markers have been used to study grapevine diversity. For instance, simple sequence repeats are a powerful tool for identification of grapevine cultivars, while amplified fragment length polymorphisms have shown their usefulness in intra-varietal diversity studies. Other techniques such as sequence-specific amplified polymorphism are based on the presence of mobile elements in the genome, but their detection lies upon their activity. Relevant attention has been drawn toward epigenetic sources of variation. In this study, a set of Vitis vinifera cv Pinot noir clones were analyzed using the methylation-sensitive amplified polymorphism technique with isoschizomers MspI and HpaII. Nine out of fourteen selective primer combinations were informative and generated two types of polymorphic fragments which were categorized as "stable" and "unstable." In total, 23 stable fragments were detected and they discriminated 92.5 % of the studied clones. Detected stable polymorphisms were either common to several clones, restricted to a few clones or unique to a single clone. The identification of these stable epigenetic markers will be useful in clonal diversity studies. We highlight the relevance of stable epigenetic variation in V. vinifera clones and analyze at which level these markers could be applicable for the development of forthright techniques for clonal distinction.

Molecular Cloning and Functional Characterization of a Dihydroflavonol 4-Reductase from Vitis bellula.

Science.gov (United States)

Zhu, Yue; Peng, Qingzhong; Li, Kegang; Xie, De-Yu

2018-04-10

Vitis bellula is a new grape crop in southern China. Berries of this species are rich in antioxidative anthocyanins and proanthocyanidins. This study reports cloning and functional characterization of a cDNA encoding a V. bellula dihydroflavonol reductase (VbDFR) involved in the biosynthesis of anthocyanins and proanthocyanidins. A cDNA including 1014 bp was cloned from young leaves and its open reading frame (ORF) was deduced encoding 337 amino acids, highly similar to V. vinifera DFR (VvDFR). Green florescence protein fusion and confocal microscopy analysis determined the cytosolic localization of VbDFR in plant cells. A soluble recombinant VbDFR was induced and purified from E. coli for enzyme assay. In the presence of NADPH, the recombinant enzyme catalyzed dihydrokaempferol (DHK) and dihydroquercetin (DHQ) to their corresponding leucoanthocyanidins. The VbDFR cDNA was introduced into tobacco plants via Agrobacterium -mediated transformation. The overexpression of VbDFR increased anthocyanin production in flowers. Anthocyanin hydrolysis and chromatographic analysis revealed that transgenic flowers produced pelargonidin and delphinidin, which were not detected in control flowers. These data demonstrated that the overexpression of VbDFR produced new tobacco anthocyanidins. In summary, all data demonstrate that VbDFR is a useful gene to provide three types of substrates for metabolic engineering of anthocyanins and proanthocyanidins in grape crops and other crops.

CLAVATA3-like genes are differentially expressed in grape vine (Vitis vinifera) tissues.

Science.gov (United States)

Tominaga-Wada, Rumi; Nukumizu, Yuka; Wada, Takuji; Sawa, Shinichiro; Tetsumura, Takuya

2013-10-15

The CLAVATA3 (CLV3)/endosperm surrounding region [(ESR) CLE] peptides function as intercellular signaling molecules that regulate various physiological and developmental processes in diverse plant species. We identified five CLV3-like genes from grape vine (Vitis vinifera var. Pinot Noir): VvCLE 6, VvCLE 25-1, VvCLE 25-2, VvCLE 43 and VvCLE TDIF. These CLV3-like genes encode short proteins containing 43-128 amino acids. Except VvCLE TDIF, grape vine CLV3-like proteins possess a consensus amino acid sequence known as the CLE domain. Phylogenic analysis suggests that the VvCLE 6, VvCLE25-1, VvCLE25-2 and VvCLE43 genes have evolved from a single common ancestor to the Arabidopsis CLV3 gene. Expression analyses showed that the five grape CLV3-like genes are expressed in leaves, stems, roots and axillary buds with significant differences in their levels of expression. For example, while all of them were strongly expressed in axillary buds, VvCLE6 and VvCLE43 expression prevailed in roots, and VvCLE25-1, VvCLE25-2 and VvCLE TDIF expression in stems. The differential expression of the five grape CLV3-like peptides suggests that they play different roles in different organs and developmental stages. Copyright © 2013 Elsevier GmbH. All rights reserved.

Molecular Cloning and Functional Characterization of a Dihydroflavonol 4-Reductase from Vitis bellula

Directory of Open Access Journals (Sweden)

Yue Zhu

2018-04-01

Full Text Available Vitis bellula is a new grape crop in southern China. Berries of this species are rich in antioxidative anthocyanins and proanthocyanidins. This study reports cloning and functional characterization of a cDNA encoding a V. bellula dihydroflavonol reductase (VbDFR involved in the biosynthesis of anthocyanins and proanthocyanidins. A cDNA including 1014 bp was cloned from young leaves and its open reading frame (ORF was deduced encoding 337 amino acids, highly similar to V. vinifera DFR (VvDFR. Green florescence protein fusion and confocal microscopy analysis determined the cytosolic localization of VbDFR in plant cells. A soluble recombinant VbDFR was induced and purified from E. coli for enzyme assay. In the presence of NADPH, the recombinant enzyme catalyzed dihydrokaempferol (DHK and dihydroquercetin (DHQ to their corresponding leucoanthocyanidins. The VbDFR cDNA was introduced into tobacco plants via Agrobacterium-mediated transformation. The overexpression of VbDFR increased anthocyanin production in flowers. Anthocyanin hydrolysis and chromatographic analysis revealed that transgenic flowers produced pelargonidin and delphinidin, which were not detected in control flowers. These data demonstrated that the overexpression of VbDFR produced new tobacco anthocyanidins. In summary, all data demonstrate that VbDFR is a useful gene to provide three types of substrates for metabolic engineering of anthocyanins and proanthocyanidins in grape crops and other crops.

Pink berry grape (Vitis vinifera L.) characterization: Reflectance spectroscopy, HPLC and molecular markers.

Science.gov (United States)

Rustioni, Laura; De Lorenzis, Gabriella; Hârţa, Monica; Failla, Osvaldo

2016-01-01

Color has a fundamental role for the qualitative evaluation and cultivar characterization of fruits. In grape, a normally functional pigment biosynthesis leads to the accumulation of a high quantity of anthocyanins. In this work, 28 Vitis vinifera L. cultivars accumulating low anthocyanins in berries were studied to characterize the biosynthetic dysfunctions in both a phenotypic and genotypic point of view. Reflectance spectroscopy, HPLC profiles and molecular markers related to VvMybA1 and VvMybA2 genes allowed a detailed description of the pigment-related characteristics of these cultivars. Data were consistent concerning the heterozygosity of the non-functional allele in both investigated genes, resulting in a low colored phenotype as described by reflectance. However, the variability in berry colour among our samples was not fully explained by MybA locus, probably due to specific interferences among the biosynthetic pathways, as suggested by the anthocyanin profile variations detected among our samples. The results presented in this work confirmed the importance of the genetic background: grapes accumulating high levels of cyanidin-3-O-glucosides (di-substituted anthocyanin) are generally originated by white cultivar retro-mutations and they seem to preserve the anomalies in the flavonoid hydroxylases enzymes which negatively affect the synthesis of tri-substituted anthocyanins. Copyright © 2015 Elsevier Masson SAS. All rights reserved.

Grapes (Vitis vinifera) as a Potential Candidate for the Therapy of the Metabolic Syndrome.

Science.gov (United States)

Akaberi, Maryam; Hosseinzadeh, Hosein

2016-04-01

Metabolic syndrome is associated with several disorders, including hypertension, diabetes, hyperlipidemia as well as cardiovascular diseases and stroke. Plant-derived polyphenols, compounds found in numerous plant species, play an important role as potential treatments for components of metabolic syndrome. Studies have provided evidence for protective effects of various polyphenol-rich foods against metabolic syndrome. Fruits, vegetables, cereals, nuts, and berries are rich in polyphenolic compounds. Grapes (Vitis vinifera), especially grape seeds, stand out as rich sources of polyphenol potent antioxidants and have been reported helpful for inhibiting the risk factors involved in the metabolic syndrome such as hyperlipidemia, hyperglycemia, and hypertension. There are also many studies about gastroprotective, hepatoprotective, and anti-obesity effects of grape polyphenolic compounds especially proanthocyanidins in the literature. The present study investigates the protective effects of grape seeds in metabolic syndrome. The results of this study show that grape polyphenols have significant effects on the level of blood glucose, lipid profile, blood pressure, as well as beneficial activities in liver and heart with various mechanisms. In addition, the pharmacokinetics of grape polyphenols is discussed. More detailed mechanistic investigations and phytochemical studies for finding the exact bioactive component(s) and molecular signaling pathways are suggested. Copyright © 2016 John Wiley & Sons, Ltd.

Phenolic composition and antioxidant capacity of pomaces from four grape varieties (Vitis vinifera L.).

Science.gov (United States)

de la Cerda-Carrasco, Aarón; López-Solís, Remigio; Nuñez-Kalasic, Hugo; Peña-Neira, Álvaro; Obreque-Slier, Elías

2015-05-01

Phenolic compounds are widely distributed secondary metabolites in plants usually conferring them with unique taste, flavour and health-promoting properties. In fruits of Vitis vinifera L., phenolic composition is highly dependent on grape variety. Differential extraction of these compounds from grapes during winemaking is critically associated with wine quality. By-products of winemaking, such as grape pomace, can contain significant amounts of polyphenols. However, information concerning the varietal effect on wine grape pomace is scarce. In this study, pomaces from Sauvignon Blanc (SB), Chardonnay (CH), Cabernet Sauvignon (CS) and Carménère (CA) grape varieties were characterized spectroscopically and by HPLC-DAD analysis. White grape pomaces (SB and CH) presented higher antioxidant capacities and higher contents of total phenols and total proanthocyanidins compared with red grape pomaces (CS and CA), whereas the latter showed much higher anthocyanin levels and colour intensities. Concentrations of monomeric proanthocyanidins and low-molecular-weight phenols in the four grape pomace varieties were significantly different. Grape pomaces from four varieties showed high but diverse contents of polyphenols and antioxidant capacities. Thus grape pomaces represent an important potential source of polyphenols, which could be useful for nutritional and/or pharmacological purposes. © 2014 Society of Chemical Industry.

Supercritical fluid extraction of phenolic compounds and antioxidants from grape (Vitis labrusca B.) seeds.

Science.gov (United States)

Ghafoor, Kashif; Al-Juhaimi, Fahad Y; Choi, Yong Hee

2012-12-01

Supercritical fluid extraction (SFE) technique was applied and optimized for temperature, CO₂ pressure and ethanol (modifier) concentration using orthogonal array design and response surface methodology for the extract yield, total phenols and antioxidants from grape (Vitis labrusca B.) seeds. Effects of extraction temperature and pressure were found to be significant for all these response variables in SFE process. Optimum SFE conditions (44 ~ 46 °C temperature and 153 ~ 161 bar CO₂ pressure) along with ethanol (extract yield (12.09 %), total phenols (2.41 mg GAE/ml) and antioxidants (7.08 mg AAE/ml), were used to obtain extracts from grape seeds. The predicted values matched well with the experimental values (12.32 % extract yield, 2.45 mg GAE/ml total phenols and 7.08 mg AAE/ml antioxidants) obtained at optimum SFE conditions. The antiradical assay showed that SFE extracts of grape seeds can scavenge more than 85 % of 1, 1-diphenyl-2-picrylhydrazyl (DPPH) radicals. The grape seeds extracts were also analyzed for hydroxybenzoic acids which included gallic acid (1.21 ~ 3.84 μg/ml), protocatechuic acid (3.57 ~ 11.78 μg/ml) and p-hydroxybenzoic acid (206.72 ~ 688.18 μg/ml).

Relação entre cognição (função executiva e percepção espacial e equilíbrio de idosos de baixa escolaridade Relationship between cognition (executive function and spatial perception and balance in low educational status elderly

Directory of Open Access Journals (Sweden)

Elaine Bazilio Custódio

2010-03-01

Full Text Available O objetivo deste estudo foi investigar se défices na percepção visuoespacial e nas funções executivas apresentariam relação com o equilíbrio em idosos de baixa escolaridade. Participaram deste estudo 38 idosos (com média de idade 69,1±6,8 anos, com um a seis anos de escolaridade formal. Os testes aplicados foram: o teste de seqüência alfa-numérica - partes A, que avalia escaneamento visual e seqüenciamento (TSA-A, B, que avalia flexibilidade mental e memória operacional (TSA-B, considerando-se ainda o delta, que avalia função executiva (TSA-D; teste de cancelamento de estrelas (TCE, que avalia percepção espacial; a escala de equilíbrio de Berg (EEB e a escala de eficácia de quedas (falls efficacy scale - international, FES-I, que avaliam equilíbrio e risco de quedas. As correlações foram verificadas pelo teste de Spearman, com pThe aim of this study was to investigate whether spatial perception and executive function deficits might have a relationship with functional balance in low-educational status elderly. Thirty-eight volunteers (mean aged 69.1±6.8 years, having one to six years of formal education, were assessed by the following tests: part A of the trail making test (TMT-A, for visual scanning ability, and cognitive processing sequencing and speed; part B of the TMT (TMT-B, that assesses mental flexibility and working memory; delta TMT (TMT-D, that assesses executive function; the star cancellation test (SCT, that evaluates spatial perception; Berg balance scale (BBS and the Falls Efficacy Scale - International (FES-I, both used in the assessment of balance and falls. Correlations were sought for by means of the Spearman test and the significance level was set at 0.05. Significant, strong correlations were found between the balance scales (BBS and FES-I and TMT-B (r=-0.61 and r=0.65, respectively; and moderate correlations between BBS and TMT-A (r=-0.51, and between FES-I and TMT-D (r=0.55. Significant correlations

Antioxidant activity of selected stilbenoids and their bioproduction in hairy root cultures of muscadine grape (Vitis rotundifolia Michx.).

Science.gov (United States)

Nopo-Olazabal, Cesar; Hubstenberger, John; Nopo-Olazabal, Luis; Medina-Bolivar, Fabricio

2013-12-04

Stilbenoids are polyphenolic phytoalexins with health-related properties in humans. Muscadine grape ( Vitis rotundifolia ) hairy root cultures were established via Agrobacterium rhizogenes -mediated transformation, and the effects of growth regulators (3-indolebutyric acid and 6-benzylaminopurine) and methyl jasmonate (MeJA) on stilbenoid production were studied. Twenty-one-day-old hairy root cultures were treated with 100 μM MeJA for 24 h, and then the stilbenoids were extracted from the medium and tissue with ethyl acetate and analyzed by HPLC. Resveratrol, piceid, and ε-viniferin were observed preferentially in tissue, whereas piceatannol was observed only in medium. Growth regulators did not affect the yield of stilbenoids, whereas higher levels were found upon treatment with MeJA. Stilbenoids identified in the hairy root cultures were analyzed for their radical scavenging capacity showing piceatannol and ε-viniferin as the strongest antioxidants. Muscadine grape hairy root cultures were demonstrated to be amenable systems to study stilbenoid biosynthesis and a sustainable source of these bioactive compounds.

Lapita on an island in the Mangroves? : the earliest human occupation at Qoqo Island, southwest Viti Levu, Fiji

International Nuclear Information System (INIS)

Nunn, P.D.; Matararaba, S.; Kumar, R.; Pene, C.; Yuen, L.; Pastorizo, M.R.

2006-01-01

In November-December 2004 a research team from theUniversity of the South Pacific and the Fiji Museum undertook geoarchaeological investigations along the coast of the Rove Peninsula, part of southwest Viti Levu Island, where evidence for Lapita-era occupation had been found on previous occasions. We were also shown a collection of pottery from nearby Qoqo Island. Surface collection of pottery from the Qoqo coastal flat yielded four dentate-stamped sherds and two notched rims (immediately post-dentate). We suggested that they had probably reached the surface through excavation by the numerous burrowing land crabs (Cardisona carnifex) living there. Five test pits were dug on the Qoqo coastal flat. Radiocarbon determinations on both marine shell and charcoal from pits F1 and R2 are considered to represent the time of earliest discernible human occupation of Qoqo Island, probably within the range cal 2850-2650 BP (900-700 BC) but perhaps cal 2950-2760 BP (1000-810 BC). 11 refs., 3 figs., 3 tabs

2392-IJBCS-Article-Marius Lebri

African Journals Online (AJOL)

hp

fièvre, les troubles d'estomac, l'asthme et la bronchite (Kirtikar et Basu, 1987; Suralkar et. Kasture, 2013). Les feuilles à goût sucré sont très prisées en Madagascar et au Sénégal dans le traitement de la toux, surtout la toux infantile. Ainsi, Abrus precatorius est classée parmi les plantes antitussives (Gairola et al.,. 2010).

1739-IJBCS-Article-Tanoh marius

African Journals Online (AJOL)

hp

d'équitabilité (E) réalisés selon le programme. GWBasic. L'analyse. Canonique de. Correspondance (ACC) a été réalisée à l'aide du programme Canoco 4.5. Cette analyse a permis de mettre en correspondance les données biotiques (36 espèces de poissons) et des données abiotiques (21 variables environnementales).

ASPECTOS ANATÔMICOS DO ENRAIZAMENTO DA VIDEIRA MUSCADÍNIA (Vitis rotundifolia Michx. ATRAVÉS DE ALPORQUIA

Directory of Open Access Journals (Sweden)

A.C. PACHECO

1998-05-01

Full Text Available A multiplicação das videiras é comumente realizada através de processos vegetativos como a estaquia e a enxertia, os quais nem sempre apresentam resultados satisfatórios, especialmente para as espécies de difícil enraizamento, comprometendo a produção comercial. A uva muscadínia (Vitis rotundifolia Michx. é considerada uma planta difícil de enraizar. Sua propagação através da estaquia mostra que o emprego de reguladores vegetais proporciona pouco ou nenhum benefício ao enraizamento das estacas. Atualmente, a alporquia em frutíferas vem se apresentando como um método de propagação que proporciona um bom enraizamento, aliado à aplicação de reguladores vegetais. Este trabalho procurou avaliar a eficiência do processo de alporquia com relação ao enraizamento da uva muscadínia bem como estudar a anatomia dos calos e das raízes adventícias. Pode-se concluir que a prática do anelamento mostra-se mais efetiva em proporcionar o enraizamento do que a retirada de lascas. A adição de ácido naftalenacético não afetou significativamente o enraizamento. As raízes adventícias apareceram nas proximidades da região cambial, nas regiões nodais e internodais dos ramos. Não ocorreu a formação de raízes diretamente do calo. O tecido do calo caracterizou-se por ser meristematicamente ativo e não apresentar amido.The propagation of grapes is ordinarily carried out by vegetative methods like cuttings and graftings, which not always present satisfactory results, especially for those species with low rooting ability, endangering the commercial production. The muscadine grape (Vitis rotundifolia Michx. is considered recalcitrant for rooting. Its propagation by cuttings shows that growth regulators have few or no benefits on rooting. Nowadays, air-layering is reported as a propagation method that promotes good rooting when combined with the application of growth regulators. This work aimed to evaluate the efficiency of air

Bem-estar social, mercado de trabalho e o desequilíbrio regional brasileiro

Directory of Open Access Journals (Sweden)

Carlos Alberto Manso

2010-06-01

Full Text Available Este trabalho contribui para a literatura empírica sobre o desequilíbrio regional brasileiro, ao analisar, no período pós-Plano Real, o desempenho econômico de cada região do País em termos do crescimento pró-pobre - crescimento econômico acompanhado de redução na desigualdade - e do bem-estar social. Para tanto, utiliza-se metodologia presente em Kakwani, Neri e Son (2006 para avaliar o comportamento do bem-estar social a partir das distribuições da renda familiar e da renda salarial em cada região do País. Investiga-se também a contribuição de indicadores do mercado de trabalho nas performances das regiões. De uma forma geral, os resultados apontam que os maiores impactos na renda dos trabalhos e no bem-estar social deveram-se à taxa de participação de trabalhadores por família e, principalmente, aos ganhos de produtividade dos trabalhadores a partir de 2003, que, por sua vez, foram motivados principalmente pelos acréscimos nos retornos médios provenientes da educação das pessoas ocupadas. Porém, esses ganhos não foram suficientes para o estabelecimento de um padrão de crescimento mais intensamente pró-pobre no Norte e no Nordeste, o que poderia ter contribuído para uma maior aproximação em termos de renda e bem-estar social destas regiões em relação às outras do País.This paper contributes to the empirical literature about the Brazilian regional disequilibrium, once it examines, in the post-Real Plan period, the economic performance of each region of the country in terms of pro-poor growth - growth with reduced inequality - and of the social welfare. To this, it is used the methodology present in Kakwani, Neri and Son (2006 to evaluate the behavior of social welfare from the distributions of familiar income and wage income in each region. Furthermore, it is investigated the contribution of labor market indicators in the performance of regions. In general, the results indicate that the greatest impacts on

Retornos da educação e o desequilíbrio regional no Brasil

Directory of Open Access Journals (Sweden)

Carlos Alberto Manso

2010-06-01

Full Text Available O problema do desequilíbrio regional brasileiro normalmente tem sido tratado na literatura nacional a partir de investigações que utilizam a renda e/ou PIB per capita como variáveis de análise. Para sociedades com baixos níveis de desigualdade, esse procedimento é uma boa representação do bem-estar social. Entretanto, para economias com elevados níveis de pobreza e desigualdade, a utilização da renda ou PIB pode não ser apropriada. Nesse sentido, esse artigo discute se a aproximação da renda per capita existente entre o Nordeste e o Sudeste brasileiro também vem ocorrendo em termos de bem-estar social. Para esse objetivo, duas medidas de bem-estar social são utilizadas: Sen (1977 e Kakwani e Son (2008. Os resultados apontam que, assim como ocorre com a renda per capita, também está havendo aproximação de bemestar considerando a medida de Sen. Entretanto, quando se leva em conta o movimento da renda dos mais pobres, presente no segundo índice, constata-se um afastamento entre as duas regiões. As análises são feitas para o período de 1995 a 2007. Por fim, identificou-se que foram os ganhos de produtividade dos trabalhadores pertencentes a famílias pobres no Sudeste os principais responsáveis por esse distanciamento.The problem of Brazilian regional disequilibrium has usually been treated in the national literature from investigations using income and/or GDP percapita as a variable of analysis. For communities with low levels of inequality, this procedure is a good representation of the social welfare. However, for economies with high levels of poverty and inequality, the use of income or GDP cannot be appropriate. Accordingly, this article discusses if the approximation of per capita income between the Northeast and Southeast Brazil has also occurred in terms of social welfare. To this, two measures of social welfare are used: Sen (1977 and Kakwani e Son (2008. The results suggest as occurs with per capita income, there

Phenolics composition and antioxidant activity of wine produced from spine grape (Vitis davidii Foex) and Cherokee rose (Rosa laevigata Michx.) fruits from South China.

Science.gov (United States)

Meng, Jiangfei; Fang, Yulin; Gao, Jinshan; Qiao, Lingling; Zhang, Ang; Guo, Zhijun; Qin, Minyang; Huang, Jizhuang; Hu, Ying; Zhuang, Xifu

2012-01-01

Wines made from 3 spine grape (Vitis davidii Foex) genotypes-Junzi 1# (JZ 1#), Junzi 2# (JZ 2#), and Liantang (LT)-and Cherokee rose (Rosa laevigata Michx., CR) were evaluated for their phenolics composition and antioxidant activities by several assays, including 2,2'-azino-bis-(3-ethylbenzothiazoline-6-sulfonic acid) diammonium salt (ABTS scavenging capacity, cupric ion reducing antioxidant capacity, and metal-chelating capacity). The results showed that CR wine had higher contents of total phenolics, total flavonoids, and oligomeric proanthocyanidins than the 3 spine grape genotype wines and Cabernet Sauvignon (CS) wine. Among the 3 varieties of spine grape wines, JZ 1# had higher contents than the 2 other genotypes. Moreover, the total monomeric anthocyanins in JZ 1# was about 4.5-fold higher than those in CS wine and CR wine. A significance analysis demonstrated that the antioxidant capacity (as measured by the ABTS scavenging capacity and cupric ion reducing antioxidant capacity) of CR wine was significantly higher than that of the control and spine grape wines. With respect to metal-chelating capacity, the CR wine was the strongest amongst all the wine samples tested, followed by JZ 1#. This indicates that CR and JZ 1# wines can potentially be considered as wild fruit wines with abundant phenolic compounds and antioxidant activities. Spine grape (Vitis davidii Foex) and Cherokee rose (Rosa laevigata Michx.) are 2 species of important wild plants in South China. However, they have not yet been effectively developed and utilized. Recently, some researchers attempted to convert their juice to wine. We anticipate that this research will provide sufficient experimental evidence for their good antioxidant activity and potential for further development and utilization. © 2011 Institute of Food Technologists®

Evaluation of Anti-Candida Activity of Vitis vinifera L. Seed Extracts Obtained from Wine and Table Cultivars

Directory of Open Access Journals (Sweden)

Giovanna Simonetti

2014-01-01

Full Text Available For the first time, grape seed extracts (GSEs, obtained from wine and table cultivars of Vitis vinifera L., cultured in experimental fields of Lazio and Puglia regions of Italy and grown in different agronomic conditions, have been tested on 43 Candida species strains. We demonstrated a significant correlation between the content of the flavan-3-ols in GSEs extracts, with a polymerization degree ≥4, and anti-Candida activity. Moreover, we demonstrated that GSEs, obtained from plants cultured with reduced irrigation, showed a content of polymeric flavan-3-ols >250 mg/g with geometric mean MIC values between 5.7 and 20.2 mg/L against Candida albicans reference strains. GSE, showing 573 mg/g of polymeric flavan-3-ols, has been tested in an experimental murine model of vaginal candidiasis by using noninvasive in vivo imaging technique. The results pointed out a significant inhibition of Candida albicans load 5 days after challenge. These findings indicate that GSEs with high content of polymeric flavan-3-ols can be used in mucosal infection as vaginal candidiasis.

Effect of equine-assisted therapy on the postural balance of the elderly Efeito da equoterapia no equilíbrio postural de idosos

Directory of Open Access Journals (Sweden)

Thais B. Araujo

2011-10-01

Full Text Available OBJECTIVE: To determine whether equine-assisted therapy (hippotherapy produces alterations in the balance of the elderly. METHODS: The sample included 17 older adults who were divided into experimental (7 subjects and control (10 subjects groups. Stabilometry data were acquired with a force platform. The Timed Up and Go test (TUG was used for clinical analysis of seated balance, transfer from a seated to a standing position, walking stability and changes in gait. Sixteen equine-assisted therapy sessions were carried out. RESULTS: Mann-Witney was used to compare the means between groups and no significant differences were found in the analyzed stabilometric parameters. In intragroup comparison with the Wilcoxon test, a significant increase in the variables COPy and Area (p=0.02 was observed. Equine-assisted therapy significantly affected (p=0.04 TUG test means between the experimental and control groups (Mann-Witney. Intragroup TUG test means were also significantly affected (p=0.04 according to the Wilcoxon test. CONCLUSIONS: Because senescence tends to normalize stabilometric measures, the number of equine-assisted therapy sessions was insufficient to determine any differences. Nevertheless, the significant improvement in TUG test scores demonstrates that this treatment frequency was a predictor of reduced fall risk in the elderly. Article registered in the Australian New Zealand Clinical Trials Registry (ANZCTR under number ACTRN12610000534088.OBJETIVO: Verificar se a equoterapia é capaz de produzir alterações no equilíbrio de idosos. MÉTODOS: Desenvolveu-se um estudo experimental controlado. A amostra foi composta de 17 idosos, divididos em grupo experimental (GE, sete sujeitos e grupo controle (GC, dez sujeitos. A aquisição dos dados da estabilometria foi realizada por meio da plataforma de força da marca AMTI (Force Measurement Systems. Para análise clínica do equilíbrio sentado, transferências de sentado para a posição em p

Efetividade do treinamento de resistência à fadiga dos músculos dos membros inferiores dentro e fora d'água no equilíbrio estático e dinâmico de idosos Effectiveness of aquatic and non-aquatic lower limb muscle endurance training in the static and dynamic balance of elderly people

Directory of Open Access Journals (Sweden)

Núbia C. P. Avelar

2010-06-01

Full Text Available CONTEXTUALIZAÇÃO: O envelhecimento compromete a habilidade do sistema nervoso central (SNC de realizar a manutenção do equilíbrio corporal bem como diminui a capacidade das reações adaptativas. Para prevenir as quedas, é necessário aprimorar as condições de recepção de informações sensoriais. OBJETIVOS: Comparar o impacto de um programa estruturado de exercícios de resistência muscular dos membros inferiores dentro e fora d'água no equilíbrio estático e dinâmico em idosos. MÉTODOS: Trata-se de um estudo clínico, prospectivo, aleatório, em que as variáveis utilizadas foram avaliadas antes e após o programa de treinamento. Foram avaliados 36 idosos por meio de quatro testes: Escala de Equilíbrio de Berg, Dynamic Gait Index, velocidade da marcha, Marcha Tandem. Posteriormente, houve a alocação dos voluntários em três grupos: grupo de exercício na piscina terapêutica, grupo de exercício no solo e grupo controle. Os grupos de exercícios foram submetidos a um programa de resistência muscular dos membros inferiores aplicado durante seis semanas, duas sessões semanais com 40 minutos de duração. Os voluntários foram reavaliados após seis semanas. Os dados foram analisados estatisticamente pelo teste ANOVA univariada para comparação entre os três grupos antes e após a intervenção. RESULTADOS: O programa de resistência muscular dos membros inferiores promoveu aumento significativo do equilíbrio dos idosos (pBACKGROUND: Aging compromises the ability of the central nervous system to maintain body balance and reduces the capacity for adaptive reactions. To prevent falls, the reception conditions for sensory information need to be improved. OBJECTIVES: To evaluate the impact of a structured aquatic and a non-aquatic exercise program for lower-limb muscle endurance on the static and dynamic balance of elderly people. METHODS: This was a prospective randomized clinical study in which the variables were assessed

Avaliação do equilíbrio entre oxidantes e antioxidantes na patogénese da doença pulmonar obstrutiva crónica

Directory of Open Access Journals (Sweden)

C. Cristóvão

2013-03-01

Full Text Available Resumo: A doença pulmonar obstrutiva crónica (DPOC é uma das doenças crónicas mais comuns e representa uma importante causa de morbilidade e mortalidade. Um desequilíbrio entre oxidantes e antioxidantes (stress oxidativo tem sido proposto como um acontecimento importante na patogénese da DPOC. O aumento do stress oxidativo em doentes com DPOC é o resultado da presença de oxidantes exógenos, nomeadamente, poluentes e fumo do tabaco, assim como oxidantes endógenos produzidos durante a inflamação. O objetivo do presente estudo consistiu em clarificar a hipótese sobre a existência de um desequilíbrio entre oxidantes e as defesas antioxidantes associado à DPOC. Neste estudo, avaliou-se um biomarcador do stress oxidativo (malonildialdeído, um produto resultante da peroxidação lipídica e antioxidantes não-enzimáticos (vitamina C e grupos sulfidrilo, em doentes com DPOC e em controlos saudáveis. Observou-se um aumento significativo (p < 0,001 do marcador do stress oxidativo nos doentes com DPOC comparativamente ao grupo controlo. Não foram encontradas alterações dependentes da idade nos níveis dos produtos da peroxidação lipídica. Os doentes DPOC apresentaram uma diminuição significativa (p < 0,001 do status antioxidante, comparativamente ao grupo controlo. Os nossos resultados evidenciam que o stress oxidativo representa uma importante alteração fisiopatológica na DPOC. Abstract: Chronic Obstructive Pulmonary Disease (COPD is one of the most common chronic diseases and a major cause of morbility and mortality. An imbalance between oxidants and antioxidants (oxidative stress has been proposed as a critical event in the pathogenesis of COPD. The increased oxidative stress in patients with COPD is the result of exogenous oxidants namely pollutants and cigarette smoke as well as endogenous oxidant production during inflammation. The aim of the present study was to clarify the hypothesis about the presence of an

Analysis of the grape MYB R2R3 subfamily reveals expanded wine quality-related clades and conserved gene structure organization across Vitis and Arabidopsis genomes

Science.gov (United States)

Matus, José Tomás; Aquea, Felipe; Arce-Johnson, Patricio

2008-01-01

Background The MYB superfamily constitutes the most abundant group of transcription factors described in plants. Members control processes such as epidermal cell differentiation, stomatal aperture, flavonoid synthesis, cold and drought tolerance and pathogen resistance. No genome-wide characterization of this family has been conducted in a woody species such as grapevine. In addition, previous analysis of the recently released grape genome sequence suggested expansion events of several gene families involved in wine quality. Results We describe and classify 108 members of the grape R2R3 MYB gene subfamily in terms of their genomic gene structures and similarity to their putative Arabidopsis thaliana orthologues. Seven gene models were derived and analyzed in terms of gene expression and their DNA binding domain structures. Despite low overall sequence homology in the C-terminus of all proteins, even in those with similar functions across Arabidopsis and Vitis, highly conserved motif sequences and exon lengths were found. The grape epidermal cell fate clade is expanded when compared with the Arabidopsis and rice MYB subfamilies. Two anthocyanin MYBA related clusters were identified in chromosomes 2 and 14, one of which includes the previously described grape colour locus. Tannin related loci were also detected with eight candidate homologues in chromosomes 4, 9 and 11. Conclusion This genome wide transcription factor analysis in Vitis suggests that clade-specific grape R2R3 MYB genes are expanded while other MYB genes could be well conserved compared to Arabidopsis. MYB gene abundance, homology and orientation within particular loci also suggests that expanded MYB clades conferring quality attributes of grapes and wines, such as colour and astringency, could possess redundant, overlapping and cooperative functions. PMID:18647406

Biosynthesis of phenolic compounds inVitis vinifera cell suspension cultures: Study on hydroxycinnamoyl CoA:ligase.

Science.gov (United States)

Lotfy, S; Lofty, S; Fleuriet, A; Ramos, T; Macheix, J J

1989-02-01

In cell suspensions cultures from grape berry pulp (Vitis vinifera cv. Gamay fréaux)hydroxycinnamoyl CoA ligase (CoAL) displayed maximum activity (100 %) forp-coumaric acid and then, in decreasing order, for ferulic acid (81.3 %) and caffeic acid (60.4 %). No activity was detected with sinapic and cinnamic acids. The changes in CoAL activity during the growth cycle of the culture displayed two peaks : the highest (6 h after subculturing) was linked with a strong increase in protein caused by dilution ; the second was weaker and occurred on the 7th day of culture.Grape cell suspension accumulated mainly peonidin (Pn) and cyanidin (Cy) glucosides (Pn 3-glucoside, Cy 3-glucoside, Pn 3-acetylglucoside, Pn 3-caffeylglucoside, Pn 3-p-coumarylglucoside, and Cy 3-p-coumarylglucoside). Maximum accumulation of anthocyanins was associated with the exponential growth phase of the culture and might be the result of the substantial increase in CoAL activity resulting from the effect of dilution. The second enzyme activity peak was probably oriented towards the acylation of anthocyanins since the percentage of acylated forms increased with time after subculturing.

The Rhizosphere Bacterial Microbiota of Vitis vinifera cv. Pinot Noir in an Integrated Pest Management Vineyard.

Science.gov (United States)

Novello, Giorgia; Gamalero, Elisa; Bona, Elisa; Boatti, Lara; Mignone, Flavio; Massa, Nadia; Cesaro, Patrizia; Lingua, Guido; Berta, Graziella

2017-01-01

Microorganisms associated with Vitis vinifera (grapevine) can affect its growth, health and grape quality. The aim of this study was to unravel the biodiversity of the bacterial rhizosphere microbiota of grapevine in an integrated pest management vineyard located in Piedmont, Italy. Comparison between the microbial community structure in the bulk and rhizosphere soil (variable: space) were performed. Moreover, the possible shifts of the bulk and rhizosphere soil microbiota according to two phenological stages such as flowering and early fruit development (variable: time) were characterized. The grapevine microbiota was identified using metagenomics and next-generation sequencing. Biodiversity was higher in the rhizosphere than in the bulk soil, independent of the phenological stage. Actinobacteria were the dominant class with frequencies ≥ 50% in all the soil samples, followed by Proteobacteria, Gemmatimonadetes, and Bacteroidetes. While Actinobacteria and Proteobacteria are well-known as being dominant in soil, this is the first time the presence of Gemmatimonadetes has been observed in vineyard soils. Gaiella was the dominant genus of Actinobacteria in all the samples. Finally, the microbiota associated with grapevine differed from the bulk soil microbiota and these variations were independent of the phenological stage of the plant.

The Rhizosphere Bacterial Microbiota of Vitis vinifera cv. Pinot Noir in an Integrated Pest Management Vineyard

Directory of Open Access Journals (Sweden)

Giorgia Novello

2017-08-01

Full Text Available Microorganisms associated with Vitis vinifera (grapevine can affect its growth, health and grape quality. The aim of this study was to unravel the biodiversity of the bacterial rhizosphere microbiota of grapevine in an integrated pest management vineyard located in Piedmont, Italy. Comparison between the microbial community structure in the bulk and rhizosphere soil (variable: space were performed. Moreover, the possible shifts of the bulk and rhizosphere soil microbiota according to two phenological stages such as flowering and early fruit development (variable: time were characterized. The grapevine microbiota was identified using metagenomics and next-generation sequencing. Biodiversity was higher in the rhizosphere than in the bulk soil, independent of the phenological stage. Actinobacteria were the dominant class with frequencies ≥ 50% in all the soil samples, followed by Proteobacteria, Gemmatimonadetes, and Bacteroidetes. While Actinobacteria and Proteobacteria are well-known as being dominant in soil, this is the first time the presence of Gemmatimonadetes has been observed in vineyard soils. Gaiella was the dominant genus of Actinobacteria in all the samples. Finally, the microbiota associated with grapevine differed from the bulk soil microbiota and these variations were independent of the phenological stage of the plant.

Aloe vera and Vitis vinifera improve wound healing in an in vivo rat burn wound model.

Science.gov (United States)

Lin, Li-Xin; Wang, Peng; Wang, Yu-Ting; Huang, Yong; Jiang, Lei; Wang, Xue-Ming

2016-02-01

Aloe vera and Vitis vinifera have been traditionally used as wound healing agents. The present study aimed to investigate the effects of aloe emodin and resveratrol in the burn wound healing procedure. Burn wounds are common in developed and developing countries, however, in developing countries, the incidence of severe complications is higher and financial resources are limited. The results of the present study demonstrated that neither aloe emodin or resveratrol were cytotoxic to THP-1 macrophages at concentrations of 1, 100 and 500 ng/ml. A significant increase in wound-healing activity was observed in mice treated with the aloe emodin and resveratrol, compared with those which received control treatments. The levels of IL-1β in the exudates of the burn wound area of the treated mice increased in a time-dependent manner over 7 days following burn wound injury. At 10 days post-injury, steady and progressive wound healing was observed in the control animals. The present study confirmed that increased wound healing occurs following treatment with aloe emodin,, compared with resveratrol, providing support for the use of Aloe vera plants to improve burn wound healing.

Relationships between harvest time and wine composition in Vitis vinifera L. cv. Cabernet Sauvignon 1. Grape and wine chemistry.

Science.gov (United States)

Bindon, Keren; Varela, Cristian; Kennedy, James; Holt, Helen; Herderich, Markus

2013-06-01

The study aimed to quantify the effects of grape maturity on wine alcohol, phenolics, flavour compounds and polysaccharides in Vitis vinifera L. cv Cabernet Sauvignon. Grapes were harvested at juice soluble solids from 20 to 26 °Brix which corresponded to a range of wine ethanol concentrations between 12% and 15.5%. Grape anthocyanin and skin tannin concentration increased as ripening progressed, while seed tannin declined. In the corresponding wines, monomeric anthocyanin and wine tannin concentration increased with harvest date, consistent with an enhanced extraction of skin-derived phenolics. In wines, there was an observed increase in yeast-derived metabolites, including volatile esters, dimethyl sulfide, glycerol and mannoproteins with harvest date. Wine volatiles which were significantly influenced by harvest date were isobutyl methoxypyrazine, C(6) alcohols and hexyl acetate, all of which decreased as ripening progressed. The implications of harvest date for wine composition is discussed in terms of both grape composition and yeast metabolism. Copyright © 2012 Elsevier Ltd. All rights reserved.

NMR-based phytochemical analysis of Vitis vinifera cv Falanghina leaves. Characterization of a previously undescribed biflavonoid with antiproliferative activity.

Science.gov (United States)

Tartaglione, Luciana; Gambuti, Angelita; De Cicco, Paola; Ercolano, Giuseppe; Ianaro, Angela; Taglialatela-Scafati, Orazio; Moio, Luigi; Forino, Martino

2018-03-01

Vitis vinifera cv Falanghina is an ancient grape variety of Southern Italy. A thorough phytochemical analysis of the Falanghina leaves was conducted to investigate its specialised metabolite content. Along with already known molecules, such as caftaric acid, quercetin-3-O-β-d-glucopyranoside, quercetin-3-O-β-d-glucuronide, kaempferol-3-O-β-d-glucopyranoside and kaempferol-3-O-β-d-glucuronide, a previously undescribed biflavonoid was identified. For this last compound, a moderate bioactivity against metastatic melanoma cells proliferation was discovered. This datum can be of some interest to researchers studying human melanoma. The high content in antioxidant glycosylated flavonoids supports the exploitation of grape vine leaves as an inexpensive source of natural products for the food industry and for both pharmaceutical and nutraceutical companies. Additionally, this study offers important insights into the plant physiology, thus prompting possible technological researches of genetic selection based on the vine adaptation to specific pedo-climatic environments. Copyright © 2017 Elsevier B.V. All rights reserved.

Stérilités mâle et femelle dans le genre Vitis. I. Modélisation de leur hérédité

OpenAIRE

CARBONNEAU , Alain

1983-01-01

En fonction de données nouvelles concernant les caractères sexuels dans le genre Vitis, en particulier la preuve de l’apparition de mâles dans des descendances de croisements entre hermaphrodites, une modélisation générale de l’hérédité des stérilités mâle et femelle est développée. Les résultats fournis par le meilleur modèle expliquent les observations effectuées jusqu’à ce jour et mettent en exergue des phénomènes de multiallélisme et d’épistasie.

Chlorophyll Fluorescence in Partially Defoliated Grape Plants (Vitis vinifera L. cv. Chardonnay / Fluorescencia de la Clorofila en Plantas de Uva (Vitis vinifera L. cv. Chardonnay Defoliadas Parcialmente

Directory of Open Access Journals (Sweden)

Peña Olmos Jaime Ernesto

2013-08-01

Full Text Available The chlorophyll content and fluorescence weredetermined in five-year-old grape plants (Vitis vinifera L. cv.Chardonnay that were subjected to early partial defoliation,in Villa de Leyva, Colombia. The experimental design wascompletely randomized, consisting of two treatments (50%defoliation and control, each with four replications of 35 plants. Every two weeks, one of every two recently-emerged leaves was removed from the non-control plants. The determination of total chlorophyll content was carried out on six leaves per plant using a CCM-200 Plus chlorophyll meter, while chlorophyll fluorescence measurements were taken with one darkadapted leaf per plant using a Junior-PAM fluorometer. Initial fluorescence (Fo, maximum fluorescence (Fm, terminal fluorescence (Ft, variable fluorescence (Fv, electron transport rate (ETR, maximum photochemical quantum yield of PSII (Fv/ Fm, effective photochemical quantum yield of photosystem II (Y(II, photochemical fluorescence quenching coefficient (qP, two non-photochemical quenching coefficients (qN and NPQ,quantum yield of light-induced non-photochemical fluorescence quenching (Y(NPQ, and quantum yield of non-light-induced non-photochemical quenching (Y(NO were measured. The chlorophyll concentration index showed higher values in the defoliated plants. There were no significant differences for the values of Fm, Ft and Fv. Fo was higher in the defoliated plants, while ETR, Fv/Fm and Y(II showed higher values in the control plants. It is evident that a reduction in leaf area modifies thepartitioning of excitation energy destined for photochemicaland non-photochemical processes, thus directly influencing the photosynthetic process of the plants evaluated. / Utilizando un diseño completamente aleatorizado,con dos tratamientos (defoliación al 50% y control y cuatrorepeticiones de 35 plantas cada una, se determinó el contenido y la fluorescencia de la clorofila en plantas de uva, sometidas a defoliación parcial

Optimization of the HS-SPME-GC/MS technique for determining volatile compounds in red wines made from Isabel grapes (Vitis labrusca

Directory of Open Access Journals (Sweden)

Narciza Maria de Oliveira ARCANJO

2015-01-01

Full Text Available AbstractBrazilian wine production is characterized by Vitis labrusca grape varieties, especially the economically important Isabel cultivar, with over 80% of its production destined for table wine production. The objective of this study was to optimize and validate the conditions for extracting volatile compounds from wine with the solid-phase microextraction technique, using the response surface method. Based on the response surface analysis, it can be concluded that the central point values maximize the process of extracting volatile compounds from wine, i.e., an equilibrium time of 15 minutes, an extraction time of 35 minutes, and an extraction temperature of 30 °C. Esters were the most numerous compounds found under these extraction conditions, indicating that wines made from Isabel cultivar grapes are characterized by compounds that confer a fruity aroma; this finding corroborates the scientific literature.

Evaluation of antioxidant activity of grapevine leaves extracts (Vitis labrusca in liver of Wistar rats

Directory of Open Access Journals (Sweden)

THAYS K. SCHAFFER

2016-03-01

Full Text Available The aim of this study was to evaluate the hepatoprotection of organic and conventional grapevine leaves extract (Vitis labrusca. The total polyphenol content and the isolate polyphenols by HPLC were evaluate. The animals received intraperitoneal injections of saline or extracts (conventional or organic - 30 mg/kg for 14 days. On day 15, the rats received carbon tetrachloride (CCl4 or mineral oil (i.p.. After 4h, the animals were euthanized. The analysis of the liver enzymes activity (AST, ALT, GGT was performed using serum, obtained by blood and the levels of lipid peroxidation (TBARS, protein oxidation (carbonyl, and the activity of antioxidant enzymes superoxide dismutase and catalase were analyzed in the liver. The results showed that the organic extract is richer in polyphenol and resveratrol than the conventional one. Both extracts prevent lipid peroxidation and protein oxidation generated by CCl4. Moreover, the extracts demonstrated ability to modulate the activity of SOD and CAT, as well as to establish a balance in the ratio of SOD/CAT. We also found that the CCl4 increased the levels of AST and GGT, and that both extracts prevent this. These results indicate that grapevine leaves extracts, both, organic and conventional, can prevent liver disorders.

A Concise Review on Multi-Omics Data Integration for Terroir Analysis in Vitis vinifera

Directory of Open Access Journals (Sweden)

Pastor Jullian Fabres

2017-06-01

Full Text Available Vitis vinifera (grapevine is one of the most important fruit crops, both for fresh consumption and wine and spirit production. The term terroir is frequently used in viticulture and the wine industry to relate wine sensory attributes to its geographic origin. Although, it can be cultivated in a wide range of environments, differences in growing conditions have a significant impact on fruit traits that ultimately affect wine quality. Understanding how fruit quality and yield are controlled at a molecular level in grapevine in response to environmental cues has been a major driver of research. Advances in the area of genomics, epigenomics, transcriptomics, proteomics and metabolomics, have significantly increased our knowledge on the abiotic regulation of yield and quality in many crop species, including V. vinifera. The integrated analysis of multiple ‘omics’ can give us the opportunity to better understand how plants modulate their response to different environments. However, ‘omics’ technologies provide a large amount of biological data and its interpretation is not always straightforward, especially when different ‘omic’ results are combined. Here we examine the current strategies used to integrate multi-omics, and how these have been used in V. vinifera. In addition, we also discuss the importance of including epigenomics data when integrating omics data as epigenetic mechanisms could play a major role as an intermediary between the environment and the genome.

Effects of solar radiation on grape (Vitis vinifera L.) composition and dried fruit colour

International Nuclear Information System (INIS)

Uhlig, B.A.

1998-01-01

Most sun-exposed fruit (Vitis vinifera L.) produced dark brown berries with low L-values, whereas most dried berries from shade fruit were acceptable in lightness although some had a green tinge. Fruit shaded by the natural vine canopy or exposed to direct solar radiation had similar drying ratios. However, berry weights were significantly higher in the shade than in the sun for both cultivars. The difference in berry weight between the two positions was less pronounced in the heat affected year. Solar radiation changed the composition of fresh berries and the colour of the dried fruit. The soluble-solid concentration was higher in fresh fruit exposed to direct solar radiation than in fruit grown in shaded conditions within the canopy. In the heat affected year the berries from both positions had the same soluble-solid concentrations, possibly due to dehydration of the fruit. No significant difference was found between the pH of sun fruit and shade fruit, but the titratable acidity was higher in shade fruit. Malate and tartrate concentrations in berry skin and the polyphenol oxidase activities had carotenoid concentrations in whole fresh berries were not significantly different for sun and shade fruit. Total phenol concentrations in berry skin were higher in sun fruit and chlorophyll concentrations in whole, fresh berries were higher in shade fruit. (author)

Vitis International Variety Catalogue (VIVC: A cultivar database referenced by genetic profiles and morphology

Directory of Open Access Journals (Sweden)

Maul Erika

2015-01-01

Full Text Available The establishment of the Vitis International Variety Catalogue (VIVC dates back to 1984. The idea was to virtually assemble all accessions maintained in the worldwide existing collections to face genetic erosion. In many cases synonymy, homonymy and misnaming hampered the clear assignment of cultivars/accessions to prime names. In the past 15 years nuclear microsatellites, in particular the nine SSR-markers VVS2, VVMD5, VVMD7, VVMD25, VVMD27, VVMD28, VVMD32, VrZAG62 and VrZAG79 were extensively applied for cultivar recognition in combination with ampelography. Genetic fin- gerprints of more than 15,000 cultivars/accessions were collected. They were taken from more than 300 articles and from microsatellite databases on the web. Allele sizes were adapted according to own internal reference varieties. Comparison of profiles revealed new identities like: “Corbeau” = “Sevilhao”, “Gragnelut” = “Fer”, “Beretinjak” = “Bianco d’Alessano”. The activities aim to equip the prime names of VIVC with reliable genetic profiles combined with the validation of their identity by ampelography. Fingerprints from 1,500 cultivars were already uploaded in VIVC. Two distinct search modules were imple- mented: “Microsatellites by varieties” and “Microsatellites by profiles”. The implementation assists the management of grape- vine genetic resources, e.g. trueness to type assessment in grapevine collections and serves research and breeding.

Isolation and molecular identification of yeast strains from “Rabilé” a ...

African Journals Online (AJOL)

Isolation and molecular identification of yeast strains from “Rabilé” a starter of local fermented drink. Ibrahim Keita, Marius K Somda, Aly Savadogo, Iliassou Mogmenga, Ousmane Koita, Alfred S Traore ...

OS MODELOS DE EQUILÍBRIO PARCIAL COMO APOIO À TOMADA DE DECISÃO NO AGRONEGÓCIO BRASILEIRO: UMA ANÁLISE A PARTIR DOS MODELOS DE VANTAGENS COMPARATIVAS REVELADAS E ORIENTAÇÃO REGIONAL

Directory of Open Access Journals (Sweden)

Dr. João Armando Dessimon Machado

2008-03-01

Full Text Available O objetivo deste trabalho é demonstrar a importância dos modelos de equilíbrio parcial de Vantagens Comparativas Reveladas e Orientação Regional, geralmente utilizados em trabalhos de economia internacional, como apoio à tomada de decisão. Neste sentido, discute-se alguns trabalhos que se utilizaram desses modelos e, a partir dos resultados encontrados, constata-se que os modelos podem ser instrumentos úteis de tomada de decisão para a formulação de políticas de comércio internacional, a fim de que o país tenha estratégias amplas para uma maior competitividade nos mercados internacionais de produtos agroalimentares. Além disso, o país poderá desenvolver estratégias específicas para os principais parceiros comerciais e também em relação aos seus principais concorrentes no mercado internacional de determinado produto.

DISTANT HYBRIDS IN F4 (VITIS VINIFERA L. X MUSCADINIA ROTUNDIFOLIA MICHX. AND OF CULTIVARS OF VITIS VINIFERA L. AND OF CONCERNING THE CONTENT OF SOME BIOCHEMICAL COMPOUNDS

Directory of Open Access Journals (Sweden)

Eugeniu ALEXANDROV

2015-04-01

Full Text Available The process of obtaining distant hybrids, as well as any crossing of cultivars of Vitis vinifera L. with representatives of species possessing the necessary qualities (resistance to diseases and pests, low temperature, etc. may change the spectrum of chemical and biochemical compounds responsible for flavour, colour and taste of grapes, obtained juice and wine. Botanical description of distant hybrids was performed during all phases of the vegetative stages; the organs of the plants were studied from spring, at bud unfolding, until early autumn, at the fall of the leaves. For the determination of diglucoside-3,5-malvidin, the fluorimetric method, for determining the methyl anthranilate, the gas chromatographic method was applied. Based on the analyzes of biochemical constituents of grapes of the distant hybrids: DRX-M4-578; -502; -571; -660; -609; -580; etc., compared to the traditional cultivars „Feteasca albă” and „Rară neagră”, it has been found that these varieties are similar. So, the distant hybrids of grapevine haven’t inherited unwanted characters for vines, some of them are strictly limited (diglucoside-3,5-malvidol. These hybrids don’t have the specific characteristics of direct production hybrids, characterised by the foxat taste of the grape berries, caused by the presence of the methyl anthranilate. The distant hybrids studied according to the classical uvologic and technological principles can be classified as follows: 5 distant hybrids are attributed to the table vine species and 2 distant hybrids have mixed properties. According to the physical and biochemical indices of the grapes of the studied distant hybrids, their characteristics are similar to European vine species.

Parâmetros hemogasométricos e equilíbrio ácido-básico de cabritos nascidos de partos normais

Directory of Open Access Journals (Sweden)

Diogo G. Camargo

2012-12-01

Full Text Available A adaptação à vida extra-uterina é período crítico para o recém-nascido. Inúmeras alterações ocorrem em diferentes sistemas e órgãos, incluindo a função respiratória e o equilíbrio ácido-básico. O presente trabalho objetivou constatar a ocorrência de acidose em cabritos recém-nascidos e obter parâmetros gasométricos e ácido-básicos dos mesmos, até as 24 horas de vida. Para tanto, foram utilizados 33 cabritos, sem distinção de sexo. Amostras sanguíneas foram colhidas por venopunção jugular, imediatamente após o nascimento, aos cinco, dez e 15 minutos, e às 24 horas de vida, para determinação do pH, pressão parcial de oxigênio (pO2, pressão parcial de dióxido de carbono (pCO2, dióxido de carbono total (TCO2, concentração de bicarbonato (HCO3, excesso de bases (BE e a saturação de oxigênio (sO2 utilizando-se analisador portátil de gases sanguíneos. Observaram-se diferenças significativas entre os momentos nos valores gasométricos dos cabritos em todas as variáveis estudadas. Os cabritos recém-nascidos apresentaram acidose respiratória no período pós-parto imediato, normalizando-se às 24 horas de vida.

"Linn" taas Theatrumis

Index Scriptorium Estoniae

2009-01-01

Theatrumis võib veel mõned korrad oktoobris vaadata sel aastal nii parima lavastaja (Lembit Peterson) kui ka meesnäitleja (Marius Peterson) kategoorias teatripreemia pälvinud lavastust - Jevgeni Griškovetsi "Linna"

Analysis of the grape MYB R2R3 subfamily reveals expanded wine quality-related clades and conserved gene structure organization across Vitis and Arabidopsis genomes

Directory of Open Access Journals (Sweden)

Arce-Johnson Patricio

2008-07-01

Full Text Available Abstract Background The MYB superfamily constitutes the most abundant group of transcription factors described in plants. Members control processes such as epidermal cell differentiation, stomatal aperture, flavonoid synthesis, cold and drought tolerance and pathogen resistance. No genome-wide characterization of this family has been conducted in a woody species such as grapevine. In addition, previous analysis of the recently released grape genome sequence suggested expansion events of several gene families involved in wine quality. Results We describe and classify 108 members of the grape R2R3 MYB gene subfamily in terms of their genomic gene structures and similarity to their putative Arabidopsis thaliana orthologues. Seven gene models were derived and analyzed in terms of gene expression and their DNA binding domain structures. Despite low overall sequence homology in the C-terminus of all proteins, even in those with similar functions across Arabidopsis and Vitis, highly conserved motif sequences and exon lengths were found. The grape epidermal cell fate clade is expanded when compared with the Arabidopsis and rice MYB subfamilies. Two anthocyanin MYBA related clusters were identified in chromosomes 2 and 14, one of which includes the previously described grape colour locus. Tannin related loci were also detected with eight candidate homologues in chromosomes 4, 9 and 11. Conclusion This genome wide transcription factor analysis in Vitis suggests that clade-specific grape R2R3 MYB genes are expanded while other MYB genes could be well conserved compared to Arabidopsis. MYB gene abundance, homology and orientation within particular loci also suggests that expanded MYB clades conferring quality attributes of grapes and wines, such as colour and astringency, could possess redundant, overlapping and cooperative functions.

Morphology and Hydraulic Architecture of Vitis vinifera L. cv. Syrah and Torrontés Riojano Plants Are Unaffected by Variations in Red to Far-Red Ratio.

Directory of Open Access Journals (Sweden)

Carina Verónica González

Full Text Available Plants have evolved an array of specific photoreceptors to acclimate to the light environment. By sensing light signals, photoreceptors modulate plant morphology, carbon- and water-physiology, crop yield and quality of harvestable organs, among other responses. Many cultural practices and crop management decisions alter light quantity and quality perceived by plants cultivated in the field. Under full sunlight, phytochromes perceive high red to far red ratios (R:FR; 1.1, whereas overhead or lateral low R:FR (below 1.1 are sensed in the presence of plant shade or neighboring plants, respectively. Grapevine is one of the most important fruit crops in the world. To date, studies on grapevine response to light focused on different Photosynthetic Active Radiation (PAR levels; however, limited data exist about its response to light quality. In this study we aimed to investigate morphological, biochemical, and hydraulic responses of Vitis vinifera to variations in R:FR. Therefore, we irradiated Syrah and Torrontés Riojano plants, grown in a glasshouse, with lateral FR light (low lateral R:FR treatment, while others, that were kept as controls, were not irradiated (ambient lateral R:FR treatment. In response to the low lateral R:FR treatment, grapevine plants did not display any of the SAS morphological markers (i.e. stem length, petiole length and angle, number of lateral shoots in any of the cultivars assessed, despite an increase in gibberelins and auxin concentrations in leaf tissues. Low lateral R:FR did not affect dry matter partitioning, water-related traits (stomata density and index, wood anatomy, or water-related physiology (plant conductance, transpiration rate, stem hydraulic conductivity, stomatal conductance. None of the Vitis vinifera varieties assessed displayed the classical morphological and hydraulic responses associated to SAS induced by phytochromes. We discuss these results in the context of natural grapevine environment and

Protein identification and quantification from riverbank grape, Vitis riparia: Comparing SDS-PAGE and FASP-GPF techniques for shotgun proteomic analysis.

Science.gov (United States)

George, Iniga S; Fennell, Anne Y; Haynes, Paul A

2015-09-01

Protein sample preparation optimisation is critical for establishing reproducible high throughput proteomic analysis. In this study, two different fractionation sample preparation techniques (in-gel digestion and in-solution digestion) for shotgun proteomics were used to quantitatively compare proteins identified in Vitis riparia leaf samples. The total number of proteins and peptides identified were compared between filter aided sample preparation (FASP) coupled with gas phase fractionation (GPF) and SDS-PAGE methods. There was a 24% increase in the total number of reproducibly identified proteins when FASP-GPF was used. FASP-GPF is more reproducible, less expensive and a better method than SDS-PAGE for shotgun proteomics of grapevine samples as it significantly increases protein identification across biological replicates. Total peptide and protein information from the two fractionation techniques is available in PRIDE with the identifier PXD001399 (http://proteomecentral.proteomexchange.org/dataset/PXD001399). © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Quantitative Prediction of Cell Wall Polysaccharide Composition in Grape (Vitis vinifera L.) and Apple (Malus domestica) Skins from Acid Hydrolysis Monosaccharide Profiles

DEFF Research Database (Denmark)

Arnous, Anis; Meyer, Anne S.

2009-01-01

On the basis of monosaccharide analysis after acid hydrolysis of fruit skin samples of three wine grape cultivars, Vitis vinifera L. Cabernet Sauvignon, Merlot, and Shiraz, and of two types of apple, Malus domestica Red Delicious and Golden Delicious, an iterative calculation method is reported...... for the quantitative allocation of plant cell wall monomers into relevant structural polysaccharide elements. By this method the relative molar distribution (mol %) of the different polysaccharides in the red wine grape skins was estimated as 57-62 mol % homogalacturonan, 6.0-14 mol % cellulose, 10-11 mol % xyloglucan......, 7 mol % arabinan, 4.5-5.0 mol % rhamnogalacturonan I, 3.5-4.0 mol % rhamnogalacturonan II, 3 mol % arabinogalactan, and 0.5-1.0 mol % mannans; the ranges indicate minor variations in the skin composition of the three different cultivars. These cell wall polysaccharides made up similar to 43...

Exogenous Applications of Brassinosteroids Improve Color of Red Table Grape (Vitis vinifera L. Cv. “Redglobe” Berries

Directory of Open Access Journals (Sweden)

Alexis E. Vergara

2018-04-01

Full Text Available Color and other quality parameters of “Redglobe” grape (Vitis vinifera L. berries were evaluated after treatment with brassinosteroid (BR analogs. Three BRs analogs (24-epibrassinolide, Triol, or Lactone were applied at three concentrations (0.0, 0.4, or 0.8 mg⋅L-1, at the onset of veraison. A commercial formulation (B-2000® was also applied, at a recommended rate of 0.06 mg⋅L-1. The tested BR analogs were effective improving berry color (evaluated as color index for red grapes, CIRG, increasing the levels of soluble solids and anthocyanins, and changing the types of anthocyanins present without altering other quality and yield parameters. The effects of BR analogs on color enhancement could be explained by an increase in soluble solids content and/or anthocyanin content. Treatment with 24-epibrassinolide (at 0.4 mg⋅L-1 or the commercial formulation tended to favor the production of dihydroxylated anthocyanins, which are responsible for the red and pink colors of grape berries. Results indicate that the use of BRs constitutes a potential tool in the production of table grapes. This is the first report of this enhancement effect in a productive context.

FSA Panel on Di etetic Products, Nutrition and Allergie s (NDA); Scientific Opinion on the substantiation of a health claim related to Vitis vinifera L. seeds extract and “helps to drain the body in case of water accumulation” pursuant to Article 13(5) of Regulation (EC) No 1924/2006

DEFF Research Database (Denmark)

Tetens, Inge

Following an application from Nutrilinks Sarl, submitted pursuant to Article 13(5) of Regulation (EC) No 1924/2006 via the Competent Authority of Belgium, the Panel on Dietetic Products, Nutrition and Allergies (NDA) was asked to deliver an opinion on the scientific substantiation of a health claim...... related to Vitis vinifera L. seeds extract and “helps to drain the body in case of water accumulation”. The Panel considers that the food constituent which is the subject of the health claim is sufficiently characterised. The claimed effect proposed by the applicant is “helps to drain the body in case......” was a beneficial physiological effect in the context of “a normal venous circulation in the legs”. The applicant acknowledged that this claim referred to the same physiological function of the body as another health claim application on Vitis vinifera L. seeds extract and maintenance of normal venous blood flow...

Unduski näidend soome keeles

Index Scriptorium Estoniae

2007-01-01

Jaan Unduski näidend "Good-bye, Vienna" tõlgiti soome keelde ja loeti ette festivalil "Baltic Circle". Samal üritusel loeti ette ka lätlase Inga Abele ja leedulase Marius Ivashkevichiuse näidendeid

Genetic analysis and QTL mapping for fruit skin anthocyanidin in grape (vitis vinifera)

International Nuclear Information System (INIS)

Guo, Y.; Xue, R.; Lin, H.; Su, K.; Zhao, Y.; Zhendong, L.; Shi, G.; Niu, Z.; Li, K.; Guo, X.

2015-01-01

In this study, an F1 population was created by the cross 87-1*9-22. The female parent 87-1 was a black purple cultivar and the male parent was an excellent breeding line with green pericarp. the skin color separation of population and distribution, and determined the content of each individual fruit peel pigment. On the basis of the genetic map of Vitis vinifera L. We carried out the grape skin pigment content quantitative trait locus (QTL) analyses. The results show that the fruit color performance for continuous variation and the inheritance of fruit skin anthocyanidin content was a quantitative inheritance. The color of offspring ranges from green and black-blue and existing distribution. Using SSR and SRAP molecular markers to construct 188 female parent maps,175 male parent maps and 251 consensus maps, and the total map distance is 1047.5 cM,1100.2 cM and 1264.2 cM respectively. The result of QTL showed that there were more QTLs exist in the linkage group of 1, 2, 3, 4, 9, 13, 14, 16 and 19 and in the linkage group of 3, 4, 13 and 14, we detected QTLs in the similar position with the result of the study in the year of 2011 and 2012, and based on this we will conduct the fine QTL location in the future, this result will lay a good foundation for the grape in the department of molecular assistant breeding in the future. (author)

Avaliação da uva cv. Isabel para a elaboração de vinho tinto

Directory of Open Access Journals (Sweden)

RIZZON Luiz Antenor

2000-01-01

Full Text Available A uva Isabel, originária do Sul dos Estados Unidos, é uma das principais cultivares de Vitis labrusca. Atualmente é a cultivar mais difundida na Serra Gaúcha, representando aproximadamente 45% de toda a uva produzida nessa região. Além da elaboração de vinho tinto comum, a Isabel é utilizada para elaboração de vinho rosado e suco e comercializada como uva de mesa. O objetivo do presente trabalho foi determinar as características agronômicas e enológicas da uva Isabel, para elaboração de vinho tinto comum. Para isso, avaliou-se a maturação da uva e realizaram-se estudos para caracterizar o cacho, o mosto e o vinho tinto, nas safras de 1988 a 1994. Os resultados obtidos evidenciaram que a uva Isabel tem cacho pequeno, solto, formado por bagas e sementes grandes. O mosto apresenta cor rosada pouco intensa, tem bom teor de açúcar e baixo nível de ácido málico e acidez total. O vinho tem cor vermelha viva; o aroma é intenso e com acentuada tipicidade varietal; a análise sensorial evidencia que geralmente falta ao vinho equilíbrio e maciez.

Esterase isozymes patterns of grape vine (Vitis vinifera L. are altered in response to fungicide exposure

Directory of Open Access Journals (Sweden)

Gleice Ribeiro Orasmo

2015-10-01

Full Text Available Current analysis characterizes the effect of different fungicides often applied for pest control on a-and b-esterase patterns of four economically important table-wine grape cultivars (Italia, Rubi, Benitaka and Brasil of Vitis vinifera. The a- and b-esterase patterns in bud leaves of the cultivars were assessed by native PAGE analysis. Cabrio Top® compound inhibited Est-2, Est-5, Est-6, Est-7, Est-8, Est-9 and Est-10 carboxylesterases, whereas Est-4, Est-11, Est-12, Est-13, Est-14 acetylesterases and Est-16 carboxylesterase were detected as weakly stained bands. Carboxylesterases and acetylesterases were also detected as weakly stained bands when exposed to fungicides Orthocide 500®, Positron Duo® and Folicur PM®. No changes in a- and b-esterase patterns were reported when the vines were exposed to the fungicides Rovral SC®, Kumulus DF®, Curzate M®, Score® or Cuprogarb 500®. The evidence of functional changes in carboxylesterase and acetylesterase levels in current study is a warning to grape producers on the dangers inherent in the indiscriminate use of potent and modern fungicides extensively used in agriculture. The inhibition effect of fungicides on esterase isozyme molecules seems to be independent of the fungicide chemical.

Grape (Vitis vinifera) extracts protect against radiation-induced oxidative stress in human erythrocyte (red blood cell)

International Nuclear Information System (INIS)

Singha, Indrani; Das, Subir Kumar; Gautam, S.

2016-01-01

Ionizing radiation (IR) causes oxidative stress through the overwhelming generation of reactive oxygen species (ROS) in the living cells leading further to the oxidative damage to biomolecules. Grapes (Vitis vinifera) contain several bioactive phytochemicals and are the richest source of antioxidant. In this study, we investigated and compared in vitro antioxidant activity and DNA damage protective property of the grape extracts of four different cultivars, including the Thompson seedless, Flame seedless, Kishmish chorni and Red globe. The activities of ascorbic acid oxidase and catalase significantly (p<0.01) differed among extracts within the same cultivar, while that of peroxidase and polyphenol oxidase did not differ significantly among extracts of any cultivar. In vitro antioxidant activities were assessed by ferric-reducing antioxidant power (FRAP) assay and ABTS. The superoxide radical-scavenging activity was higher in the seed as compared to the skin or pulp of the same cultivar. Pretreatment with grape extracts attenuates oxidative stress induced by 4 Gy γ-radiation in human erythrocytes in vitro. These results suggest that grape extract serve as a potential source of natural antioxidants against the IR-induced oxidative stress and also inhibit apoptosis. Furthermore, the protective action of grape depends on the source of extract (seed, skin or pulp) and type of the cultivars. (author)

Characterization and Expression Analysis of a Retinoblastoma-Related Gene from Chinese Wild Vitis pseudoreticulata.

Science.gov (United States)

Wen, Zhifeng; Gao, Min; Jiao, Chen; Wang, Qian; Xu, Hui; Walter, Monika; Xu, Weirong; Bassett, Carole; Wang, Xiping

2012-01-01

Retinoblastoma-related (RBR) genes, a conserved gene family in higher eukaryotes, play important roles in cell differentiation, development, and mammalian cell death; however, little is known of their function in plants. In this study, a RBR gene was isolated from the Chinese wild grape, Vitis pseudoreticulata W. T. Wang clone "Baihe-35-1", and designated as VpRBR . The cDNA sequence of VpRBR was 3,030 bp and contained an open reading frame of 3,024 bp. Conceptual translation of this gene indicated a composition of 1,007 amino acids with a predicted molecular mass of 117.3 kDa. The predicted protein showed a retinoblastoma-associated protein domain A from amino acid residues 416 to 579, and domain B from residues 726 to 855. The result of expression analysis indicated that VpRBR was expressed in tissues, leaves, stem, tendrils, flower, and grape skin at different expression levels. Further quantitative reverse transcription-PCR (qRT-PCR) data indicated that VpRBR levels were higher in Erysiphe necator-treated "Baihe-35-1" and "Baihe-13-1", two resistant clones of Chinese wild V. pseudoreticulata , than in E. necator-treated "Hunan-1", a susceptible clone of V. pseudoreticulata . Furthermore, the expression of VpRBR in response to salicylic acid (SA), methyl jasmonate (MeJA), and ethylene (Eth) in grape leaves was also investigated. Taken together, these data indicate that VpRBR may contribute to some aspect of powdery mildew resistance in grape.

Leo Burnett wins agency of the year title in Estonia and Lithuania

Index Scriptorium Estoniae

2004-01-01

Eesti Kuldmuna reklaamikonkursil, Leedu reklaamifestivalil Adrenalinas aasta reklaamiagentuuri tiitli pälvinud ettevõttest Kontuur Leo Burnett. Madis Laas, Tomas Ramanauskas ja Marius Petrukaitis vastavad küsimustele firma edu võimalike põhjuste ja tulevikuplaanide kohta

Evolución de las relaciones nutricionales suelo-planta desarrolladas en suelos de la D. O. "Tierra de León" dedicados al cultivo de Vitis vinífera L. cv. Prieto Picudo

OpenAIRE

Olego Morán, Miguel Ángel

2013-01-01

Se constata la gran influencia e importancia que tiene el pH de los suelos, sobre la biodisponibilidad de los nutrientes minerales presentes en los mismos. Se ha constatado que los nutrientes minerales Mg y Cu de los tejidos vegetales de Vitis vinífera L. cv. Prieto Picudo, aparecen con una interacción antagónica y significativa, lo cual reviste gran importancia, dada la escasez del nutriente Mg en estos suelos, y los continuos tratamientos con base cúprica que actualmente se realizan

Cloning, Characterization, and Functional Investigation of VaHAESA from Vitis amurensis Inoculated with Plasmopara viticola

Directory of Open Access Journals (Sweden)

Shaoli Liu

2018-04-01

Full Text Available Plant pattern recognition receptors (PRRs are essential for immune responses and establishing symbiosis. Plants detect invaders via the recognition of pathogen-associated molecular patterns (PAMPs by PRRs. This phenomenon is termed PAMP-triggered immunity (PTI. We investigated disease resistance in Vitis amurensis to identify PRRs that are important for resistance against downy mildew, analyzed the PRRs that were upregulated by incompatible Plasmopara viticola infection, and cloned the full-length cDNA of the VaHAESA gene. We then analyzed the structure, subcellular localization, and relative disease resistance of VaHAESA. VaHAESA and PRR-receptor-like kinase 5 (RLK5 are highly similar, belonging to the leucine-rich repeat (LRR-RLK family and localizing to the plasma membrane. The expression of PRR genes changed after the inoculation of V. amurensis with compatible and incompatible P. viticola; during early disease development, transiently transformed V. vinifera plants expressing VaHAESA were more resistant to pathogens than those transformed with the empty vector and untransformed controls, potentially due to increased H2O2, NO, and callose levels in the transformants. Furthermore, transgenic Arabidopsis thaliana showed upregulated expression of genes related to the PTI pathway and improved disease resistance. These results show that VaHAESA is a positive regulator of resistance against downy mildew in grapevines.

Characterization of Flavan-3-ols and Expression of MYB and Late Pathway Genes Involved in Proanthocyanidin Biosynthesis in Foliage of Vitis bellula

Directory of Open Access Journals (Sweden)

Ke-Gang Li

2013-03-01

Full Text Available Proanthocyanidins (PAs are fundamental nutritional metabolites in different types of grape products consumed by human beings. Although the biosynthesis of PAs in berry of Vitis vinifera has gained intensive investigations, the understanding of PAs in other Vitis species is limited. In this study, we report PA formation and characterization of gene expression involved in PA biosynthesis in leaves of V. bellula, a wild edible grape species native to south and south-west China. Leaves are collected at five developmental stages defined by sizes ranging from 0.5 to 5 cm in length. Analyses of thin layer chromatography (TLC and high performance liquid chromatography-photodiode array detector (HPLC-PAD show the formation of (+-catechin, (−-epicatechin, (+-gallocatechin and (−-epigallocatechin during the entire development of leaves. Analyses of butanol-HCl boiling cleavage coupled with spectrometry measurement at 550 nm show a temporal trend of extractable PA levels, which is characterized by an increase from 0.5 cm to 1.5 cm long leaves followed by a decrease in late stages. TLC and HPLC-PAD analyses identify cyanidin, delphinidin and pelargonidin produced from the cleavage of PAs in the butanol-HCl boiling, showing that the foliage PAs of V. bellula include three different types of extension units. Four cDNAs, which encode VbANR, VbDFR, VbLAR1 and VbLAR2, respectively, are cloned from young leaves. The expression patterns of VbANR and VbLAR2 but not VbLAR1 and VbDFR follow a similar trend as the accumulation patterns of PAs. Two cDNAs encoding VbMYBPA1 and VbMYB5a, the homologs of which have been demonstrated to regulate the expression of both ANR and LAR in V. vinifera, are also cloned and their expression profiles are similar to those of VbANR and VbLAR2. In contrast, the expression profiles of MYBA1 and 2 homologs involved in anthocyanin biosynthesis are different from those of VbANR and VbLAR2. Our data show that both ANR and LAR branches are

Foliar applications of iron promote flavonoids accumulation in grape berry of Vitis vinifera cv. Merlot grown in the iron deficiency soil.

Science.gov (United States)

Shi, Pengbao; Song, Changzheng; Chen, Haiju; Duan, Bingbing; Zhang, Zhenwen; Meng, Jiangfei

2018-07-01

Flavonoids are important compounds for grape and wine quality. Foliar fertilization with iron compounds has been reported to have a substantial impact on grape composition in the grapevines growing in calcareous soil. However, much less is known about its real impact on flavonoid composition. In the present study, Ferric ethylenediamine di (O-hydroxyphenylacetic) acid (Fe-EDDHA) was foliar applied to Merlot (Vitis vinifera L.) grapevines growing in calcareous soil over two consecutive vintages in order to study its effect on grape flavonoid composition. Fe-EDDHA foliar supply tended to increase grape sugar, anthocyanin and flavonol content, decrease acid content and enhance the juice pH when compared to the control. Principal component analysis showed that the vintage also had influence on grape quality. The results suggested that Fe-EDDHA foliar application had an enhancement effect on grape secondary metabolism, and the effect increased the nutritional value of the consequent grapes and wines. Copyright © 2018 Elsevier Ltd. All rights reserved.

Effects of whole-wheat flour and bordeaux grape pomace (Vitis labrusca L. on the sensory, physicochemical and functional properties of cookies

Directory of Open Access Journals (Sweden)

Ariadne Roberto KARNOPP

2015-12-01

Full Text Available Abstract Grape pomace, which is derived from the skin and seeds, is the residue from the production of grape juice and wine. It corresponds to up to 20% of the total volume and it contains a high level of dietary fibers and bioactive compounds. In the Brazilian market, there is no product containing grape pomace as a replacement for conventional wheat flour. Thus, this study aimed to assess the effects of whole-wheat flour and organic Bordeaux grape pomace (Vitis labrusca L. on the sensory, physicochemical and functional properties of cookies using response surface methodology (RSM. The regression models indicated that the addition of whole-wheat and organic grape pomace decreased (p 65% of explained data variability, except for brittleness. The sensory evaluation results revealed that no significant differences (p > 0.05 were observed for the cookie samples, implying that the addition of grape pomace and whole-wheat flour did not negatively affect the preference of cookies.

Cloning, sequencing, purification, and crystal structure of Grenache (Vitis vinifera) polyphenol oxidase.

Science.gov (United States)

Virador, Victoria M; Reyes Grajeda, Juan P; Blanco-Labra, Alejandro; Mendiola-Olaya, Elizabeth; Smith, Gary M; Moreno, Abel; Whitaker, John R

2010-01-27

The full-length cDNA sequence (P93622_VITVI) of polyphenol oxidase (PPO) cDNA from grape Vitis vinifera L., cv Grenache, was found to encode a translated protein of 607 amino acids with an expected molecular weight of ca. 67 kDa and a predicted pI of 6.83. The translated amino acid sequence was 99%, identical to that of a white grape berry PPO (1) (5 out of 607 amino acid potential sequence differences). The protein was purified from Grenache grape berries by using traditional methods, and it was crystallized with ammonium acetate by the hanging-drop vapor diffusion method. The crystals were orthorhombic, space group C222(1). The structure was obtained at 2.2 A resolution using synchrotron radiation using the 39 kDa isozyme of sweet potato PPO (PDB code: 1BT1 ) as a phase donor. The basic symmetry of the cell parameters (a, b, and c and alpha, beta, and gamma) as well as in the number of asymmetric units in the unit cell of the crystals of PPO, differed between the two proteins. The structures of the two enzymes are quite similar in overall fold, the location of the helix bundles at the core, and the active site in which three histidines bind each of the two catalytic copper ions, and one of the histidines is engaged in a thioether linkage with a cysteine residue. The possibility that the formation of the Cys-His thioether linkage constitutes the activation step is proposed. No evidence of phosphorylation or glycoslyation was found in the electron density map. The mass of the crystallized protein appears to be only 38.4 kDa, and the processing that occurs in the grape berry that leads to this smaller size is discussed.

Regulated deficit irrigation as a water management strategy in Vitis vinifera production

International Nuclear Information System (INIS)

Wample, R.L.; Smithyman, R.

2002-01-01

An initial six-year study in a commercial vineyard located in the Columbia River Valley of Washington State, United States of America, examined the management practices and potential benefits of regulated deficit irrigation (RDI) on Vitis vinifera cv. Sauvignon blanc. The objective of the treatments was to evaluate the effect of deficit irrigation prior to, compared with after, veraison. Each of four irrigation treatments was applied to 1.6 ha and replicated four times for a total 27.0 ha. Irrigation treatments were based on desired soil moisture levels in the top metre of the profile where most of the root system is found. Soil moisture was monitored using a neutron probe and the information was combined with calculations of evaporative demand to determine the irrigation required on a weekly basis. Vine growth, yield, fruit quality and cold hardiness were monitored throughout the study. The results indicated that RDI prior to veraison was effective in controlling shoot growth, as determined by shoot length and elongation rate, as well as pruning weights. Sixteen wine lots, each of approximately 12,000 litres, were prepared each season. Although there was some effect on berry weight, yield was not always significantly reduced. Full irrigation prior to veraison resulted in excessive shoot growth. RDI applied after veraison to vines with large canopies resulted in greater water deficit stress. Fruit quality was increased by pre-veraison RDI compared to postveraison RDI based on wines made. Regulated deficit irrigation applied at anytime resulted in better early-season lignification of canes and cold hardening of buds. There was a slight improvement in mid-winter cold hardiness of vines subjected to RDI. However, this effect was inconsistent. Studies on Cabernet Sauvignon and White Riesling are underway to confirm these results and to investigate the impact of RDI on fruit quality and winemaking practices. (author)

Baltoscandalistide massiline meeleavaldus : Beckett lauludes, verepilastus ja bensiinihais / Kadi Herkül

Index Scriptorium Estoniae

Herkül, Kadi

2000-01-01

Meeldejäävaimaid "teatripärleid" Rakvere teatrifestivalilt "Baltoscandal 2000" : Moving House Theatre Company "Becketti laulud" ("Beckett Songs"), lavastaja Laszlo Hudi, Oskaras Korshunovas Theatre, Marius von Mayenburgi "Tule nägu" ("The Face of Fire"), lavastaja Oskaras Korshunovas

Evaluation of phenolic compounds content and in vitro antioxidant activity of red wines produced from Vitis labrusca grapes

Directory of Open Access Journals (Sweden)

Daniel Braga de Lima

2011-09-01

Full Text Available Wine production in the northern Curitiba, Paraná, Brazil, specifically the communes of Colombo and Almirante Tamandaré, is based mainly on the utilization of Vitis labrusca grapes var. Bordô (Ives. Total sugar content, pH, and total acidity were analyzed in red wine samples from 2007 and 2008 vintages following official methods of analysis. Moreover, total phenolic, flavonoid, and tannin contents were analyzed by colorimetric methodologies and the antioxidant activity was determined using the 2,2-diphenyl-1-picrylhydrazyl (DPPH radical methodology. Phenolic compounds were identified by high performance liquid chromatography. The total phenolic content of wine samples presented concentrations varying between 1582.35 and 2896.08 mg gallic acid.L-1 since the major part corresponds to flavonoid content. In these compounds' concentration range, a direct relationship between phenolic compounds content and levels of antioxidant activity was not observed. Among the identified phenolic compounds, chlorogenic, caffeic, and syringic acids were found to be the major components. Using three principal components, it was possible to explain 81.36% of total variance of the studied samples. Principal Components Analysis does not differentiate between vintages.

Post-stroke motor and functional evaluations: a clinical correlation using Fugl-Meyer assessment scale, Berg balance scale and Barthel index Avaliações motoras e funcionais pós-AVC: correlação clínica usando a escala de desempenho físico de Fugl-Meyer, a escala de equilíbrio de Berg e o índice de Barthel

Directory of Open Access Journals (Sweden)

Roberta de Oliveira

2006-09-01

Full Text Available Stroke is one of the major causes of morbidity and mortality. Sequels deriving from this event may lead to motor disability and from mild to severe deficits. In order to better classify sensory-motor dysfunction, balance and ability to perform activities of daily living, quantitative and qualitative evaluation scales have been used. OBJECTIVE: To correlate the scales Fugl-Meyer assessment scale, Berg balance scale and Barthel index. Twenty subjects with sequel after a single, unilateral stroke in chronic phase (>6 months post ictus were evaluated for about one hour. RESULTS: Barthel scale was statistically related to the total motor score of Fugl-Meyer assessment (r=0.597, p=0.005. The lower limb section at Fugl-Meyer had positive correlation with Berg scale (r=0.653, p=0.002 and with the balance section of Fugl-Meyer own scale (r=0.449, p=0.047. Both balance scales were correlated one with other (r=0.555, p=0.011. Statistical divergence appeared when Barthel's Index was correlated with Berg's Scale (r=0.425, p=0.062, and it is not statistically significant. CONCLUSION: The use of both quantitative and qualitative scales was shown to be a good measuring instrument for the classification of the general clinical performance of the patient, especially when positively related joint evaluations are applied.O acidente vascular cerebral (AVC é reconhecido como uma das maiores causas de morbidade e mortalidade. Seqüelas decorrentes deste evento podem levar a inabilidade motora e déficits leves a graves. Para classificar melhor a disfunção sensitivo-motora, o equilíbrio e as habilidades para as atividades de vida diária, escalas de avaliações quantitativas e qualitativas estão sendo utilizadas. OBJETIVO: Correlacionar a escala de desempenho físico de Fugl-Meyer, a escala de equilíbrio de Berg e o índice de Barthel. MÉTODO: Foram selecionados 20 sujeitos com sequela de um único e unilateral AVC em fase crônica (>6 meses pós ictal, que

Raadioteatril elu sees. Elu sees? / Mart Aas, Tõnis Leemets ; interv. Kutt Kommel

Index Scriptorium Estoniae

Aas, Mart

2007-01-01

Eesti Raadio raadioteatri 78. sünnipäeval esietendus Vikerraadios dokumentaalkuuldemäng "Elu sees" Aleksander Alleni (hilisema nimega Aleksander Aas) mälestuste põhjal. Theatrumi lavastuse on raadiole seadnud Mart Aas, Marius Peterson, Toomas Lõhmuste ja Tõnis Leemets

Fundamental Mechanisms of NeuroInformation Processing: Inverse Problems and Spike Processing

Science.gov (United States)

2016-08-04

Neurokernel software using the Python programming language and the PyCUDA in- terface to NVIDIAs CUDA GPU programming environment to avail ourselves of the...Neuroscience, UCSD. Marius Buibas, Scientist, Brain Corporation , San Diego, California. Gaute T. Einevoll, Department of Mathematical Sciences

Desequilíbrio imunológico periférico mediado por células Th17/Treg em pacientes com rinite alérgica

Directory of Open Access Journals (Sweden)

Xuekun Huang

2014-04-01

Full Text Available Introdução: A rinite alérgica (RA é uma doença não infecciosa da mucosa nasal mediada por IgE após o contato com alérgenos. Objetivo: Investigar as células Th17 periféricas e CD4 + CD25 + Foxp3 + células T reguladoras (Treg e a expressão sérica de citocinas em pacientes com RA. Métodos: De março a maio de 2012, foi coletado o sangue periférico de 14 pacientes com RA (grupo RA e seis indivíduos saudáveis (grupo controle. A detecção das células Th17 e células Treg foi realizada através da citometria de fluxo e os níveis séricos de IL -17 e TGF- β1. Foram medidos por ELISA. Resultados: A percentagem de células Th17 no grupo RA foi bem maior do que no grupo controle (p < 0,01. A proporção de células Treg no grupo RA também foi drasticamente menor quando comparada ao grupo controle (p < 0,01. No grupo RA, o nível sérico de IL-17 foi significativamente maior do que no grupo controle (p < 0,01. Conclusão: O desequilíbrio de células Th17/Treg periféricas desempenha um papel importante na patogênese da RA.

Aspectos clínicos e funcionais do equilíbrio corporal em idosos com vertigem posicional paroxística benigna Clinical and functional aspects of body balance in elderly subjects with benign paroxysmal positional vertigo

Directory of Open Access Journals (Sweden)

Daniela Patricia Vaz

2013-04-01

Full Text Available Vertigem Posicional Paroxística Benigna (VPPB pode alterar o equilíbrio corporal em pacientes idosos. OBJETIVO: Observar os efeitos da manobra de Epley em idosos com VPPB, avaliando os aspectos clínicos e funcionais do equilíbrio corporal. Forma de estudo: clínico e prospectivo. MÉTODO: Após o diagnóstico da doença (teste de DixHallpike, os testes Time Up and Go (TUGT, Clinical test of Sensory Interaction and Balance (CTSIB e o teste de membros inferiores (MMI foram realizados antes e após a manobra de reposicionamento de Epley modificada. RESULTADOS: O gênero feminino foi o mais prevalente e a média etária foi de 70,10 anos (DP = 7,00. Todos os pacientes apresentaram ductolitíase de canal posterior. Os seguintes sintomas melhoraram após a manobra: a instabilidade postural (p = 0,006, náusea e vômito (p = 0,021 e zumbido (p = 0,003. Em relação ao TUGT e o escore do teste de MMII, observou-se diminuição significante do tempo pós-manobra de Epley (p Benign paroxysmal positional vertigo (BPPV may compromise the balance of elderly subjects. OBJECTIVE: To observe the effects of the Epley maneuver in elderly subjects with BPPV and assess clinical and functional aspects of body balance. METHOD: This is a prospective clinical study. Patients diagnosed with BPPV (Dix-Hallpike test were submitted to the Timed Up & Go (TUG test, the Clinical Test of Sensory Interaction and Balance (CTSIB, and lower limb testing before and after they were repositioned using the modified Epley maneuver. RESULTS: Most subjects were females, and the group's mean age was 70.10 years (SD = 7.00. All patients had canalithiasis of the posterior canal. The following symptoms improved after the maneuver: postural instability (p = 0.006, nausea and vomiting (p = 0.021, and tinnitus (p = 0.003. Subjects improved their times significantly in the TUG and lower limb tests after the Epley maneuver (p < 0.001. Patients performed better on the CTSIB after the Epley

Effects of cane girdling on yield, fruit quality and maturation of (Vitis vinifera L. cv. Flame Seedless

Directory of Open Access Journals (Sweden)

Soltekin Oguzhan

2016-01-01

Full Text Available This study was carried out to determine the effects of cane girdling on coloration, maturation, yield and some quality characteristics of Vitis vinifera L. cv. Flame Seedless table grape variety. Cane girdling practices were treated at pea-size stage (G2 and veraison period (G1 over two growing seasons, 2013–2014, at the facility of Manisa Viticultural Research Institute in Turkey. Cane girdling was performed on the canes after first shoot was left from the bottom and 4 mm-wide ring of bark was completely removed with a doubleded knife. On the other hand control vines were left untouched. Statistical analyses showed that TSS, berry length, colour parameters, CIRG index and anthocyanin content of Flame Seedless was significantly affected by the cane girdling treatments in both years, 2013 and 2014. In addition it was detected that any effect of girdling treatments cannot be determined statistically significant on total yield, marketable yield, titrable acidity and 50 berry weight. Total and marketable yields of girdled vines had higher value than control vines although they were not statistically significant. Furthermore it was observed 9 and 12 days earliness with G2 treatments compare to the control vines in 2013 and 2014, respectively.

Aplikasi Ekstrak Hasil Fermentasi Biji Jagung dan Rebung untuk Meningkatkan Mutu Buah Anggur Bali (Vitis vinifera L. var. Alphonso Lavallee

Directory of Open Access Journals (Sweden)

I NYOMAN GEDE ASTAWA

2016-11-01

Full Text Available Applications of Extracts of Fermented Immature Corn Seed and BambooSprout For Improvement of Table grape Quality of Vitis vinifera L. var.Alphonso Lavallee. The objective of the research was to determine the effect ofapplication of extracts of fermented immature corn seed and bamboo sprout for improvementof table grape quality. The research was designed as Completely Randomized Block Design,with five treatments and ten replications. The treatments were K0 (control, J50 (extract offermented immature seed of corn with concentration of 50%, J100 (extract of fermentedimmature seed of corn with concentration of 100%, R50 (extract of fermented bamboo sproutwith concentration of 50% and R100 (extract of fermented bamboo sprout with concentrationof 100%. The results showed that all of the treatments improved sugar content of the fruit.However, the treatment of J100 resulted in the greatest increase of berry number per-bunchand the lowest number of seed per-berry. In conclusion, for improvement of the table grapequality, the treatment of J100 was the most appropriate among other treatments used in thecurrent research.

Physiological behaviors and recovery responses of four galician grapevine (Vitis vinifera L. cultivars under water stress

Directory of Open Access Journals (Sweden)

Islam M. T.

2012-11-01

Full Text Available Gas exchange parameters and chlorophyll fluorescence of four pot grown Galician grapevines (Vitis vinifera L. cv. Albariño, Brancellao, Godello and Treixadura were examined under different levels of water stress in greenhouse. After extreme stress, gas exchange recovery responses were evaluated. Average ΨPD for control and stressed plants were -0.4MPa and -1.45MPa respectively. All varieties showed gradual declining of all gas exchange parameters (gs, E and A with increasing of stress periods. Under stressed conditions, Albariño and Godello showed higher CO2 assimilation rate. At the end of stress period leaf defoliation was found in Albariño and Brancellao. Gas exchange recovery was higher for both Godello and Treixadura. A better response of auxiliary bud recovery was present in Albariño than in Brancellao. Close correlations between water stress and gas exchange parameters were found and it varies on genotype. Albariño, Godello and Treixadura followed same diurnal patterns of gas exchange rate for control and stressed plant respectively. Diurnal pattern of CO2 assimilation rate of all tested varieties followed gs and E. Only Brancellao showed treatment effect on mid-day Fv/Fm. Among four varieties photoinhibition was only found in Brancellao. At stressed condition physiological responses of grapevines were genotype depended.

Effect of maceration duration on physicochemical characteristics, organic acid, phenolic compounds and antioxidant activity of red wine from Vitis vinifera L. Karaoglan.

Science.gov (United States)

Kocabey, N; Yilmaztekin, M; Hayaloglu, A A

2016-09-01

Effects of different maceration times (5, 10 and 15 days) on composition, phenolic compounds and antioxidant activities of red wines made from the Vitis vinifera L. Karaoglan grown in Malatya were investigated. Maceration duration changed some chemical constituents and color of Karaoglan red wines. A linear relationship was observed between antioxidant activity of wine and maceration duration. Major organic acid was tartaric acid which was at the highest concentration in wine macerated for 10 days. A total of 25 phenolic compounds was determined in wine samples. Within these phenolics; procyanidin B2, trans -caftaric acid, gallic acid, trans -caffeic acid, (+) catechin, (-) epicatechin and quercetin-3- O -glucoside were the most abundant phenolics regardless of maceration duration. In general, extended maceration duration resulted in increase in the concentration of phenolic compounds, reflecting the antioxidant activities of wine. In conclusion, the highest concentrations of total and individual phenolic compounds as well as antioxidant activities were found in wines macerated for 15 days.

Histopathological study of response of Vitis vinifera cv. Cabernet Sauvignon to bark and wood injury with and without inoculation by Phaeomoniella chlamydospora

Directory of Open Access Journals (Sweden)

Jérôme POUZOULET

2013-09-01

Full Text Available Summary. Phaeomoniella chlamydospora (Pch is one of the main causal agents of tracheomycosis in grapevine. We characterize how this fungus affects the response of Vitis vinifera cv. Cabernet Sauvignon to bark and xylem-tissue wounding after six weeks post-treatment. A histological investigation shows that, in xylem tissue, cell-wall modifications in response to wounding are related to suberin deposits rather than to lignin-induced wall thickening. The xylem response does not appear to be disturbed by Pch infection. Therefore, cell-wall modification strongly inhibits the development of wound-closure tissue (WCT but does not prevent the differentiation of the necro-phylactic periderm. Hyphae localization in tissue surrounding the wound or inoculation sites indicates that Pch colonizes all cell types, such as vascular tissues, paratracheal parenchyma cells, fibers and rays. The results also suggest that efficient compartmentalization separating fascicular xylem portions is assured by thick suberized cell walls bordering the ray parenchyma.

Relationship between the elemental composition of grapeyards and bioactive compounds in the Cabernet Sauvignon grapes Vitis vinífera harvested in Mexico.

Science.gov (United States)

Acuña-Avila, Pedro Estanislao; Vásquez-Murrieta, María Soledad; Franco Hernández, Marina Olivia; López-Cortéz, Ma Del Socorro

2016-07-15

The red grape Vitis vinífera is an important source of phenolic compounds, which can prevent disease if included as a part of a diet. The levels of these compounds in grapes have been associated with various environmental factors, such as climate, soil composition, and biotic stress. The purpose of this study was to determine the relationship between the elemental compositions of the soil and the grapes and the presence of bioactive compounds, such as catechin, epicatechin, piceid and resveratrol. Ethanol-based extracts of red grapes were used to quantify total and individual phenolic compounds by HPLC. It was observed that the elemental compositions of the soil and the grapes were related to their locations within different wine-producing regions. A principal component analysis showed a relationship between high metal content (Sr, Mn, Si and Pb) and higher concentrations of antioxidants in the grapes. Copyright © 2016 Elsevier Ltd. All rights reserved.

Maturation curves of ‘Tannat’ grape (Vitis vinifera L. for red winemaking/ Curvas de maturação da uva ‘Tannat’ (Vitis vinifera L. para a elaboração de vinho tinto

Directory of Open Access Journals (Sweden)

Werner Genta

2004-05-01

Full Text Available The objetive of this research was to characterize the maturation of ‘Tannat’ grape (Vitis vinifera L. produced in the northwest of Parana state, for red winemaking. The experimental area was established in a commercial vineyard of Vinícola Intervin®, Maringá, PR. The vineyard was planted in August of 2000 and the vines were trained in a pergola system, in a 4.0 x 1.0 m spacing, budded on ‘IAC 766 Campinas’ rootstock. The evaluations started from the winter pruning of 2003. The random design was used as the statistical model with 20 replications and each plot was composed by one tree. The maturation curves of ‘Tannat’ grape were determined through chemical characteristic analysis of berries, such as total soluble solids (TSS, titratable acidity (TA and maturation index (TSS/TA, which were evaluated weekly from early ripening to 7 days after harvest, processing 300 berries per sampling. Through regression analysis, the performance of these chemical characteristics was evaluated over time. It was possible to conclude that: the curves of TSS, TA and TSS/TA were well-fitted to the cubic model and; the ‘Tannat’ grape reached 21.20 oBrix, 1.04% of tartaric acid and 20.38 of maturation index during harvest, what indicates a good performance of this cultivar for red winemaking at the local condition.O trabalho teve como objetivo caracterizar a maturação da videira ‘Tannat’ (Vitis vinifera L. cultivada no norte do Estado do Paraná para a elaboração de vinho tinto. A área experimental foi instalada em uma propriedade comercial pertencente à Vinícola Intervin®, no município de Maringá, PR. O vinhedo foi estabelecido em agosto de 2000 e as plantas foram conduzidas no sistema latada no espaçamento de 4,0 m x 1,5 m, enxertadas sobre o porta-enxerto ‘IAC 766 Campinas’. As avaliações tiveram início a partir da poda de produção, realizada no fim do inverno de 2003. O delineamento experimental foi o inteiramente

Proposta de atuação fisioterapêutica em uma criança com síndrome de Angelman, enfatizando o equilíbrio postural: estudo de caso Propuesta de actuación fisioterapéutica en un niño con Síndrome de Angelman, enfatizando el equilibrio postural: estudio de caso Proposal for a physical therapy program in a child with Angelman syndrome, emphasizing postural balance: a case study

Directory of Open Access Journals (Sweden)

Livia Pessarelli Visicato

2013-03-01

Full Text Available A síndrome de Angelman (SA é caracterizada por alterações neuromotoras como marcha atáxica e atraso na aquisição de habilidades motoras, porém são escassos os estudos investigando o efeito de intervenções aplicadas a essa população. O objetivo do estudo foi verificar o efeito de um treino de equilíbrio em uma criança com SA. Participou do estudo uma criança de nove anos de idade com diagnóstico de SA, sexo feminino. Foi aplicado um protocolo para treino de equilíbrio por oito semanas, com frequência de duas vezes por semana. O treino consistiu em atividades envolvendo equilíbrio estático sob diversas condições de dificuldade. Após o treino, a análise de biofotogrametria computadorizada do equilíbrio estático revelou redução do grau de oscilação, que passou de 38° para 13,78°. A pontuação na escala de Berg passou de 27 pontos, na avaliação, para 37 pontos na reavaliação. No teste Timed Up & Go, a criança realizou a tarefa em 15 segundos, na avaliação, e, na reavaliação, em 12 segundos. Em conjunto, os resultados sugerem que o treino favoreceu melhora no equilíbrio estático e dinâmico, bem como na mobilidade funcional.El síndrome de Angelman (SA es caracterizado por alteraciones neuromotoras como marcha atáxica y atraso en la adquisición de habilidades motoras, pero son escasos los estudios investigando el efecto de intervenciones aplicadas a esta población. El objetivo de este estudio fue verificar el efecto de un entrenamiento del equilibrio en un niño con SA. Participó del estudio un niño de 9 años de edad con diagnóstico de SA, sexo femenino. Fue aplicado un protocolo de entrenamiento para el equilibrio por 8 semanas, con frecuencia de 2 veces por semana. El entrenamiento consistió en actividades involucrando el equilibrio estático sobre diversas condiciones de dificultad. Después del entrenamiento el análisis de biofotogrametría computarizada del equilibrio estático reveló reducci

Ritualnõi skandal / Mark Levin

Index Scriptorium Estoniae

Levin, Mark

2000-01-01

Rakvere teatrifestival "Baltoscandal 2000" : New Yorgi Wyoming Dance Theatre Projecti all tegutseva Pat Creminsi tantsuõhtu, inglase Pit Upponi kehastatud Hitler monotükis "Adolf", Oskaras Korshunovas Theatre, Marius von Mayenburgi "Tule nägu" ("The Face of Fire"), lavastaja Oskaras Korshunovas, jt.

Avaliação do equilíbrio estático de crianças e adolescentes com síndrome de Down Static balance assessment among children and adolescents with Down syndrome

Directory of Open Access Journals (Sweden)

CHZ Meneghetti

2009-06-01

Full Text Available OBJETIVOS: Avaliar o equilíbrio estático de crianças e adolescentes com Síndrome de Down (SD pela Biofotogrametria Computadorizada e verificar a influência da visão nesta situação. MÉTODOS: Participaram 11 crianças e adolescentes com SD e 14 crianças e adolescentes de ambos os gêneros, neurologicamente normais que compuseram o grupo controle. Durante as filmagens, os participantes se mantiveram na posição ortostática com os braços posicionados ao lado do corpo e com os pés paralelos sobre uma superfície plana. As crianças de ambos os grupos foram filmadas na vista anterior (plano frontal e na vista de perfil direito (plano sagital nas condições com visão e sem visão. Nas filmagens na condição de olhos fechados, foram utilizados óculos de natação totalmente vedados, com a finalidade do participante não ter nenhuma informação visual. O instrumento utilizado foi a Biofotogrametria Computadorizada, que serviu como referência angular para verificar as oscilações do corpo em equilíbrio estático. RESULTADOS:As crianças e adolescentes com SD oscilaram mais (pOBJECTIVES: To evaluate static balance and the influence of visual information among children and adolescents with Down Syndrome (DS by means of computerized biophotogrammetry. METHODS: Eleven children and adolescents with DS took part in the study and 14 neurologically normal children and adolescents comprised the control group (both genders. During filming, the subjects remained in the orthostatic position with arms to the side of the body and feet parallel on a flat surface. Both groups were filmed in anterior view (frontal plane and right lateral view (sagittal plane with and without the eyes covered. While being filmed with eyes covered, the subjects wore fully blacked-out swimming goggles to eliminate all visual information. The instrument used was computerized biophotogrammetry, which served as an angular reference for verifying body sway in static stance

Avaliação de sistemas de janela para suporte a decisões de projeto quanto ao equilíbrio de ganhos de luz e calor

Directory of Open Access Journals (Sweden)

Kamila Mendonça de Lima

Full Text Available O projeto de janelas considera os efeitos do meio externo, tais como o ganho de calor solar e a iluminação natural, os quais podem ser conflitantes. Este trabalho avalia o desempenho de diferentes alternativas de sistemas de janela para suporte a decisões de projeto quanto ao equilíbrio de ganhos de luz e calor no ambiente interno, com ênfase no uso de escritório no contexto do clima quente e úmido. Para isso, simulações computacionais integradas utilizando os programas Daysim e EnergyPlus foram realizadas, considerando-se o acionamento das lâmpadas apenas quando a luz natural não é suficiente para atender ao uso do ambiente. Foram variados o percentual de área de abertura, o tipo de vidro e o ângulo de sombreamento, simultaneamente, identificando-se soluções de compromisso quanto aos critérios de disponibilidade e uniformidade da luz e demanda de energia elétrica no ambiente. O controle solar pelo uso de dispositivo de proteção solar apresentou resultados substancialmente melhores que o controle solar apenas pela redução da transmissão da radiação solar do vidro. A avaliação realizada contribui para o aprofundamento da compreensão do impacto de diferentes variáveis de projeto nos fenômenos que caracterizam o desempenho da abertura de uma edificação.

"Tere! Head teatripäeva!" : Rakveres jagati auhindu mulluste teatriteenete eest / Verni Leivak

Index Scriptorium Estoniae

Leivak, Verni, 1966-

2009-01-01

Rakvere Teatris toimunud teatriauhindade jagamisest. Lisatud aastaauhindade laureaadid - Tiit Ojasoo ja Ene-Liis Semper parim lavastus ("Ruja"), Lembit Peterson - lavastaja auhind ("Maarja kuulutamine" ja "Linn"), Maria Peterson ja Laura Peterson - naisnäitleja auhind, Marius Peterson - meesnäitleja auhind, Piret Laurimaa - naiskõrvalosa auhind, Rain Simmul - meeskõrvalosa auhind, Liisi Eelmaa - kunstniku auhind, Ain Saviauk - žürii eriauhind, Valle-Sten Maiste - Reet Neimari kriitikaauhind, Arvo Volmer - muusikalavastuse auhind, Eve Andre - balletilavastuse auhind, Jaan Undusk - algupärase dramaturgia auhind, Marius Peterson - sõnalavastuse muusikalise kujunduse auhind, Tiina Tauraite ja Margus Prangel - Ants Lauteri auhind, Lembit Peterson - Priit Põldroosi auhind, Mart Madiste - Georg Otsa auhind, Sigrid Orusaar - Otto Hermanni auhind, Tiit Härm - Rahel Olbrei auhind, Ene-Liis Semper - Natalie Mei auhind, Jevgeni Ibragimov - Salme Reegi auhind, Margus Alver - Aleksander Kurtna auhind, Toomas Suuman - Karl Adra auhind, Sten Karpov ja Uku Uusberg - Kristallkingakese auhind

Orçamento Público Municipal: Uma Análise no Município de Cosmópolis/SP com Enfoque no Equilíbrio das Receitas X Despesas no Período de 2007 a 2012

Directory of Open Access Journals (Sweden)

Luciano Aparecido dos Santos

2014-08-01

Full Text Available O planejamento em uma organização é necessário para que se tenha uma definição clara dos projetos e atividades que serão desenvolvidos, de acordo com condições pré-estabelecidas, sendo uma das ferramentas mais importantes para realizá-lo a elaboração do orçamento, uma ferramenta gerencial a partir da qual se estabelecem quais as metas que se pretende atingir utilizando-se dos recursos disponíveis. O presente trabalho tem por objetivo analisar a relação entre receitas x despesas, com enfoque no equilíbrio orçamentário objetivando contribuir com a Prefeitura Municipal de Cosmópolis/SP na avaliação de seu planejamento e posterior execução orçamentária, bem como demonstrar a população de que forma a máquina administrativa está sendo gerenciada. A fim de se cumprir o objetivo proposto, foi realizado um estudo de caso sobre o orçamento do referido município com a utilização de investigação bibliográfica e documental. O texto apresenta a discussão sobre a estrutura orçamentária no Brasil, bem como as fases do processo orçamentário. Abordou-se a relação entre receita, despesa e o equilíbrio orçamentário seguido do estudo evolutivo das receitas e despesas do município referente aos anos de 2007 a 2012 e da utilização de quocientes do Balanço Orçamentário. Através da análise dos quocientes obtidos evidencia-se que as receitas arrecadadas nos anos de 2007, 2008 e 2011 superaram as despesas executadas, resultando em um superávit orçamentário. Entretanto, nos anos de 2009, 2010 e 2012 houve uma inversão, sendo as despesas realizadas superiores às receitas arrecadadas, o que ocasionou um déficit orçamentário. Dessa forma, torna-se clara a importância que o acompanhamento destes indicadores possui, uma vez que proporciona aos gestores melhores condições de acompanhamento no que se refere a um processo avaliativo e decisorial mais acurado perante a sociedade local.

USO DA EQUAÇÃO DE ESTADO DE PENG-ROBINSON COM REGRA DE MISTURA DEPENDENTE DA COMPOSIÇÃO NA PREDIÇÃO DO EQUILÍBRIO DE FASES DO SISTEMA TERNÁRIO CO2-LIMONENO-CITRAL

Directory of Open Access Journals (Sweden)

Alessandra Lopes de OLIVEIRA

1997-12-01

Full Text Available Dados de equilíbrio de fases a pressões elevadas dos sistemas binários CO2-Limoneno e CO2-Citral e do sistema ternário CO2-Limoneno-Citral foram coletados da literatura e usados na modelagem termodinâmica que emprega a equação de estado de PENG-ROBINSON [1] com: 1 Regra de mistura clássica; 2 Regra de mistura dependente da composição de STRYJEK & VERA [2]. Os parâmetros de interação binária entre CO2-Limoneno e CO2-Citral foram obtidos pelo ajuste dos modelos a dados experimentais, fazendo uso de dois programas computacionais, os quais envolvem a minimização de uma função objetivo, pelo método Simplex de NELDER & MEAD (3, que foi escrita em termos dos desvios relativos entre os pontos experimentais e os calculados pelos modelos. O equilíbrio de fases do sistema ternário foi calculado utilizando-se os parâmetros de interação binária ajustados previamente e considerando parâmetros nulos entre os componentes Limoneno e Citral. A análise dos resultados indica, para as condições supercríticas, que os dois modelos foram capazes de predizer qualitativamente o sistema ternário, fornecendo resultados compatíveis, em ordem de grandeza, com os valores experimentais.Phase equilibrium data at high pressures for CO2-Limonene and CO2-Citral binary systems and for CO2-Limonene-Citral ternary systems were collected from literature and employed in a thermodynamic modelling that uses the PENG-ROBINSON equation of state with: (1 classical mixture rule; (2 STRYJEK & VERA composition dependant mixture rule. The binary interaction parameters for the CO2-Limonene and CO2-Citral systems were obtained by fitting the models to the experimental data using two computational programmes that involved the minimisation of an objective function by the simplex method as suggested by NELDER & MEAD, written as a function of the deviation between experimental and calculated data. The phase equilibrium for the ternary systems was calculated using the

Effect of grapevine latent buds (Vitis vinifera L., cv. Merlot chilling on their starch content: biochimical and cytological approachs

Directory of Open Access Journals (Sweden)

Tayeb Koussa

2001-12-01

Full Text Available Biochimical analysis and photonic microscopy observations of starch were investigated in latent buds of Vitis vinifera L. (cv. Merlot collected during their dormancy phase and during their cold storage at 2°C. Biochimical analysis showed that starch levels of grapevine latent buds was high (70 mg/g DW. Microscopical observations confirmed this result and showed a gradient of starch content in different regions of bud in which the foliars primordiums and scales were the starch richer. Buds conservation at 2°C reduced their starch content but this decrease begun only after 9 days of chilling corresponding to the time necessary for budbreak and for the beginning of increase the bud burst ability. The hydrolysis of starch seems begun at the first in apex and then propaged to the other regions of bud. In the scales, the most exposed region to cold, storage at 2°C during 56 days induced an increase of cellular tannins content and cell walls polysaccharides. These results were discuted in relation to the increase of bud burst ability and to their cold acclimatation.

Unsaponifiable fraction isolated from grape (Vitis vinifera L.) seed oil attenuates oxidative and inflammatory responses in human primary monocytes.

Science.gov (United States)

Millan-Linares, Maria C; Bermudez, Beatriz; Martin, Maria E; Muñoz, Ernesto; Abia, Rocio; Millan, Francisco; Muriana, Francisco J G; Montserrat-de la Paz, Sergio

2018-04-25

Grape (Vitis vinifera L.) seed has well-known potential for production of oil as a byproduct of winemaking and is a rich source of bioactive compounds. Herein, we report that the unsaponifiable fraction (UF) isolated from grape seed oil (GSO) possesses anti-oxidative and anti-inflammatory properties towards human primary monocytes. The UF isolated from GSO was phytochemically characterized by GC-MS and HPLC. Freshly obtained human monocytes were used to analyse the effects of GSOUF (10-100 μg mL-1) on oxidative and inflammatory responses using FACS analysis, RT-qPCR, and ELISA procedures. GSOUF skewed the monocyte plasticity towards the anti-inflammatory non-classical CD14+CD16++ monocytes and reduced the inflammatory competence of LPS-treated human primary monocytes diminishing TNF-α, IL-1β, and IL-6 gene expression and secretion. In addition, GSOUF showed a strong reactive oxygen species (ROS)-scavenging activity, reducing significantly nitrite levels with a significant decrease in Nos2 gene expression. Our results suggest that the UF isolated from GSO has significant potential for the management of inflammatory and oxidative conditions and offer novel benefits derived from the consumption of GSO in the prevention of inflammation-related diseases.

Remote compositional analysis of lunar olivine-rich lithologies with Moon Mineralogy Mapper (M3) spectra

Science.gov (United States)

Isaacson, P.J.; Pieters, C.M.; Besse, S.; Clark, R.N.; Head, J.W.; Klima, R.L.; Mustard, J.F.; Petro, N.E.; Staid, M.I.; Sunshine, J.M.; Taylor, L.A.; Thaisen, K.G.; Tompkins, S.

2011-01-01

A systematic approach for deconvolving remotely sensed lunar olivine-rich visible to near-infrared (VNIR) reflectance spectra with the Modified Gaussian Model (MGM) is evaluated with Chandrayaan-1 Moon Mineralogy Mapper (M 3) spectra. Whereas earlier studies of laboratory reflectance spectra focused only on complications due to chromite inclusions in lunar olivines, we develop a systematic approach for addressing (through continuum removal) the prominent continuum slopes common to remotely sensed reflectance spectra of planetary surfaces. We have validated our continuum removal on a suite of laboratory reflectance spectra. Suites of olivine-dominated reflectance spectra from a small crater near Mare Moscoviense, the Copernicus central peak, Aristarchus, and the crater Marius in the Marius Hills were analyzed. Spectral diversity was detected in visual evaluation of the spectra and was quantified using the MGM. The MGM-derived band positions are used to estimate the olivine's composition in a relative sense. Spectra of olivines from Moscoviense exhibit diversity in their absorption features, and this diversity suggests some variation in olivine Fe/Mg content. Olivines from Copernicus are observed to be spectrally homogeneous and thus are predicted to be more compositionally homogeneous than those at Moscoviense but are of broadly similar composition to the Moscoviense olivines. Olivines from Aristarchus and Marius exhibit clear spectral differences from those at Moscoviense and Copernicus but also exhibit features that suggest contributions from other phases. If the various precautions discussed here are weighed carefully, the methods presented here can be used to make general predictions of absolute olivine composition (Fe/Mg content). Copyright ?? 2011 by the American Geophysical Union.

Mälestusmärk iseendale / Rein Veidemann

Index Scriptorium Estoniae

Veidemann, Rein, 1946-

2009-01-01

Lembit Petersonist ja tema lavastusest "Maarja kuulutamine", mille eest ta pälvis aastapreemia ja osatäitmiste eest samas lavastuses said aasta naisnäitlejapreemiad tema tütred Maria ja Laura Peterson. Poeg Marius Peterson sai preemia osatäitmise eest lavastuses "Linn"

Fentes labiopalatines dans la province du Katanga en République ...

African Journals Online (AJOL)

Fentes labiopalatines dans la province du Katanga en République Démocratique du Congo: Aspects épidémiologiques, anatomocliniques et thérapeutiques. Cedrick Milindi Sangwa, Olivier Mukuku, Christian Tshisuz, Jules Mulefu Panda, Mireille Kakinga, Marius Feruzi Kitembo, Jean-Felix Mutomb, Bwana Fwamba ...

A candidate gene association study on muscat flavor in grapevine (Vitis vinifera L.

Directory of Open Access Journals (Sweden)

Boursiquot Jean-Michel

2010-11-01

Full Text Available Abstract Background The sweet, floral flavor typical of Muscat varieties (Muscats, due to high levels of monoterpenoids (geraniol, linalool and nerol, is highly distinct and has been greatly appreciated both in table grapes and in wine since ancient times. Muscat flavor determination in grape (Vitis vinifera L. has up to now been studied by evaluating monoterpenoid levels through QTL analysis. These studies have revealed co-localization of 1-deoxy-D-xylulose 5-phosphate synthase (VvDXS with the major QTL positioned on chromosome 5. Results We resequenced VvDXS in an ad hoc association population of 148 grape varieties, which included muscat-flavored, aromatic and neutral accessions as well as muscat-like aromatic mutants and non-aromatic offsprings of Muscats. Gene nucleotide diversity and intragenic linkage disequilibrium (LD were evaluated. Structured association analysis revealed three SNPs in moderate LD to be significantly associated with muscat-flavored varieties. We identified a putative causal SNP responsible for a predicted non-neutral substitution and we discuss its possible implications for flavor metabolism. Network analysis revealed a major star-shaped cluster of reconstructed haplotypes unique to muscat-flavored varieties. Moreover, muscat-like aromatic mutants displayed unique non-synonymous mutations near the mutated site of Muscat genotypes. Conclusions This study is a crucial step forward in understanding the genetic regulation of muscat flavor in grapevine and it also sheds light on the domestication history of Muscats. VvDXS appears to be a possible human-selected locus in grapevine domestication and post-domestication. The putative causal SNP identified in Muscat varieties as well as the unique mutations identifying the muscat-like aromatic mutants under study may be immediately applied in marker-assisted breeding programs aimed at enhancing fragrance and aroma complexity respectively in table grape and wine cultivars.

Reabilitação vestibular e qualidade de vida em idosos com queixa de tontura

OpenAIRE

Paz-Oliveira, Andréa

2012-01-01

INTRODUÇÃO: As alterações do equilíbrio corporal, clinicamente caracterizadas como tontura, vertigem, desequilíbrio e queda, estão entre as queixas mais comuns da população idosa. O envelhecimento compromete a habilidade do sistema nervoso central em realizar o processamento dos sinais vestibulares, visuais e proprioceptivos responsáveis pela manutenção do equilíbrio corporal, bem como diminui a capacidade de modificações dos reflexos adaptativos. Esses processos degenerativos ...

Assessment of (poly)phenols in grape (Vitis vinifera L.) stems by using food/pharma industry compatible solvents and Response Surface Methodology.

Science.gov (United States)

Domínguez-Perles, R; Teixeira, A I; Rosa, E; Barros, A I

2014-12-01

A Box-Behnken design of Response Surface Methodology (RSM) was conducted to analyse the effect of time (10-30 min), temperature (25-95°C), and solvents concentration (5-90%) on the extraction of total phenolics, flavonoids, ortho-diphenols, and anthocyanins as well as to assess the ABTS(+) scavenging capacity, which were considered as response variables. Values coefficients of determination (R(2)), ranging from 0.903 to 0.996, fitted for describing efficient extraction of bioactive (poly)phenols and antioxidant activity. The recorded data allowed to establish the optimal extraction conditions at 23.0 min, 95.0°C, and 57.9% of food-quality ethanol/water for Vitis vinifera L. var. 'Viosinho' (white variety), and 23.4 min, 84.2°C, and 63.8% for var. 'Touriga Nacional' (red variety). The achievement of optimal extraction conditions of phenolics from grape stems using solvents compatible with further uses in food/pharma industries demonstrated that RSM constitutes a powerful tool for deriving optimal conditions for extraction of antioxidant phenolic compounds from grape stems. Copyright © 2014 Elsevier Ltd. All rights reserved.

Relationships between harvest time and wine composition in Vitis vinifera L. cv. Cabernet Sauvignon 2. Wine sensory properties and consumer preference.

Science.gov (United States)

Bindon, Keren; Holt, Helen; Williamson, Patricia O; Varela, Cristian; Herderich, Markus; Francis, I Leigh

2014-07-01

A series of five Vitis vinifera L. cv Cabernet Sauvignon wines were produced from sequentially-harvested grape parcels, with alcohol concentrations between 12% v/v and 15.5% v/v. A multidisciplinary approach, combining sensory analysis, consumer testing and detailed chemical analysis was used to better define the relationship between grape maturity, wine composition and sensory quality. The sensory attribute ratings for dark fruit, hotness and viscosity increased in wines produced from riper grapes, while the ratings for the attributes red fruit and fresh green decreased. Consumer testing of the wines revealed that the lowest-alcohol wines (12% v/v) were the least preferred and wines with ethanol concentration between 13% v/v and 15.5% v/v were equally liked by consumers. Partial least squares regression identified that many sensory attributes were strongly associated with the compositional data, providing evidence of wine chemical components which are important to wine sensory properties and consumer preferences, and which change as the grapes used for winemaking ripen. Copyright © 2014 Elsevier Ltd. All rights reserved.

Volatile components of vine leaves from two Portuguese grape varieties (Vitis vinifera L.), Touriga Nacional and Tinta Roriz, analysed by solid-phase microextraction.

Science.gov (United States)

Fernandes, Bruno; Correia, Ana C; Cosme, Fernanda; Nunes, Fernando M; Jordão, António M

2015-01-01

The purpose of this work was to study the volatile composition of vine leaves and vine leaf infusion prepared from vine leaves collected at 30 and 60 days after grape harvest of two Vitis vinifera L. species. Eighteen volatile compounds were identified by gas chromatography-mass spectrometry in vine leaves and in vine leaf infusions. It was observed that the volatile compounds present in vine leaves are dependent on the time of harvest, with benzaldehyde being the major volatile present in vine leaves collected at 30 days after harvesting. There are significant differences in the volatile composition of the leaves from the two grape cultivars, especially in the sample collected at 60 days after grape harvest. This is not reflected in the volatile composition of the vine leaf infusion made from this two cultivars, the more important being the harvesting date for the volatile profile of vine leaf infusion than the vine leaves grape cultivar.

Aumento da oferta e redução de impostos nos serviços de infra-estrutura na economia brasileira: uma abordagem de equilíbrio geral

Directory of Open Access Journals (Sweden)

Maria Aparecida Silva Oliveira

2009-09-01

Full Text Available A baixa qualidade da infra-estrutura e a elevada carga tributária que incide sobre esses setores oneram a utilização de seus serviços. O objetivo desta pesquisa é analisar os impactos do aumento na oferta de infra-estrutura e da redução nos impostos sobre seus serviços na economia brasileira. Foi utilizado um Modelo Aplicado de Equilíbrio Geral. Essas políticas proporcionariam crescimento da atividade agregada e ganhos de competitividade. O crescimento da renda e os ganhos de competitividade levariam ao crescimento das exportações; elevação na remuneração aos fatores, ocasionando elevação na renda das famílias e nos investimentos; e aumento na receita do governo e no PIB, além dos ganhos de utilidade pelos consumidores.Low quality of infrastructure and high tax burden on those sectors make more expensive their services. The purpose of this paper is to analyze the impacts of the increase in the supply of infrastructure services, and taxes reduction on those services on the Brazilian economy. A General Equilibrium Model was used to run the simulations. Those polices would increase sectors competitiveness and economic growth. Also, exports and factors remuneration would increase, causing elevation in the families' income and investments. Government tax collection, GDP, and consumer utility would increase in the scenarios where infrastructure service expansion and tax reduction are simulated.

Iron Supply Affects Anthocyanin Content and Related Gene Expression in Berries of Vitis vinifera cv. Cabernet Sauvignon.

Science.gov (United States)

Shi, Pengbao; Li, Bing; Chen, Haiju; Song, Changzheng; Meng, Jiangfei; Xi, Zhumei; Zhang, Zhenwen

2017-02-14

Anthocyanins are important compounds for red grape and red wine quality, and can be influenced by supply of nutrients such as nitrogen, phosphorus, potassium, zinc, and iron. The present work aims to gain a better understanding of the effect of iron supply on anthocyanins concentration in grape berries. To this end, own-rooted four-year-old Cabernet Sauvignon grapevines ( Vitis vinifera ) were fertigated every three days with 0, 23, 46, 92, and 184 μM iron (Fe) from ferric ethylenediamine di ( o -hydroxyphenylacetic) acid (Fe-EDDHA) in a complete nutrient solution. Fe deficiency or excess generally led to higher concentrations of titratable acidity and skin/berry ratio, and to lower reducing sugar content, sugar/acid ratio, pH, berry weight, and concentration of anthocyanins. Most of the individual anthocyanins detected in this study, except cyanidin-3- O -glucoside, delphinidin-3- O -glucoside, and cyanidin-3- O -(6- O -coumaryl)-glucoside, in moderate Fe treatment (46 μM) grapes were significantly higher than those of other treatments. Genes encoding chalcone isomerase (CHI), flavanone 3-hydroxylase (F3H), leucoanthocyanidin dioxygenase (LDOX), and anthocyanin O -methyltransferase (AOMT) exhibited higher transcript levels in berries from plants cultivated with 46 μM Fe compared to the ones cultivated with other Fe concentrations. We suggest that grape sugar content, anthocyanins content, and transcriptions of genes involved in anthocyanin biosynthesis were correlated with Fe supply concentrations.

Biochemical and proteomic analysis of grape berries (Vitis labruscana) during cold storage upon postharvest salicylic acid treatment.

Science.gov (United States)

Cai, Han; Yuan, Xiaozhuan; Pan, Jiaojiao; Li, Huan; Wu, Ziming; Wang, Yun

2014-10-15

Salicylic acid (SA) treatment has been widely used to maintain fruit quality during postharvest storage. To elucidate the molecular mechanism related to this treatment, the effect of SA treatment on fruit quality as well as protein expression profiles of grape berries (Vitis labruscana cv. Kyoho) during the subsequent cold storage was evaluated. As expected, SA treatment inhibited postharvest loss and chilling damage by reducing fruit softening and membrane damage and slowing weight loss. A gel-based proteomic approach was designed to screen for differentially expressed proteins in SA-treated and control grape berries. A total of 69 differentially accumulated proteins were successfully identified by matrix-assisted laser desorption/ionization time-of-flight (MALDI-TOF) mass spectrometry, which can be functionally classified into eight categories. Among these proteins, antioxidant enzymes including ascorbate peroxidase, oxidoreductase, and glutathione S-transferase were induced, and the abundances of several defense-related proteins, such as heat shock protein (HSP) and temperature-induced lipocalin, were up-regulated by SA treatment. In addition, proteins involved in carbohydrate catabolism and energy production were also induced by SA treatment. Interpretation of the data for differential accumulation of proteins revealed that the effect of SA on reducing postharvest losses and chilling damage of grape berries during cold storage may be due to activated defense responses and carbohydrate metabolism and higher levels of energy status.

Color, anthocyanin, and antioxidant characteristics of young wines produced from spine grapes (Vitis davidii Foex) in China

Science.gov (United States)

Han, Fuliang; Ju, Yanlun; Ruan, Xianrui; Zhao, Xianfang; Yue, Xiaofeng; Zhuang, Xifu; Qin, Minyang; Fang, Yulin

2017-01-01

ABSTRACT Background: Spine grape has gained attention in the field of wine science due to its good growth characteristics. Spine grape wine has been made by local residents for a long time. However, the scientific evaluation of spine wine has not been systemically documented compared to Vitis vinifera grape wines Methods: We compared 11 spine wines from south China (W1–W11) with 7 high-quality international wines (W12–W18). The total phenolic content, the total anothcyanin content and the antioxidant activity of these wines were analyzed and compared. Meanwhile, anthocyanin profiles of these wines were also documented. Results: Compared with other wines most of the spine wines had a strong red intensity with a blue hue. Malvidin-3,5-O-diglucoside and malvidin-3-O-(6-O-coumaroyl)-glucoside-5-glucoside appeared to be the major anthocyanins in these wines. The scavenging capacity analyses of these wines using ABTS, DPPH, and CUPRAC assays indicated that spine wines possessed high antioxidant properties, especially spine wine W3, W4, W6 and W8. Their high antioxidant properties were mainly related to the high levels of the total phenolic content and anthocyanins. Conclusion: These results suggested that spine wine might be considered a good wine source for the Chinese wine industry and provided useful information on the knowledge of spine grape. PMID:28804435

Color, anthocyanin, and antioxidant characteristics of young wines produced from spine grapes (Vitis davidii Foex) in China.

Science.gov (United States)

Han, Fuliang; Ju, Yanlun; Ruan, Xianrui; Zhao, Xianfang; Yue, Xiaofeng; Zhuang, Xifu; Qin, Minyang; Fang, Yulin

2017-01-01

Background : Spine grape has gained attention in the field of wine science due to its good growth characteristics. Spine grape wine has been made by local residents for a long time. However, the scientific evaluation of spine wine has not been systemically documented compared to Vitis vinifera grape wines Methods : We compared 11 spine wines from south China (W1-W11) with 7 high-quality international wines (W12-W18). The total phenolic content, the total anothcyanin content and the antioxidant activity of these wines were analyzed and compared. Meanwhile, anthocyanin profiles of these wines were also documented. Results : Compared with other wines most of the spine wines had a strong red intensity with a blue hue. Malvidin-3,5- O -diglucoside and malvidin-3- O -(6- O -coumaroyl)-glucoside-5-glucoside appeared to be the major anthocyanins in these wines. The scavenging capacity analyses of these wines using ABTS, DPPH, and CUPRAC assays indicated that spine wines possessed high antioxidant properties, especially spine wine W3, W4, W6 and W8. Their high antioxidant properties were mainly related to the high levels of the total phenolic content and anthocyanins. Conclusion : These results suggested that spine wine might be considered a good wine source for the Chinese wine industry and provided useful information on the knowledge of spine grape.

The Modulatory Role of Vitis vinifera in Oxidative Stress and Carbohydrate Metabolism of Irradiated Rats

International Nuclear Information System (INIS)

El Tahawy, N.A.; Salama, S.F.; Ashry, O.M.

2008-01-01

Proanthocyanidins are naturally occurring antioxidants found in grape seed extract (GSPE) of Vitis vinifera. The present study aims at assessing the protective effects of GSPI against free radicals induced by ionizing radiation on the antioxidant status, the process of carbohydrate metabolism, and some hematological parameters in adult rats. Catalase (CAT) activity and reduced glutathione (GSH) concentration along with lipid peroxidation measured as thiobarbituric acid reactive substances (TBARS) were determined in liver and muscle tissues, The activity of glucose-6)-phosphatase was determined in liver tissues and glucose level in serum. Erythrocytes count (RBCs), hemoglobin content (Hb) and haematocrit value (Hct %) were also determined. Rats received daily GSPE by gavage in concentration of 100 mg/Kg body weight for 15 consecutive days before exposure to 5 Gy dose of whole body gamma irradiation. The experimental investigations were carried out on the second and third weeks post irradiation.The results indicate that ingestion of GSPE is safe and had no significant effect on the levels of the parameters studied. Exposure to radiation produced a significant decrease in CAT activity and GSH content along with significant increase of TEARS levels in liver and muscle tissues. Liver glucose-6-phosphatase activity increased 2 and 3 weeks post irradiation concomitant with a significant increase of serum glucose level. Blood RBCs, Hb and Hct levels were significantly depressed. Administration of GSPE ameliorated the severity of changes in all the parameters measured. It could be concluded that proanthocyanidins might play a considerable role in ameliorating the radiation induced changes in antioxidant status and carbohydrate metabolites

Diversity of Aspergillus section Nigri on the surface of Vitis labrusca and its hybrid grapes.

Science.gov (United States)

Ferranti, Larissa de Souza; Fungaro, Maria Helena P; Massi, Fernanda Pelisson; Silva, Josué José da; Penha, Rafael Elias Silva; Frisvad, Jens Christian; Taniwaki, Marta Hiromi; Iamanaka, Beatriz Thie

2018-03-02

This study investigated the presence of Aspergillus species belonging to Aspergillus section Nigri on Vitis labrusca and its hybrid grapes grown in Brazil. The ability of the fungi isolates to produce ochratoxin A (OTA) and fumonisin B 2 (FB 2 ) as well as the presence of these mycotoxins in the grapes were also studied. Eighty-eight samples were collected from the main grape producing states in Brazil: Rio Grande do Sul (n=30), Pernambuco (n=21), São Paulo (n=21) and Paraná (n=16). The highest average contamination level by A. section Nigri occurred on the grapes from Pernambuco (66.3%). A total of 2042 A. section Nigri isolates was analyzed and clustered in three groups according to morphology characterization: A. section Nigri uniseriate (79.3%), A. niger "aggregate" (18.3%) and A. carbonarius (2.4%). In order to precisely identify the Aspergillus species, two hundred and forty-eight strains were subjected to DNA sequencing. Among the A. section Nigri uniseriate group, the following species were found: A. japonicus, A. uvarum, A. brunneoviolaceus, A. aculeatus and A. labruscus. Within the A. niger "aggregate", the following species were found: A.niger sensu stricto, A. welwitschiae and A. vadensis. Regarding mycotoxin-production capacity, 3.2% of the total A. section Nigri isolates (2042) were positive for OTA production and from A. niger "aggregate" (373) tested, 42.1% were FB 2 producers. However, none of the 88 grape samples were contaminated with these mycotoxins. Copyright © 2017. Published by Elsevier B.V.

Meie skandaalitsesime ka! Jaanipäeval võttis MM suuna teatrifestivalile "Baltoscandal" / Anu Aaremäe, Tiiu Suvi

Index Scriptorium Estoniae

Aaremäe, Anu

2000-01-01

Meeldejäävaimaid "teatripärleid" Rakvere teatrifestivalilt "Baltoscandal 2000" : Oskaras Korshunovas Theatre, Marius von Mayenburgi "Tule nägu" ("The Face of Fire"), lavastaja O. Korshunovas, Pit Uttoni ühemehetükk "Adolf", Sasha Pepeljajevi trupi "One Second Hand" ja poola "Moisture", lavastaja Madzik Leszek

Proceedings – Mathematical Sciences | Indian Academy of Sciences

Indian Academy of Sciences (India)

Under additional hypotheses on we deduce the existence of solutions if is unbounded. Author Affiliations. Marius Ghergu1 Constantin Niculescu1 Vicenţiu Rădulescu1. Department of Mathematics, University of Craiova, 1100 Craiova, Romania. Dates. Manuscript received: 22 February 2002; Manuscript revised: 23 May ...

Jasmonic acid-isoleucine formation in grapevine (Vitis vinifera L.) by two enzymes with distinct transcription profiles.

Science.gov (United States)

Böttcher, Christine; Burbidge, Crista A; di Rienzo, Valentina; Boss, Paul K; Davies, Christopher

2015-07-01

The plant hormone jasmonic acid (JA) is essential for stress responses and the formation of reproductive organs, but its role in fruit development and ripening is unclear. Conjugation of JA to isoleucine is a crucial step in the JA signaling pathway since only JA-Ile is recognized by the jasmonate receptor. The conjugation reaction is catalyzed by JA-amido synthetases, belonging to the family of Gretchen Hagen3 (GH3) proteins. Here, in vitro studies of two grapevine (Vitis vinifera L. cv Shiraz) GH3 enzymes, VvGH3-7 and VvGH3-9, demonstrated JA-conjugating activities with an overlapping range of amino acid substrates, including isoleucine. Expression studies of the corresponding genes in grape berries combined with JA and JA-Ile measurements suggested a primary role for JA signaling in fruit set and cell division and did not support an involvement of JA in the ripening process. In response to methyl JA (MeJA) treatment, and in wounded and unwounded (distal) leaves, VvGH3-9 transcripts accumulated, indicating a participation in the JA response. In contrast, VvGH3-7 was unresponsive to MeJA and local wounding, demonstrating a differential transcriptional regulation of VvGH3-7 and VvGH3-9. The transient induction of VvGH3-7 in unwounded, distal leaves was suggestive of the involvement of an unknown mobile wound signal. © 2014 Institute of Botany, Chinese Academy of Sciences.

Expression of putative expansin genes in phylloxera (Daktulosphaira vitifoliae Fitch) induced root galls of Vitis spp.

Science.gov (United States)

Lawo, N C; Griesser, M; Forneck, A

Grape phylloxera ( Daktulosphaira vitifoliae Fitch) is a serious global pest in viticulture. The insects are sedentary feeders and require a gall to feed and reproduce. The insects induce their feeding site within the meristematic zone of the root tip, where they stay attached, feeding both intra- and intercellularly, and causing damage by reducing plant vigour. Several changes in cell structure and composition, including increased cell division and tissue swelling close to the feeding site, cause an organoid gall called a nodosity to develop. Because alpha expansin genes are involved in cell enlargement and cell wall loosening in many plant tissues it may be anticipated that they are also involved in nodosity formation. To identify expansin genes in Vitis vinifera cv. Pinot noir , we mined for orthologues genes in a comparative analysis. Eleven putative expansin genes were identified and shown to be present in the rootstock Teleki 5C ( V. berlandieri Planch. x V. riparia Michx.) using specific PCR followed by DNA sequencing. Expression analysis of young and mature nodosities and uninfested root tips were conducted via quantitative real time PCR (qRT-PCR). Up-regulation was measured for three putative expansin genes (VvEXPA15, -A17 and partly -A20) or down-regulation for three other putative genes (VvEXPA7, -A12, -A20) in nodosities. The present study clearly shows the involvement of putative expansin genes in the phylloxera-root interaction.

Expressão transiente do gene gus, sob regulação de quatro promotores, em diferentes tecidos de mamoeiro (Carica papaya L. e videira (Vitis sp. Transient expression of the gus gene, under the regulation of four promoters, on different tissues of papaya (Carica papaya l. and grape (Vitis sp.

Directory of Open Access Journals (Sweden)

Adelar Almeida Pinto

2002-12-01

Full Text Available O mamoeiro (Carica papaya L. e a videira (Vitis vinifera L. destacam-se entre as fruteiras produzidas no Brasil por serem plantadas em quase todo o território nacional e apresentarem importância econômica e social. A tecnologia de produção de organismos geneticamente modificados, também conhecidos como "transgênicos", tem grande potencial de uso no desenvolvimento de fruteiras melhoradas. Porém, questões de propriedade intelectual limitam o uso da engenharia genética por países em desenvolvimento, que normalmente não detêm direitos sobre processos ou produtos necessários ao uso desta. Neste contexto, o presente estudo buscou avaliar promotores de expressão gênica alternativos ao CaMV 35S, que é o mais utilizado no desenvolvimento de transgênicos, mas é patenteado. Para tanto, construções gênicas com o gene gus sob a regulação de diferentes promotores foram testadas para expressão transiente em diversos tecidos de mamoeiro e videira. Expressão transiente foi avaliada em embriões somáticos, folhas, caules, raízes e frutos. O promotor do gene UBQ3, que é constitutivo e se encontra em domínio publico, mostrou ser uma alternativa promissora para futuros trabalhos de transformação genética de mamoeiro, mas não de videira.Papaya (Carica papaya L. and grapes (Vitis vinifera L. are among the most important fruit crops produced in Brazil, and are cultivated in several regions around the country being of economical and social importance. Genetic engineering has great potential on the development of genetically improved fruit crops. However, intellectual property issues constantly limit the commercial use of this technology in developing countries. Thus, the present study aimed to evaluate gene promoters as alternatives to the 35S CaMV, which is the most used so far in the development of transgenic plants, but it is patented. In order to do that, the expression of the gus gene under the regulation of distinct promoters was

Resistência induzida em frutos de videira 'Isabel' (Vitis Labrusca e seus efeitos sobre a qualidade pós-colheita Induced resistance in fruits of 'Isabel' vine (Vitis labrusca and its effects on post-harvest quality

Directory of Open Access Journals (Sweden)

Kedma Maria Silva Pinto

2013-03-01

Full Text Available A indução de resistência tem sido apontada como alternativa sustentável para o manejo de doenças, mas pouco se sabe sobre a interferência de tais produtos na qualidade pós-colheita dos frutos. Assim, o presente trabalho tem por objetivo avaliar a produção e a maturação de frutos de videira 'Isabel' (Vitis labrusca, oriundos de plantas tratadas com elicitores de resistência, em Natuba-PB. Os experimentos foram realizados nos períodos de setembro de 2009 a janeiro de 2010 (safra 1 e de fevereiro a junho de 2010 (safra 2. Foram utilizados oito tratamentos (Testemunha; Fungicida (Metiram + Piraclostrobina; Fosfito de potássio; Agro-Mós®; Fungicida + Fosfito de potássio; Fungicida + Agro-Mós®; Fosfito de potássio + Agro-Mós® e Fungicida + Fosfito de potássio + Agro-Mós® e quatro repetições de 5 plantas. As aplicações foram realizadas a cada 10 dias, iniciando-se 20 dias após a poda, totalizando 12 aplicações. As coletas de frutos foram realizadas aos 45; 60;90 e 120 dias após a poda. As variáveis analisadas foram: massa dos cachos, comprimento e diâmetro dos cachos, rendimento de polpa, sólidos solúveis (SS, pH, acidez titulável (AT e relação SS/AT. O tratamento com fosfito de potássio promoveu o aumento de 24% no comprimento dos cachos, em relação à testemunha, na primeira safra. O rendimento de polpa e a relação SS/AT não foram influenciados pelos tratamentos, e o teor de sólidos solúveis foi influenciado positivamente pela aplicação de fosfito de potássio, com incrementos superiores a 60%, em ambas as safras avaliadas.Induction of resistance has been identified as a sustainable alternative for disease management, but little information is known about the interference of such products in the postharvest fruit. Thus, the present study aims to evaluate the production and ripening of grapes 'Isabel' (Vitis labrusca from plants treated with resistance elicitors in Natuba-PB, Brazil. The experiments

Equilíbrio e retração muscular em jovens estudantes usuárias de calçado de salto alto Equilibrium and muscle retraction in young female students users of high-heeled shoes

Directory of Open Access Journals (Sweden)

Dernival Bertoncello

2009-06-01

Full Text Available Verifica-se precocidade na utilização de calçado de salto alto, mas não há muitos estudos identificando suas conseqüências. O objetivo deste trabalho foi verificar alterações de equilíbrio e eventual retração muscular em estudantes universitárias habituadas a utilizar salto alto diariamente. Foram avaliadas 30 jovens (média de 20 anos de idade que anotaram, durante duas semanas, o tempo diário em que permaneciam com o calçado. Foram avaliadas quanto a desvios posturais, quanto às retrações musculares da cadeia posterior, pelo teste de alcance horizontal, e quanto ao equilíbrio, pelo teste de Romberg. Os resultados foram analisados estatisticamente. A média de estatura foi 1,63 m e a de massa corporal, 58,5 kg. O tempo médio de uso dos sapatos de salto alto foi de 34 h por semana. Ao relacionar o alcance horizontal com o tempo semanal de uso do salto alto, verificou-se forte correlação negativa (r=-0,8692; pPrecocity has been noticed in the use of high-heeled shoes. However, there are not many studies on its consequences. The aim of this work was to search for equilibrium alterations in young women used to daily wearing high-heeled shoes. Thirty female undergraduates (mean aged 20 years old were asked to write down, for two weeks, the number of hours per day they remained with the shoes on. They were then assessed as to posture deviations, as to muscle retractions of the posterior chain by means of the sit and reach test, and as to equilibrium by the Romberg test. Results were statistically analysed. Mean volunteers' height was 1.63 m and mean body mass, 58.5 kg. A negative, strong correlation (r=-0.8692; p<0.0001 was noticed between reach range and weekly time (in hours of high-heeled shoe wearing. No correlation was found between reach range and time of high-heel use in years. Seventeen out of the 30 volunteers presented positive test for loss of equilibrium when barefoot with closed eyes. A weak, negative correlation (r

Variability in chemical composition of Vitis vinifera cv Mencía from different geographic areas and vintages in Ribeira Sacra (NW Spain).

Science.gov (United States)

Vilanova, M; Rodríguez, I; Canosa, P; Otero, I; Gamero, E; Moreno, D; Talaverano, I; Valdés, E

2015-02-15

A chemical study was conducted from 2009 to 2012 to examine spatial and seasonal variability of red Vitis vinifera Mencía located in different geographic areas (Amandi, Chantada, Quiroga-Bibei, Ribeiras do Sil and Ribeiras do Miño) from NW Spain. Mencía samples were analysed for phenolic, (flavan-3-ols, flavonols, anthocyanins, acids and resveratrol), nitrogen (TAC, TAN, YAN and TAS) and volatiles compounds (alcohols, C6 compounds, ethyl esters, terpenes, aldehydes, acids, lactones, volatile phenols and carbonyl compounds) by GC-MS and HPLC. Results showed that the composition of Mencía cultivar was more affected by the vintage than the geographic area. The amino acid composition was less affected by both geographic origin and vintage, showing more varietal stability. Application of Principal Component Analysis (PCA) to experimental data showed a good separation of Mencía grape according to geographical origin and vintages. PCA also showed high correlations between the ripening ratio and C6 compounds, resveratrol and carbonyl compounds. Copyright © 2014 Elsevier Ltd. All rights reserved.

Fruit sphere microenvironments and berry phenolic content of Cabernet Sauvignon (Vitis vinifera L. cultivated under rain-shelter systems with coloured plastic film

Directory of Open Access Journals (Sweden)

Jiang-Fei MENG

Full Text Available Abstract Rain-shelter cultivation has been proven an important cultivation method for grape-plantings in continental monsoon climate zones, of which white plastic films are the most common shelter material. However, while this method and material reduces the occurrence of the disease, it can also decrease the grape berry quality. Five colours (including red, yellow, blue, purple, and white of plastic films were covered above Cabernet Sauvignon (Vitis vinifera L. grapevine rows before veraison. Rain-shelter cultivation reduced air temperature, wind speed, and total solar radiation and enhanced relative humidity in the fruit sphere of grapevines. For each particular colour plastic film, the irradiance of its corresponding spectrum band in the canopy of vines was higher than with other colour plastic films. Meanwhile, the blue plastic film treatment significantly promoted the accumulation of total phenolics, anthocyanins, flavonoids, tannins, and phenolic acids more than the other colours of plastic films. Blue plastic films are more beneficial for berry quality promotion of wine grapes, especially Cabernet Sauvignon, under rain-shelter cultivation in continental monsoon climate zones.

Mass spectrometric and enzymatic evidence confirm the existence of anthocyanidin 3,5-O-diglucosides in cabernet sauvignon (Vitis vinifera L.) grape berries.

Science.gov (United States)

Xing, Ran-Ran; Li, Si-Yu; He, Fei; Yang, Zhe; Duan, Chang-Qing; Li, Zheng; Wang, Jun; Pan, Qiu-Hong

2015-04-01

It has been widely accepted that anthocyanidin 3,5-O-diglucosides do not exist in Vitis vinifera L. Cabernet Sauvignon (CS) berries. However, our anthocyanin analyses using HPLC-ESI-MS/MS detected the existence of a low level of anthocyanidin 3,5-O-diglucosides in the Cabernet Sauvignon grape berries grown in China. The authenticity of these samples was confirmed with microsatellite markers. The existence of anthocyanidin 3,5-O-diglucoside was further verified by the enzymatic evidence for the first time. Four putative 5-O-glucosyltransferase (5GT) genes were isolated from the Cabernet Sauvignon berries. The enzymatic analysis showed that a recombinant protein (designated as Vv5GT3) glucosylated the 3-O- and 5-O-positions of anthocyanidins and flavonols. A phylogenetic analysis revealed that this bifunctional enzyme belongs to the 5GT subfamily of UDP-glycosyltransferases. This finding brought a new understanding of the anthocyanins' profile and their biosynthesis in V. vinifera and would be helpful for further investigations of the mechanism of accumulation of anthocyanidin diglucosides in Cabernet Sauvignon berries in China's wine-producing regions.

No evidence for an open vessel effect in centrifuge-based vulnerability curves of a long-vesselled liana (Vitis vinifera).

Science.gov (United States)

Jacobsen, Anna L; Pratt, R Brandon

2012-06-01

Vulnerability to cavitation curves are used to estimate xylem cavitation resistance and can be constructed using multiple techniques. It was recently suggested that a technique that relies on centrifugal force to generate negative xylem pressures may be susceptible to an open vessel artifact in long-vesselled species. Here, we used custom centrifuge rotors to measure different sample lengths of 1-yr-old stems of grapevine to examine the influence of open vessels on vulnerability curves, thus testing the hypothesized open vessel artifact. These curves were compared with a dehydration-based vulnerability curve. Although samples differed significantly in the number of open vessels, there was no difference in the vulnerability to cavitation measured on 0.14- and 0.271-m-long samples of Vitis vinifera. Dehydration and centrifuge-based curves showed a similar pattern of declining xylem-specific hydraulic conductivity (K(s)) with declining water potential. The percentage loss in hydraulic conductivity (PLC) differed between dehydration and centrifuge curves and it was determined that grapevine is susceptible to errors in estimating maximum K(s) during dehydration because of the development of vessel blockages. Our results from a long-vesselled liana do not support the open vessel artifact hypothesis. © 2012 The Authors. New Phytologist © 2012 New Phytologist Trust.

Sugars, organic acids, and phenolic compounds of ancient grape cultivars (Vitis vinifera L.) from Igdir province of Eastern Turkey.

Science.gov (United States)

Eyduran, Sadiye Peral; Akin, Meleksen; Ercisli, Sezai; Eyduran, Ecevit; Maghradze, David

2015-01-13

The Eurasian grapevine (Vitis vinifera L.) is the most widely cultivated and economically important horticultural crop in the world. As a one of the origin area, Anatolia played an important role in the diversification and spread of the cultivated form V. vinifera ssp. vinifera cultivars and also the wild form V. vinifera ssp. sylvestris ecotypes. Although several biodiversity studies have been conducted with local cultivars in different regions of Anatolia, no information has been reported so far on the biochemical (organic acids, sugars, phenolic acids, vitamin C) and antioxidant diversity of local historical table V. vinifera cultivars grown in Igdir province. In this work, we studied these traits in nine local table grape cultivars viz. 'Beyaz Kismis' (synonym name of Sultanina or Thompson seedless), 'Askeri', 'El Hakki', 'Kirmizi Kismis', 'Inek Emcegi', 'Hacabas', 'Kerim Gandi', 'Yazen Dayi', and 'Miskali' spread in the Igdir province of Eastern part of Turkey. Variability of all studied parameters is strongly influenced by cultivars (P grape cultivars grown in Igdir province of Eastern part of Turkey contained diverse and valuable sugars, organic acids, phenolic acids, Vitamin C values and demonstrated important antioxidant capacity for human health benefits. Further preservation and use of this gene pool will be helpful to avoid genetic erosion and to promote continued agriculture in the region.

Leaf blade and petiole nutritional evolution and variability throughout the crop season for Vitis vinifera L. cv. Graciano

Energy Technology Data Exchange (ETDEWEB)

Dominguez, N.; García-Escudero, N.; Romero, I.; Benito, A.; Martín, I.

2015-07-01

An adequate nutritional state of a crop can be kept by means of a well-designed fertilization plan based on the assessment of the nutrient availability throughout the growing season. The objective of this study was to determine the reliability of leaf blade and petiole diagnosis and the period of validity of their references at both flowering and veraison by means of systematic monitoring throughout the complete growing season. The study was carried out in two plots planted with Vitis vinifera L. cv. Graciano within the AOC Rioja (Spain). Blades and petioles were collected throughout a growing season (2006) and total N, P, K, Ca, Mg, Fe, Mn, Zn, Cu and B concentrations were analyzed in both tissues. Results suggest, in general, that petioles have higher variability and lower analysis reproducibility than blades. Therefore, blade could be a more appropriate tissue to evaluate N, P, K, Ca, and Mg at both flowering and veraison in this variety. Micronutrients in blade and petiole showed different variability behaviour in each of the vineyards studied, therefore, based on our results, it was difficult to determine which one could be the best tissue for the nutritional diagnosis of the ‘Graciano’ variety. Seasonal changes of nutrient concentration in both tissues also confirmed the need for reference values for each tissue and each phenological stage. (Author)

Changes in the free amino acid composition with maturity of the noble cultivar of Vitis rotundifolia Michx. grape.

Science.gov (United States)

Lamikanra, O; Kassa, A K

1999-12-01

The changes in amino acid composition that occur with maturity of the Noble cultivar of the Vitis rotundifolia Michx. (muscadine) grape were determined by HPLC. Eighteen amino acids were identified. Histidine was the most prominent amino acid followed by alanine. The concentrations of most of the major amino acids (alanine, glycine, histidine, valine, isoleucine, aspartic acid, and serine) were highest at verasion. Glutamine and threonine contents dropped sharply after fruit set, while those of arginine and proline increased gradually with maturity and ripening. Tyrosine content increased gradually with maturity and ripening following a slight drop after fruit set. In ripe grapes, seeds contained most of the amino acids in mature grapes (50%) followed by the pulp (23%), the juice (15%), and the skin (11%). Alanine, histidine, and arginine were the principal amino acids identified in the juice. Alanine, histidine, arginine, valine, glutamine, aspartic acid, proline, serine, and threonine accounted for about 90% of the amino acids in the pulp. In seeds, alanine, proline, asparagine, and histidine accounted for over 55% of the amino acids, while alanine and histidine were found to be the predominant free amino acids in the skin. The profile indicates some differences in the changes in amino acid composition with berry maturity and relative amounts of amino acids present in muscadine compared to those in nonmuscadine grape species.

Hepatoprotective Effects of Total Triterpenoids and Total Flavonoids from Vitis vinifera L against Immunological Liver Injury in Mice

Directory of Open Access Journals (Sweden)

Tao Liu

2012-01-01

Full Text Available Suosuo grape (the fruits of Vitis vinifera L has been used for prevention and treatment of liver diseases in Uighur folk medicine in China besides its edible value. In this study, the hepatoprotective effects of total triterpenoids (VTT and total flavonoids (VTF from Suosuo grape were evaluated in Bacille-Calmette-Guerin- (BCG- plus-lipopolysaccharide- (LPS- induced immunological liver injury (ILI in mice. Various dose groups (50, 150, and 300 mg/kg of VTT and VTF alleviated the degree of liver injury of ILI mice, effectively reduced the BCG/LPS-induced elevated liver index and spleen index, hepatic nitric oxide (NO, and malondialdehyde (MDA content, increased liver homogenate alanine aminotransferase (ALT and aspartate aminotransferase (AST levels, and restored hepatic superoxide dismutase (SOD activity in ILI mice. VTT and VTF also significantly inhibited intrahepatic expression of Th1 cytokines (IFN-γ and IL-2 in ILI mice and increased intrahepatic expression of Th2 cytokines (IL-4 and IL-10. Moreover, the increased Bax/Bcl-2 ratio was significantly downregulated by VTT and VTF in liver tissue of ILI mice. These results are comparable to those of biphenyl dicarboxylate (DDB, the reference hepatoprotective agent and suggest that VTT and VTF play a protective role against immunological liver injury, which may have important implications for our understanding of the immunoregulatory mechanisms of this plant.

"Doing Theology" in Conversation

Science.gov (United States)

Ehrensperger, Kathy

2011-01-01

This article presents the author's review of "Revisiting Christianity: theological reflections," by Marius C. Felderhof. This volume by a dedicated teacher and theologian is rooted in, and emerged from, the context of teaching Christian theology to young students of very diverse backgrounds and contexts of life. The commitment to engage in…

Kirjad Sirbile / Mart Kivastik

Index Scriptorium Estoniae

Kivastik, Mart, 1963-

2007-01-01

Mannheimi filmifestivalist. Filmidest "Nadine" (rezh. Erik de Bruyn), "Dead End", "Kremen" (rezh. Aleksei Mizgirev), "Overnight" (rezh. Ferenc Török), "Mirush" ("Blodsband", rezh. Marius Holst), "Sztuczki" (rezh. Andrzej Jakimowski), "Por sus propios ojos" ("Through her own eyes", rezh. Liliana Paolinelli), "Terra Sonambula" ("Sleepwalking Land", rezh. Teresa Prata). Festivali auhinnatud filmid

A candidate-gene association study for berry colour and anthocyanin content in Vitis vinifera L.

Directory of Open Access Journals (Sweden)

Silvana Cardoso

Full Text Available Anthocyanin content is a trait of major interest in Vitis vinifera L. These compounds affect grape and wine quality, and have beneficial effects on human health. A candidate-gene approach was used to identify genetic variants associated with anthocyanin content in grape berries. A total of 445 polymorphisms were identified in 5 genes encoding transcription factors and 10 genes involved in either the biosynthetic pathway or transport of anthocyanins. A total of 124 SNPs were selected to examine association with a wide range of phenotypes based on RP-HPLC analysis and visual characterization. The phenotypes were total skin anthocyanin (TSA concentration but also specific types of anthocyanins and relative abundance. The visual assessment was based on OIV (Organisation Internationale de la Vigne et du Vin descriptors for berry and skin colour. The genes encoding the transcription factors MYB11, MYBCC and MYC(B were significantly associated with TSA concentration. UFGT and MRP were associated with several different types of anthocyanins. Skin and pulp colour were associated with nine genes (MYB11, MYBCC, MYC(B, UFGT, MRP, DFR, LDOX, CHI and GST. Pulp colour was associated with a similar group of 11 genes (MYB11, MYBCC, MYC(B, MYC(A, UFGT, MRP, GST, DFR, LDOX, CHI and CHS(A. Statistical interactions were observed between SNPs within the transcription factors MYB11, MYBCC and MYC(B. SNPs within LDOX interacted with MYB11 and MYC(B, while SNPs within CHI interacted with MYB11 only. Together, these findings suggest the involvement of these genes in anthocyanin content and on the regulation of anthocyanin biosynthesis. This work forms a benchmark for replication and functional studies.

Influence of a deficit irrigation regime during ripening on berry composition in grapevines (Vitis vinifera L.) grown in semi-arid areas.

Science.gov (United States)

López, María-Isabel; Sánchez, María-Teresa; Díaz, Antonio; Ramírez, Pilar; Morales, José

2007-11-01

A study was made of the effects of irrigation management strategies during ripening on the quality of Spanish field-grown grapevine (Vitis vinifera L.) cultivars (Baladi, Airén, Montepila, Muscat Blanc à Petits Grains and Pedro Ximénez) grown under the "Montilla-Moriles" Appellation of Origin in Cordoba, Spain. From 1999 to 2002, two water-availability regimes were established: irrigation and non-irrigation. The study aimed to ascertain the effect of irrigation on berry development and ripening, and hence on grape juice quality. Changes in phenological stages, vegetative growth, vineyard yield, berry weight, total soluble solids, titrable acidity, pH, tartaric acid, malic acid, and potassium content were monitored. No significant differences were noted in phenological phases between the non-irrigation and deficit irrigation regimes. The Ravaz index, pruning weight, vineyard yield and berry weight were significantly higher in all varieties and years under deficit irrigation. Deficit irrigation induced higher titrable acidity, higher malic acid and potassium contents and a lower pH, but had no significant effects on berry sugar accumulation or tartaric acid content. Deficit irrigation thus appears to be a promising technique for the production of quality young wines in semi-arid areas.

The bouquet of grapevine (Vitis vinifera L. cv. Cabernet Sauvignon) flowers arises from the biosynthesis of sesquiterpene volatiles in pollen grains

Science.gov (United States)

Martin, Diane M.; Toub, Omid; Chiang, Angela; Lo, Bernard C.; Ohse, Sebastian; Lund, Steven T.; Bohlmann, Jörg

2009-01-01

Terpenoid volatiles are important information molecules that enable pollinators to locate flowers and may protect reproductive tissues against pathogens or herbivores. Inflorescences of grapevine (Vitis vinifera L.) are composed of tiny green flowers that produce an abundance of sesquiterpenoid volatiles. We demonstrate that male flower parts of grapevines are responsible for sesquiterpenoid floral scent formation. We describe temporal and spatial patterns of biosynthesis and release of floral volatiles throughout the blooming of V. vinifera L. cv. Cabernet Sauvignon. The biosynthesis of sesquiterpene volatiles, which are emitted with a light-dependent diurnal pattern early in the morning at prebloom and bloom, is localized to anthers and, more specifically, within the developing pollen grains. Valencene synthase (VvValCS) enzyme activity, which produces the major sesquiterpene volatiles of grapevine flowers, is present in anthers. VvValCS transcripts are most abundant in flowers at prebloom stages. Western blot analysis identified VvValCS protein in anthers, and in situ immunolabeling located VvValCS protein in pollen grains during bloom. Histochemical staining, as well as immunolabeling analysis by fluorescent microscopy and transmission electron microscopy, indicated that VvValCS localizes close to lipid bodies within the maturing microspore. PMID:19359488

Evaluation of five protocols for DNA extraction from leaves of Malus sieversii, Vitis vinifera, and Armeniaca vulgaris.

Science.gov (United States)

Aubakirova, K; Omasheva, M; Ryabushkina, N; Tazhibaev, T; Kampitova, G; Galiakparov, N

2014-02-27

Leaves of Malus sieversii, Vitis vinifera, and Armeniaca vulgaris contain substantial amounts of secondary metabolites, which limit the high-quality DNA extraction performance. In this study, five extraction protocols were compared for their ability to produce good quality DNA from fresh and dried (with silica gel) leaves of these species. The modified protocol of Dellaporta et al., using polyvinylpyrrolidone to bind the phenolic compounds and a high molar concentration of potassium acetate to inhibit co-precipitation of polysaccharides with DNA, produced the best DNA quality for all species tested. DNA extracted by this method had a 1.77-1.96 A260/280 nm ratio and successful amplification of the 18S ribosomal DNA gene. DNA concentrations of dried leaves were lower than those obtained from fresh leaves, which was likely due to aspects of the drying procedure. All five methods for grapevine produced DNA of obvious better quality from green canes compared to leaves, due to the relatively low content of secondary metabolites in the former. For grapevine and apricot, three methods can be equally used to obtain DNA of good quality: the Doyle and Doyle modified method using CTAB and high concentration of NaCl, the Jobes et al. modified method, and the sodium dodecyl sulfate mini preparation method of Edwards et al. The protocol of Jobes et al. using LiCl for RNA removal showed the best results for most of the M. sieversii samples examined.

Enhanced resveratrol production in Vitis vinifera cell suspension cultures by heavy metals without loss of cell viability.

Science.gov (United States)

Cai, Zhenzhen; Kastell, Anja; Speiser, Claire; Smetanska, Iryna

2013-09-01

The effects of heavy metal ions (Co(2+), Ag(+), Cd(2+)) on cell viability and secondary metabolite production, particularly anthocyanins and phenolic acids in Vitis vinifera cell suspension cultures, were investigated. Of these, Co at all three used concentrations (5.0, 25, and 50 μM), Ag, and Cd at low concentration (5.0 μM) were most effective to stimulate the phenolic acid production, increasing the 3-O-glucosyl-resveratrol up to 1.6-fold of the control level (250.5 versus 152.4 μmol/g), 4 h after the treatments. Meanwhile, the elicitors at effective concentrations did not suppress cell growth, while the cell viability maintained. In contrast, Ag and Cd at high concentrations (25 and 50 μM) remarkably reduced the cell viability, decreasing the cell viability up to about 15 % of the control level, 24 h after the treatments. The heavy metal ions did not affect the anthocyanin production. These observations show how, in a single system, different groups of secondary products can show distinct differences in their responses to potential elicitors. The 1,1-diphenyl-2-picrylhydrazyl radical scavenging activity, peroxidase activity, medium pH value, and conductivity were only slightly elevated by the heavy metal ions. The results suggest that some of the secondary metabolites production was stimulated by the used elicitors, but there was not a stress response of the cells.

Phenological behavior of the grapevine (vitis vinifera l., cv cabernet sauvignon in Sutamarchán - Boyacá.

Directory of Open Access Journals (Sweden)

Diana Carolina Vargas Herrera

2013-12-01

Full Text Available In tropical cold weather, the grapevine presents phenological disorders, difficult agronomic disfavoring vintage quality. With the purpose of establishing phenological cycles determined the duration of the different phases of the development cycle of the grapevine, cv "Cabernet Sauvignon" (Vitis vinifera L. in the vineyard Ain-Karim (5º39` N, 73º95' W, 2110 masl. We determined the average duration of sprouting (SP, flowering (FL, veraison (VE and vintage (VI periods from pruning, and the total cycle of growth, according to the phenological scale Biologische Bundesanstalt Bundessortenamt Chemise (BBCH. To set the average of the process was considered when the plants reached 50% of each event. Determining growing degree days (GDD support the temperature record by a datalogger. Phenological data were subjected to a descriptive analysis as means and standard deviation. The duration of the period between pruning (PR and vintage (VI, with average temperature of 17.87 ° C, had a duration of 183 days after pruning (DAP, accumulating growing degree days 1458.1 (GDD. Flowering occurred at 50 days after pruning (DAP, accumulating 397.7 GDD. Veraison 122 was presented to the accumulation of 578.2 DAP with GDD. While from veraison to maturity 478.9 GDD accumulated in 62 days. Under Sutamarchán agro-climatic conditions, during the investigation, collects, on average, 7.98 degrees daily growth, which implies that for the Cabernet Sauvignon, the total duration of the phenological cycle is 184 days, accumulating 1458.1 GDD.

Iron Supply Affects Anthocyanin Content and Related Gene Expression in Berries of Vitis vinifera cv. Cabernet Sauvignon

Directory of Open Access Journals (Sweden)

Pengbao Shi

2017-02-01

Full Text Available Anthocyanins are important compounds for red grape and red wine quality, and can be influenced by supply of nutrients such as nitrogen, phosphorus, potassium, zinc, and iron. The present work aims to gain a better understanding of the effect of iron supply on anthocyanins concentration in grape berries. To this end, own-rooted four-year-old Cabernet Sauvignon grapevines (Vitis vinifera were fertigated every three days with 0, 23, 46, 92, and 184 μM iron (Fe from ferric ethylenediamine di (o-hydroxyphenylacetic acid (Fe-EDDHA in a complete nutrient solution. Fe deficiency or excess generally led to higher concentrations of titratable acidity and skin/berry ratio, and to lower reducing sugar content, sugar/acid ratio, pH, berry weight, and concentration of anthocyanins. Most of the individual anthocyanins detected in this study, except cyanidin-3-O-glucoside, delphinidin-3-O-glucoside, and cyanidin-3-O-(6-O-coumaryl-glucoside, in moderate Fe treatment (46 μM grapes were significantly higher than those of other treatments. Genes encoding chalcone isomerase (CHI, flavanone 3-hydroxylase (F3H, leucoanthocyanidin dioxygenase (LDOX, and anthocyanin O-methyltransferase (AOMT exhibited higher transcript levels in berries from plants cultivated with 46 μM Fe compared to the ones cultivated with other Fe concentrations. We suggest that grape sugar content, anthocyanins content, and transcriptions of genes involved in anthocyanin biosynthesis were correlated with Fe supply concentrations.

Effect of salicylic acid and aloe vera gel on postharvest quality of table grapes ( Vitis Vinifera

Directory of Open Access Journals (Sweden)

H. Peyro

2017-06-01

Full Text Available To investigate the effects of salicylic acid dipping and Aloe vera gel coating on shelf life and post harvest quality of table grapes (Vitis vinifera of the cultivar Shahroudi, a factorial experiment was conducted on the basis of randomized complete blocks design with three factors and three replicates in agricultural faculty of Islamic Azad University in 2014. The treatments were dipping in Salicylic acid (three levels of 0, 1 and 2 mmmol-1 for 15 minutes and coating with Aloe vera gel (four levels of 0, 10%, 15% and 20% w/v and measurement of traits in 1st day, 30th day and 60th day after treatment of berries. The results showed that the interaction effect of salicylic acid and Aloe vera gel application was significant on all of traits except for pH value in a way that the best and the minimum weight loss (0.09g was obtained by application of 2 mmol-1 Salicylic acid and 20% Aloe vera gel in 1st day after treatment. The greatest amount of total soluble solids (428.43 g.100g-1 fruit juice was found in 2 mmol-1 Salicylic acid and 15% Aloe vera gel in 60th day. The highest Catalase enzyme activity (0.0013 Ua.mg-1Pro was attained in 2 mmol-1 Salicylic acid and 15% Aloe vera gel in 30th day. These results demonstrated that treatment of grape berries by salicylic acid and Aloe vera gel had positive effect on shelf life of table grapes and their postharvest quality

The vacuolar channel VvALMT9 mediates malate and tartrate accumulation in berries of Vitis vinifera.

Science.gov (United States)

De Angeli, Alexis; Baetz, Ulrike; Francisco, Rita; Zhang, Jingbo; Chaves, Maria Manuela; Regalado, Ana

2013-08-01

Vitis vinifera L. represents an economically important fruit species. Grape and wine flavour is made from a complex set of compounds. The acidity of berries is a major parameter in determining grape berry quality for wine making and fruit consumption. Despite the importance of malic and tartaric acid (TA) storage and transport for grape berry acidity, no vacuolar transporter for malate or tartrate has been identified so far. Some members of the aluminium-activated malate transporter (ALMT) anion channel family from Arabidopsis thaliana have been shown to be involved in mediating malate fluxes across the tonoplast. Therefore, we hypothesised that a homologue of these channels could have a similar role in V. vinifera grape berries. We identified homologues of the Arabidopsis vacuolar anion channel AtALMT9 through a TBLASTX search on the V. vinifera genome database. We cloned the closest homologue of AtALMT9 from grape berry cDNA and designated it VvALMT9. The expression profile revealed that VvALMT9 is constitutively expressed in berry mesocarp tissue and that its transcription level increases during fruit maturation. Moreover, we found that VvALMT9 is targeted to the vacuolar membrane. Using patch-clamp analysis, we could show that, besides malate, VvALMT9 mediates tartrate currents which are higher than in its Arabidopsis homologue. In summary, in the present study we provide evidence that VvALMT9 is a vacuolar malate channel expressed in grape berries. Interestingly, in V. vinifera, a tartrate-producing plant, the permeability of the channel is apparently adjusted to TA.

Graphite reactor physics; Physique des piles a graphite

Energy Technology Data Exchange (ETDEWEB)

Bacher, P; Cogne, F [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires; Noc, B [Electricite de France (EDF), 75 - Paris (France)

1964-07-01

The study of graphite-natural uranium power reactor physics, undertaken ten years ago when the Marcoule piles were built, has continued to keep in step with the development of this type of pile. From 1960 onwards the critical facility Marius has been available for a systematic study of the properties of lattices as a function of their pitch, of fuel geometry and of the diameter of cooling channels. This study has covered a very wide field: lattice pitch varying from 19 to 38 cm. uranium rods and tubes of cross-sections from 6 to 35 cm{sup 2}, channels with diameters between 70 and 140 mm. The lattice calculation methods could thus be checked and where necessary adapted. The running of the Marcoule piles and the experiments carried out on them during the last few years have supplied valuable information on the overall evolution of the neutronic properties of the fuel as a function of irradiation. More detailed experiments have also been performed in Marius with plutonium-containing fuels (irradiated or synthetic fuels), and will be undertaken at the beginning of 1965 at high temperature in the critical facility Cesar, which is just being completed at Cadarache. Spent fuel analyses complement these results and help in their interpretation. The thermalization and spectra theories developed in France can thus be verified over the whole valid temperature range. The efficiency of control rods as a function of their dimensions, the materials of which they are made and the lattices surrounding them has been measured in Marius, and the results compared with calculation on the one hand and with the measurements carried out in EDF 1 on the other. Studies on the control proper of graphite piles were concerned essentially with the risks of spatial instability and the means of detecting and controlling them, and with flux distortions caused by the control rods. (authors) [French] Entreprise il y a dix ans a l'occasion de la construction des piles de Marcoule, l'etude de la

Equilíbrio ácido-base e hidroeletrolítico em eqüinos com cólica Acid-base and hidroelectrolytic balance in colic horses

Directory of Open Access Journals (Sweden)

Paula Alessandra Di Filippo

2008-08-01

Full Text Available Foram utilizados setenta eqüinos distribuídos em três grupos experimentais, G1 (vinte eqüinos hígidos, G2 (vinte e cinco eqüinos com cólica, os quais passaram por tratamento clínico ou cirúrgico e sobreviveram e G3 (vinte e cinco eqüinos com cólica, os quais passaram por tratamento clínico ou cirúrgico e foram a óbito ou foram sacrificados. Amostras de sangue foram obtidas em dez diferentes momentos, mediante punção da jugular, para estudo do equilíbrio ácido-base e hidroeletrolítico. Os eqüinos com cólica apresentaram diminuição (PSeventy horses were distributed into three experimental groups ad follows: G1, twenty healthy animals; G2, twenty-five colic horses that survived after clinical or surgical treatment; and G3, twenty-five colic horses that were sacrificed or died after clinical or surgical treatment. Blood samples were taken from the jugular vein to assess acid-base balance and water-electrolyte balance. Colic horses had lower pH(v (P<0.05, mainly G3 animals. Acidosis was confirmed by the lower pH(v associated with decreased pCO2(v, cBase(v and cHCO-3(vP, which was probably due to an increased production of lactate during anaerobic glycolysis as a result from hypovolemia. Furthermore, hyponatremia, hypokalemia and hyperchloremia were detected. The presence and the extent of the imbalances contributed substantially to the prognosis of colic horses.

Efeito renoprotetor dos flavonoides do vinho na nefrotoxicidade do imunossupressor Tacrolimus Efecto renoprotector de los flavonoides del vino en la nefrotoxicidad del inmunosupresor Tacrolimus Renoprotective effects of wine flavonoids in nephrotoxicity of the immunosuppressant Tacrolimus

Directory of Open Access Journals (Sweden)

Wanessa Teixeira Silva

2011-01-01

Full Text Available OBJETIVO: Verificar o efeito renoprotetor do extrato de Vitis vinifera L na nefrotoxicidade induzida pelo Tacrolimus em estudos experimentais com ratos. MÉTODOS: Pesquisa quantitativa com modelo experimental, na qual foram utilizados ratos Wistar, machos, adultos, pesando entre 250g - 300g, tratados uma vez ao dia por cincodias, por gavagem, conforme segue: Salina (controle, cloreto de sódio 0,1ml; Vitis (Vitis vinifera L 3mg/kg, FK (0,5mg/kg e FK+Vitis (0,5mg/kg + 3mg/kg, respectivamente . A função renal foi avaliada por meio do clearance de creatinina (Clcr/ 100g, método Jaffé e a peroxidação lipídica pela mensuração de peróxidos urinários (PU, FOX-2. RESULTADOS: A administração de FK elevou a excreção de peróxidos e reduziu o clearance de creatinina, e a administração simultânea com Vitis vinifera L protegeu a função renal nesses parâmetros. CONCLUSÃO: Os dados confirmaram a lesão nefrotóxica induzida pelo Tacrolimus e demonstraram o efeito renoprotetor do Vitis Vinifera L.OBJETIVO: Verificar el efecto renoprotector del extracto de Vitis vinifera L en la nefrotoxicidad inducida por el Tacrolimus en estudios experimentales con ratas. MÉTODOS: Investigación cuantitativa con modelo experimental, en la cual fueron utilizadas ratas Wistar, machos, adultos, que pesaban entre 250g - 300g, tratados una vez al dia por cinco días, por alimentación forzada, conforme sigue: Salina (control, cloreto de sodio 0,1ml; Vitis (Vitis vinifera L 3mg/kg, FK (0,5mg/kg e FK+Vitis (0,5mg/kg + 3mg/kg, respectivamente . La función renal fue evaluada por medio del clearance de creatinina (Clcr/ 100g, método Jaffé y la peroxidación lipídica por la mensuración de peróxidos urinarios (PU, FOX-2. RESULTADOS: La administración de FK elevó la excreción de peróxidos y redujo el clearance de creatinina, y la administración simultánea con Vitis vinifera L protegió la función renal en esos parámetros. CONCLUSIÓN: Los datos

Tartu Ülikooli Narva Kolledž = University of Tartu Narva College / Hannes Praks

Index Scriptorium Estoniae

Praks, Hannes, 1973-

2013-01-01

Eesti Sisearhitektide Liidu 2012. aasta parima avaliku ruumi preemia pälvinud TÜ Narva Kolledzi sisekujundusest. Autorid: Hannes Praks, Kadri Tamme, Kristjan Holm, Liisi Murula, Toomas Pääsuke, Ahti Grüngerg, Daniel Marius Reisser, Helen Sarapuu. Arhitektuur: Kavakava. ESLi aastapreemiate žürii liikmete Raivo Puusepa ja Mari Kurismaa arvamused

Structural Changes Induced in Grapevine (Vitis vinifera L. DNA by Femtosecond IR Laser Pulses: A Surface-Enhanced Raman Spectroscopic Study

Directory of Open Access Journals (Sweden)

Nicoleta E. Dina

2016-05-01

Full Text Available In this work, surface-enhanced Raman spectra of ten genomic DNAs extracted from leaf tissues of different grapevine (Vitis vinifera L. varieties, respectively, are analyzed in the wavenumber range 300–1800 cm−1. Furthermore, structural changes induced in grapevine genomic nucleic acids upon femtosecond (170 fs infrared (IR laser pulse irradiation (λ = 1100 nm are discussed in detail for seven genomic DNAs, respectively. Surface-enhanced Raman spectroscopy (SERS signatures, vibrational band assignments and structural characterization of genomic DNAs are reported for each case. As a general observation, the wavenumber range between 1500 and 1660 cm−1 of the spectra seems to be modified upon laser treatment. This finding could reflect changes in the base-stacking interactions in DNA. Spectral shifts are mainly attributed to purines (dA, dG and deoxyribose. Pyrimidine residues seem to be less affected by IR femtosecond laser pulse irradiation. Furthermore, changes in the conformational properties of nucleic acid segments are observed after laser treatment. We have found that DNA isolated from Feteasca Neagra grapevine leaf tissues is the most structurally-responsive system to the femtosecond IR laser irradiation process. In addition, using unbiased computational resources by means of principal component analysis (PCA, eight different grapevine varieties were discriminated.

Avaliação do potencial de cinco cultivares de videiras americanas para sucos de uva no sul de Minas Gerais Potential evaluation of five american cultivars for grape juices in the south of Minas Gerais state

Directory of Open Access Journals (Sweden)

Giuliano Elias Pereira

2008-10-01

Full Text Available Objetivou-se, no presente trabalho realizar uma caracterização dos sucos de uva de cinco cultivares de videira americana Vitis labrusca (Folha de Figo, Alwood, Concord, BRS-Rúbea e Isabel segundo suas características visuais, olfativas e gustativas, utilizando um método descritivo por um painel de degustadores da Embrapa Uva e Vinho (EMBRAPA/CNPUV de Bento Gonçalves e da Associação Brasileira de Enologia (ABE, constituído por doze degustadores. De acordo com os resultados, os sucos das cultivares Isabel e Folha de Figo foram superiores aos demais, segundo a análise de componentes principais (ACP, principalmente pelas variáveis limpidez, equilíbrio olfativo, intensidade e corpo gustativo, persistência olfato-gustativa e julgamento geral (notas. O suco Folha de Figo foi superior ao Isabel quanto à tonalidade, sendo o primeiro caracterizado como vermelho-violáceo. A cultivar Folha de Figo é a mais utilizada na região para a produção de suco, podendo os produtores utilizarem também a cultivar Isabel, que mostrou potencial nas condições edafo-climáticas do sul de Minas Gerais.The present work was designed to accomplish the characterization of the different grape juices of five grapevine cultivars of Vitis labrusca (Folha de Figo, Alwood, Concord, BRS-Rúbea e Isabel according to their visual, smell and taste characteristics utilizing a descriptive method by a panel of tasters of Embrapa Grape and Wine (EMBRAPA/CNPUV of Bento Gonçalves, and of the Brazilian Enology Association (ABE consisting of 12 tasters. According to the results, the juices of the cultivars Isabel and Folha de Figo were higher than the others, analyzed statistically according to the Principal Component Analysis (PCA, mainly by the visual cleanliness variables, olfatory equilibrium, gustative body and quality, olfato-gustative persistence and general judgement (scores and the juice of Folha de Figo was higher than Isabel according to visual shade, the former

Bioactive potential of Vitis labrusca L. grape juices from the Southern Region of Brazil: phenolic and elemental composition and effect on lipid peroxidation in healthy subjects.

Science.gov (United States)

Toaldo, Isabela Maia; Cruz, Fernanda Alves; Alves, Tatiana de Lima; de Gois, Jefferson Santos; Borges, Daniel L G; Cunha, Heloisa Pamplona; da Silva, Edson Luiz; Bordignon-Luiz, Marilde T

2015-04-15

Grapes are rich in polyphenols with biologically active properties. Although the bioactive potential of grape constituents are frequently reported, the effects of Brazilian Vitis labrusca L. grape juices ingestion have not been demonstrated in humans. This study identified the phenolic and elemental composition of red and white grape juices and the effect of organic and conventional red grape juice consumption on lipid peroxidation in healthy individuals. Concentrations of anthocyanins, flavanols and phenolic acids and the in vitro antioxidant activity were significantly higher in the organic juice. The macro-elements K, Ca, Na and Mg were the most abundant minerals in all juices. The acute consumption of red grape juices promoted significant decrease of lipid peroxides in serum and TBARS levels in plasma. It is concluded that red V. labrusca L. grape juices produced in Southern Brazil showed lipid peroxidation inhibition abilities in healthy subjects, regardless of the cultivation system. Copyright © 2014 Elsevier Ltd. All rights reserved.

Influence of vineyard altitude on Glera grape ripening (Vitis vinifera L.): effects on aroma evolution and wine sensory profile.

Science.gov (United States)

Alessandrini, Massimiliano; Gaiotti, Federica; Belfiore, Nicola; Matarese, Fabiola; D'Onofrio, Claudio; Tomasi, Diego

2017-07-01

Environmental factors have been acknowledged to greatly influence grape and wine aromas. Among them, the effect of altitude on grape aroma compounds has scarcely been debated in literature available to date. In the present study, we investigated the influence of altitude on grape composition and aroma evolution during ripening of Vitis vinifera L. cultivar Glera grown in Conegliano-Valdobbiadene DOCG area (Italy). The site at highest altitude (380 m above sea level) was warmer than the lowest site (200 m above sea level) and, even with differences in temperature in the range 1.5-2 °C, the impact of the cultivation site on grape ripening and aroma accumulation and preservation was significant. The lowest site demonstrated slower grape ripening, and grapes at harvest accumulated lower amounts of all of the main classes of aroma compounds typical of the Glera variety. Wines produced from the highest site were preferred in tasting trials for their more patent floral notes and elegance. Altitude strongly influences grape ripening evolution and flavour accumulation in the Glera grape, and this result accounts for the different styles in the sparkling wines subsequently produced. Moreover, the present study shows that aroma compound biosynthesis, particularly that of benzenoides, starts before véraison in Glera. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

Effect of γ-radiation on the production of aflatoxin B1 by Aspergillus parasiticus in raisins (Vitis vinifera L.)

International Nuclear Information System (INIS)

Kanapitsas, Alexandros; Batrinou, Anthimia; Aravantinos, Athanasios; Markaki, Panagiota

2015-01-01

Aflatoxin B 1 (AFB 1 ) mostly produced by Aspergillus flavus and Aspergillus parasiticus, is an extremely toxic and carcinogenic metabolite. The effect of gamma irradiation at dose of 10 kGy on the production of aflatoxin B 1 (AFB 1 ) inoculated by Aspergillus parasiticus in raisins (Vitis vinifera L.) and on AFB 1 in contaminated samples, was investigated. Values of the amount of aflatoxin B 1 produced on the 12th day of incubation, after irradiation, showed that gamma radiation exposure at 10 kGy decreased AFB 1 production at 65% compared with the non-irradiated sample, on the same day. The application of 10 kGy gamma radiation directly on 100 ng of AFB 1 which were spiked in raisins resulted in ∼29% reduction of AFB 1 . According to the risk assessment analysis the Provisional Maximum Tolerable Daily Intake (PMTDI) of 1.0 ng AFB 1 kg −1 bw, indicates that consumers are less exposed to AFB 1 from the irradiated raisins. - Highlights: • Aflatoxin B 1 (AFB 1 ) is an extremely toxic and carcinogenic metabolite. • AFB 1 is produced in raisins. • Irradiation at the dose of 10 kGy affects AFB 1 production. • 10 kGy reduced (∼65%) AFB 1 production by A.parasiticus in raisins. • 10 kGy reduced (∼29%) AFB 1 spiked directly in raisins

Anti-Dermatophyte and Anti-Malassezia Activity of Extracts Rich in Polymeric Flavan-3-ols Obtained from Vitis vinifera Seeds.

Science.gov (United States)

Simonetti, Giovanna; D'Auria, Felicia Diodata; Mulinacci, Nadia; Innocenti, Marzia; Antonacci, Donato; Angiolella, Letizia; Santamaria, Anna Rita; Valletta, Alessio; Donati, Livia; Pasqua, Gabriella

2017-01-01

Several human skin diseases are associated with fungi as dermatophytes and Malassezia. Skin mycoses are increasing and new alternatives to conventional treatments with improved efficacy and/or safety profiles are desirable. For the first time, the anti-dermatophytes and the anti-Malassezia activities of Vitis vinifera seed extracts obtained from different table and wine cultivars have been evaluated. Geometric minimal inhibitory concentration ranged from 20 to 97 µg/mL for dermatophytes and from 32 to 161 µg/mL for Malassezia furfur. Dried grape seed extracts analyzed by HPLC/DAD/ESI/MS showed different quali-quantitative compositions in terms of monomeric and polymeric flavan-3-ols. The minimal inhibitory concentrations for Trichophyton mentagrophytes and for M. furfur were inversely correlated with the amount of the polymeric fraction (r = -0.7639 and r = -0.7228, respectively). Differently, the antifungal activity against T. mentagrophytes was not correlated to the content of flavan-3-ol monomers (r = 0.2920) and only weakly correlated for M. furfur (r = -0.53604). These results suggest that extracts rich in polymeric flavan-3-ols, recovered from V.  vinifera seeds, could be used for the treatment of skin fungal infections. Copyright © 2016 John Wiley & Sons, Ltd. Copyright © 2016 John Wiley & Sons, Ltd.

Parámetros biológicos y poblacionales de Planococcus ficus (Hemiptera: Pseudococcidae sobre dos cultivares de Vitis vinifera

Directory of Open Access Journals (Sweden)

MARCELA. F. GONZALEZ LUNA

2016-01-01

Full Text Available La cochinilla harinosa Planococcus ficus Signoret causa severos da- ños en viñedos argentinos. El objetivo de este trabajo es comparar los parámetros biológicos y poblacionales de P. ficus sobre los cultivares de Vitis vinifera Chardon- nay y Malbec, así como evaluar el efecto de las temperatura sobre tales parámet- ros y obtener las respectivas curvas estimadas de crecimiento poblacional. Con temperaturas constantes de 15, 25 y 37 °C, 46 % de H.R. y fotoperíodo de 16:8 h (Luz: Oscuridad, diariamente se registraron el número de individuos de cada estadio, la ecdisis y la descendencia. A 25 °C, el período ninfal fue similar en am- bos cultivares. La fecundidad, la tasa intrínseca de incremento natural ( r m , la tasa finita de incremento ( λ y la tasa neta de reproducción ( R 0 sobre Malbec fueron superiores a Chardonnay. El tiempo generacional ( T y el tiempo de duplicación ( D fueron menores en Malbec. A 15 °C las cochinillas criadas sobre Malbec lograron reproducirse, no se obtuvieron diferencias significativas en los cultivares ensaya- dos. No se verificó el cumplimiento del ciclo completo a 37 °C. Se demostró que la capacidad reproductiva de P. ficus fue mayor sobre Malbec.

Analysis of the grape (Vitis vinifera L.) thaumatin-like protein (TLP) gene family and demonstration that TLP29 contributes to disease resistance.

Science.gov (United States)

Yan, Xiaoxiao; Qiao, Hengbo; Zhang, Xiuming; Guo, Chunlei; Wang, Mengnan; Wang, Yuejin; Wang, Xiping

2017-06-27

Thaumatin-like protein (TLP) is present as a large family in plants, and individual members play different roles in various responses to biotic and abiotic stresses. Here we studied the role of 33 putative grape (Vitis vinifera L.) TLP genes (VvTLP) in grape disease resistance. Heat maps analysis compared the expression profiles of 33 genes in disease resistant and susceptible grape species infected with anthracnose (Elsinoe ampelina), powdery mildew (Erysiphe necator) or Botrytis cinerea. Among these 33 genes, the expression level of TLP29 increased following the three pathogens inoculations, and its homolog from the disease resistant Chinese wild grape V. quinquangularis cv. 'Shang-24', was focused for functional studies. Over-expression of TLP29 from grape 'Shang-24' (VqTLP29) in Arabidopsis thaliana enhanced its resistance to powdery mildew and the bacterium Pseudomonas syringae pv. tomato DC3000, but decreased resistance to B. cinerea. Moreover, the stomatal closure immunity response to pathogen associated molecular patterns was strengthened in the transgenic lines. A comparison of the expression profiles of various resistance-related genes after infection with different pathogens indicated that VqTLP29 may be involved in the salicylic acid and jasmonic acid/ethylene signaling pathways.

A capillary electrophoretic method for isolation and characterization ...

African Journals Online (AJOL)

European (Vitis vinifera) and American (Vitis labrusca) grape species succumb to a bacterial disease known as Pierce's Disease (PD). In contrast, muscadine grape genotypes (Vitis rotundifolia) are tolerant/resistant to PD. This is due to the unique biochemical composition of muscadine xylem. However, because of low ...

Transcriptome and metabolome reprogramming in Vitis vinifera cv. Trincadeira berries upon infection with Botrytis cinerea.

Science.gov (United States)

Agudelo-Romero, Patricia; Erban, Alexander; Rego, Cecília; Carbonell-Bejerano, Pablo; Nascimento, Teresa; Sousa, Lisete; Martínez-Zapater, José M; Kopka, Joachim; Fortes, Ana Margarida

2015-04-01

Vitis vinifera berries are sensitive towards infection by the necrotrophic pathogen Botrytis cinerea, leading to important economic losses worldwide. The combined analysis of the transcriptome and metabolome associated with fungal infection has not been performed previously in grapes or in another fleshy fruit. In an attempt to identify the molecular and metabolic mechanisms associated with the infection, peppercorn-sized fruits were infected in the field. Green and veraison berries were collected following infection for microarray analysis complemented with metabolic profiling of primary and other soluble metabolites and of volatile emissions. The results provided evidence of a reprogramming of carbohydrate and lipid metabolisms towards increased synthesis of secondary metabolites involved in plant defence, such as trans-resveratrol and gallic acid. This response was already activated in infected green berries with the putative involvement of jasmonic acid, ethylene, polyamines, and auxins, whereas salicylic acid did not seem to be involved. Genes encoding WRKY transcription factors, pathogenesis-related proteins, glutathione S-transferase, stilbene synthase, and phenylalanine ammonia-lyase were upregulated in infected berries. However, salicylic acid signalling was activated in healthy ripening berries along with the expression of proteins of the NBS-LRR superfamily and protein kinases, suggesting that the pathogen is able to shut down defences existing in healthy ripening berries. Furthermore, this study provided metabolic biomarkers of infection such as azelaic acid, a substance known to prime plant defence responses, arabitol, ribitol, 4-amino butanoic acid, 1-O-methyl- glucopyranoside, and several fatty acids that alone or in combination can be used to monitor Botrytis infection early in the vineyard. © The Author 2015. Published by Oxford University Press on behalf of the Society for Experimental Biology. All rights reserved. For permissions, please email

VvGONST-A and VvGONST-B are Golgi-localised GDP-sugar transporters in grapevine (Vitis vinifera L.).

Science.gov (United States)

Utz, Daniella; Handford, Michael

2015-02-01

Plant nucleotide-sugar transporters (NSTs) are responsible for the import of nucleotide-sugar substrates into the Golgi lumen, for subsequent use in glycosylation reactions. NSTs are specific for either GDP- or UDP-sugars, and almost all transporters studied to date have been isolated from Arabidopsis thaliana L. In order to determine the conservation of the import mechanism in other higher plant species, here we report the identification and characterisation of VvGONST-A and VvGONST-B from grapevine (Vitis vinifera L. cv. Thompson Seedless), which are the orthologues of the GDP-sugar transporters GONST3 and GONST4 in Arabidopsis. Both grapevine NSTs possess the molecular features characteristic of GDP-sugar transporters, including a GDP-binding domain (GXL/VNK) towards the C-terminal. VvGONST-A and VvGONST-B expression is highest at berry setting and decreases throughout berry development and ripening. Moreover, we show using green fluorescent protein (GFP) tagged versions and brefeldin A treatments, that both are localised in the Golgi apparatus. Additionally, in vitro transport assays after expression of both NSTs in tobacco leaves indicate that VvGONST-A and VvGONST-B are capable of transporting GDP-mannose and GDP-glucose, respectively, but not a range of other UDP- and GDP-sugars. The possible functions of these NSTs in glucomannan synthesis and/or glycosylation of sphingolipids are discussed. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

Field-Based Metabolomics of Vitis vinifera L. Stems Provides New Insights for Genotype Discrimination and Polyphenol Metabolism Structuring

Directory of Open Access Journals (Sweden)

Kévin Billet

2018-06-01

Full Text Available Grape accumulates numerous polyphenols with abundant health benefit and organoleptic properties that in planta act as key components of the plant defense system against diseases. Considerable advances have been made in the chemical characterization of wine metabolites particularly volatile and polyphenolic compounds. However, the metabotyping (metabolite-phenotype characterization of grape varieties, from polyphenolic-rich vineyard by-product is unprecedented. As this composition might result from the complex interaction between genotype, environment and viticultural practices, a field experiment was setting up with uniform pedo-climatic factors and viticultural practices of growing vines to favor the genetic determinism of polyphenol expression. As a result, UPLC-MS-based targeted metabolomic analyses of grape stems from 8 Vitis vinifera L. cultivars allowed the determination of 42 polyphenols related to phenolic acids, flavonoids, procyanidins, and stilbenoids as resveratrol oligomers (degree of oligomerization 1–4. Using a partial least-square discriminant analysis approach, grape stem chemical profiles were discriminated according to their genotypic origin showing that polyphenol profile express a varietal signature. Furthermore, hierarchical clustering highlights various degree of polyphenol similarity between grape varieties that were in agreement with the genetic distance using clustering analyses of 22 microsatellite DNA markers. Metabolite correlation network suggested that several polyphenol subclasses were differently controlled. The present polyphenol metabotyping approach coupled to multivariate statistical analyses might assist grape selection programs to improve metabolites with both health-benefit potential and plant defense traits.

Clonal differences and impact of defoliation on Sauvignon blanc (Vitis vinifera L.) wines: a chemical and sensory investigation.

Science.gov (United States)

Šuklje, Katja; Antalick, Guillaume; Buica, Astrid; Langlois, Jennifer; Coetzee, Zelmari A; Gouot, Julia; Schmidtke, Leigh M; Deloire, Alain

2016-02-01

The aim of this study, performed on Sauvignon blanc clones SB11 and SB316, grafted on the same rootstock 101-14 Mgt (Vitis riparia × V. ruperstris) and grown at two adjacent vineyards, was two-fold: (1) to study wine chemical and sensory composition of both clones within an unaltered canopy; and (2) to determine the effect of defoliation (e.g. bunch microclimate) on wine chemical and sensory composition. Orthogonal projection to latent structures discriminate analysis (OPLS-DA) was applied to the concentration profiles of volatile compounds derived from gas chromatography-mass spectrometry data. The loadings directions inferred that 3-isobutyl-2-methoxypyrazine (IBMP) discriminated control treatments (shaded fruit zone) of both clones from defoliation treatments (exposed fruit zone), whereas 3-sulfanyl-hexan-1-ol (3SH), 3-sulfanylhexyl acetate (3SHA), hexanol, hexyl hexanoate and some other esters discriminated defoliated treatments from the controls. The OPLS-DA indicated the importance of IBMP, higher alcohol acetates and phenylethyl esters, for discrimination of clone SB11 from clone SB316 irrespective of the treatment. Defoliation in the fruit zone significantly decreased perceived greenness in clone SB11 and elevated fruitier aromas, whereas in clone SB316 the effect of defoliation on wine sensory perception was less noticeable regardless the decrease in IBMP concentrations. These findings highlight the importance of clone selection and bunch microclimate to diversify produced wine styles. © 2015 Society of Chemical Industry.

Water extract of Vitis coignetiae Pulliat leaves attenuates oxidative stress and inflammation in progressive NASH rats.

Science.gov (United States)

Pak, Wing; Takayama, Fusako; Hasegawa, Azusa; Mankura, Mitsumasa; Egashira, Toru; Ueki, Keiji; Nakamoto, Kazuo; Kawasaki, Hiromu; Mori, Akitane

2012-01-01

This study aimed to investigate the therapeutic effects of the water extract of leaves of Vitis coignetiae Pulliat (VCPL) on nonalcoholic steatohepatitis (NASH) with advanced fibrosis, as our previous study exhibited its preventive effect on NASH. The NASH animal model [PCT/JP2007/52477] was prepared by loading recurrent and intermittent hypoxemia stress to a rat with fatty liver, which resembled the condition occurring in patients with obstructive sleep apnea (OSA) and fatty liver, who have a high incidence of NASH. Intermittent hypoxemia stress is regarded as a condition similar to warm ischemia followed by re-oxygenation, which induces oxidative stress (OS). The daily 100 or 300 mg/kg VCPL administrations were performed for 3 weeks perorally beginning at the time of detection of advanced liver fibrosis. The therapeutic efficacy of VCPL on NASH was demonstrated by the reduction of the leakage of hepato-biliary enzymes and the amelioration of liver fibrosis. The OS elevation in NASH rats was measured based on the derivation of reactive oxygen species from liver mitochondrial energy metabolism and on the decrease in plasma SOD-like activity. The aggravation of inflammatory responses was demonstrated by the neutrophil infiltration (elevated myeloperoxidase activity) and the progression of fibrosis in the livers of NASH rats. In addition, the NASH rats without VCPL treatment also exhibited activation of nuclear factor-κB, a key factor in the link between oxidative stress and inflammation. All of these changes were reduced dose-dependently by the VCPL administration. These findings indicate that VCPL may improve hepatic fibrosis or at least suppress the progression of NASH, by breaking the crosstalk between OS and inflammation.

Phenology and thermal summation (degree days for ‘Isabel’ grape (Vitis labrusca produced in the Northwest of Parana State/ Fenologia e soma térmica (graus-dia para a videira ‘Isabel’ (Vitis labrusca cultivada no Noroeste do Paraná

Directory of Open Access Journals (Sweden)

Werner Genta

2004-05-01

Full Text Available The objetive of this research was to characterize the phenological performance of ‘Isabel’ grape (Vitis labrusca produced in the northwest of Parana state, as well to characterize its thermal demand in degree-days. The experimental area was established in a commercial vineyard of Vinícola Intervin®, Maringá, PR. The vineyard was planted in August of 2000 and the trees were trained in a pergola system, in a 4.0 x 1.0 m spacing. The evaluations started from the winter pruning of 2003. The random design was used as the statistical model with 20 replications and each plot was composed by one tree. The phenology of grapes was evaluated considering the duration in days of each one of the following subperiods: pruning to bud swell, pruning to beggining of shoot growth, pruning to visible cluster, pruning to flowering, pruning to early ripening and pruning to harvest. The thermal demand of ‘Isabel’ grape was determined using the degree-days summation from the pruning to harvest, as well for each of the subperiods, considering two base-temperatures (10oC and 12oC. It was possible to conclude that: the duration of the ‘Isabel’ grape (pruning to harvest in the northwest of Parana is 127 days, and its thermal demand is 1,238.20 degree-days. The most suitable base-temperature to calculate this demand was 10oC.O trabalho teve como objetivo caracterizar o comportamento fenológico da videira ‘Isabel’ (Vitis labrusca cultivada no norte do Estado do Paraná, bem como caracterizar sua exigência térmica em graus-dia. A área experimental foi instalada em uma propriedade comercial pertencente à Vinícola Intervin®, localizada no município de Maringá, PR. O vinhedo foi estabelecido em agosto de 2000 e as plantas foram conduzidas no sistema latada no espaçamento de 4,0 m x 1,0 m. As avaliações tiveram início a partir da poda de frutificação realizada no fim do inverno de 2003. O delineamento experimental foi o inteiramente casualizado

Kalevi kommivabrik läks Luksemburgi investeerimisfondile / Toivo Tänavsuu

Index Scriptorium Estoniae

Tänavsuu, Toivo

2007-01-01

Kalevi ja Tere omandanud Luksemburgis registreeritud fondi Alta Capital Partners S.C.A. osanikud on 80% ulatuses Indrek Rahumaa, Andres Rätsepp, Jaak Raid ja Marius Binkevicius, 20% osakutest kuulub Briti varahaldusfirmale Bonfield Asset Management. Fondi hakkab haldama Läti firma Alta Capital Partners SIA. Skeemid: Mis Oliver Kruudale alles jäi? Mida Indrek Rahumaa ostis

South African Journal for Research in Sport, Physical Education and ...

African Journals Online (AJOL)

An assessment of the physical fitness and coronary heart disease risk factors of white females in the Zululand area that attend health and fitness clubs · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Marius F. Coetsee, 13-22. http://dx.doi.org/10.4314/sajrs.v25i1.25827 ...

Kuidas rasketel hetkedel käitud, kellelt nõu küsid? / Erko Karing, Monika Peetson, Helen Sildna... [jt.

Index Scriptorium Estoniae

2010-01-01

Küsimusele vastavad Guvatraki reklaamibüroo juht Erko Karing, audiitor- ja finantsnõustamisfirma Deloitte vandeaudiitor Monika Peetson, muusikapeo Tallinn Music Week peakorraldaja ja ettevõtte MUsicCase omanik Helen Sildna, ETL-Baltic Groupi juhatuse esimees ja üks loojatest Krista Mulenok, Eesti Posti e-arvete operaatori eArvekeskus juht Marius Arrak ning firma Sailinvest omanik Jaanus Tamme

Alternative SNP detection platforms, HRM and biosensors, for varietal identification in Vitis vinifera L. using F3H and LDOX genes.

Science.gov (United States)

Gomes, Sónia; Castro, Cláudia; Barrias, Sara; Pereira, Leonor; Jorge, Pedro; Fernandes, José R; Martins-Lopes, Paula

2018-04-11

The wine sector requires quick and reliable methods for Vitis vinifera L. varietal identification. The number of V. vinifera varieties is estimated in about 5,000 worldwide. Single Nucleotide Polymorphisms (SNPs) represent the most basic and abundant form of genetic sequence variation, being adequate for varietal discrimination. The aim of this work was to develop DNA-based assays suitable to detect SNP variation in V. vinifera, allowing varietal discrimination. Genotyping by sequencing allowed the detection of eleven SNPs on two genes of the anthocyanin pathway, the flavanone 3-hydroxylase (F3H, EC: 1.14.11.9), and the leucoanthocyanidin dioxygenase (LDOX, EC 1.14.11.19; synonym anthocyanidin synthase, ANS) in twenty V. vinifera varieties. Three High Resolution Melting (HRM) assays were designed based on the sequencing information, discriminating five of the 20 varieties: Alicante Bouschet, Donzelinho Tinto, Merlot, Moscatel Galego and Tinta Roriz. Sanger sequencing of the HRM assay products confirmed the HRM profiles. Three probes, with different lengths and sequences, were used as bio-recognition elements in an optical biosensor platform based on a long period grating (LPG) fiber optic sensor. The label free platform detected a difference of a single SNP using genomic DNA samples. The two different platforms were successfully applied for grapevine varietal identification.

GENETIC DI VERSITY OF A MPI CILLIN-RE SI STANT Vibri o ISOLATED FROM VAR IOUS STA GES OF TIGER SHRIMP LARVA E DEVELOPMENT

Directory of Open Access Journals (Sweden)

WIDANARNI a

2000-01-01

Full Text Available This research was carri ed out to st udy genetic di versity of ampici llin-resi sta nt Vi brio from variou s stages o f t iger shrimp larvae (Penaeus Monodon de velopment from,Ta mbak Inti Raky at hatchery, near Labuan, West Jav a, Indonesia. A total of 25 am picillin- resistant Vi brio is ol at es were isolated using thiosul pha te citrat e bi le -sal t sucr os e agar ( TCBS -Aga r a nd s eawa ter complet e agar (SWC-Agar. Physiological and bioc he mical cha racteri zation showed that the i solates could be grouped into only two species, i.e. V. har veyi from the egg s tage; and V. metschnikovii from larvae and post-larval stage (i.e nauplius, zoe a, mysis, PLi, P L5, PL,0, and P L,5. Thes e is olates were also present i n t heir r espective rearing wate r of each s tage and som e natural feed. Schi zoty ping analysis e mployin g rest riction endonuclease Noll (5 '-GC4GGCCGC indicate d that the is ol at es could be grouped i nto at l east 13 differ en t ge no ty pe s. Therefore, schizoty ping was more di sc ri mi native than phy siologica l charac te riz ati on . This stud y showed that particu lar grou ps of Vi brio colonize d all s tages of shrimp la rvae and de monstrated cl os ed ph yl og en et ic r elationsh ip. These gro ups of Vi brio mi gh t be the do mi na nt microbiota whic h could suppress the de velopment of othe r Vi brio in cl ud ing th e pathogen ic Vi brio.

Grape (Vitis vinifera) extracts protects against radiation-induced oxidative stress in human erythrocyte (RBC)

International Nuclear Information System (INIS)

Ghosh, Subhashis

2016-01-01

Ionizing radiation (IR) causes oxidative stress through the overwhelming generation of reactive oxygen species (ROS) in the living cells leading further to the oxidative damage to biomolecules. Grapes (Vitis vinifera) contain several bioactive phytochemicals and are the richest source of antioxidant. In this study, we investigated the radioprotective actions of the grape extracts of two different cultivars, including the Thompson seedless (green) and Kishmish chorni (black) in human erythrocytes. Pretreatment with grape extracts attenuates oxidative stress induced by 4 Gy-radiation in human erythrocytes in vitro. These results suggest that grape extract serve as a potential source of natural antioxidants against the IR-induced oxidative stress and also inhibit apoptosis. Furthermore, the protective action of grape depends on the source of extract (seed, skin or pulp) and type of the cultivars. Effects of grape extracts of different cultivars on protein content, Thiobarbituric acid reactive substances (TBARS) level, reduced glutathione (GSH) content and activities of Catalase, Nitrite, GST, GR in human erythrocytes against -radiation exposure at a dose of 4 Gy are investigated. The grape extracts did not appear to alter the viability of human erythrocytes. Exposure of erythrocytes to the -irradiation at a dose of 4 Gy significantly increased the extent of formation of TBARS, while decreased the level of GSH and activities of CAT, GSSG , GST, GR in the erythrocytes as compared to the non-irradiated control counterparts. This was significantly attenuated by the pretreatment with the grape seed extracts (p<0.001) and significantly with the skin extracts (p<0.05) compared to the ionizing radiation exposed group. Moreover, protection offered by the seed extracts was found significantly better than that was offered by the pulp extract of the same cultivar. In conclusion, our results suggested that the grape extracts significantly attenuated IR induced oxidative stress and

Influence of processing and storage of integral grape juice (Vitis labrusca L.) on its physical and chemical characteristics, cytotoxicity, and mutagenicity in vitro.

Science.gov (United States)

Düsman, E; Almeida, I V; Pinto, E P; Lucchetta, L; Vicentini, V E P

2017-05-31

Integral grape juice is extracted from the grape through processes that allow the retention of their natural composition. However, due to the severity of some processes, fruit juices can undergo changes in their quality. The present study evaluated the cytotoxic and mutagenic effects of integral grape juice by a cytokinesis-blocked micronucleus assay in Rattus norvegicus hepatoma cells (HTC) in vitro. Vitis labrusca L. (variety Concord) were produced organically and by a conventional system, and their juice was extracted by a hot extraction process. The organic grapes were subjected to ultraviolet-type C radiation (UV-C). Experiments were performed after production and after 6 months in storage. Physicochemical analyses revealed that UV-C irradiation of organic grapes, the juice production process, and storage resulted in nutraceutical alterations. However, none of the juice concentrations were cytotoxic to HTC cells by the cytokinesis-blocked proliferation index results or were mutagenic, because the formation of micronucleated cells was not induced. In general, juice induced cell proliferation, possibly due to the presence of vitamins and sugar content (total soluble solid). The data increased the understanding of food technology and confirmed the quality and safety consumption of these juices.

Agreement between instruments for assessing balance after stroke

OpenAIRE

Correia, Anabela; Pimenta, Carla; Alves, Marta; Virella, Daniel

2017-01-01

Introdução – A perturbação do equilíbrio após acidente vascular cerebral (AVC) é importante pela sua frequência e repercussões. Instrumentos de avaliação do equilíbrio validados e de fácil aplicação são necessários para identificar risco de queda e para adequar estratégias de intervenção. Objetivos – Verificar a concordância entre as avaliações do equilíbrio estático, dinâmico e mobilidade funcional após AVC e verificar se a concordância varia com o grau de dependência. Metodologia – Estudo t...

Influence of Berry Heterogeneity on Phenolics and Antioxidant Activity of Grapes and Wines: A Primary Study of the New Winegrape Cultivar Meili (Vitis vinifera L.)

Science.gov (United States)

Liu, Xu; Li, Jinlu; Tian, Yuping; Liao, Mingan; Zhang, Zhenwen

2016-01-01

Wine grapes are usually harvested in vineyards when they ripen. However, not all of the berries in a vineyard ripen homogeneously because of different microclimates around the clusters and berries. In this study, the influence of berry heterogeneity on the phenolic content and antioxidant capacity of grapes and wines under a continental monsoon climate was evaluated for a new wine grape cultivar Meili (Vitis vinifera L.). The total phenolic, flavonoid, flavanol, and monomeric anthocyanin contents in the skin and wine significantly increased with grape density; however, there was no significant difference in the seeds between the two lower densities. The highest values of DPPH free radical-scavenging activity, cupric-reducing antioxidant capacity, and hydroxyl radical-scavenging activity in the skin, seed and wine were detected for the densest berries. The sum of individual phenolic compounds in skin, seed and wine increased with berry density, though no significant difference for skin was observed between the two higher density classes. Hence, the chemical components of Meili grapes and wines were positively associated with the berry density at harvest under the continental monsoon climate. PMID:26974974

Leaf blade and petiole nutritional diagnosis for Vitis vinifera L. cv. 'Tempranillo' by deviation from optimum percentage method

Energy Technology Data Exchange (ETDEWEB)

Romero, I.; Benito, A.; Dominguez, N.; Garcia-Escudero, E.

2014-06-01

Deviation from optimum percentage (DOP) is a diagnosis methodology for leaf analyses which expresses the deviation for each element with respect to its optimal concentration. This deviation is an individual index for each nutrient and allows the sorting of all the analyzed nutrients according to their limitations. A nutritional survey was undertaken over eleven years in La Rioja (Spain), to establish reference concentrations for the nutritional diagnosis of Vitis vinifera L., cv. 'Tempranillo' grafted on Richter-110. Reference concentrations for DOP methodology are proposed, and sensibility for the nutritional diagnosis was evaluated for blade and petiole analysis of N, P, K, Ca, Mg, Fe, Mn, Zn, Cu, and B at flowering and veraison phenological stages by comparison between DOP and sufficiency ranges (SR) methods. Results suggest that petiole has lower sensibility than blade to detect deficiencies or excesses of N, P, K, Ca, Mg, Zn, and Mn at veraison. In addition, petiole is a better tissue than blade to detect Fe and B deficiencies or excesses. Therefore, our results make possible the right choice between tissues, leaf blade or petiole, for a general nutritional diagnosis of 'Tempranillo' grapevines. On the other hand, it is possible to evaluate the status of each nutrient in each phonological stage analyzing both tissues and comparing the nutrient status to its references, DOP or SR, in the most adequate tissue. (Author)

Effects of Bois noir on carbon assimilation, transpiration, stomatal conductance of leaves and yield of grapevine (Vitis vinifera) cv. Chardonnay.

Science.gov (United States)

Endeshaw, Solomon T; Murolo, Sergio; Romanazz, Gianfranco; Neri, Davide

2012-06-01

Bois noir (BN) is one of the main phytoplasma diseases of grapevine (Vitis vinifera). It is widespread, and can cause severe losses in European vineyards. The infective agent colonizes phloem elements and induces visible symptoms of leaf yellowing or reddening after a relatively long incubation period. As the most sensitive cultivars to BN, Chardonnay plants were grouped as healthy or symptomatic in spring, based on the records from the previous year. Leaf gas exchange and chlorophyll a fluorescence were measured weekly from July to September in healthy plants, and in symptomatic and asymptomatic leaves from symptomatic plants. The midday relative water content (mRWC) was measured once per month. The detection of phytoplasma DNA by nested-polymerase chain reaction revealed BN infection in symptomatic leaf samples at the end of September. A significant decrease in pigment content and maximum quantum efficiency of photosystem II (Fv/Fm) of these symptomatic leaves was detected from July to September, although in the asymptomatic leaves of the symptomatic plants the net photosynthesis (Pn) decrease was not significant. In the leaves from the healthy plants, Pn and transpiration were relatively stable. Of note, in July, an initially healthy plant showed a strong Pn reduction that was followed by visible leaf yellowing symptoms only in August. The phytoplasma infection also stimulated significant reductions in mRWC of the symptomatic leaves, with a final large decrease in yield.

Evaluation of the Anti-Inflammatory Activity of Raisins (Vitis vinifera L. in Human Gastric Epithelial Cells: A Comparative Study

Directory of Open Access Journals (Sweden)

Chiara Di Lorenzo

2016-07-01

Full Text Available Raisins (Vitis vinifera L. are dried grapes largely consumed as important source of nutrients and polyphenols. Several studies report health benefits of raisins, including anti-inflammatory and antioxidant properties, whereas the anti-inflammatory activity at gastric level of the hydro-alcoholic extracts, which are mostly used for food supplements preparation, was not reported until now. The aim of this study was to compare the anti-inflammatory activity of five raisin extracts focusing on Interleukin (IL-8 and Nuclear Factor (NF-κB pathway. Raisin extracts were characterized by High Performance Liquid Chromatography-Diode Array Detector (HPLC-DAD analysis and screened for their ability to inhibit Tumor necrosis factor (TNFα-induced IL-8 release and promoter activity in human gastric epithelial cells. Turkish variety significantly inhibited TNFα-induced IL-8 release, and the effect was due to the impairment of the corresponding promoter activity. Macroscopic evaluation showed the presence of seeds, absent in the other varieties; thus, hydro-alcoholic extracts from fruits and seeds were individually tested on IL-8 and NF-κB pathway. Seed extract inhibited IL-8 and NF-κB pathway, showing higher potency with respect to the fruit. Although the main effect was due to the presence of seeds, the fruit showed significant activity as well. Our data suggest that consumption of selected varieties of raisins could confer a beneficial effect against gastric inflammatory diseases.

A comparative ecophysiology of ecolly (vitis vinifera l.) under the traditional independent long-stem pruning and crawled cordon training

International Nuclear Information System (INIS)

Nan, L.; Zhao, X.; Liu, L.; Wang, H.; Li, H.

2014-01-01

The aim of this study was to compare the ecophysiology character of Ecolly grape (Vitis vinifera L.) with the new technology-single crawled cordon training (SCCT) and traditional method-independent long-stem pruning (ILSP). The connections among net photosynthesis rate (Pn), transpiration rate (Tr), instantaneous water utilization efficiency (WUEi), stomatal conductance (Cs) and intercellular CO/sub 2/ concentration (Ci) were always mutual and inextricable in the trial. The leaves in every stage had the highest Pn respectively when growing under the light irradiance of the different period. The ILSP showed a lower total photosynthetic capacity than the SCCT. There was the total semblable Tr for two pruning plants, but lower Tr in ILSP at the every position of the prior stage and riping stage (PS and RS) excluding the growing stage (GS). The WUEi declined because of the net CO/sub 2/ assimilation saturated and the transpiration constantly fleetly increased before the photosynthetic active radiation (PAR) increased to 600 meu mol m/sup -2/ s/sup -1/. The increased WUEis from the first to the second stage deduced that stomatal closure at high irradiance reduced more Tr than Pn, while the values decreased again in the last stage indicated that stomatal opening at low irradiance added more Tr than Pn. These results suggested that it may be possible technology to change trellises in order to obtain better ecophysiology character in this study. The growth variability of vine may be affected by a particular training style. (author)

Modified constraint-induced movement therapy and modified forced-use therapy for stroke patients are both effective to promote balance and gait improvements Terapia de constrição com indução do movimento e terapia de uso forçado modificadas em pacientes pós-acidente vascular encefálico são eficientes em promover melhora do equilíbrio e da marcha

Directory of Open Access Journals (Sweden)

Amanda C. Fuzaro

2012-04-01

ção com indução do movimento (CIMT foram desenvolvidas objetivando a reversão do desuso aprendido do membro superior parético. Não se encontrou na literatura quais seriam os possíveis efeitos dessas técnicas na reabilitação da marcha e do equilíbrio. OBJETIVOS: Avaliar o efeito da FUT e da CIMT modificadas (mFUT e mCIMT na marcha e no equilíbrio durante quatro semanas de tratamento e três meses de seguimento. MÉTODOS: Este estudo incluiu 37 sujeitos hemiparéticos pós-AVE, divididos em dois grupos com base no protocolo de tratamento. A imobilização do membro superior não-parético foi feita por 23 horas ao dia, cinco dias por semana. Os sujeitos foram avaliados no início, durante quatro semanas de tratamento e três meses de acompanhamento. Para a avaliação, utilizou-se a Escala de Impacto do AVE (SIS, Berg Balance Scale (BBS e Fugl-Meyer Motor Assesment (FM. Para a marcha, utilizou-se o teste de caminhada de 10 metros (T10 e Timed Up & Go test (TUG. RESULTADOS: Ambos os grupos revelaram um melhor estado de saúde (SIS, melhor equilíbrio, com melhor utilização dos membros inferiores (BBS e FM e maior velocidade na marcha (T10 e TUG durante tratamento e seguimento em comparação com o início. CONCLUSÃO: Os resultados mostram que a mFUT e a mCIMT são eficazes para a reabilitação do equilíbrio e da marcha.

Molecular cloning and functional analysis of two FAD2 genes from American grape (Vitis labrusca L.).

Science.gov (United States)

Lee, Kyeong-Ryeol; Kim, Sun Hee; Go, Young-Sam; Jung, Sung Min; Roh, Kyung Hee; Kim, Jong-Bum; Suh, Mi-Chung; Lee, Sukchan; Kim, Hyun Uk

2012-11-10

The synthesis of polyunsaturated fatty acids (PUFAs), the most abundant fatty acids in plants, begins with a reaction catalyzed by fatty acid desaturase 2 (FAD2; EC 1.3.1.35), also called microsomal oleate Δ12-desaturase. Since the FAD2 gene was first identified in Arabidopsis thaliana, FAD2 research has gained wide interest as the essential enzyme for synthesizing PUFA. Grapes are one of the most frequently cultivated fruits in the world, with most commercial growers cultivating Vitis vinifera and V. labrusca. Grapeseed oil contains a high proportion, 60-70% of linoleic acid (18:2). We cloned two putative FAD2 genes from V. labrusca cv. Campbell Early based on V. vinifera genome sequences. Deduced amino acid sequences of two putative genes showed that VlFAD2s show high similarity to Arabidopsis FAD2 and commonly contain six transmembrane domain, three histidine boxes and endoplasmic reticulum (ER) retrieval motif representing the characteristics of fatty acid desaturase. Phylogenetic analyses of various plant FAD2s showed that VlFAD2-1 and VlFAD2-2 are separately grouped with constitutive and seed-type FAD2s, respectively. Southern blot showed that one or two bands are found in each lane. Because Campbell Early is a hybrid cultivar, FAD2-1 and FAD2-2 genes may exist as one copy in V. labrusca. Expression analysis in different tissues indicated that VlFAD2-1 is a constitutive gene but VlFAD2-2 is a seed-type gene. Complementation experiments of fad2-1 mutant Arabidopsis with VlFAD2-1 or VlFAD2-2 demonstrated that VlFAD2-1 and VlFAD2-2 can restore low PUFA proportion of fad2 to normal PUFA proportion. Copyright © 2012 Elsevier B.V. All rights reserved.

Effects of Grapevine Leafroll associated Virus 3 (GLRaV-3) and duration of infection on fruit composition and wine chemical profile of Vitis vinifera L. cv. Sauvignon blanc.

Science.gov (United States)

Montero, R; Mundy, D; Albright, A; Grose, C; Trought, M C T; Cohen, D; Chooi, K M; MacDiarmid, R; Flexas, J; Bota, J

2016-04-15

In order to determine the effects of Grapevine Leafroll associated Virus 3 (GLRaV-3) on fruit composition and chemical profile of juice and wine from Vitis vinifera L. cv. Sauvignon blanc grown in New Zealand, composition variables were measured on fruit from vines either infected with GLRaV-3 (established or recent infections) or uninfected vines. Physiological ripeness (20.4°Brix) was the criterion established to determine the harvest date for each of the three treatments. Date of grape ripeness was strongly affected by virus infection. In juice and wine, GLRaV-3 infection prior to 2008 reduced titratable acidity compared with the uninfected control. Differences observed in amino acids from the three infection status groups did not modify basic wine chemical properties. In conclusion, GLRaV-3 infection slowed grape ripening, but at equivalent ripeness to result in minimal effects on the juice and wine chemistry. Time of infection produced differences in specific plant physiological variables. Copyright © 2015 Elsevier Ltd. All rights reserved.

Distribution of Rotundone and Possible Translocation of Related Compounds Amongst Grapevine Tissues in Vitis vinifera L. cv. Shiraz

Science.gov (United States)

Zhang, Pangzhen; Fuentes, Sigfredo; Wang, Yueying; Deng, Rui; Krstic, Mark; Herderich, Markus; Barlow, Edward W. R.; Howell, Kate

2016-01-01

Rotundone is an attractive wine aroma compound, especially important for cool climate Shiraz. Its presence in wine is mainly from the grape skin, but can also be found in non-grape tissues, such as leaves and stems. Whether rotundone is produced independently within different grapevine tissues or transported amongst non-grape tissues and grape berries remains unclear. The current study investigated the distribution of this compound in different vine tissues during development and studied the most likely mode of rotundone translocation—via phloem—using stable isotope feeding. In addition, local production of rotundone induced by herbivore feeding was assessed. Results showed that rotundone was firstly detected in the petioles and peduncles/rachises within the development of Vitis vinifera L. cv. Shiraz. Different grapevine tissues had a similar pattern of rotundone production at different grape developmental stages. In the individual vine shoots, non-grape tissues contained higher concentrations and amounts of rotundone compared to berries, which showed that non-grape tissues were the larger pool of rotundone within the plant. This study confirmed the local production of rotundone in individual tissues and ruled out the possibility of phloem translocation of rotundone between different tissues. In addition, other terpenes, including one monoterpenoid (geraniol) and six sesquiterpenes (clovene, α-ylangene, β-copaene, α-muurolene, δ-cadinene, and cis/trans-calamenene) were, for the first time, detected in the ethylenediaminetetraacetic acid-facilitated petiole phloem exudates, with their originality unconfirmed. Unlike other herbivore-induced terpenes, herbivorous activity had limited influences on the concentration of rotundone in grapevine leaves. PMID:27446104

Characterization of genomic sequence showing strong association with polyembryony among diverse Citrus species and cultivars, and its synteny with Vitis and Populus.

Science.gov (United States)

Nakano, Michiharu; Shimada, Takehiko; Endo, Tomoko; Fujii, Hiroshi; Nesumi, Hirohisa; Kita, Masayuki; Ebina, Masumi; Shimizu, Tokurou; Omura, Mitsuo

2012-02-01

Polyembryony, in which multiple somatic nucellar cell-derived embryos develop in addition to the zygotic embryo in a seed, is common in the genus Citrus. Previous genetic studies indicated polyembryony is mainly determined by a single locus, but the underlying molecular mechanism is still unclear. As a step towards identification and characterization of the gene or genes responsible for nucellar embryogenesis in Citrus, haplotype-specific physical maps around the polyembryony locus were constructed. By sequencing three BAC clones aligned on the polyembryony haplotype, a single contiguous draft sequence consisting of 380 kb containing 70 predicted open reading frames (ORFs) was reconstructed. Single nucleotide polymorphism genotypes detected in the sequenced genomic region showed strong association with embryo type in Citrus, indicating a common polyembryony locus is shared among widely diverse Citrus cultivars and species. The arrangement of the predicted ORFs in the characterized genomic region showed high collinearity to the genomic sequence of chromosome 4 of Vitis vinifera and linkage group VI of Populus trichocarpa, suggesting that the syntenic relationship among these species is conserved even though V. vinifera and P. trichocarpa are non-apomictic species. This is the first study to characterize in detail the genomic structure of an apomixis locus determining adventitious embryony. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.

Vol draadwerk

African Journals Online (AJOL)

Owner

Die motto van Marius Crous se derde bundel,. Vol draadwerk (2012) is ontleen aan die vader van die psigoanalise, Sigmund Freud, wat lui: “Everywhere I go I find a poet has been there before me.” Vol draadwerk verskyn ses jaar ná sy vorige bundel, Aan 'n beentjie sit en kluif. (2006). Vir sy bundel, Brief uit die kolonies ...

EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA); Scientific Opinion on the substantiation of a health claim related to Vitis vinifera L. seeds extract and “helps to decrease swollen legs” pursuant to Article 13(5) of Regulation (EC) No 1924/2006

DEFF Research Database (Denmark)

Tetens, Inge

Following an application from Nutrilinks Sarl, submitted pursuant to Article 13(5) of Regulation (EC) No 1924/2006 via the Competent Authority of Belgium, the Panel on Dietetic Products, Nutrition and Allergies (NDA) was asked to deliver an opinion on the scientific substantiation of a health claim...... related to Vitis vinifera L. seeds extract and “helps to decrease swollen legs”. The Panel considers that the food constituent which is the subject of the health claim is sufficiently characterised. Upon EFSA’s request for clarification, the applicant stated that the claimed effect was “helps to decrease...

Ferro e neurodegeneração = Iron and neurodegeneration

Directory of Open Access Journals (Sweden)

Fernandez, Liana L.

2007-01-01

Conclusões: a revisão da literatura sugere que o estresse oxidativo, associado ao desequilíbrio na homeostase do ferro, seja uma via importante em relação à patogênese da neurodegeneração. Esses dados requerem novas investigações para esclarecer se este desequilíbrio é causa ou conseqüência do processo neurodegenerativo

Aging effect on the pigment composition and color of Vitis vinifera L. Cv. Tannat wines. Contribution of the main pigment families to wine color.

Science.gov (United States)

Boido, Eduardo; Alcalde-Eon, Cristina; Carrau, Francisco; Dellacassa, Eduardo; Rivas-Gonzalo, Julian C

2006-09-06

Red wines made from Vitis vinifera L. cv. Tannat grapes are known to possess high contents of tannins and intense color, features that are responsible for the originality of these wines. This work aimed to study the evolution of the pigment composition and CIELAB color parameters as Tannat wines become older, as well as to establish the contribution to wine color of the main pigment families. Tannat wines produced in Uruguay from grapes of the same vineyard in six consecutive vintages (1998-2003) and Tannat grapes of the 2003 harvest were analyzed by means of HPLC-DAD-MS and UV-vis spectrometric techniques. The correlations between the different pigment families and the CIELAB parameters revealed the importance of the variations of the percentage, found in anthocyanins and flavanol-anthocyanin acetaldehyde-mediated condensation products (decrease) and pyranoanthocyanins and direct condensation products (increase), in the modification of the color from purple-red hues to more orange-red ones. The color suffered qualitative rather than quantitative changes, that is, the hue (h*ab) increased, whereas the chroma (C*ab) and lightness (L) did not show a defined trend with time.

Effect of rain-shelter cultivation of Vitis vinifera cv. Cabernet Gernischet on the phenolic profile of berry skins and the incidence of grape diseases.

Science.gov (United States)

Meng, Jiang-Fei; Ning, Peng-Fei; Xu, Teng-Fei; Zhang, Zhen-Wen

2012-12-27

Rain-shelter cultivation is an effective cultural method to prevent rainfall damage during grape harvest and widely applied in the Chinese rainy regions. In this study we investigated the effect of rain-shelter cultivation on grape diseases and phenolic composition in the skins of Vitis vinifera cv. Cabernet Gernischet grape berries through the comparison with open-field cultivation at two vintages (2010 and 2011). The results showed that rain-shelter cultivation reduced the incidence of grape diseases significantly and delayed the maturation of Cabernet Gernischet fruits. With regards to most of the phenolic compounds identified in this study, their content in grape samples under rain-shelter cultivation was decreased compared to those under open-field cultivation. However, rain-shelter cultivation stimulated the accumulation of dihydroquercetin-3-O-rhamnoside in grape skins during grape maturation. These were related with micrometeorological alterations in vineyards by using plastic covering under rain-shelter cultivation. It suggests the rain-shelter cultivation makes possible the cultivation of "Cabernet Gernischet" grapes in an organic production system, for providing a decrease in the incidence of diseases and the dependence on chemical pesticides in the grape and wine industry.

Isolation and characterization of a Vitis vinifera transcription factor, VvWRKY1, and its effect on responses to fungal pathogens in transgenic tobacco plants.

Science.gov (United States)

Marchive, Chloé; Mzid, Rim; Deluc, Laurent; Barrieu, François; Pirrello, Julien; Gauthier, Adrien; Corio-Costet, Marie-France; Regad, Farid; Cailleteau, Bernard; Hamdi, Saïd; Lauvergeat, Virginie

2007-01-01

Pathogen attack represents a major problem for viticulture and for agriculture in general. At present, the use of phytochemicals is more and more restrictive, and therefore it is becoming essential to control disease by having a thorough knowledge of resistance mechanisms. The present work focused on the trans-regulatory proteins potentially involved in the control of the plant defence response, the WRKY proteins. A full-length cDNA, designated VvWRKY1, was isolated from a grape berry library (Vitis vinifera L. cv. Cabernet Sauvignon). It encodes a polypeptide of 151 amino acids whose structure is characteristic of group IIc WRKY proteins. VvWRKY1 gene expression in grape is regulated in a developmental manner in berries and leaves and by various signal molecules involved in defence such as salicylic acid, ethylene, and hydrogen peroxide. Biochemical analysis indicates that VvWRKY1 specifically interacts with the W-box in various nucleotidic contexts. Functional analysis of VvWRKY1 was performed by overexpression in tobacco, and transgenic plants exhibited reduced susceptibility to various fungi but not to viruses. These results are consistent with a possible role for VvWRKY1 in grapevine defence against fungal pathogens.

Effect of Rain-Shelter Cultivation of Vitis vinifera cv. Cabernet Gernischet on the Phenolic Profile of Berry Skins and the Incidence of Grape Diseases

Directory of Open Access Journals (Sweden)

Teng-Fei Xu

2012-12-01

Full Text Available Rain-shelter cultivation is an effective cultural method to prevent rainfall damage during grape harvest and widely applied in the Chinese rainy regions. In this study we investigated the effect of rain-shelter cultivation on grape diseases and phenolic composition in the skins of Vitis vinifera cv. Cabernet Gernischet grape berries through the comparison with open-field cultivation at two vintages (2010 and 2011. The results showed that rain-shelter cultivation reduced the incidence of grape diseases significantly and delayed the maturation of Cabernet Gernischet fruits. With regards to most of the phenolic compounds identified in this study, their content in grape samples under rain-shelter cultivation was decreased compared to those under open-field cultivation. However, rain-shelter cultivation stimulated the accumulation of dihydroquercetin-3-O-rhamnoside in grape skins during grape maturation. These were related with micrometeorological alterations in vineyards by using plastic covering under rain-shelter cultivation. It suggests the rain-shelter cultivation makes possible the cultivation of “Cabernet Gernischet” grapes in an organic production system, for providing a decrease in the incidence of diseases and the dependence on chemical pesticides in the grape and wine industry.

As mudanças climáticas e seus impactos no reino da vida: perspectivas para um futuro não apocalíptico

Directory of Open Access Journals (Sweden)

Leo Pessini

2016-10-01

Full Text Available Clima e saúde humana relacionam-se profundamente. Se o equilíbrio entre ambos ajuda a todos na qualidade de vida, o desequilíbrio prejudica principalmente os mais pobres. A exploração predatória da natureza em vista do progresso humano tem sido a principal causa de desiquilíbrios. Se a humanidade não optar em colocar as pessoas em primeiro lugar, e a economia como um meio, e não como um fim, e não substituir o ideal de produtividade pelo da equidade e a competitividade pela solidariedade, o atual modelo de desenvolvimento se tornará uma ameaça ainda maior tanto para o clima como para a saúde humana.

Commercial Digital Camera to Estimate Postharvest Leaf Area Index in Vitis vinifera L. cv. Cabernet Sauvignon on a Vertical Trellis Uso de una Cámara Digital Comercial para Estimar el Índice de Área Foliar en Vitis vinifera L. cv. Cabernet Sauvignon en Poscosecha Conducida en Espaldera Vertical

Directory of Open Access Journals (Sweden)

Miguel Espinosa L.

2010-06-01

Full Text Available The leaf area index (LAI of a vineyard (Vitis vinifera L. cv. Cabernet Sauvignon located in the commune of Cauquenes, Maule Region in Chile, was estimated from digital images obtained with a commercial camera using two indirect methods: Leaf Area Gap and Brightness (LAGB and -Photogrammetric Leaf Area Quantification System (PLAQS. The latter requires deleafing of the grapevine. In a normalized difference vegetation index (NDVI map, three points of vine vigor were selected: high, medium, and low for which horizontal and vertical images were obtained. Images were filtered with the Arc View GIS 3.1 program to provide only leaf images and corresponding pixel numbers. Image area and square meters per linear meter were calculated. The best models were selected from  three linear regression adjustments: i LAI of LAGB vertical images of with LAI of PLAQS, ii LAI of PLAQS horizontal images with and, iii LAI of both types of images with PLAQS. The parameters in all models were significant. Adjustment between the LAGB and PLAQS vertical images provides greater simplicity and easy calculation since it requires only a vertical image to estimate LAI. Images thus obtained can accurately estimate LAI in this type of cultivar.En un viñedo (Vitis vinifera L. cv. Cabernet Sauvignon ubicado en la comuna de Cauquenes, Región del Maule, se estimó el índice de área foliar (LAI mediante imagen digital obtenida de una cámara fotográfica comercial, a partir de dos métodos indirectos: Espacio y Brillo Área Foliar (LAGB y Sistema Cuantificador de Área Foliar por Fotogrametría (PLAQS. Este último, requiere el deshoje de la parra. En un mapa de índice vegetativo diferencial normalizado (NDVI, se seleccionaron tres puntos de vigor de las vides: alto, medio y bajo, en cada uno de los cuales se obtuvo una imagen horizontal y vertical. Las imágenes se filtraron con el programa Arc View GIS 3.1, dejando sólo las hojas y el número de píxeles correspondientes. Se

ECOLOGIA ORGANIZACIONAL E O ÓTIMO DE PARETO: ENSAIO SOBRE A FORMAÇÃO DO ECOSSISTEMA EM EQUILÍBRIO

Directory of Open Access Journals (Sweden)

Lucas Roberto da Silva Dias

2007-05-01

Full Text Available ResumoEste trabalho visa oferecer, de forma complementar e particular, os pressupostos da teoria da Ecologia Organizacional. Tais pressupostos incidem sobre o questionamento da existência de um elevado número de diversidade organizacional. Assim, discute-se que a grande diversidade das formas organizacionais deve-se ao fato destas buscarem atender às contingências ambientais através da diversificação, e não pela mudança adaptativa, conforme proposto pela teoria de contingências. Por possuírem formas estruturais isomórficas mesmo em situações diferenciadas, as organizações sofrem pressões quanto ao processo de seleção imposto pelos ambientes nos quais estão inseridas, configurando assim, o denominado determinismo ambiental. Buscando alcançar tais preceitos, a literatura existente foca seus estudos nas taxas de fundação e fracasso organizacionais, crendo que estas [as organizações] estão em constante processo de seleção mercadológica. Neste contexto, este trabalho buscará [de forma didática] através da utilização das ferramentas de análise microeconômica denominadas Caixa de Edgeworth e Ótimo de Pareto, apresentar e corroborar com os pressupostos da teoria da Ecologia Organizacional, tendo como premissa a existência de uma comunidade organizacional sempre “tendendo” à formação de uma comunidade equilibrada, ou seja, a busca por um ecossistema em equilíbrio. ABSTRACT The aim of this work is to offer the presuppositions of the theory of the Organizational Ecology in a complementally and personal way. Such presuppositions are based on the question about the existence of a high organizational diversity. Thus, the literature discusses that the high organizational diversity is linked to the fact that the organizations answer to the environmental contingencies through the diversification, and not through the adaptive learning, as proposed by the theory of contingencies. Because the organizations maintain

Frost Grape Polysaccharide (FGP), an Emulsion-Forming Arabinogalactan Gum from the Stems of Native North American Grape Species Vitis riparia Michx.

Science.gov (United States)

Price, Neil P J; Vermillion, Karl E; Eller, Fred J; Vaughn, Steven F

2015-08-19

A new arabinogalactan is described that is produced in large quantity from the cut stems of the North American grape species Vitis riparia (Frost grape). The sugar composition consists of l-arabinofuranose (l-Araf, 55.2%) and d-galactopyranose (d-Galp 30.1%), with smaller components of d-xylose (11.2%), d-mannose (3.5%), and glucuronic acid (GlcA, ∼2%), the latter linked via a galactosyl residue. Permethylation identified 3-linked Galp residues, some substituted at the 2-position with Galp or Manp, terminal Araf and Xylp, and an internal 3-substituted Araf. NMR (HSQC, TOCSY, HMBC, DOSY) identified βGalp and three αAraf spin systems, in an Araf-α1,3-Araf-α1,2-Araf-α1,2-Galp structural motif. Diffusion-ordered NMR showed that the FGP has a molecular weight of 1-10 MDa. Unlike gum arabic, the FGP does not contain a hydroxyproline-rich protein (HPRP). FGP forms stable gels at >15% w/v and at 1-12% solutions are viscous and are excellent emulsifiers of flavoring oils (grapefruit, clove, and lemongrass), giving stable emulsions for ≥72 h. Lower concentrations (0.1% w/v) were less viscous, yet still gave stable grapefruit oil/water emulsions. Hence, FGP is a β1,3-linked arabinogalactan with potential as a gum arabic replacement in the food and beverage industries.

Berry ripening, pre-processing and thermal treatments affect the phenolic composition and antioxidant capacity of grape (Vitis vinifera L.) juice.

Science.gov (United States)

Genova, Giuseppe; Tosetti, Roberta; Tonutti, Pietro

2016-01-30

Grape juice is an important dietary source of health-promoting antioxidant molecules. Different factors may affect juice composition and nutraceutical properties. The effects of some of these factors (harvest time, pre-processing ethylene treatment of grapes and juice thermal pasteurization) were here evaluated, considering in particular the phenolic composition and antioxidant capacity. Grapes (Vitis vinifera L., red-skinned variety Sangiovese) were collected twice in relation to the technological harvest (TH) and 12 days before TH (early harvest, EH) and treated with gaseous ethylene (1000 ppm) or air for 48 h. Fresh and pasteurized (78 °C for 30 min) juices were produced using a water bath. Three-way analysis of variance showed that the harvest date had the strongest impact on total polyphenols, hydroxycinnamates, flavonols, and especially on total flavonoids. Pre-processing ethylene treatment significantly increased the proanthocyanidin, anthocyanin and flavan-3-ol content in the juices. Pasteurization induced a significant increase in anthocyanin concentration. Antioxidant capacity was enhanced by ethylene treatment and pasteurization in juices from both TH and EH grapes. These results suggest that an appropriate management of grape harvesting date, postharvest and processing may lead to an improvement in nutraceutical quality of juices. Further research is needed to study the effect of the investigated factors on juice organoleptic properties. © 2015 Society of Chemical Industry.

The year of political advertising - now! / Marius Vaupsas

Index Scriptorium Estoniae

Vaupsas, Marius

2004-01-01

BBDO Lukrecijos Reklama juht prognoosib 2004. aastat Leedu reklaamiturul, poliitilisest reklaamist, poliitikute ja reklaamispetsialistide vahelistest suhetest ning reklaamiagentuuride rollist poliitilistes valimiskampaaniates. Lisa: Some examples of successful cooperation

Decentralized and Modular Electrical Architecture

Science.gov (United States)

Elisabelar, Christian; Lebaratoux, Laurence

2014-08-01

This paper presents the studies made on the definition and design of a decentralized and modular electrical architecture that can be used for power distribution, active thermal control (ATC), standard inputs-outputs electrical interfaces.Traditionally implemented inside central unit like OBC or RTU, these interfaces can be dispatched in the satellite by using MicroRTU.CNES propose a similar approach of MicroRTU. The system is based on a bus called BRIO (Bus Réparti des IO), which is composed, by a power bus and a RS485 digital bus. BRIO architecture is made with several miniature terminals called BTCU (BRIO Terminal Control Unit) distributed in the spacecraft.The challenge was to design and develop the BTCU with very little volume, low consumption and low cost. The standard BTCU models are developed and qualified with a configuration dedicated to ATC, while the first flight model will fly on MICROSCOPE for PYRO actuations and analogue acquisitions. The design of the BTCU is made in order to be easily adaptable for all type of electric interface needs.Extension of this concept is envisaged for power conditioning and distribution unit, and a Modular PCDU based on BRIO concept is proposed.

Inhibition of Grape Crown Gall by Agrobacterium vitis F2/5 Requires Two Nonribosomal Peptide Synthetases and One Polyketide Synthase.

Science.gov (United States)

Zheng, Desen; Burr, Thomas J

2016-02-01

Agrobacterium vitis nontumorigenic strain F2/5 is able to inhibit crown gall disease on grapevines. The mechanism of grape tumor inhibition (GTI) by F2/5 has not been fully determined. In this study, we demonstrate that two nonribosomal peptide synthetase (NRPS) genes (F-avi3342 and F-avi5730) and one polyketide synthase gene (F-avi4330) are required for GTI. Knockout of any one of them resulted in F/25 losing GTI capacity. We previously reported that F-avi3342 and F-avi4330 but not F-avi5730 are required for induction of grape tissue necrosis and tobacco hypersensitive response. F-avi5730 is predicted to encode a single modular NRPS. It is located in a cluster that is homologous to the siderophore vicibactin biosynthesis locus in Rhizobium species. Individual disruption of F-avi5730 and two immediate downstream genes, F-avi5731 and F-avi5732, all resulted in reduced siderophore production; however, only F-avi5730 was found to be required for GTI. Complemented F-avi5730 mutant (ΔF-avi5730(+)) restored a wild-type level of GTI activity. It was determined that, over time, populations of ΔF-avi4330, ΔF-avi3342, and ΔF-avi5730 at inoculated wound sites on grapevine did not differ from those of ΔF-avi5730(+) indicating that loss of GTI was not due to reduced colonization of wound sites by mutants.

Characterization of a Vitis vinifera cv. Cabernet Sauvignon 3',5'-O-methyltransferase showing strong preference for anthocyanins and glycosylated flavonols.

Science.gov (United States)

Lücker, Joost; Martens, Stefan; Lund, Steven T

2010-09-01

At ripening initiation in red grapevine (Vitis vinifera) berries, the exocarp turns color from green to red and then to purple due to the accumulation and extent of methylation of anthocyanins. The accumulation of transcripts encoding an O-methyltransferase was recently shown to be closely correlated with the onset of ripening and the degree of blue/purple pigmentation in grapevine berries; however, the biochemical function of this gene has remained uncharacterized. In this study, an O-methyltransferase cDNA that showed a distinct expression pattern when compared to closely related sequences was expressed in Escherichia coli and enzyme assays were carried out with a broad array of anthocyanin and other flavonoid substrates. We demonstrate that this enzyme carries out 3',5'-O-methylation of anthocyanins and flavonol compounds in vitro, which are known to be present in grape berries, with a preference for glycosylated substrates. The highest relative specific activity for the enzyme was found with delphinidin 3-O-glucoside as substrate. The enzyme is not able to methylate flavan type skeletons with chiral centers, such as either catechins or dihydroquercetin. The enzyme showed negligible specific activity for caffeoyl-CoA, compared to flavonol and anthocyanin substrates. Phylogenetic analysis of the O-methyltransferase suggests that it may be a member of a distinct subclass of Type 2 bivalent metal-dependent S-adenosyl-methionine O-methyltransferases. (c) 2010. Published by Elsevier Ltd. All rights reserved.

Simultaneous determination of phenolic compounds in Cynthiana grape (Vitis aestivalis) by high performance liquid chromatography-electrospray ionisation-mass spectrometry.

Science.gov (United States)

Ramirez-Lopez, L M; McGlynn, W; Goad, C L; Mireles Dewitt, C A

2014-04-15

Phenolic acids, flavanols, flavonols and stilbenes (PAFFS) were isolated from whole grapes, juice, or pomace and purified using enzymatic hydrolysis. Only anthocyanin mono-glucosides and a few of the oligomers from Cynthiana grape (Vitis aestivalis) were analysed. Flavonoid-anthocyanin mono-glucosides (FA) were isolated using methanol/0.1% hydrochloric acid extraction. In addition, crude extractions of phenolic compounds from Cynthiana grape using 50% methanol, 70% methanol, 50% acetone, 0.01% pectinase, or petroleum ether were also evaluated. Reverse phase high performance liquid chromatography (RP-HPLC) with photodiode array (PDA) detector was used to identify phenolic compounds. A method was developed for simultaneous separation, identification and quantification of both PAFFS and FA. Quantification was performed by the internal standard method using a five points regression graph of the UV-visible absorption data collected at the wavelength of maximum absorbance for each analyte. From whole grape samples nine phenolic compounds were tentatively identified and quantified. The individual phenolic compounds content varied from 3 to 875 mg kg⁻¹ dry weight. For juice, twelve phenolic compounds were identified and quantified. The content varied from 0.07 to 910 mg kg⁻¹ dry weight. For pomace, a total of fifteen phenolic compounds were tentatively identified and quantified. The content varied from 2 mg kg⁻¹ to 198 mg kg⁻¹ dry matter. Results from HPLC analysis of the samples showed that gallic acid and (+)-catechin hydrate were the major phenolic compounds in both whole grapes and pomace. Cyanidin and petunidin 3-O-glucoside were the major anthocyanin glucosides in the juice. Published by Elsevier Ltd.

Influence of constitutive phenolic compounds on the response of grapevine (Vitis vinifera L.) leaves to infection by Plasmopara viticola.

Science.gov (United States)

Latouche, Gwendal; Bellow, Sébastien; Poutaraud, Anne; Meyer, Sylvie; Cerovic, Zoran G

2013-01-01

Flavonols and hydroxycinnamic acids are known to contribute to plant resistance against pathogens, but there are few reports on the implication of flavonols in the resistance of grapevine against Plasmopara viticola, and none on the involvement of hydroxycinnamic acids. In order to analyze the effect of flavonols on P. viticola infection, variable amounts of flavonols were induced by different light conditions in otherwise phenologically identical leaves. Differences in content of leaf hydroxycinnamic acids were induced at the same time. A non-invasive monitoring of flavonols and hydroxycinnamic acids was performed with Dualex leaf-clip optical sensors. Whatever the light condition, there were no significant changes in flavonol or in hydroxycinnamic acid contents for control and inoculated leaves during the development of P. viticola until 6 days after inoculation. The violet-blue autofluorescence of stilbenes, the main phytoalexins of grapevine that accumulate in inoculated leaves, was used as an indicator of infection by P. viticola. The implication of leaf constitutive flavonols and hydroxycinnamic acids in the defence of Vitis vinifera against P. viticola could be investigated in vivo thanks to this indicator. The increase in stilbene violet-blue autofluorescence started earlier for leaves with low flavonol content than for leaves with higher content, suggesting that constitutive flavonols are able to slow down the infection by P. viticola. On the contrary, constitutive hydroxycinnamic acids did not seem to play a role in defence against P. viticola. The non-destructive nature of the methods used alleviates the major problem of destructive experiments: the large variability in leaf phenolic contents.

Flower abscission in Vitis vinifera L. triggered by gibberellic acid and shade discloses differences in the underlying metabolic pathways

Directory of Open Access Journals (Sweden)

Sara eDomingos

2015-06-01

Full Text Available Understanding abscission is both a biological and an agronomic challenge. Flower abscission induced independently by shade and gibberellic acid (GAc sprays was monitored in grapevine (Vitis vinifera L. growing under a soilless greenhouse system during two seasonal growing conditions, in an early and late production cycle. Physiological and metabolic changes triggered by each of the two distinct stimuli were determined. Environmental conditions exerted a significant effect on fruit set as showed by the higher natural drop rate recorded in the late production cycle with respect to the early cycle. Shade and GAc treatments increased the percentage of flower drop compared to the control, and at a similar degree, during the late production cycle. The reduction of leaf gas exchanges under shade conditions was not observed in GAc treated vines. The metabolic profile assessed in samples collected during the late cycle differently affected primary and secondary metabolisms and showed that most of the treatment-resulting variations occurred in opposite trends in inflorescences unbalanced in either hormonal or energy deficit abscission-inducing signals. Particularly concerning carbohydrates metabolism, sucrose, glucose, tricarboxylic acid (TCA metabolites and intermediates of the raffinose family oligosaccharides pathway were lower in shaded and higher in GAc samples. Altered oxidative stress remediation mechanisms and indolacetic acid (IAA concentration were identified as abscission signatures common to both stimuli. According to the global analysis performed, we report that grape flower abscission mechanisms triggered by GAc application and C-starvation are not based on the same metabolic pathways.

Promoting Effect of Foliage Sprayed Zinc Sulfate on Accumulation of Sugar and Phenolics in Berries of Vitis vinifera cv. Merlot Growing on Zinc Deficient Soil

Directory of Open Access Journals (Sweden)

Chang-Zheng Song

2015-02-01

Full Text Available The effect of foliage sprayed zinc sulfate on berry development of Vitis vinifera cv. Merlot growing on arid zone Zn-deficient soils was investigated over two consecutive seasons, 2013 and 2014. Initial zinc concentration in soil and vines, photosynthesis at three berry developmental stages, berry weight, content of total soluble solids, titratable acidity, phenolics and expression of phenolics biosynthetic pathway genes throughout the stages were measured. Foliage sprayed zinc sulfate showed promoting effects on photosynthesis and berry development of vines and the promotion mainly occurred from veraison to maturation. Zn treatments enhanced the accumulation of total soluble solids, total phenols, flavonoids, flavanols, tannins and anthocyanins in berry skin, decreasing the concentration of titratable acidity. Furthermore, foliage sprayed zinc sulfate could significantly influence the expression of phenolics biosynthetic pathway genes throughout berry development, and the results of expression analysis supported the promotion of Zn treatments on phenolics accumulation. This research is the first comprehensive and detailed study about the effect of foliage sprayed Zn fertilizer on grape berry development, phenolics accumulation and gene expression in berry skin, providing a basis for improving the quality of grape and wine in Zn-deficient areas.

Petersonide dünastia teatriaasta mõjukaim

Index Scriptorium Estoniae

2009-01-01

27. märtsil jagas žürii Rakvere Teatris välja teatripreemiad 2008. aasta töö eest. Lavastaja auhinna pälvis Lembit Peterson lavastuste eest "Maarja kuulutamine" ja "Linn" Theatrumis ning Priit Põldroosi preemia oma pedagoogilise tegevuse eest, naisnäitleja auhinnad said Maria Peterson ja Laura Peterson ning meesnäitleja auhinna pälvis Marius Peterson. Lisatud kõikide auhinnasaajate nimekiri

Caractérisations agromorphologique et anatomique du gombo du ...

African Journals Online (AJOL)

(Hamon & Charrier, 1997). Ses fortes teneurs en glucides, protéines, vitamines A et C, en fer, phosphore, potassium et magnésium ont été démontrées par Hamon (1988), Koechlin (1989) et Nzikou et al.(2006). Après le pressage des graines, le tourteau contient 30% de protéines. (Marius et al., 1997). De même, ses vertus.

Tartu Ülikooli Narva Kolledž = Narva College of the University of Tartu

Index Scriptorium Estoniae

2015-01-01

Tartu Ülikooli Narva Kolledž Raekoja plats 2, valminud 2012. Eesti kultuurkapitali aastapreemia 2013. Arhitektid Siiri Vallner, Katrin Koov, Indrek Peil (Kavakava), kaasautorid Heidi Urb, Andro Mänd, Sten-Mark Mändmaa, Maarja Tüür, sisearhitekt Hannes Praks. Kaasa töötasid Kadri Tamme, Kristjan Holm, Liisi Murula, Toomas Pääsuke, Ahti Grünberg, Daniel Marius Reisser, Helen Sarapuu

Rain-Shelter Cultivation Modifies Carbon Allocation in the Polyphenolic and Volatile Metabolism of Vitis vinifera L. Chardonnay Grapes

Science.gov (United States)

Han, Mei-Mei; Yang, Xiao-Fan; Li, Zheng; Wang, Jun; Pan, Qiu-Hong

2016-01-01

This study investigated the effect of rain-shelter cultivation on the biosynthesis of flavonoids and volatiles in grapes, with an aim of determining whether rain-shelter application could help to improve the sensory attributes and quality of grapes. Vitis vinifera L. Chardonnay grapes, grown in the Huaizhuo basin region of northern China, were selected within two consecutive years. A rain-shelter roof was constructed using a colorless polyethylene (PE) film with a light transmittance of 80%. Results showed that rain-shelter treatment did not affect the accumulation of soluble solids during grape maturation. However, the allocation of assimilated carbon in phenolic and volatile biosynthetic pathways varied significantly, leading to alterations in polyphenolic and volatile profiles. The rain-shelter cultivation enhanced the concentration of flavan-3-ols via the flavonoid-3’5’-hydroxylase (F3’5’H) pathway, but reduced the level of flavonols and flavan-3-ols via the flavonoid-3’-hydroxylase (F3’H) pathway. In addition, the rain-shelter cultivation significantly enhanced the synthesis of fatty acid-derived volatiles, isoprene-derived terpenoids and amino acid-derived branched-chain aliphatics, but led to a decrease in the accumulation of isoprene-derived norisoprenoids and amino acid-derived benzenoids. Principal component analysis revealed some key compounds that differentiated the grapes cultivated under open-field and rain-shelter conditions. Moreover, the effect of the rain-shelter application on the accumulation of these compounds appeared to be vintage dependent. The alteration of their profiles caused by the rain-shelter treatment was significant in the vintage that received higher rainfall, which usually took place in the first rapid growth and veraison phases. PMID:27218245

Terminal Posterior Tilted Implants Planned as a Sinus Graft Alternative for Fixed Full-Arch Implant-Supported Maxillary Restoration: A Case Series with 10- to 19-Year Results on 44 Consecutive Patients Presenting for Routine Maintenance.

Science.gov (United States)

Fortin, Yvan; Sullivan, Richard M

2017-02-01

Posterior maxillary tilted implants are gaining prevalence as an alternative to sinus grafts supporting fixed maxillary restorations. This paper reports long-term results after loading using this technique. Consecutive patients presenting for either routine hygiene maintenance or unplanned emergency care who had received tilted implants as a sinus graft alternative to support fixed fully implant-supported restoration of an edentulous maxilla and were followed for a minimum of 10 years from initial implant placement were included in this evaluation. Forty-four patients were identified: 40 with bilateral tilted implants and 4 with one tilted and one axial posterior implant. Eight patients received one-piece fixed porcelain-to-gold screw-retained restorations, and thirty-six patients received a fully implant-supported patient-removable Marius Bridge. Seventy-nine out of 84 originally loaded posterior tilted implants survived a minimum of 10 years loading; one tilted implant was lost at 10 years. Eight additional posterior implants were placed for either these lost tilted posterior implants or as proactive supplemental support; one of these replacement tilted implants survived for at least 10 years and is included in the data. All patients have maintained continuous fixed function throughout the follow-up period. Forty-one out of 44 patients continue with the original restoration, 33 without modification or removal of the fixed restoration or implant-connecting bar. One porcelain-to-gold and seven Marius Bridges had framework modifications to accommodate additional implants; 3 Marius Bridge restorations were replaced with a newer generation. Within the limits of this retrospective study, the results show that continuous fixed function of fully implant-supported maxillary restorations using posterior tilted implants in terminal positions of support as a sinus graft alternative combined with axial anterior implants is possible over a prolonged period. Loss of a posterior

Desequilíbrio entre a oferta e a demanda brasileira por pescados em 2002/2003 e 2008/2009 = Brazilian fishery supply and demand inequality in 2002/2003 and 2008/2009

Directory of Open Access Journals (Sweden)

Daniel Yokoyama Sonoda

2015-01-01

Full Text Available A produção nacional de pescados entre 2003 e 2009 aumentou em 250,54 mil t, o déficit da balança comercial bruta de pescados aumentou em 285,48 mil t, porém, não se constatou elevação do consumo domiciliar bruto de pescados no mesmo período. Este trabalho propõe um método de análise baseado no equilíbrio entre a oferta e a demanda agregada de pescados nos períodos de 2002-2003 e 2008-2009 para verificar se existe a coerência entre o crescimento da oferta e a destinação dos pescados (consumo domiciliar e fora de casa. Os cálculos indicam que enquanto os dados oficiais apontam um crescimento do consumo per capita aparente de 2 kg/hab.ano, os dados corrigidos apresentam um crescimento mais modesto (em torno de 0,6 kg/hab.ano entre os anos de 2002-2003 e 2008-2009. = Brazilian fish production between 2003 and 2009 increased by 250.54 t, gross fish trade deficit increased at 285.48t, but the household consumption of fish was flat in the same period. This paper proposes an analysis of fish aggregate supply and demand balance in the periods of 2002-2003 and 2008-2009 to check the consistency between supply growth and allocation of fish (household consumption and eating out. While official data indicate 2 kg/hab.year increases in apparent per capita fishery consumption, the corrected data shows 0.6 kg/hab.year increase between 2002-2003 and 2008-2009.

Expression of Vitis amurensis VaERF20 in Arabidopsis thaliana Improves Resistance to Botrytis cinerea and Pseudomonas syringae pv. Tomato DC3000

Directory of Open Access Journals (Sweden)

Mengnan Wang

2018-03-01

Full Text Available Ethylene response factor (ERF transcription factors play important roles in regulating immune responses in plants. In our study, we characterized a member of the ERF transcription factor family, VaERF20, from the Chinese wild Vitis genotype, V. amurensis Rupr “Shuangyou”. Phylogenetic analysis indicated that VaERF20 belongs to group IXc of the ERF family, in which many members are known to contribute to fighting pathogen infection. Consistent with this, expression of VaERF20 was induced by treatment with the necrotrophic fungal pathogen Botrytis cinerea (B. cinerea in “Shuangyou” and V. vinifera “Red Globe”. Arabidopsis thaliana plants over-expressing VaERF20 displayed enhanced resistance to B. cinerea and the bacterium Pseudomonas syringae pv. tomato (Pst DC3000. Patterns of pathogen-induced reactive oxygen species (ROS accumulation were entirely distinct in B. cinerea and PstDC3000 inoculated plants. Examples of both salicylic acid (SA and jasmonic acid/ethylene (JA/ET responsive defense genes were up-regulated after B. cinerea and PstDC3000 inoculation of the VaERF20-overexpressing transgenic A. thaliana plants. Evidence of pattern-triggered immunity (PTI, callose accumulation and stomatal defense, together with increased expression of PTI genes, was also greater in the transgenic lines. These data indicate that VaERF20 participates in various signal transduction pathways and acts as an inducer of immune responses.

Effects of exogenous growth regulators on cell suspension culture of yin-hong grape (vitis vinifera l.) and establishment of the optimum medium

International Nuclear Information System (INIS)

Chao, Y.; Feng, J.C.; Yan, W.Y.; Xiao, Y.; Jun, Y.Y

2015-01-01

Callus induced by stem of Yin-hong grape (Vitis vinifera L.) was used as materials and B5 medium as basic medium. The major growth parameters of cell suspension cultures with various levels of 1-Naphthaleneacetic acid (NAA) and 6-Benzyl aminopurine (6-BA) were investigated to provide a basis for the optimum medium of suspension cell cultures of Yin-hong grape regarding cell number, packed cell volume (PCV), dry cell weight (DCW), cell viability, and morphology. All data were analysed by of two-way analysis of variance (ANOVA). Results showed that the treatment of 6-BA and NAA would effect the cell growth dynamics, probably causing logarithmic phase in advance at higher levels of 6-BA. Different concentration of 6-BA and NAA had significant effects on cells number, PCV, DCW and viability (p<0.05), while no-significant effect was observed on the cells morphology. The optimum medium for suspension cell cultures of Yin-hong grape was identified as B5+1.5 mg/L6-BA+1.5 mg/LNAA+ 250 mg/L casein hydrolysate + 30 g/L sucrose. With the optimum medium, the maximum number of suspension cells after the logarithmic growth phase was 34.78 * 108 / mL, the highest cell viability reached 86.45%.; DCW reached 3.84 g/L and PCV reached 0.092 mL/mL after eight days cultivating. (author)

Teores de Elementos Minerais e Caracterização Física da Uva Isabel (Vitis labrusca L. Produzida em Boa Vista/RR

Directory of Open Access Journals (Sweden)

Magda Márcia Becker

2014-07-01

Full Text Available The Roraima viticulture began in 2003 with the creation of the Vale do Rio Branco project, in which the cultivation of grapes was enlarged for a commercial production. However, no information has been found in literature  about the mineral content of grapes produced. Considering the essentiality and importance of this information for human nutrition, quantification of species K by flame photometry and Ca, Fe and Zn by flame atomic absorption spectrometry in pulps of grapes of the Isabel, Vitis labrusca L. variety, cultivated in Boa Vista/RR has been realized, as well as determination of the physical characteristics of the grape bunches and berries. The determinations´ results indicate that K had the highest concentration, followed by Ca, Fe and Zn, being similar to the data, described in other literature sources, except for Ca, which showed smaller, indicating an intervention demand of culture methods employed to optimize the absorption of this species by vines. The consumption of Isabel grape can contribute to the achievement of the adequate intake recommendations of mineral elements. The results of the physical characterization let us classify Isabel grape bunches to very small, loose and green stalks. Overall, this study reveals new data about the physical characteristics and mineral composition present in Isabel grape grown in Boa Vista/RR.

Avaliação do equilíbrio estático em indivíduos amputados de membros inferiores através da biofotogrametria computadorizada Evaluation of the static balance lower limb amputeers by means of computerized biophotogrammetry

Directory of Open Access Journals (Sweden)

MA Baraúna

2006-01-01

Full Text Available Contextualização: Para que sejam realizadas atividades funcionais da vida diária é primordial a manutenção do equilíbrio estático, possibilitando posturas, movimentos e respostas adequadas. Objetivos: O presente trabalho teve como finalidade avaliar e comparar, através do teste de Romberg adaptado, as oscilações do equilíbrio estático de amputados protetizados de membros inferiores com indivíduos não amputados. Método: Foram avaliados 33 indivíduos do sexo masculino com idade média de 33,38 anos, divididos em três diferentes grupos. O grupo A foi composto por 12 indivíduos amputados que utilizavam prótese transfemural. O grupo B foi formado por 9 indivíduos amputados transtibiais. O grupo controle C continha 12 indivíduos não amputados. Cada indivíduo foi filmado nos planos frontal e sagital, avaliado quadro a quadro para a seleção de momentos de maiores oscilações. As imagens selecionadas foram quantificadas através da Biofotogrametria Computadorizada, utilizando-se o programa ALCimage 2.1®. Resultados: Os resultados mostraram diferenças significativas entre as oscilações anteriores para o grupo A (transfemural e entre as oscilações para o lado esquerdo, no grupo B. Conclusão: A partir destes resultados, conclui-se que amputados de membros inferiores apresentam uma tendência de oscilação mais significante em direção anterior e para o lado contra-lateral à prótese. Com o avanço da idade, nota-se uma menor tendência à oscilação posterior.Background: To accomplish day-to-day functional activities, it is fundamentally important to maintain static balance, thereby enabling appropriate postures, movements and responses. Objective: The purpose of this study was to evaluate oscillations in static balance among amputees with lower limb prostheses, by means of an adapted Romberg test, and to compare such oscillations with those among individuals without amputations. Method: Thirty-three male individuals of

Colonization of Vitis vinifera by a green fluorescence protein-labeled, gfp-marked strain of Xylophilus ampelinus, the causal agent of bacterial necrosis of grapevine.

Science.gov (United States)

Grall, Sophie; Manceau, Charles

2003-04-01

The dynamics of Xylophilus ampelinus were studied in Vitis vinifera cv. Ugni blanc using gfp-marked bacterial strains to evaluate the relative importance of epiphytic and endophytic phases of plant colonization in disease development. Currently, bacterial necrosis of grapevine is of economic importance in vineyards in three regions in France: the Cognac, Armagnac, and Die areas. This disease is responsible for progressive destruction of vine shoots, leading to their death. We constructed gfp-marked strains of the CFBP2098 strain of X. ampelinus for histological studies. We studied the colonization of young plants of V. vinifera cv. Ugni blanc by X. ampelinus after three types of artificial contamination in a growth chamber and in a greenhouse. (i) After wounding of the stem and inoculation, the bacteria progressed down to the crown through the xylem vessels, where they organized into biofilms. (ii) When the bacteria were forced into woody cuttings, they rarely colonized the emerging plantlets. Xylem vessels could play a key role in the multiplication and conservation of the bacteria, rather than being a route for plant colonization. (iii) When bacterial suspensions were sprayed onto the plants, bacteria progressed in two directions: both in emerging organs and down to the crown, thus displaying the importance of epiphytic colonization in disease development.

Analysis of Phenolic Compounds and Antioxidant Abilities of Extracts from Germinating Vitis californica Seeds Submitted to Cold Stress Conditions and Recovery after the Stress

Science.gov (United States)

Weidner, Stanisław; Chrzanowski, Sebastian; Karamać, Magdalena; Król, Angelika; Badowiec, Anna; Mostek, Agnieszka; Amarowicz, Ryszard

2014-01-01

The material for this study consisted of stratified seeds of Vitis californica submitted to germination under optimum conditions (+25 °C) or under chill stress (+10 °C), also followed by recovery. It has been determined that the germinating seeds contain considerable amounts of tannins, catechins as well as phenolic acids such as gallic, p-coumaric, caffeic and ferulic acids. Gallic acid appeared in the highest amount in the germinating seeds (from 42.40–204.00 µg/g of fresh weight (FW)), followed by caffeic acid (from 6.62–20.13 µg/g FW), p-coumaric acid (from 2.59–5.41 µg/g FW), and ferulic acid (from 0.56–0.92 µg/g FW). The phenolic acids occurred mostly in the ester form. Under chill stress, the germinating seeds were determined to contain an elevated total amount of phenolics, as well as raised levels of condensed tannins, catechins, gallic acid, and gafeic acid. The levels of p-coumoric and ferulic acids were found to have decreased. In extracts isolated from a sample exposed to low temperature, increased antioxidant activity and reduction potential were also demonstrated. Tissue of the germinating seeds which underwent post-stress recovery was found to have less total phenolics. PMID:25222557

THE APPLICATION OF LEAF ULTRASONIC RESONANCE TO VITIS VINIFERA L. SUGGESTS THE EXISTENCE OF A DIURNAL OSMOTIC ADJUSTMENT SUBJECTED TO PHOTOSYNTHESIS

Directory of Open Access Journals (Sweden)

Domingo Sancho-Knapik

2016-10-01

Full Text Available The main objective of this study was to apply the air-coupled broad-band ultrasonic spectroscopy in attached transpiring leaves of Vitis vinifera L. to monitor changes in leaf water potential (Y through the measurements of the standardized value of the resonant frequency associated with the maximum transmitance (f/fo. With this purpose, the response of grapevine to a drought stress period was investigated in terms of leaf water status, ultrasounds, gas exchange and sugar accumulation. Two strong correlations were obtained between f/fo and Y measured at predawn (pd and at midday (md with different slopes. This fact implied the existence of two values of Y for a given value of f/fo, which was taken as a sign that the ultrasonic technique was not directly related to the overall Y, but only to one of its components: the turgor pressure (P. The difference in Y at constant f/fo (d was found to be dependent on net CO2 assimilation (A and might be used as a rough estimator of photosynthetic activity. It was then, the other main component of Y, osmotic potential (π, the one that may have lowered the values of midday Y with respect to predawn Y by the accumulation of sugars associated to net CO2 assimilation. This phenomenon suggests the existence of a diurnal osmotic adjustment in this species associated to sugars production in well-watered plants.

Chemical composition and bioactive compounds of grape pomace (Vitis vinifera L., Benitaka variety, grown in the semiarid region of Northeast Brazil

Directory of Open Access Journals (Sweden)

Eldina Castro Sousa

2014-03-01

Full Text Available Grape pomace (Vitis vinifera L., Benitaka variety, grown in the semiarid region of Northeast Brazil was evaluated in relation to chemical composition, and content of minerals and functional properties. Its microbiological quality and toxic potential, using Artemia salina sp, were also investigated. The results showed that the flour obtained from these residues had below neutral pH (3.82, moisture (3.33g/100g, acidity of (0.64g of citric acid/100g, and ash (4.65 g/100g. The amount of total dietary fiber (46.17g/100g stood out quantitatively compared to the content of carbohydrate (29.2g/100 g, protein (8.49g/100g, and lipids (8.16g/100g. The total energy was 224Kcal/100g. With regard to the compounds with functional properties, higher values of insoluble fiber 79% (36.4 g/100 g; vitamin C (26.25 mg of acid ascorbic/100g, and anthocyanins (131mg/100g were found. The minerals iron, potassium, zinc, manganese, and calcium were present in higher concentrations. There were no significant copper values. The results showed that the grape residues are an important source of nutrients and compounds with functional properties suggesting that they can be incorporated as an ingredient in the diet and/or used as a dietary supplement aiming at health benefits. The residues did not show microbiological contamination and were considered nontoxic.

Ectopic expression of Arabidopsis broad-spectrum resistance gene RPW8.2 improves the resistance to powdery mildew in grapevine (Vitis vinifera).

Science.gov (United States)

Hu, Yang; Li, Yajuan; Hou, Fengjuan; Wan, Dongyan; Cheng, Yuan; Han, Yongtao; Gao, Yurong; Liu, Jie; Guo, Ye; Xiao, Shunyuan; Wang, Yuejin; Wen, Ying-Qiang

2018-02-01

Powdery mildew is the most economically important disease of cultivated grapevines worldwide. Here, we report that the Arabidopsis broad-spectrum disease resistance gene RPW8.2 could improve resistance to powdery mildew in Vitis vinifera cv. Thompson Seedless. The RPW8.2-YFP fusion gene was stably expressed in grapevines from either the constitutive 35S promoter or the native promoter (NP) of RPW8.2. The grapevine shoots and plantlets transgenic for 35S::RPW8.2-YFP showed reduced rooting and reduced growth at later development stages in the absence of any pathogens. Infection tests with an adapted grapevine powdery mildew isolate En NAFU1 showed that hyphal growth and sporulation were significantly restricted in transgenic grapevines expressing either of the two constructs. The resistance appeared to be attributable to the ectopic expression of RPW8.2, and associated with the enhanced encasement of the haustorial complex (EHC) and onsite accumulation of H 2 O 2 . In addition, the RPW8.2-YFP fusion protein showed focal accumulation around the fungal penetration sites. Transcriptome analysis revealed that ectopic expression of RPW8.2 in grapevines not only significantly enhanced salicylic acid-dependent defense signaling, but also altered expression of other phytohormone-associated genes. Taken together, our results indicate that RPW8.2 could be utilized as a transgene for improving resistance against powdery mildew in grapevines. Copyright © 2017 Elsevier B.V. All rights reserved.

Occurrence of a number of enzymes involved in either gluconeogenesis or other processes in the pericarp of three cultivars of grape (Vitis vinifera L.) during development.

Science.gov (United States)

Famiani, Franco; Moscatello, Stefano; Ferradini, Nicoletta; Gardi, Tiziano; Battistelli, Alberto; Walker, Robert P

2014-11-01

It is uncertain whether the enzymes pyruvate orthophosphate dikinase (PPDK) or isocitrate lyase (ICL) are present in the pericarp of grape, in which they could function in gluconeogenesis. The occurrence of these and other enzymes was investigated in the pericarp of three cultivars of grape (Vitis vinifera L.). In particular, the abundance of the enzymes aldolase, glutamine synthase (GS), acid invertase, ribulose-1,5-bisphosphate carboxylase/oxygenase (Rubisco), phosphoenolpyruvate carboxylase (PEPC), PPDK and ICL were determined during the development of the pericarp of the cultivars Cabernet Sauvignon, Chardonnay and Zibibbo. PPDK and ICL were not detected at any stage of development. Each of the other enzymes showed different changes in abundance during development. However, for a given enzyme its changes in abundance were similar in each cultivar. In the ripe pericarp of Cabernet Sauvignon, PEPC, cytosolic GS and aldolase were equally distributed between the vasculature and parenchyma cells of the flesh and skin. The absence or very low abundance of PPDK provides strong evidence that any gluconeogenesis from malate utilises phosphoenolpyruvate carboxykinase (PEPCK). The absence or very low abundance of ICL in the pericarp precludes any gluconeogenesis from ethanol. Copyright © 2014 Elsevier Masson SAS. All rights reserved.

Efeito da suplementação de cloreto de amônio sobre os equilíbrios eletrolítico e ácido-básico e o pH urinário de ovinos confinados

Directory of Open Access Journals (Sweden)

Danilo O.L. Ferreira

2014-08-01

Full Text Available A incidência da urolitíase obstrutiva em ovinos é elevada, principalmente em machos confinados, tanto para produção de carne, quanto reprodutores de alto valor genético. A acidificação urinária é um dos métodos para prevenção desta enfermidade e pode ser realizada de forma eficaz com a suplementação de cloreto de amônio na dieta, que pode propiciar a instalação de acidose metabólica. A hemogasometria avalia o equilíbrio ácido-básico sanguíneo de forma prática e fácil. Neste trabalho, avaliou-se o efeito do cloreto de amônio sobre o equilíbrio ácido-básico e eletrolítico de ovinos em confinamento para quantificar a acidose metabólica desenvolvida. Utilizaram-se 100 ovinos, machos, confinados, com idade aproximada de três meses. Constituíram-se três grupos experimentais: Grupo I (n=40, recebeu 400mg/kg/PV de cloreto de amônio/animal/dia por 21 dias consecutivos, momento da interrupção da administração do acidificante urinário (M3 e continuidade do acompanhamento clinico até o final do experimento (M6; Grupo II (n=40, 400mg/kg/PV de cloreto de amônio/animal/dia por 42 dias consecutivos; Grupo III (n=20, não recebeu cloreto de amônio durante todo o período do experimento. Os Momentos (M de colheita de amostras e avaliação clínica foram estabelecidos com intervalo de sete dias, sendo M0 (imediatamente antes do início do tratamento com cloreto de amônio, M1 (sete dias após, M2, M3, M4, M5 e M6, totalizando 56 dias de confinamento. A alimentação consistiu de ração total, composta por 15% de feno triturado e 85% de concentrado, água e sal mineral ad libitum. Após adaptação de 15 dias à dieta de confinamento, colheram-se de todos os animais amostras de urina para mensuração do pH, e sangue venoso para hemogasometria, nos diferentes momentos. A acidificação urinária foi mantida enquanto houve a administração de cloreto de amônio nos grupos GI e GII. Os valores de Na+ e K+ permaneceram

O desenvolvimento motor em escolares dos anos iniciais do ensino fundamental

OpenAIRE

Lima, Lidijane dos Santos

2016-01-01

Introdu????o: segundo Rosa Neto (2002), motricidade ?? a intera????o de v??rias fun????es motoras (perceptivo motor, neuromotora, psicomotora) e cita os seguintes elementos da motricidade humana: Motricidade global, Motricidade fina, Equil??brio, Esquema corporal, Organiza????o Espacial, Organiza????o Temporal e Lateralidade. Objetivo: avaliar o desenvolvimento motor, em especifico os aspectos da motricidade fina e equil??brio. Material e M??todos: a amostra foi de 38 crian??as de ambos os se...

Análise da pressão plantar e do equilíbrio postural em diferentes fases da gestação Analysis of plantar pressure and postural balance during different phases of pregnancy

Directory of Open Access Journals (Sweden)

SI Ribas

2007-10-01

Full Text Available OBJETIVO: Analisar a pressão plantar e o equilíbrio postural nos três trimestres de gravidez, bem como a correlação com as características antropométricas. METODOLOGIA: 60 voluntárias com idade média de 23,3 ± 5,5 anos, sendo 15 mulheres em cada grupo: não-gestantes (C, primeiro (1T, segundo (2T e terceiro trimestre (3T. A avaliação foi efetuada por meio de plataforma de pressão na posição bipodal com os olhos abertos. As variáveis analisadas nos pés direito e esquerdo foram: pico de pressão em todo o pé (PT, no antepé (PA e no retropé (PR; distância entre a borda medial dos pés (largura da base de suporte; distância do centro de força ao limite anterior (CFF e posterior (CFC dos pés; deslocamento ântero-posterior (AP e médio--lateral (ML do centro de força; e área de contato (AC. RESULTADOS: Não houve diferença no pico de pressão de contato e na distância CFF e CFC entre os grupos. O deslocamento AP foi maior (p 0,05 entre os grupos para o deslocamento ML. Houve correlação positiva entre peso ganho durante a gestação com AC para o grupo 2T e com PT no pé direito do grupo 1T. CONCLUSÃO: Os resultados demonstram a influência das mudanças anatômicas e fisiológicas inerentes à gestação na pressão plantar, além de sugerir uma redução do equilíbrio postural no 3T, relacionada ao maior deslocamento AP nessa fase.OBJECTIVE: To analyze plantar pressure and postural balance during the three trimesters of pregnancy, and also to correlate these with anthropometric characteristics. METHOD: Sixty volunteers participated in this study, with a mean age of 23.3 ± 5.5 years. There were 15 subjects in each group: non-pregnant (C, first trimester (1T, second trimester (2T and third trimester (3T. Evaluations were performed in bipedal stance with open eyes, using a pressure platform. The following variables were analyzed in the right and left feet: peak pressures in the whole foot (WFP, forefoot (FFP and

Como o Banco Central tem reagido aos choques (bolhas nos preços das habitações brasileiras? Uma análise por meio por meio do Modelo Dinâmico Estocástico de Equilíbrio Geral (DSGE

Directory of Open Access Journals (Sweden)

Cássio Nóbrega Besarria

2016-12-01

Full Text Available Este artigo tem o propósito de analisar os efeitos do choque (bolha nos preços dos imóveis sobre as variáveis macroeconômicas brasileiras (PIB, inflação e taxa de juro. Foram utilizados dois procedimentos metodológicos: inicialmente, serão obtidos os parâmetros estruturais do modelo Dinâmico Estocástico de Equilíbrio Geral (DSGE, por meio do Método Generalizado dos Momentos (GMM. Esses resultados dessa etapa serão utilizados na simulação dos efeitos dos choques nos preços das habitações na economia artificial. Posteriormente, será utilizado o modelo de Vetores Autorregressivos (VAR, no qual os choques serão identificados por meio de restrições de sinais, baseadas nas respostas obtidas pela calibração do modelo teórico. Os resultados mostraram que os efeitos da bolha no mercado habitacional brasileiro afetou positivamente os movimentos subsequentes no produto e na inflação; no entanto, o efeito desse choque se deu de forma transitória sobre essas variáveis, trazendo efeitos persistentes apenas sobre a taxa de juros.

Transcriptomic analysis of grape (Vitis vinifera L.) leaves during and after recovery from heat stress.

Science.gov (United States)

Liu, Guo-Tian; Wang, Jun-Fang; Cramer, Grant; Dai, Zhan-Wu; Duan, Wei; Xu, Hong-Guo; Wu, Ben-Hong; Fan, Pei-Ge; Wang, Li-Jun; Li, Shao-Hua

2012-09-28

Grapes are a major fruit crop around the world. Heat stress can significantly reduce grape yield and quality. Changes at the molecular level in response to heat stress and subsequent recovery are poorly understood. To elucidate the effect of heat stress and subsequent recovery on expression of genes by grape leaves representing the classic heat stress response and thermotolerance mechanisms, transcript abundance of grape (Vitis vinifera L.) leaves was quantified using the Affymetrix Grape Genome oligonucleotide microarray (15,700 transcripts), followed by quantitative Real-Time PCR validation for some transcript profiles. We found that about 8% of the total probe sets were responsive to heat stress and/or to subsequent recovery in grape leaves. The heat stress and recovery responses were characterized by different transcriptional changes. The number of heat stress-regulated genes was almost twice the number of recovery-regulated genes. The responsive genes identified in this study belong to a large number of important traits and biological pathways, including cell rescue (i.e., antioxidant enzymes), protein fate (i.e., HSPs), primary and secondary metabolism, transcription factors, signal transduction, and development. We have identified some common genes and heat shock factors (HSFs) that were modulated differentially by heat stress and recovery. Most HSP genes were upregulated by heat stress but were downregulated by the recovery. On the other hand, some specific HSP genes or HSFs were uniquely responsive to heat stress or recovery. The effect of heat stress and recovery on grape appears to be associated with multiple processes and mechanisms including stress-related genes, transcription factors, and metabolism. Heat stress and recovery elicited common up- or downregulated genes as well as unique sets of responsive genes. Moreover, some genes were regulated in opposite directions by heat stress and recovery. The results indicated HSPs, especially small HSPs

Transcriptomic analysis of grape (Vitis vinifera L. leaves during and after recovery from heat stress

Directory of Open Access Journals (Sweden)

Liu Guo-Tian

2012-09-01

Full Text Available Abstract Background Grapes are a major fruit crop around the world. Heat stress can significantly reduce grape yield and quality. Changes at the molecular level in response to heat stress and subsequent recovery are poorly understood. To elucidate the effect of heat stress and subsequent recovery on expression of genes by grape leaves representing the classic heat stress response and thermotolerance mechanisms, transcript abundance of grape (Vitis vinifera L. leaves was quantified using the Affymetrix Grape Genome oligonucleotide microarray (15,700 transcripts, followed by quantitative Real-Time PCR validation for some transcript profiles. Results We found that about 8% of the total probe sets were responsive to heat stress and/or to subsequent recovery in grape leaves. The heat stress and recovery responses were characterized by different transcriptional changes. The number of heat stress-regulated genes was almost twice the number of recovery-regulated genes. The responsive genes identified in this study belong to a large number of important traits and biological pathways, including cell rescue (i.e., antioxidant enzymes, protein fate (i.e., HSPs, primary and secondary metabolism, transcription factors, signal transduction, and development. We have identified some common genes and heat shock factors (HSFs that were modulated differentially by heat stress and recovery. Most HSP genes were upregulated by heat stress but were downregulated by the recovery. On the other hand, some specific HSP genes or HSFs were uniquely responsive to heat stress or recovery. Conclusion The effect of heat stress and recovery on grape appears to be associated with multiple processes and mechanisms including stress-related genes, transcription factors, and metabolism. Heat stress and recovery elicited common up- or downregulated genes as well as unique sets of responsive genes. Moreover, some genes were regulated in opposite directions by heat stress and recovery

Diversidad genética de levaduras aisladas a partir de uvas de Vitis vinifera ssp. Sylvestris (Gmelin Hegi en el área Euroasiática

Directory of Open Access Journals (Sweden)

Cordero-Bueso Gustavo

2017-01-01

Full Text Available Vitis vinifera L. ssp. Sylvestris(Gmelin Hegi is recognized as the dioecious parental generation of today's cultivars. Climatic change and the arrival in Europe of pathogens and pests have led it to be included on the IUCN Red List of Threatened Species in 1997. At best of our knowledge, no studies on microbial populations of grape-berry surfaces have been done. The present work has been focused on the study of yeast occurrence and diversity on grape-berries collected from wild vines. Final outputs have allowed: ito obtain precise information about yeast communities; ii to provide an objective framework for the classification of the broadest range of species according to their extinction risk; iii to select attractive yeast strains for their biotechnological potential, offering new opportunities to winemakers. Sampling plan was performed in Azerbaijan, Georgia, Italy, Romania and Spain. In all, 3180 yeast colonies were isolated and identified as belonging to 50 species, including Saccharomyces cerevisiae, by 26S rDNA D1/D2 domains and ITS region sequencing. Isolates of S. cerevisiaewere also analysed by SSR-PCR obtaining 163 different genotypes. This study highlights the biodiversity potential of pristine environments that still represent a fascinating source to face common problems in winemaking.

PRINCIPAIS PROBLEMAS FISIOLÓGICOS APRESENTADOS POR PACIENTES COM INFARTO DO MIOCÁRDIO E AS RESPECTIVAS PRESCRIÇÕES DE ENFERMAGEM

Directory of Open Access Journals (Sweden)

Moema Guedes Barbaío

Full Text Available As autoras descrevem problemas relativos a dor, equilíbrio circulatório, freqüência cardíaca, equilíbrio enzimático e eletrolítico, termo-regulação, sono, repouso, eliminação, terapêutica e nutrição em pacientes com infarto do miocardio. Em seguida indicam quais seriam as prescrições de enfermagem a serem adotadas, pelo pessoal de enfermagem, frente a tais problemas.

Development of an in vivo glucosylation platform by coupling production to growth: Production of phenolic glucosides by a glycosyltransferase of Vitis vinifera.

Science.gov (United States)

De Bruyn, Frederik; De Paepe, Brecht; Maertens, Jo; Beauprez, Joeri; De Cocker, Pieter; Mincke, Stein; Stevens, Christian; De Mey, Marjan

2015-08-01

Glycosylation of small molecules can significantly alter their properties such as solubility, stability, and/or bioactivity, making glycosides attractive and highly demanded compounds. Consequently, many biotechnological glycosylation approaches have been developed, with enzymatic synthesis and whole-cell biocatalysis as the most prominent techniques. However, most processes still suffer from low yields, production rates and inefficient UDP-sugar formation. To this end, a novel metabolic engineering strategy is presented for the in vivo glucosylation of small molecules in Escherichia coli W. This strategy focuses on the introduction of an alternative sucrose metabolism using sucrose phosphorylase for the direct and efficient generation of glucose 1-phosphate as precursor for UDP-glucose formation and fructose, which serves as a carbon source for growth. By targeted gene deletions, a split metabolism is created whereby glucose 1-phosphate is rerouted from the glycolysis to product formation (i.e., glucosylation). Further, the production pathway was enhanced by increasing and preserving the intracellular UDP-glucose pool. Expression of a versatile glucosyltransferase from Vitis vinifera (VvGT2) enabled the strain to efficiently produce 14 glucose esters of various hydroxycinnamates and hydroxybenzoates with conversion yields up to 100%. To our knowledge, this fast growing (and simultaneously producing) E. coli mutant is the first versatile host described for the glucosylation of phenolic acids in a fermentative way using only sucrose as a cheap and sustainable carbon source. © 2015 Wiley Periodicals, Inc.

BIOMETRIC EVALUATION OF THE HOOF BALANCE OF EQUIDS USED TO PULL WAGONS IN BELO HORI¬ZONTE CITY, BRAZIL AVALIAÇÃO BIOMÉTRICA DO EQUILÍBRIO PODAL DE EQÜÍDEOS DE TRAÇÃO NO MUNICÍPIO DE BELO HORIZONTE

Directory of Open Access Journals (Sweden)

Ubiratan Pereira de Melo

2007-07-01

Full Text Available The hoof balance of 58 equids used to pull wagons in the city of Belo Horizonte was evaluated, by measuring length and width of sole and frog, length of heels and length of hoof wall and toe angle from the four hooves. Significant differences were not observed between right and left fore and hindlimbs, for both equines and mules. The difference of toe angle among opposite members was not significant, however, 46,5% of the animals presented some difference among the angle of the opposite forelimb, varying from the degree 1 to the 3, while 41,3% presented angle diffe¬rence among the hindlimb, varying from the degree 1 to the 3. A total of 31,30% of medium-lateral imbalance of the heels was observed, and foot contraction varied from 67,86 to 78,18% to the different studied members. A high correlation between body weight and toe length, sole length and sole width. Also, 79,30% of the animals worn rubber shoes manufactured from car tires. Based on the results, this study found that the incidence of dorso-palmar/plantar foot imbalance in equids used to pull wagons in the Belo Horizonte city is higher than the medium-lateral form. KEY-WORDS: Equines and mules, hoof, hoof imbalance, wagons. Avaliou-se o equilíbrio podal de 58 animais de tra¬ção em atividade no município de Belo Horizonte por meio da mensuração do comprimento e largura da sola e ranilha, comprimento da pinça e dos talões e ângulo da pinça dos quatro cascos. Não se observaram diferenças significativas entre as medidas dos cascos contralaterais de eqüinos e muares. A diferença de angulação da pinça entre membros contralaterais não foi significativa. Entretanto, 46,5% dos animais apresentaram diferença entre a angulação dos cascos contralaterais anteriores, variando do grau 1 ao 3, enquanto 41,3% apresentaram diferença de angulação entre os cascos posteriores, variando do grau 1 ao 3. Observou-se o índice de 31,30% de desnivelamento médio-lateral dos talões, e

NCBI nr-aa BLAST: CBRC-TSYR-01-0087 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TSYR-01-0087 ref|YP_002550227.1| ice nucleation protein [Agrobacterium vitis S4] gb|ACM37217.1| ice nuc...leation protein [Agrobacterium vitis S4] YP_002550227.1 8e-16 19% ...

BRAIN JOURNAL - PREFACE (OF THE FIRST SPECIAL ISSUE)

OpenAIRE

Bogdan Patrut

2010-01-01

BRAIN. Broad Research in Artificial Intelligence and Neuroscience, ISSN 2067-3957, Volume 1, July 2010, Special Issue on Complexity in Sciences and Artificial Intelligence Editors • Barna Iantovics, Petru Maior University, Targu Mures, Romania • Dumitru Rădoiu, Petru Maior University, Targu Mures, Romania • Marius Măruşteri, Universiy of Medicine and Pharmacy, Targu Mures, Romania • Matthias Dehmer, Institute for Bioinformatics and Translational Research, The Health and Life Scien...

Effects of distillation system and yeast strain on the aroma profile of Albariño (Vitis vinifera L.) grape pomace spirits.

Science.gov (United States)

Arrieta-Garay, Y; Blanco, P; López-Vázquez, C; Rodríguez-Bencomo, J J; Pérez-Correa, J R; López, F; Orriols, I

2014-10-29

Orujo is a traditional alcoholic beverage produced in Galicia (northwest Spain) from distillation of grape pomace, a byproduct of the winemaking industry. In this study, the effect of the distillation system (copper charentais alembic versus packed column) and the yeast strain (native yeast L1 versus commercial yeast L2) on the chemical and sensory characteristics of orujo obtained from Albariño (Vitis vinifera L.) grape pomace has been analyzed. Principal component analysis, with two components explaining 74% of the variance, is able to clearly differentiate the distillates according to distillation system and yeast strain. Principal component 1, mainly defined by C6-C12 esters, isoamyl octanoate, and methanol, differentiates L1 from L2 distillates. In turn, principal component 2, mainly defined by linear alcohols, linalool, and 1-hexenol, differentiates alembic from packed column distillates. In addition, an aroma descriptive test reveals that the distillate obtained with a packed column from a pomace fermented with L1 presented the highest positive general impression, which is associated with the highest fruity and smallest solvent aroma scores. Moreover, chemical analysis shows that use of a packed column increases average ethanol recovery by 12%, increases the concentration of C6-C12 esters by 25%, and reduces the concentration of higher alcohols by 21%. In turn, L2 yeast obtained lower scores in the alembic distillates aroma profile. In addition, with L1, 9% higher ethanol yields were achieved, and L2 distillates contained 34%-40% more methanol than L1 distillates.

Day and night heat stress trigger different transcriptomic responses in green and ripening grapevine (vitis vinifera) fruit.

Science.gov (United States)

Rienth, Markus; Torregrosa, Laurent; Luchaire, Nathalie; Chatbanyong, Ratthaphon; Lecourieux, David; Kelly, Mary T; Romieu, Charles

2014-04-28

Global climate change will noticeably affect plant vegetative and reproductive development. The recent increase in temperatures has already impacted yields and composition of berries in many grapevine-growing regions. Physiological processes underlying temperature response and tolerance of the grapevine fruit have not been extensively investigated. To date, all studies investigating the molecular regulation of fleshly fruit response to abiotic stress were only conducted during the day, overlooking possible critical night-specific variations. The present study explores the night and day transcriptomic response of grapevine fruit to heat stress at several developmental stages. Short heat stresses (2 h) were applied at day and night to vines bearing clusters sequentially ordered according to the developmental stages along their vertical axes. The recently proposed microvine model (DRCF-Dwarf Rapid Cycling and Continuous Flowering) was grown in climatic chambers in order to circumvent common constraints and biases inevitable in field experiments with perennial macrovines. Post-véraison berry heterogeneity within clusters was avoided by constituting homogenous batches following organic acids and sugars measurements of individual berries. A whole genome transcriptomic approach was subsequently conducted using NimbleGen 090818 Vitis 12X (30 K) microarrays. Present work reveals significant differences in heat stress responsive pathways according to day or night treatment, in particular regarding genes associated with acidity and phenylpropanoid metabolism. Precise distinction of ripening stages led to stage-specific detection of malic acid and anthocyanin-related transcripts modulated by heat stress. Important changes in cell wall modification related processes as well as indications for heat-induced delay of ripening and sugar accumulation were observed at véraison, an effect that was reversed at later stages. This first day - night study on heat stress adaption of the

Interactions between ethylene and auxin are crucial to the control of grape (Vitis vinifera L.) berry ripening.

Science.gov (United States)

Böttcher, Christine; Burbidge, Crista A; Boss, Paul K; Davies, Christopher

2013-12-23

Fruit development is controlled by plant hormones, but the role of hormone interactions during fruit ripening is poorly understood. Interactions between ethylene and the auxin indole-3-acetic acid (IAA) are likely to be crucial during the ripening process, since both hormones have been shown to be implicated in the control of ripening in a range of different fruit species. Grapevine (Vitis vinifera L.) homologues of the TRYPTOPHAN AMINOTRANSFERASE RELATED (TAR) and YUCCA families, functioning in the only characterized pathway of auxin biosynthesis, were identified and the expression of several TAR genes was shown to be induced by the pre-ripening application of the ethylene-releasing compound Ethrel. The induction of TAR expression was accompanied by increased IAA and IAA-Asp concentrations, indicative of an upregulation of auxin biosynthesis and conjugation. Exposure of ex planta, pre-ripening berries to the ethylene biosynthesis inhibitor aminoethoxyvinylglycine resulted in decreased IAA and IAA-Asp concentrations. The delayed initiation of ripening observed in Ethrel-treated berries might therefore represent an indirect ethylene effect mediated by increased auxin concentrations. During berry development, the expression of three TAR genes and one YUCCA gene was upregulated at the time of ripening initiation and/or during ripening. This increase in auxin biosynthesis gene expression was preceded by high expression levels of the ethylene biosynthesis genes 1-aminocyclopropane-1-carboxylate synthase and 1-aminocyclopropane-1-carboxylate oxidase. In grape berries, members of both gene families involved in the two-step pathway of auxin biosynthesis are expressed, suggesting that IAA is produced through the combined action of TAR and YUCCA proteins in developing berries. The induction of TAR expression by Ethrel applications and the developmental expression patterns of auxin and ethylene biosynthesis genes indicate that elevated concentrations of ethylene prior to the

Photosynthetic responses to heat treatments at different temperatures and following recovery in grapevine (Vitis amurensis L.) leaves.

Science.gov (United States)

Luo, Hai-Bo; Ma, Ling; Xi, Hui-Feng; Duan, Wei; Li, Shao-Hua; Loescher, Wayne; Wang, Jun-Fang; Wang, Li-Jun

2011-01-01

The electron transport chain, Rubisco and stomatal conductance are important in photosynthesis. Little is known about their combined responses to heat treatment at different temperatures and following recovery in grapevines (Vitis spp.) which are often grown in climates with high temperatures. The electron transport function of photosystem II, the activation state of Rubisco and the influence of stomatal behavior were investigated in grapevine leaves during heat treatments and following recovery. High temperature treatments included 35, 40 and 45°C, with 25°C as the control and recovery temperature. Heat treatment at 35°C did not significantly (P>0.05) inhibit net photosynthetic rate (P(n)). However, with treatments at 40 and 45°C, P(n) was decreased, accompanied by an increase in substomatal CO(2) concentration (C(i)), decreases in stomatal conductance (g(s)) and the activation state of Rubisco, and inhibition of the donor side and the reaction center of PSII. The acceptor side of PSII was inhibited at 45°C but not at 40°C. When grape leaves recovered following heat treatment, P(n), g(s) and the activation state of Rubisco also increased, and the donor side and the reaction center of PSII recovered. The increase in P(n) during the recovery period following the second 45°C stress was slower than that following the 40°C stress, and these increases corresponded to the donor side of PSII and the activation state of Rubisco. Heat treatment at 35°C did not significantly (P>0.05) influence photosynthesis. The decrease of P(n) in grape leaves exposed to more severe heat stress (40 or 45°C) was mainly attributed to three factors: the activation state of Rubisco, the donor side and the reaction center of PSII. However, the increase of P(n) in grape leaves following heat stress was also associated with a stomatal response. The acceptor side of PSII in grape leaves was responsive but less sensitive to heat stress.

Kaninen Allan, giraffen Marius og llivets værdi

DEFF Research Database (Denmark)

Sandøe, Peter

2015-01-01

Det var ikke smart, da en rasiovært på Radio24syv dor åben mikrofon dræbte kaninen Allan ved hjælp af en cykelpumpe. Men det er i orden at slå dyr ihjæl, hvis det sikrer, at de resterende dyr får bedre livsvilkår....

Kaubamärgiomaniku huvide kaitse võimalused kahju hüvitamisel : [bakalaureusetöö] / Triinu Paidla ; Tartu Ülikool, õigusteaduskond ; juhendaja: Margit Piirman

Index Scriptorium Estoniae

Paidla, Triinu

2010-01-01

Kaubamärgiõiguse rikkumisest ja sellest tulenevatest tsiviilõiguslikest õiguskaitsevahenditest, kahju ja ebaõiglaselt teenitud kasu hindamisest, teistest kahju hüvitamise meetoditest (karistuslik kahjutasu, seadusjärgne kahjuhüvitis, kahjuhüvitis ex aequo et bono)

Molecular characterization and technological properties of wine yeasts isolated during spontaneous fermentation of Vitis vinifera L.cv. Narince grape must grown in ancient wine making area Tokat, Anatolia

Directory of Open Access Journals (Sweden)

Çelik Zeynep Dilan

2017-01-01

Full Text Available Narince is a native white grape variety of Vitis vinifera L grown in Tokat and produces rich and balanced wines often with a greenish yellow tint and delicate fruity flavour. Fermentation by indigenous yeasts may produce wines with complex oenological properties that are unique to specific region. In this study yeast population during alcoholic fermentation of Narince was investigated. Yeasts were identified by PCR-RFLP analysis of the 5.8 ITS rRNA region and sequence information for the D1/D2 domains of the 26S gene. Eight different species belonging to nine genera were identified as: Hanseniaspora uvarum, Hansenispora guilliermondii, Pichia kluyveri, Metschnikowiaspp., Pichia occidentalis, Torulaspora delbrueckii, Candida zemplinina, Lachancea thermotolerance and Saccharomyces cerevisiae. Hanseniaspora guilliermondii, Metschnikowiaspp., Pichia occidentalis and Pichia kluyveri were identified only in the early stage of fermentation. Selected yeasts tested for their physiological traits, ethanol, SO2, temperature, pH tolerance, H2S production, killer and enzymatic activity, fermentation rate, flocculation characteristic, foam, volatile acid and volatile compounds production. Among the yeasts, one,Lachancea thermotolerance and four Saccharomyces cerevisiae strain showed remarkable technological properties and results were compared with those obtained by using commercial starter culture.

A leaf gas exchange model that accounts for intra-canopy variability by considering leaf nitrogen content and local acclimation to radiation in grapevine (Vitis vinifera L.).

Science.gov (United States)

Prieto, Jorge A; Louarn, Gaëtan; Perez Peña, Jorge; Ojeda, Hernán; Simonneau, Thierry; Lebon, Eric

2012-07-01

Understanding the distribution of gas exchange within a plant is a prerequisite for scaling up from leaves to canopies. We evaluated whether leaf traits were reliable predictors of the effects of leaf ageing and leaf irradiance on leaf photosynthetic capacity (V(cmax) , J(max) ) in field-grown vines (Vitis vinifera L). Simultaneously, we measured gas exchange, leaf mass per area (LMA) and nitrogen content (N(m) ) of leaves at different positions within the canopy and at different phenological stages. Daily mean leaf irradiance cumulated over 10 d (PPFD(10) ) was obtained by 3D modelling of the canopy structure. N(m) decreased over the season in parallel to leaf ageing while LMA was mainly affected by leaf position. PPFD(10) explained 66, 28 and 73% of the variation of LMA, N(m) and nitrogen content per area (N(a) ), respectively. Nitrogen content per unit area (N(a) = LMA × N(m) ) was the best predictor of the intra-canopy variability of leaf photosynthetic capacity. Finally, we developed a classical photosynthesis-stomatal conductance submodel and by introducing N(a) as an input, the model accurately simulated the daily pattern of gas exchange for leaves at different positions in the canopy and at different phenological stages during the season. © 2012 Blackwell Publishing Ltd.

A novel green synthesis of Fe{sub 3}O{sub 4}-Ag core shell recyclable nanoparticles using Vitis vinifera stem extract and its enhanced antibacterial performance

Energy Technology Data Exchange (ETDEWEB)

Venkateswarlu, Sada; Natesh Kumar, B.; Prathima, B. [Analytical and inorganic Division of Chemistry, S.V. University, Tirupati-517502, Andhra Pradesh (India); Anitha, K. [Department of Chemistry, S.K. University, Anantapur-515003, Andhra Pradesh (India); Jyothi, N.V.V., E-mail: nvvjyothi01@gmail.com [Analytical and inorganic Division of Chemistry, S.V. University, Tirupati-517502, Andhra Pradesh (India)

2015-01-15

We described a novel and eco-friendly method for preparing Fe{sub 3}O{sub 4}-Ag core shell nanoparticles (CSNPs) with high magnetism and potent antibacterial activity. The Fe{sub 3}O{sub 4}-Ag CSNPs were obtained using waste material of Vitis vinifera (grape) stem extract as the green solvent, reducing and capping agent. The result recorded from X-ray powder diffraction (XRD), UV–vis spectrum, energy dispersive spectroscopy (EDS), Fourier transform infrared spectroscopy (FT-IR) supports the biosynthesis and characterization of Fe{sub 3}O{sub 4}-Ag CSNPs. From transmission electron microscopy (TEM) the size of the Fe{sub 3}O{sub 4}-Ag nanoparticles was measured below 50 nm; high-resolution TEM (HRTEM) indicates the core shell structure; and selected area electron diffraction (SAED) has revealed polycrystalline nature. Vibrating sample magnetometer (VSM) shows the ferromagnetic nature of Fe{sub 3}O{sub 4}-Ag CSNPs at room temperature with saturation magnetization of 15.74 emu/g. Further, these biogenic nanoparticles were highly hazardous to microorganisms. The antibacterial activity of biogenic Fe{sub 3}O{sub 4}-Ag CSNPs showed potent inhibitory activity against both Gram-positive and Gram-negative pathogens. These nanoparticles may also be reusable because of its excellent ferromagnetic property.

ORF Sequence: NC_002937 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available brio vulgaris subsp. vulgaris str. Hildenborough] MHDTIPEYIRDGAQDMLAQGGVQKLGLKKEGGTWEIDGSIQSDDFQIYVSRISLTPSE...LPNWEREAQKFVPELKRLIIYGTRREGMFKLIDESDLVVTTYALLRRDLEELQNHTFNCIILDEAQNIKNPNTITARSVRRIKADMRLCLSGTPIENNLFELWSLFEF

ORF Sequence: NC_002937 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available brio vulgaris subsp. vulgaris str. Hildenborough] MPKQGMTQTQTVETLSFDDAGLANQLFGAQNGNLDIIAERSGTSIDTCGNAVTVSGEN...KRIILTRPAVEAGEKLGFLPGDLVEKVNPYLRPLYDALHDMLDFQKVTDMLETGVIEIAPLAFMRGRTLNDAFIILDEAQN

Acesso ao cuidado na Estratégia Saúde da Família: equilíbrio entre demanda espontânea e prevenção/promoção da saúde

Directory of Open Access Journals (Sweden)

Armando Henrique Norman

2015-03-01

Full Text Available Este artigo propõe algumas diretrizes para a organização do trabalho na Atenção Primária à Saúde (APS e na Estratégia Saúde da Família (ESF, relacionadas aos desafios de prover acesso e equilibrar no cotidiano dos serviços ações de prevenção de agravos e promoção da saúde com o cuidado ao adoecimento. Primeiramente, apresenta algumas ideias específicas sobre a importância do acesso para a qualidade dos serviços de saúde, seguidas de uma crítica sintética - fundamentada nos conceitos de Geoffrey Rose - à estratégia preventiva de alto risco, que tem tido alto impacto na organização das rotinas assistenciais. A seguir, contextualiza a promoção da saúde relacionada ao cuidado individual na APS/ESF, discutindo o potencial sinérgico do cuidado e da promoção da saúde, em suas dimensões individuais e coletivas, para transcender o modelo biomédico/mecanicista. Finalmente, apoiado nos tópicos anteriores, no que tange aos seus desdobramentos operacionais e utilizando um exemplo concreto, propõe algumas diretrizes para a organização do trabalho e das agendas de médicos e enfermeiros da ESF, de modo a viabilizar equilíbrio e sinergia entre acesso ao cuidado e prevenção/promoção, com vistas ao fortalecimento da ESF como coordenadora local do cuidado e principal porta de entrada do Sistema Único de Saúde.

ALGORITMO ETAPA A ETAPA PARA LA SIMULACIÓN DE CASCADAS DE EXTRACCIÓN EN FASE LÍQUIDA APLICANDO EL MODELO DE EQUILIBRIO ALGORITMO ETAPA A ETAPA PARA A SIMULAÇÃO DE CASCATAS DE EXTRAÇÃO EM FASE LÍQUIDA APLICANDO O MODELO DE EQUILÍBRIO STAGE-BY-STAGE ALGORITHM FOR SIMULATION OF LIQUID PHASE EXTRACTION CASCADES APPLYING THE EQUILIBRIUM MODEL

Directory of Open Access Journals (Sweden)

César A Sánchez

2009-12-01

Full Text Available Se presenta un método de solución etapa a etapa para el conjunto de ecuaciones de balance de masa, relaciones de equilibrio, suma de composiciones y entalpía (MESH, mass equilibrium sum enthalpy que representan el modelo de equilibrio para un arreglo a contracorriente de etapas de extracción en fase líquida. El fundamento teórico se encuentra en la termodinámica: equilibrio líquido-líquido, flash isotérmico y flash adiabático. El algoritmo supera los alcances de los métodos gráficos e isotérmicos típicos en el estudio de los procesos de extracción y es aplicable a situaciones adicionales muy comunes: transferencia de calor en las etapas, etapas adiabáticas, temperaturas diferentes para los flujos de alimentación y solvente. El algoritmo se ilustra en tres ejemplos, los dos primeros en operación isotérmica con tres componentes (agua, ácido acético y acetato de butilo y diez etapas, y un tercero más elaborado que involucra transferencia de calor con cuatro componentes (agua, ácido acético, butanol y acetato de butilo y quince etapas.Apresenta-se um método de solução etapa a etapa para o conjunto de equações de balanço de massa, relações de equilíbrio, soma de composições e entalpia (MESH mass equilibrium sum enthalpy que representam o modelo de equilíbrio para um arranjo en contracorrente de períodos de extração em fase líquida. O fundamento teórico se encontra na termodinâmica: equilíbrio líquido-líquido, flash isotérmico e flash adiabático. O algoritmo supera os alcances dos métodos gráficos e isotérmicos típicos no estudo dos processos de extração e é aplicável a situações adicionais muito comuns: transferência de calor nas etapas, etapas adiabáticas, temperaturas diferentes para os fluxos de alimentação e solvente. O algoritmo se ilustra em três exemplos, os dois primeiros em operação isotérmica com três componentes (água, ácido acético e acetato de butila e dez etapas, e um

Malbec grape (Vitis vinifera L.) responses to the environment: Berry phenolics as influenced by solar UV-B, water deficit and sprayed abscisic acid.

Science.gov (United States)

Alonso, Rodrigo; Berli, Federico J; Fontana, Ariel; Piccoli, Patricia; Bottini, Rubén

2016-12-01

High-altitude vineyards receive elevated solar ultraviolet-B (UV-B) levels so producing high quality berries for winemaking because of induction in the synthesis of phenolic compounds. Water deficit (D) after veraison, is a commonly used tool to regulate berry polyphenols concentration in red wine cultivars. Abscisic acid (ABA) plays a crucial role in the acclimation to environmental factors/signals (including UV-B and D). The aim of the present study was to evaluate independent and interactive effects of high-altitude solar UV-B, moderate water deficit and ABA applications on Vitis vinifera cv. Malbec berries. The experiment was conducted during two growing seasons with two treatments of UV-B (+UV-B and -UV-B), watering (+D and -D) and ABA (+ABA and -ABA), in a factorial design. Berry fresh weight, sugar content, fruit yield, phenolic compounds profile and antioxidant capacity (ORAC) were analyzed at harvest. Previous incidence of high UV-B prevented deleterious effects of water deficit, i.e. berry weight reduction and diminution of sugar accumulation. High UV-B increased total phenols (mainly astilbin, quercetin and kaempferol) and ORAC, irrespectively of the combination with other factors. Fruit yield was reduced by combining water deficit and high UV-B or water deficit and ABA. Two applications of ABA were enough to induced biochemical changes increasing total anthocyanins, especially those with higher antioxidant capacity. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

O equilíbrio de Nash como uma solução para o conflito entre eficiência e custo na escolha de sistemas de tratamento de esgoto sanitário com o auxílio de um modelo de tomada de decisão The Nash equilibrium as a solution to the conflict between efficiency and cost in the choice of systems for sanitary sewage treatment using a decision making model

Directory of Open Access Journals (Sweden)

Alexandre Bevilacqua Leoneti

2010-03-01

Full Text Available A escolha de estações de tratamento de esgoto pode, dentre outras coisas, envolver um conflito entre a eficiência e o custo, pois para o menor custo possível esta escolha também deverá satisfazer várias exigências ambientais. Para auxiliar na escolha de uma estação de menor custo, um modelo baseado em técnicas de tomada de decisão foi desenvolvido por Oliveira (2004. Todavia, se não forem levados em consideração os outros critérios envolvidos, a interação entre os tomadores de decisão e suas respectivas estratégias podem fazer com que a escolha do sistema de tratamento não seja a mais adequada. Para estes casos, o equilíbrio de Nash pode oferece uma solução, construída com base na interação entre os jogadores, a qual poderia satisfazer razoavelmente os interesses conflitantes. Desta forma, o objetivo desta pesquisa foi, com base nos dados de saída do modelo de Oliveira (2004, encontrar o equilíbrio de Nash para propor uma solução para o conflito entre a eficiência e o custo nas escolhas do sistema de tratamento de esgoto sanitário. A comparação entre os diferentes resultados alcançados, quando apenas considerado o critério de menor custo ou de maior eficiência, demonstrou que a adoção do equilíbrio de Nash pode ser uma alternativa viável para solucionar o conflito entre a eficiência e o custo nas escolhas das estações de tratamento de esgoto sanitário.The choice of sewage treatment plants may, among others, involve a conflict between efficiency and cost, because for the lowest possible cost, this choice should meet some environmental requirements. To assist in the choice of a treatment system for municipal sanitary sewer, a model based on techniques of decision making was developed by Oliveira (2004. However, if the other criteria involved are not considered, the interaction between decision makers and their strategies can turn the choice of the treatment system into an inadequate one. For these

A música como promotora do bem-estar psicológico na adolescência

OpenAIRE

Freire, Inês da Silva

2011-01-01

Tese de mestrado, Psicologia (Secção de Psicologia Clínica e da Saúde - Núcleo de Psicoterapia Cognitiva-Comportamental e Integrativa), Universidade de Lisboa, Faculdade de Psicologia, 2011 A música tem assumido um papel muito importante no quotidiano dos indivíduos, manifestando-se nas suas actividades mais usuais, como adormecer, acordar, viajar, celebrar. Sendo a adolescência um período caracterizado por grande inquietação, momentos ora de desequilíbrio, ora de equilíbrio, anim...

Prevalência do medo de cair em uma população de idosos da comunidade e sua correlação com mobilidade, equilíbrio dinâmico, risco e histórico de quedas Prevalence of fear of falling among a population of older adults and its correlation with mobility, dynamic balance, risk and history of falls

Directory of Open Access Journals (Sweden)

KT Lopes

2009-06-01

Full Text Available OBJETIVOS: Investigar a prevalência do medo de cair em uma população de idosos da comunidade e sua correlação com mobilidade, equilíbrio dinâmico, risco e histórico de quedas. MÉTODOS: Estudo transversal randomizado. Participaram do estudo 147 idosos com idades entre 60 e 92 anos, sendo 94 (65,95% mulheres e 53 (36,05% homens. O medo de cair foi avaliado usando FES-I-BRASIL (FIB, a mobilidade foi avaliada por meio do teste "Timed Up and go" (TUG, o risco de quedas, por meio do "Functional Reach Test" (FRT e o equilíbrio dinâmico, pelo teste da Marcha Tandem (MT. RESULTADOS: Cento e trinta e três (90,48% idosos relataram medo de cair em pelo menos uma atividade, e 80 (54,42% dos idosos apresentaram histórico de quedas (HQ. A correlação de Pearson demonstrou resultado significante (pOBJECTIVES: To investigate the prevalence of fear of falling among a population of older adults and its correlation with mobility, dynamic balance, risk and history of falls. METHODS: This was a randomized cross-sectional study. The participants were 147 older adults between the ages of 60 and 92: 94 women (65.95% and 53 men (36.05%. Fear of falling was assessed using FES-I-BRAZIL (FIB; mobility, using the "timed up and go" (TUG test; risk of falls, using the "functional reach test" (FRT; and dynamic balance, using the "tandem gait test"(TGT. RESULTS: One hundred and thirty-three older adults (90.48% reported fear of falling in at least one activity and 80 older adults (54.42% had a history of falls (HF. Pearson's correlation was statistically significant (p<0.001 between fear of falling and the TGT (r=-0.44248, FRT (r=-0.51562, HF (r=0.54069, TUG (r=0.45738 and age (r=0.39772. CONCLUSIONS: The present study identified high prevalence of fear of falling among older adults in the community, independent of their history of falls, and significant correlations between fear of falling and mobility, dynamic balance, risk and history of falls.

The Evolution of Total Phenolic Compounds and Antioxidant Activities during Ripening of Grapes (Vitis vinifera L., cv. Tempranillo Grown in Semiarid Region: Effects of Cluster Thinning and Water Deficit

Directory of Open Access Journals (Sweden)

Inmaculada Garrido

2016-11-01

Full Text Available A study was made of how water status (rainfed vs. irrigated and crop load (no cluster thinning vs. cluster thinning can together affect the grapes of Vitis vinifera cv. Tempranillo vines growing in a semiarid zone of Extremadura (Spain. The grapes were monitored at different stages of ripening, measuring the peroxidase (POX and superoxide dismutase (SOD antioxidant activities and the phenolic content (flavonoids and phenylpropanoids, together with other parameters. The irrigation regime was adjusted to provide 100% of crop evapotranspiration (ETc. The findings confirmed previous results that both thinning and water deficit advance ripening, while irrigation and high crop load (no thinning lengthen the growth cycle. The SOD activity remained practically constant throughout ripening in the thinned treatments and was always lower than in the unthinned treatments, an aspect which could have been the cause of the observed greater level of lipid peroxidation in the water deficit, thinned treatment. The nonspecific peroxidase activity was very low, especially in the thinned treatments. The effect of thinning was enhanced when combined with water deficit, inducing increases in phenylpropanoids and, above all, flavonoids at the harvest stage of ripening, while leaving the polyphenol oxidase activity (PPO unaffected.

Chemical composition and sensory properties of non-wooded and wooded Shiraz (Vitis vinifera L.) wine as affected by vineyard row orientation and grape ripeness level.

Science.gov (United States)

Hunter, Jacobus J; Volschenk, Cornelis G

2018-05-01

The study aimed to unravel vineyard row orientation (NS, EW, NE-SW, NW-SE) and grape ripeness level (23, 25, 27 °Balling) implications for grape and wine composition and sensory properties/style (non-wooded/wooded wines) of Vitis vinifera L. cv. Shiraz (rootstock 101-14 Mgt). Soluble solid/titratable acidity ratios were lowest for EW, whereas warmer canopy sides (NW, N, NE) advanced grape ripening. Skin anthocyanins and phenolics generally decreased with ripening. NW-SE rows and S, SE, E and NE canopy sides showed highest skin total anthocyanins and phenolics. Wine total anthocyanins and phenolics increased with grape ripening; EW had lower values. Wine phenolic contents differed between canopy sides; N, NE, E and SE tended higher. Wine sensory profiles increased with grape ripening. For non-wooded wines, NW-SE and NE-SW row orientations generally resulted in highest scores, followed by NS. For EW rows, the N side presented better wines. Wood addition enhanced specific sensory descriptor perceptions. A large collection of wine styles surfaced in the same vineyard and terroir, increasing options to contribute positively to sustainable products. The study generated globally applicable, novel information vital for unlocking and valorising terroir/site potential for grape and wine chemical composition and wine sensory/style properties. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

The Induction of Noble Rot (Botrytis cinerea Infection during Postharvest Withering Changes the Metabolome of Grapevine Berries (Vitis vinifera L., cv. Garganega

Directory of Open Access Journals (Sweden)

Stefano Negri

2017-06-01

Full Text Available The natural or induced development of noble rot caused by the fungus Botrytis cinerea during the late stages of grapevine (Vitis vinifera L. berry ripening is used in some traditional viticulture areas to produce high-quality wines such as Sauternes and Tokaji. In this research, we wanted to verify if by changing the environmental conditions during post-harvest withering we could induce the noble rot development on harvested berries in order to positively change the wine produced from withered Garganega berries. Therefore, we exposed the berries to postharvest withering under normal or artificially humid conditions, the latter to induce noble rot. The presence of noble rot symptoms was associated with the development of B. cinerea in the berries maintained under humid conditions. The composition of infected and non-infected berries was investigated by untargeted metabolomics using liquid chromatography/mass spectrometry. We also explored the effects of the two withering methods on the abundance of volatile organic compounds in wine by yeast-inoculated micro-fermentation followed by targeted gas chromatography/mass spectrometry. These experiments revealed significant metabolic differences between berries withered under normal and humid conditions, indicating that noble rot affects berry metabolism and composition. As well as well-known botrytization markers, we detected two novel lipids that have not been observed before in berries infected with noble rot. Unraveling the specific metabolic profile of berries infected with noble rot may help to determine the compounds responsible for the organoleptic quality traits of botrytized Garganega wines.

Screening of various botanical extracts for antioxidant activity using DPPH free radical method.

Science.gov (United States)

Waqas, Muhammad Khurram; Saqib, Najam-Us; Rashid, Saeed-Ur; Shah, Pervaiz Akhtar; Akhtar, Naveed; Murtaza, Ghulam

2013-01-01

Aiming at the exploration of herbal use by society, crude extracts of the seeds of some commonly used medicinal plants (Vitis vinifera, Tamarindus indica and Glycin max) were screened for their free radical scavenging properties using ascorbic acid as standard antioxidant. Free radical scavenging activity was evaluated using 1,1-diphenyl-2-picrylhydrazyl (DPPH) free radical. The overall antioxidant activity of grape seeds (Vitis vinifera) was the strongest, followed in descending order by soybean (Glycin max) and tamarind (Tamarindus indica). The seeds extract of Vitis vinifera, Glycin max and Tamarindus indica showed 85.61%, 83.45% and 79.26%, DPPH scavenging activity respectively.

Adaptogenic and nootropic activities of aqueous extract of Vitis vinifera (grape seed): an experimental study in rat model

Science.gov (United States)

Sreemantula, Satyanarayana; Nammi, Srinivas; Kolanukonda, Rajabhanu; Koppula, Sushruta; Boini, Krishna M

2005-01-01

Background The aerial parts of Vitis vinifera (common grape or European grape) have been widely used in Ayurveda to treat a variety of common and stress related disorders. In the present investigation, the seed extract of V. vinifera was evaluated for antistress activity in normal and stress induced rats. Furthermore, the extract was studied for nootropic activity in rats and in-vitro antioxidant potential to correlate its antistress activity. Methods For the evaluation of antistress activity, groups of rats (n = 6) were subjected to forced swim stress one hour after daily treatment of V. vinifera extract. Urinary vanillylmandelic acid (VMA) and ascorbic acid were selected as non-invasive biomarkers to assess the antistress activity. The 24 h urinary excretion of vanillylmandelic acid (VMA) and ascorbic acid were determined by spectrophotometric methods in all groups under normal and stressed conditions. The nootropic activity of the extract as determined from acquisition, retention and retrieval in rats was studied by conditioned avoidance response using Cook's pole climbing apparatus. The in vitro antioxidant activity was determined based on the ability of V. vinifera to scavenge hydroxyl radicals. Results Daily administration of V. vinifera at doses of 100, 200 and 300 mg/kg body weight one hour prior to induction of stress inhibited the stress induced urinary biochemical changes in a dose dependent manner. However, no change in the urinary excretion of VMA and ascorbic acid was observed in normal animals at all the doses studied. The cognition, as determined by the acquisition, retention and recovery in rats was observed to be dose dependent. The extract also produced significant inhibition of hydroxyl radicals in comparison to ascorbic acid in a dose dependent manner. Conclusion The present study provides scientific support for the antistress (adaptogenic), antioxidant and nootropic activities of V. vinifera seed extract and substantiate the traditional claims