WorldWideScience

Sample records for brachypodium distachyon grain

  1. A comprehensive overview of grain development in Brachypodium distachyon variety Bd21

    Science.gov (United States)

    Guillon, F.; Larré, C.; Petipas, F.; Berger, A.; Moussawi, J.; Rogniaux, H.; Santoni, A.; Saulnier, L.; Jamme, F.; Miquel, M.; Lepiniec, L.; Dubreucq, B.

    2012-01-01

    A detailed and comprehensive understanding of seed reserve accumulation is of great importance for agriculture and crop improvement strategies. This work is part of a research programme aimed at using Brachypodium distachyon as a model plant for cereal grain development and filling. The focus was on the Bd21-3 accession, gathering morphological, cytological, and biochemical data, including protein, lipid, sugars, starch, and cell-wall analyses during grain development. This study highlighted the existence of three main developmental phases in Brachypodium caryopsis and provided an extensive description of Brachypodium grain development. In the first phase, namely morphogenesis, the embryo developed rapidly reaching its final morphology about 18 d after fertilization (DAF). Over the same period the endosperm enlarged, finally to occupy 80% of the grain volume. During the maturation phase, carbohydrates were continuously stored, mainly in the endosperm, switching from sucrose to starch accumulation. Large quantities of β-glucans accumulated in the endosperm with local variations in the deposition pattern. Interestingly, new β-glucans were found in Brachypodium compared with other cereals. Proteins (i.e. globulins and prolamins) were found in large quantities from 15 DAF onwards. These proteins were stored in two different sub-cellular structures which are also found in rice, but are unusual for the Pooideae. During the late stage of development, the grain desiccated while the dry matter remained fairly constant. Brachypodium exhibits some significant differences with domesticated cereals. Beta-glucan accumulates during grain development and this cell wall polysaccharide is the main storage carbohydrate at the expense of starch. PMID:22016425

  2. Anther ontogeny in Brachypodium distachyon.

    Science.gov (United States)

    Sharma, Akanksha; Singh, Mohan B; Bhalla, Prem L

    2015-03-01

    Brachypodium distachyon has emerged as a model plant for the improvement of grain crops such as wheat, barley and oats and for understanding basic biological processes to facilitate the development of grasses as superior energy crops. Brachypodium is also the first species of the grass subfamily Pooideae with a sequenced genome. For obtaining a better understanding of the mechanisms controlling male gametophyte development in B. distachyon, here we report the cellular changes during the stages of anther development, with special reference to the development of the anther wall. Brachypodium anthers are tetrasporangiate and follow the typical monocotyledonous-type anther wall formation pattern. Anther differentiation starts with the appearance of archesporial cells, which divide to generate primary parietal and primary sporogenous cells. The primary parietal cells form two secondary parietal layers. Later, the outer secondary parietal layer directly develops into the endothecium and the inner secondary parietal layer forms an outer middle layer and inner tapetum by periclinal division. The anther wall comprises an epidermis, endothecium, middle layer and the secretory-type tapetum. Major documented events of anther development include the degradation of a secretory-type tapetum and middle layer during the course of development and the rapid formation of U-shaped endothecial thickenings in the mature pollen grain stage. The tapetum undergoes degeneration at the tetrad stage and disintegrates completely at the bicellular stage of pollen development. The distribution of insoluble polysaccharides in the anther layers and connective tissue through progressive developmental stages suggests their role in the development of male gametophytes. Until sporogenous cell stage, the amount of insoluble polysaccharides in the anther wall was negligible. However, abundant levels of insoluble polysaccharides were observed during microspore mother cell and tetrad stages and gradually

  3. The deposition and characterization of starch in Brachypodium distachyon

    DEFF Research Database (Denmark)

    Tanackovic, Vanja; Svensson, Jan T.; Jensen, Susanne Langgård

    2014-01-01

    Brachypodium distachyon is a non-domesticated cereal. Nonetheless, Brachypodium was recently introduced as a model plant for temperate cereals. This study compares grain starch metabolism in Brachypodium and barley (Hordeum vulgare). In Brachypodium, we identified and annotated 28 genes involved...

  4. The WRKY transcription factor family in Brachypodium distachyon

    National Research Council Canada - National Science Library

    Tripathi, Prateek; Rabara, Roel C; Langum, Tanner J; Boken, Ashley K; Rushton, Deena L; Boomsma, Darius D; Rinerson, Charles I; Rabara, Jennifer; Reese, R Neil; Chen, Xianfeng; Rohila, Jai S; Rushton, Paul J

    2012-01-01

    .... Brachypodium distachyon (Brachypodium) is such a system. The WRKY family of transcription factors is one of the most important families of plant transcriptional regulators with members regulating important agronomic traits...

  5. Brachypodium distachyon as a Genetic Model System.

    Science.gov (United States)

    Kellogg, Elizabeth A

    2015-01-01

    Brachypodium distachyon has emerged as a powerful model system for studying the genetics of flowering plants. Originally chosen for its phylogenetic proximity to the large-genome cereal crops wheat and barley, it is proving to be useful for more than simply providing markers for comparative mapping. Studies in B. distachyon have provided new insight into the structure and physiology of plant cell walls, the development and chemical composition of endosperm, and the genetic basis for cold tolerance. Recent work on auxin transport has uncovered mechanisms that apply to all angiosperms other than Arabidopsis. In addition to the areas in which it is currently used, B. distachyon is uniquely suited for studies of floral development, vein patterning, the controls of the perennial versus annual habit, and genome organization.

  6. Brachypodium distachyon

    DEFF Research Database (Denmark)

    Tanackovic, Vanja

    Starch is one of the most abundant polysaccharides on the Earth, the principal energy storage of most plant species and of crucial significance for humans as a major nutrient in human diet. The majority of produced starch comes from cereals, domesticated grasses, characterized by specific en...... (1.9%). Brachypodium starch bioengineering was demonstrated by ge­netic transformation to provide transgenic Brachypodium lines expressing green fluorescent protein (GFP) driven by the barley hordein promoter. Additionally, this thesis aims to introduce the starch-recognising probe carbohydrate...... binding module family 20 (CBM20) from Aspergillus niger for detecting different starch structures using carbohydrate microarray high throughput screening. The screening method was validated using transgenic barley grain analysed over development and germination and Brachypodium starch....

  7. Genetic architecture of flowering time variation in Brachypodium distachyon

    Science.gov (United States)

    The transition to reproductive development is a crucial step of a plant’s life cycle, and the timing of this transition is an important factor in crop yields. Here, we report new insights into the genetic control of natural variation in flowering time in Brachypodium distachyon, a non-domesticated c...

  8. The WRKY transcription factor family in Brachypodium distachyon

    Directory of Open Access Journals (Sweden)

    Tripathi Prateek

    2012-06-01

    Full Text Available Abstract Background A complete assembled genome sequence of wheat is not yet available. Therefore, model plant systems for wheat are very valuable. Brachypodium distachyon (Brachypodium is such a system. The WRKY family of transcription factors is one of the most important families of plant transcriptional regulators with members regulating important agronomic traits. Studies of WRKY transcription factors in Brachypodium and wheat therefore promise to lead to new strategies for wheat improvement. Results We have identified and manually curated the WRKY transcription factor family from Brachypodium using a pipeline designed to identify all potential WRKY genes. 86 WRKY transcription factors were found, a total higher than all other current databases. We therefore propose that our numbering system (BdWRKY1-BdWRKY86 becomes the standard nomenclature. In the JGI v1.0 assembly of Brachypodium with the MIPS/JGI v1.0 annotation, nine of the transcription factors have no gene model and eleven gene models are probably incorrectly predicted. In total, twenty WRKY transcription factors (23.3% do not appear to have accurate gene models. To facilitate use of our data, we have produced The Database of Brachypodium distachyon WRKY Transcription Factors. Each WRKY transcription factor has a gene page that includes predicted protein domains from MEME analyses. These conserved protein domains reflect possible input and output domains in signaling. The database also contains a BLAST search function where a large dataset of WRKY transcription factors, published genes, and an extensive set of wheat ESTs can be searched. We also produced a phylogram containing the WRKY transcription factor families from Brachypodium, rice, Arabidopsis, soybean, and Physcomitrella patens, together with published WRKY transcription factors from wheat. This phylogenetic tree provides evidence for orthologues, co-orthologues, and paralogues of Brachypodium WRKY transcription factors

  9. The WRKY transcription factor family in Brachypodium distachyon.

    Science.gov (United States)

    Tripathi, Prateek; Rabara, Roel C; Langum, Tanner J; Boken, Ashley K; Rushton, Deena L; Boomsma, Darius D; Rinerson, Charles I; Rabara, Jennifer; Reese, R Neil; Chen, Xianfeng; Rohila, Jai S; Rushton, Paul J

    2012-06-22

    A complete assembled genome sequence of wheat is not yet available. Therefore, model plant systems for wheat are very valuable. Brachypodium distachyon (Brachypodium) is such a system. The WRKY family of transcription factors is one of the most important families of plant transcriptional regulators with members regulating important agronomic traits. Studies of WRKY transcription factors in Brachypodium and wheat therefore promise to lead to new strategies for wheat improvement. We have identified and manually curated the WRKY transcription factor family from Brachypodium using a pipeline designed to identify all potential WRKY genes. 86 WRKY transcription factors were found, a total higher than all other current databases. We therefore propose that our numbering system (BdWRKY1-BdWRKY86) becomes the standard nomenclature. In the JGI v1.0 assembly of Brachypodium with the MIPS/JGI v1.0 annotation, nine of the transcription factors have no gene model and eleven gene models are probably incorrectly predicted. In total, twenty WRKY transcription factors (23.3%) do not appear to have accurate gene models. To facilitate use of our data, we have produced The Database of Brachypodium distachyon WRKY Transcription Factors. Each WRKY transcription factor has a gene page that includes predicted protein domains from MEME analyses. These conserved protein domains reflect possible input and output domains in signaling. The database also contains a BLAST search function where a large dataset of WRKY transcription factors, published genes, and an extensive set of wheat ESTs can be searched. We also produced a phylogram containing the WRKY transcription factor families from Brachypodium, rice, Arabidopsis, soybean, and Physcomitrella patens, together with published WRKY transcription factors from wheat. This phylogenetic tree provides evidence for orthologues, co-orthologues, and paralogues of Brachypodium WRKY transcription factors. The description of the WRKY transcription factor

  10. Brachypodium distachyon genomics for sustainable food and fuel production.

    Science.gov (United States)

    Bevan, Michael W; Garvin, David F; Vogel, John P

    2010-04-01

    Grass crops are the most important sources of human nutrition, and their improvement is centrally important for meeting the challenges of sustainable agriculture, for feeding the world's population and for developing renewable supplies of fuel and industrial products. We describe the complete sequence of the compact genome of Brachypodium distachyon (Brachypodium) the first pooid grass to be sequenced. We demonstrate the many favorable characteristics of Brachypodium as an experimental system and show how it can be used to navigate the large and complex genomes of closely related grasses. The functional genomics and other experimental resources that are being developed will provide a key resource for improving food and forage crops, in particular wheat, barley and forage grasses, and for establishing new grass crops for sustainable energy production. Copyright 2010 Elsevier Ltd. All rights reserved.

  11. A Universal Genome Array and Transcriptome Atlas for Brachypodium Distachyon

    Energy Technology Data Exchange (ETDEWEB)

    Mockler, Todd [Oregon State Univ., Corvallis, OR (United States)

    2017-04-17

    Brachypodium distachyon is the premier experimental model grass platform and is related to candidate feedstock crops for bioethanol production. Based on the DOE-JGI Brachypodium Bd21 genome sequence and annotation we designed a whole genome DNA microarray platform. The quality of this array platform is unprecedented due to the exceptional quality of the Brachypodium genome assembly and annotation and the stringent probe selection criteria employed in the design. We worked with members of the international community and the bioinformatics/design team at Affymetrix at all stages in the development of the array. We used the Brachypodium arrays to interrogate the transcriptomes of plants grown in a variety of environmental conditions including diurnal and circadian light/temperature conditions and under a variety of environmental conditions. We examined the transciptional responses of Brachypodium seedlings subjected to various abiotic stresses including heat, cold, salt, and high intensity light. We generated a gene expression atlas representing various organs and developmental stages. The results of these efforts including all microarray datasets are published and available at online public databases.

  12. Use of Agrobacterium rhizogenes strain 18r12v and paromomycin selection for transformation of Brachypodium distachyon and Brachypodium sylvaticum

    Directory of Open Access Journals (Sweden)

    Ray eCollier

    2016-05-01

    Full Text Available The genetic transformation of monocot grasses is a resource intensive process, the quality and efficiency of which is dependent in part upon the method of DNA introduction, as well as the ability to effectively separate transformed from wildtype tissue. Agrobacterium-mediated transformation of Brachypodium has relied mainly on Agrobacterium tumefaciens strain AGL1. Currently the antibiotic hygromycin B has been the selective agent of choice for robust identification of transgenic calli in Brachypodium distachyon and Brachypodium sylvaticum but few other chemicals have been shown to work as well for selection of transgenic Brachypodium cells in tissue culture. This study demonstrates that Agrobacterium rhizogenes strain 18r12v and paromomycin selection can be successfully used for the efficient generation of transgenic B. distachyon and B. sylvaticum. Additionally we observed that the transformation rates were similar to or higher than those obtained with A. tumefaciens strain AGL1 and hygromycin selection. The A. rhizogenes strain 18r12v harboring the pARS1 binary vector and paromomycin selection is an effective means of generating transgenic Brachypodium plants. This novel approach will facilitate the transgenic complementation of T-DNA knockout mutants of B. distachyon which were created using hygromycin selection, as well as aid the implementation of more complex genome manipulation strategies which require multiple rounds of transformation.

  13. QTLs for resistance to the false brome rust Puccinia brachypodii in the model grass Brachypodium distachyon L.

    NARCIS (Netherlands)

    Barbieri, M.; Marcel, T.C.; Niks, R.E.; Francia, E.; Pasquariello, M.; Mazzamurro, V.; Garvin, D.F.; Pecchioni, N.

    2012-01-01

    The potential of the model grass Brachypodium distachyon L. (Brachypodium) for studying grass–pathogen interactions is still underexploited. We aimed to identify genomic regions in Brachypodium associated with quantitative resistance to the false brome rust fungus Puccinia brachypodii. The inbred

  14. Brachypodium distachyon as a model system for studies of copper transport in cereal crops

    Directory of Open Access Journals (Sweden)

    Ha-il eJung

    2014-05-01

    Full Text Available Copper (Cu is an essential micronutrient that performs a remarkable array of functions in plants including photosynthesis, cell wall remodeling, flowering, and seed set. Of the world's major cereal crops, wheat, barley, and oat are the most sensitive to Cu deficiency. Cu deficient soils include alkaline soils, which occupy approximately 30% of the world’s arable lands, and organic soils that occupy an estimated 19% of arable land in Europe. We used Brachypodium distachyon (brachypodium as a proxy for wheat and other grain cereals to initiate analyses of the molecular mechanisms underlying their increased susceptibility to Cu deficiency. In this report, we focus on members of the CTR/COPT family of Cu transporters because their homologs in A. thaliana are transcriptionally upregulated in Cu-limited conditions and are involved either in Cu uptake from soils into epidermal cells in the root, or long-distance transport and distribution of Cu in photosynthetic tissues. We found that of five COPT proteins in brachypodium, BdCOPT3 and BdCOPT4 localize to the plasma membrane and are transcriptionally upregulated in roots and leaves by Cu deficiency. We also found that BdCOPT3, BdCOPT4, and BdCOPT5 confer low affinity Cu transport, in contrast to their counterparts in A. thaliana that confer high affinity Cu transport. These data suggest that increased sensitivity to Cu deficiency in some grass species may arise from lower efficiency and, possibly, other properties of components of Cu uptake and tissue partitioning systems and reinforce the importance of using brachypodium as a model for the comprehensive analyses of Cu homeostasis in cereal crops.

  15. Genome sequence analysis of the model grass Brachypodium distachyon: insights into grass genome evolution

    Energy Technology Data Exchange (ETDEWEB)

    Schulman, Al

    2009-08-09

    Three subfamilies of grasses, the Erhardtoideae (rice), the Panicoideae (maize, sorghum, sugar cane and millet), and the Pooideae (wheat, barley and cool season forage grasses) provide the basis of human nutrition and are poised to become major sources of renewable energy. Here we describe the complete genome sequence of the wild grass Brachypodium distachyon (Brachypodium), the first member of the Pooideae subfamily to be completely sequenced. Comparison of the Brachypodium, rice and sorghum genomes reveals a precise sequence- based history of genome evolution across a broad diversity of the grass family and identifies nested insertions of whole chromosomes into centromeric regions as a predominant mechanism driving chromosome evolution in the grasses. The relatively compact genome of Brachypodium is maintained by a balance of retroelement replication and loss. The complete genome sequence of Brachypodium, coupled to its exceptional promise as a model system for grass research, will support the development of new energy and food crops

  16. Comparative and Evolutionary Analysis of Grass Pollen Allergens Using Brachypodium distachyon as a Model System

    Science.gov (United States)

    Sharma, Akanksha; Sharma, Niharika; Bhalla, Prem; Singh, Mohan

    2017-01-01

    Comparative genomics have facilitated the mining of biological information from a genome sequence, through the detection of similarities and differences with genomes of closely or more distantly related species. By using such comparative approaches, knowledge can be transferred from the model to non-model organisms and insights can be gained in the structural and evolutionary patterns of specific genes. In the absence of sequenced genomes for allergenic grasses, this study was aimed at understanding the structure, organisation and expression profiles of grass pollen allergens using the genomic data from Brachypodium distachyon as it is phylogenetically related to the allergenic grasses. Combining genomic data with the anther RNA-Seq dataset revealed 24 pollen allergen genes belonging to eight allergen groups mapping on the five chromosomes in B. distachyon. High levels of anther-specific expression profiles were observed for the 24 identified putative allergen-encoding genes in Brachypodium. The genomic evidence suggests that gene encoding the group 5 allergen, the most potent trigger of hay fever and allergic asthma originated as a pollen specific orphan gene in a common grass ancestor of Brachypodium and Triticiae clades. Gene structure analysis showed that the putative allergen-encoding genes in Brachypodium either lack or contain reduced number of introns. Promoter analysis of the identified Brachypodium genes revealed the presence of specific cis-regulatory sequences likely responsible for high anther/pollen-specific expression. With the identification of putative allergen-encoding genes in Brachypodium, this study has also described some important plant gene families (e.g. expansin superfamily, EF-Hand family, profilins etc) for the first time in the model plant Brachypodium. Altogether, the present study provides new insights into structural characterization and evolution of pollen allergens and will further serve as a base for their functional

  17. Comparative and Evolutionary Analysis of Grass Pollen Allergens Using Brachypodium distachyon as a Model System.

    Directory of Open Access Journals (Sweden)

    Akanksha Sharma

    Full Text Available Comparative genomics have facilitated the mining of biological information from a genome sequence, through the detection of similarities and differences with genomes of closely or more distantly related species. By using such comparative approaches, knowledge can be transferred from the model to non-model organisms and insights can be gained in the structural and evolutionary patterns of specific genes. In the absence of sequenced genomes for allergenic grasses, this study was aimed at understanding the structure, organisation and expression profiles of grass pollen allergens using the genomic data from Brachypodium distachyon as it is phylogenetically related to the allergenic grasses. Combining genomic data with the anther RNA-Seq dataset revealed 24 pollen allergen genes belonging to eight allergen groups mapping on the five chromosomes in B. distachyon. High levels of anther-specific expression profiles were observed for the 24 identified putative allergen-encoding genes in Brachypodium. The genomic evidence suggests that gene encoding the group 5 allergen, the most potent trigger of hay fever and allergic asthma originated as a pollen specific orphan gene in a common grass ancestor of Brachypodium and Triticiae clades. Gene structure analysis showed that the putative allergen-encoding genes in Brachypodium either lack or contain reduced number of introns. Promoter analysis of the identified Brachypodium genes revealed the presence of specific cis-regulatory sequences likely responsible for high anther/pollen-specific expression. With the identification of putative allergen-encoding genes in Brachypodium, this study has also described some important plant gene families (e.g. expansin superfamily, EF-Hand family, profilins etc for the first time in the model plant Brachypodium. Altogether, the present study provides new insights into structural characterization and evolution of pollen allergens and will further serve as a base for their

  18. Cell walls and the developmental anatomy of the Brachypodium distachyon stem internode.

    Directory of Open Access Journals (Sweden)

    Dominick A Matos

    Full Text Available While many aspects of plant cell wall polymer structure are known, their spatial and temporal distribution within the stem are not well understood. Here, we studied vascular system and fiber development, which has implication for both biofuel feedstock conversion efficiency and crop yield. The subject of this study, Brachypodium distachyon, has emerged as a grass model for food and energy crop research. Here, we conducted our investigation using B. distachyon by applying various histological approaches and Fourier transform infrared spectroscopy to the stem internode from three key developmental stages. While vascular bundle size and number did not change over time, the size of the interfascicular region increased dramatically, as did cell wall thickness. We also describe internal stem internode anatomy and demonstrate that lignin deposition continues after crystalline cellulose and xylan accumulation ceases. The vascular bundle anatomy of B. distachyon appears to be highly similar to domesticated grasses. While the arrangement of bundles within the stem is highly variable across grasses, B. distachyon appears to be a suitable model for the rind of large C4 grass crops. A better understanding of growth and various anatomical and cell wall features of B. distachyon will further our understanding of plant biomass accumulation processes.

  19. Expansion and stress responses of AP2/EREBP superfamily in Brachypodium distachyon.

    Science.gov (United States)

    Chen, Lihong; Han, Jiapeng; Deng, Xiaomin; Tan, Shenglong; Li, Lili; Li, Lun; Zhou, Junfei; Peng, Hai; Yang, Guangxiao; He, Guangyuan; Zhang, Weixiong

    2016-02-12

    APETALA2/ethylene-responsive element binding protein (AP2/EREBP) transcription factors constitute one of the largest and most conserved gene families in plant, and play essential roles in growth, development and stress response. Except a few members, the AP2/EREBP family has not been characterized in Brachypodium distachyon, a model plant of Poaceae. We performed a genome-wide study of this family in B. distachyon by phylogenetic analyses, transactivation assays and transcript profiling. A total of 149 AP2/EREBP genes were identified and divided into four subfamilies, i.e., ERF (ethylene responsive factor), DREB (dehydration responsive element binding gene), RAV (related to ABI3/VP) and AP2. Tandem duplication was a major force in expanding B. distachyon AP2/EREBP (BdAP2/EREBP) family. Despite a significant expansion, genomic organizations of BdAP2/EREBPs were monotonous as the majority of them, except those of AP2 subfamily, had no intron. An analysis of transcription activities of several closely related and duplicated BdDREB genes showed their functional divergence and redundancy in evolution. The expression of BdAP2/EREBPs in different tissues and the expression of DREB/ERF subfamilies in B. distachyon, wheat and rice under abiotic stresses were investigated by next-generation sequencing and microarray profiling. Our results are valuable for further function analysis of stress tolerant AP2/EREBP genes in B. distachyon.

  20. Genome Wide Analysis of Nucleotide-Binding Site Disease Resistance Genes in Brachypodium distachyon

    Directory of Open Access Journals (Sweden)

    Shenglong Tan

    2012-01-01

    Full Text Available Nucleotide-binding site (NBS disease resistance genes play an important role in defending plants from a variety of pathogens and insect pests. Many R-genes have been identified in various plant species. However, little is known about the NBS-encoding genes in Brachypodium distachyon. In this study, using computational analysis of the B. distachyon genome, we identified 126 regular NBS-encoding genes and characterized them on the bases of structural diversity, conserved protein motifs, chromosomal locations, gene duplications, promoter region, and phylogenetic relationships. EST hits and full-length cDNA sequences (from Brachypodium database of 126 R-like candidates supported their existence. Based on the occurrence of conserved protein motifs such as coiled-coil (CC, NBS, leucine-rich repeat (LRR, these regular NBS-LRR genes were classified into four subgroups: CC-NBS-LRR, NBS-LRR, CC-NBS, and X-NBS. Further expression analysis of the regular NBS-encoding genes in Brachypodium database revealed that these genes are expressed in a wide range of libraries, including those constructed from various developmental stages, tissue types, and drought challenged or nonchallenged tissue.

  1. Diurnal Transcriptome and Gene Network Represented through Sparse Modeling in Brachypodium distachyon

    Directory of Open Access Journals (Sweden)

    Satoru Koda

    2017-11-01

    Full Text Available We report the comprehensive identification of periodic genes and their network inference, based on a gene co-expression analysis and an Auto-Regressive eXogenous (ARX model with a group smoothly clipped absolute deviation (SCAD method using a time-series transcriptome dataset in a model grass, Brachypodium distachyon. To reveal the diurnal changes in the transcriptome in B. distachyon, we performed RNA-seq analysis of its leaves sampled through a diurnal cycle of over 48 h at 4 h intervals using three biological replications, and identified 3,621 periodic genes through our wavelet analysis. The expression data are feasible to infer network sparsity based on ARX models. We found that genes involved in biological processes such as transcriptional regulation, protein degradation, and post-transcriptional modification and photosynthesis are significantly enriched in the periodic genes, suggesting that these processes might be regulated by circadian rhythm in B. distachyon. On the basis of the time-series expression patterns of the periodic genes, we constructed a chronological gene co-expression network and identified putative transcription factors encoding genes that might be involved in the time-specific regulatory transcriptional network. Moreover, we inferred a transcriptional network composed of the periodic genes in B. distachyon, aiming to identify genes associated with other genes through variable selection by grouping time points for each gene. Based on the ARX model with the group SCAD regularization using our time-series expression datasets of the periodic genes, we constructed gene networks and found that the networks represent typical scale-free structure. Our findings demonstrate that the diurnal changes in the transcriptome in B. distachyon leaves have a sparse network structure, demonstrating the spatiotemporal gene regulatory network over the cyclic phase transitions in B. distachyon diurnal growth.

  2. Diurnal Transcriptome and Gene Network Represented through Sparse Modeling in Brachypodium distachyon.

    Science.gov (United States)

    Koda, Satoru; Onda, Yoshihiko; Matsui, Hidetoshi; Takahagi, Kotaro; Yamaguchi-Uehara, Yukiko; Shimizu, Minami; Inoue, Komaki; Yoshida, Takuhiro; Sakurai, Tetsuya; Honda, Hiroshi; Eguchi, Shinto; Nishii, Ryuei; Mochida, Keiichi

    2017-01-01

    We report the comprehensive identification of periodic genes and their network inference, based on a gene co-expression analysis and an Auto-Regressive eXogenous (ARX) model with a group smoothly clipped absolute deviation (SCAD) method using a time-series transcriptome dataset in a model grass, Brachypodium distachyon. To reveal the diurnal changes in the transcriptome in B. distachyon, we performed RNA-seq analysis of its leaves sampled through a diurnal cycle of over 48 h at 4 h intervals using three biological replications, and identified 3,621 periodic genes through our wavelet analysis. The expression data are feasible to infer network sparsity based on ARX models. We found that genes involved in biological processes such as transcriptional regulation, protein degradation, and post-transcriptional modification and photosynthesis are significantly enriched in the periodic genes, suggesting that these processes might be regulated by circadian rhythm in B. distachyon. On the basis of the time-series expression patterns of the periodic genes, we constructed a chronological gene co-expression network and identified putative transcription factors encoding genes that might be involved in the time-specific regulatory transcriptional network. Moreover, we inferred a transcriptional network composed of the periodic genes in B. distachyon, aiming to identify genes associated with other genes through variable selection by grouping time points for each gene. Based on the ARX model with the group SCAD regularization using our time-series expression datasets of the periodic genes, we constructed gene networks and found that the networks represent typical scale-free structure. Our findings demonstrate that the diurnal changes in the transcriptome in B. distachyon leaves have a sparse network structure, demonstrating the spatiotemporal gene regulatory network over the cyclic phase transitions in B. distachyon diurnal growth.

  3. Annotation and comparative analysis of the glycoside hydrolase genes in Brachypodium distachyon

    Energy Technology Data Exchange (ETDEWEB)

    Tyler, Ludmila [United States Department of Agriculture (USDA), Western Regional Research Center (WRRC), Albany; Bragg, Jennifer [United States Department of Agriculture (USDA), Western Regional Research Center (WRRC), Albany; Wu, Jiajie [United States Department of Agriculture (USDA), Western Regional Research Center (WRRC), Albany; Yang, Xiaohan [ORNL; Tuskan, Gerald A [ORNL; Vogel, John [United States Department of Agriculture (USDA), Western Regional Research Center (WRRC), Albany

    2010-01-01

    Background Glycoside hydrolases cleave the bond between a carbohydrate and another carbohydrate, a protein, lipid or other moiety. Genes encoding glycoside hydrolases are found in a wide range of organisms, from archea to animals, and are relatively abundant in plant genomes. In plants, these enzymes are involved in diverse processes, including starch metabolism, defense, and cell-wall remodeling. Glycoside hydrolase genes have been previously cataloged for Oryza sativa (rice), the model dicotyledonous plant Arabidopsis thaliana, and the fast-growing tree Populus trichocarpa (poplar). To improve our understanding of glycoside hydrolases in plants generally and in grasses specifically, we annotated the glycoside hydrolase genes in the grasses Brachypodium distachyon (an emerging monocotyledonous model) and Sorghum bicolor (sorghum). We then compared the glycoside hydrolases across species, both at the whole-genome level and at the level of individual glycoside hydrolase families. Results We identified 356 glycoside hydrolase genes in Brachypodium and 404 in sorghum. The corresponding proteins fell into the same 34 families that are represented in rice, Arabidopsis, and poplar, helping to define a glycoside hydrolase family profile which may be common to flowering plants. Examination of individual glycoside hydrolase familes (GH5, GH13, GH18, GH19, GH28, and GH51) revealed both similarities and distinctions between monocots and dicots, as well as between species. Shared evolutionary histories appear to be modified by lineage-specific expansions or deletions. Within families, the Brachypodium and sorghum proteins generally cluster with those from other monocots. Conclusions This work provides the foundation for further comparative and functional analyses of plant glycoside hydrolases. Defining the Brachypodium glycoside hydrolases sets the stage for Brachypodium to be a monocot model for investigations of these enzymes and their diverse roles in planta. Insights

  4. Application of Tissue Culture and Transformation Techniques in Model Species Brachypodium distachyon.

    Science.gov (United States)

    Sogutmaz Ozdemir, Bahar; Budak, Hikmet

    2018-01-01

    Brachypodium distachyon has recently emerged as a model plant species for the grass family (Poaceae) that includes major cereal crops and forage grasses. One of the important traits of a model species is its capacity to be transformed and ease of growing both in tissue culture and in greenhouse conditions. Hence, plant transformation technology is crucial for improvements in agricultural studies, both for the study of new genes and in the production of new transgenic plant species. In this chapter, we review an efficient tissue culture and two different transformation systems for Brachypodium using most commonly preferred gene transfer techniques in plant species, microprojectile bombardment method (biolistics) and Agrobacterium-mediated transformation.In plant transformation studies, frequently used explant materials are immature embryos due to their higher transformation efficiencies and regeneration capacity. However, mature embryos are available throughout the year in contrast to immature embryos. We explain a tissue culture protocol for Brachypodium using mature embryos with the selected inbred lines from our collection. Embryogenic calluses obtained from mature embryos are used to transform Brachypodium with both plant transformation techniques that are revised according to previously studied protocols applied in the grasses, such as applying vacuum infiltration, different wounding effects, modification in inoculation and cocultivation steps or optimization of bombardment parameters.

  5. Investigations of barley stripe mosaic virus as a gene silencing vector in barley roots and in Brachypodium distachyon and oat

    DEFF Research Database (Denmark)

    Pacak, Andrzej; Geisler, Katrin; Jørgensen, Bodil

    2010-01-01

    -expressed genes we wanted to explore the potential of BSMV for silencing genes in root tissues. Furthermore, the newly completed genome sequence of the emerging cereal model species Brachypodium distachyon as well as the increasing amount of EST sequence information available for oat (Avena species) have created...

  6. Analysis of saccharification in Brachypodium distachyon stems under mild conditions of hydrolysis

    Directory of Open Access Journals (Sweden)

    Statham Emily R

    2008-10-01

    Full Text Available Abstract Background Brachypodium distachyon constitutes an excellent model species for grasses. It is a small, easily propagated, temperate grass with a rapid life cycle and a small genome. It is a self-fertile plant that can be transformed with high efficiency using Agrobacteria and callus derived from immature embryos. In addition, considerable genetic and genomic resources are becoming available for this species in the form of mapping populations, large expressed sequence tag collections, T-DNA insertion lines and, in the near future, the complete genome sequence. The development of Brachypodium as a model species is of particular value in the areas of cell wall and biomass research, where differences between dicots and grasses are greatest. Here we explore the effect of mild conditions of pretreatment and hydrolysis in Brachypodium stem segments as a contribution for the establishment of sensitive screening of the saccharification properties in different genetic materials. Results The non-cellulosic monosaccharide composition of Brachypodium is closely related to grasses of agricultural importance and significantly different from the dicot model Arabidopsis thaliana. Diluted acid pretreatment of stem segments produced significant release of sugars and negatively affected the amount of sugars obtained by enzymatic hydrolysis. Monosaccharide and oligosaccharide analysis showed that the hemicellulose fraction is the main target of the enzymatic activity under the modest hydrolytic conditions used in our assays. Scanning electron microscopy analysis of the treated materials showed progressive exposure of fibrils in the stem segments. Conclusion Results presented here indicate that under mild conditions cellulose and hemicellulose are hydrolysed to differing extents, with hemicellulose hydrolysis predominating. We anticipate that the sub-optimal conditions for hydrolysis identified here will provide a sensitive assay to detect variations in

  7. Genome-wide evolutionary characterization and expression analyses of WRKY family genes in Brachypodium distachyon.

    Science.gov (United States)

    Wen, Feng; Zhu, Hong; Li, Peng; Jiang, Min; Mao, Wenqing; Ong, Chermaine; Chu, Zhaoqing

    2014-06-01

    Members of plant WRKY gene family are ancient transcription factors that function in plant growth and development and respond to biotic and abiotic stresses. In our present study, we have investigated WRKY family genes in Brachypodium distachyon, a new model plant of family Poaceae. We identified a total of 86 WRKY genes from B. distachyon and explored their chromosomal distribution and evolution, domain alignment, promoter cis-elements, and expression profiles. Combining the analysis of phylogenetic tree of BdWRKY genes and the result of expression profiling, results showed that most of clustered gene pairs had higher similarities in the WRKY domain, suggesting that they might be functionally redundant. Neighbour-joining analysis of 301 WRKY domains from Oryza sativa, Arabidopsis thaliana, and B. distachyon suggested that BdWRKY domains are evolutionarily more closely related to O. sativa WRKY domains than those of A. thaliana. Moreover, tissue-specific expression profile of BdWRKY genes and their responses to phytohormones and several biotic or abiotic stresses were analysed by quantitative real-time PCR. The results showed that the expression of BdWRKY genes was rapidly regulated by stresses and phytohormones, and there was a strong correlation between promoter cis-elements and the phytohormones-induced BdWRKY gene expression. © The Author 2014. Published by Oxford University Press on behalf of Kazusa DNA Research Institute.

  8. Centromeres cluster de novo at the beginning of meiosis in Brachypodium distachyon.

    Directory of Open Access Journals (Sweden)

    Ruoyu Wen

    Full Text Available In most eukaryotes that have been studied, the telomeres cluster into a bouquet early in meiosis, and in wheat and its relatives and in Arabidopsis the centromeres pair at the same time. In Arabidopsis, the telomeres do not cluster as a typical telomere bouquet on the nuclear membrane but are associated with the nucleolus both somatically and at the onset of meiosis. We therefore assessed whether Brachypodium distachyon, a monocot species related to cereals and whose genome is approximately twice the size of Arabidopsis thaliana, also exhibited an atypical telomere bouquet and centromere pairing. In order to investigate the occurrence of a bouquet and centromere pairing in B distachyon, we first had to establish protocols for studying meiosis in this species. This enabled us to visualize chromosome behaviour in meiocytes derived from young B distachyon spikelets in three-dimensions by fluorescent in situ hybridization (FISH, and accurately to stage meiosis based on chromatin morphology in relation to spikelet size and the timing of sample collection. Surprisingly, this study revealed that the centromeres clustered as a single site at the same time as the telomeres also formed a bouquet or single cluster.

  9. Linking dynamic phenotyping with metabolite analysis to study natural variation in drought responses of Brachypodium distachyon

    Directory of Open Access Journals (Sweden)

    Lorraine H.C. Fisher

    2016-11-01

    Full Text Available Drought is an important environmental stress limiting the productivity of major crops worldwide. Understanding drought tolerance and possible mechanisms for improving drought resistance is therefore a prerequisite to develop drought-tolerant crops that produce significant yields with reduced amounts of water. Brachypodium distachyon (Brachypodium is a key model species for cereals, forage grasses and energy grasses. In this study, initial screening of a Brachypodium germplasm collection consisting of 138 different ecotypes exposed to progressive drought, highlighted the natural variation in morphology, biomass accumulation and responses to drought stress. A core set of ten ecotypes, classified as being either tolerant, susceptible or intermediate, in response to drought stress, were exposed to mild or severe (respectively 15% and 0% soil water content drought stress and phenomic parameters linked to growth and colour changes were assessed. When exposed to severe drought stress, phenotypic data and metabolite profiling combined with multivariate analysis revealed a remarkable consistency in separating the selected ecotypes into their different pre-defined drought tolerance groups. Increases in several metabolites, including for the phytohormones jasmonic acid and salicylic acid, and TCA-cycle intermediates, were positively correlated with biomass yield and with reduced yellow pixel counts; suggestive of delayed senescence, both key target traits for crop improvement to drought stress. While metabolite analysis also separated ecotypes into the distinct tolerance groupings after exposure to mild drought stress, similar analysis of the phenotypic data failed to do so, confirming the value of metabolomics to investigate early responses to drought stress. The results highlight the potential of combining the analyses of phenotypic and metabolic responses to identify key mechanisms and markers associated with drought tolerance in both the Brachypodium

  10. A BAC-based physical map of Brachypodium distachyon and its comparative analysis with rice and wheat

    Science.gov (United States)

    Gu, Yong Q; Ma, Yaqin; Huo, Naxin; Vogel, John P; You, Frank M; Lazo, Gerard R; Nelson, William M; Soderlund, Carol; Dvorak, Jan; Anderson, Olin D; Luo, Ming-Cheng

    2009-01-01

    Background Brachypodium distachyon (Brachypodium) has been recognized as a new model species for comparative and functional genomics of cereal and bioenergy crops because it possesses many biological attributes desirable in a model, such as a small genome size, short stature, self-pollinating habit, and short generation cycle. To maximize the utility of Brachypodium as a model for basic and applied research it is necessary to develop genomic resources for it. A BAC-based physical map is one of them. A physical map will facilitate analysis of genome structure, comparative genomics, and assembly of the entire genome sequence. Results A total of 67,151 Brachypodium BAC clones were fingerprinted with the SNaPshot HICF fingerprinting method and a genome-wide physical map of the Brachypodium genome was constructed. The map consisted of 671 contigs and 2,161 clones remained as singletons. The contigs and singletons spanned 414 Mb. A total of 13,970 gene-related sequences were detected in the BAC end sequences (BES). These gene tags aligned 345 contigs with 336 Mb of rice genome sequence, showing that Brachypodium and rice genomes are generally highly colinear. Divergent regions were mainly in the rice centromeric regions. A dot-plot of Brachypodium contigs against the rice genome sequences revealed remnants of the whole-genome duplication caused by paleotetraploidy, which were previously found in rice and sorghum. Brachypodium contigs were anchored to the wheat deletion bin maps with the BES gene-tags, opening the door to Brachypodium-Triticeae comparative genomics. Conclusion The construction of the Brachypodium physical map, and its comparison with the rice genome sequence demonstrated the utility of the SNaPshot-HICF method in the construction of BAC-based physical maps. The map represents an important genomic resource for the completion of Brachypodium genome sequence and grass comparative genomics. A draft of the physical map and its comparisons with rice and wheat

  11. Updated taxonomic descriptions, iconography, and habitat preferences of Brachypodium distachyon, B. stacei, and B. hybridum (Poaceae

    Directory of Open Access Journals (Sweden)

    Catalán, Pilar

    2016-06-01

    Full Text Available We present an updated morphological revision of the three annual species of the genus Brachypodium (Poaceae: B. distachyon, B. tacei, and B. hybridum, which were recently segregated as independent species from the single-species complex B. distachyon s.l. These three species have been proposed as a model system for grass polyploid speciation, and their genomes have been sequenced. However, despite the increasing number of genomic and population-genetic studies conducted for each of these species, no taxonomic updating has been done on them since their original descriptions. B. stacei, the rarest species of the complex, has a protologue based only on the study of specimens from its type locality in Torrent (Formentera, Spain. In this study we update the taxonomic descriptions of the three species using morphoanatomical data from specimens collected throughout their respective native circum-Mediterranean distributions as well as in other localities where they are non-autochthonous. We also provide icons for each species and information about their habitat preferences and geographic distributions.Presentamos una revisión morfológica actualizada de las tres especies anuales del género Brachypodium (Poaceae, B. distachyon, B. stacei y B. ybridum. Estas dos últimas han sido recientemente segregadas como especies independientes dentro del complejo B. distachyon s.l. Las tres especies han sido propuestas como grupo modelo de especiación poliploide en gramíneas y sus genomas han sido secuenciados. Sin embargo, pese al incremento de estudios genómicos y genético-poblacionales desarrollados en poblaciones de estas especies, no se ha llevado a cabo todavía ninguna actualización taxonómica para las mismas desde que se describieron. El protólogo de B. stacei, la especie más rara del complejo, está basado únicamente en el estudio de especímenes de su localidad clásica en Torrent (Formentera, España. En este estudio actualizamos las

  12. Molecular and functional characterization of cold-responsive C-repeat binding factors from Brachypodium distachyon

    Science.gov (United States)

    2014-01-01

    Background Adverse environmental conditions severely influence various aspects of plant growth and developmental processes, causing worldwide reduction of crop yields. The C-repeat binding factors (CBFs) are critical transcription factors constituting the gene regulatory network that mediates the acclimation process to low temperatures. They regulate a large number of cold-responsive genes, including COLD-REGULATED (COR) genes, via the CBF-COR regulon. Recent studies have shown that the CBF transcription factors also play a role in plant responses to drought and salt stresses. Putative CBF gene homologues and their downstream genes are also present in the genome of Brachypodium distachyon, which is perceived as a monocot model in recent years. However, they have not been functionally characterized at the molecular level. Results Three CBF genes that are responsive to cold were identified from Brachypodium, designated BdCBF1, BdCBF2, and BdCBF3, and they were functionally characterized by molecular biological and transgenic approaches in Brachypodium and Arabidopsis thaliana. Our results demonstrate that the BdCBF genes contribute to the tolerance response of Brachypodium to cold, drought, and salt stresses by regulating downstream targets, such as DEHYDRIN5.1 (Dhn5.1) and COR genes. The BdCBF genes are induced under the environmental stress conditions. The BdCBF proteins possess transcriptional activation activity and bind directly to the promoters of the target genes. Transgenic Brachypodium plants overexpressing the BdCBF genes exhibited enhanced resistance to drought and salt stresses as well as low temperatures, and accordingly endogenous contents of proline and soluble sugars were significantly elevated in the transgenic plants. The BdCBF transcription factors are also functional in the heterologous system Arabidopsis. Transgenic Arabidopsis plants overexpressing the BdCBF genes were also tolerant to freezing, drought, and salt stresses, and a set of stress

  13. Molecular and physiological analysis of growth-limiting drought stress in Brachypodium distachyon leaves.

    Science.gov (United States)

    Verelst, Wim; Bertolini, Edoardo; De Bodt, Stefanie; Vandepoele, Klaas; Demeulenaere, Marlies; Pè, Mario Enrico; Inzé, Dirk

    2013-03-01

    The drought-tolerant grass Brachypodium distachyon is an emerging model species for temperate grasses and cereal crops. To explore the usefulness of this species for drought studies, a reproducible in vivo drought assay was developed. Spontaneous soil drying led to a 45% reduction in leaf size, and this was mostly due to a decrease in cell expansion, whereas cell division remained largely unaffected by drought. To investigate the molecular basis of the observed leaf growth reduction, the third Brachypodium leaf was dissected in three zones, namely proliferation, expansion, and mature zones, and subjected to transcriptome analysis, based on a whole-genome tiling array. This approach allowed us to highlight that transcriptome profiles of different developmental leaf zones respond differently to drought. Several genes and functional processes involved in drought tolerance were identified. The transcriptome data suggest an increased energy availability in the proliferation zones, along with an up-regulation of sterol synthesis that may influence membrane fluidity. This information may be used to improve the tolerance of temperate cereals to drought, which is undoubtedly one of the major environmental challenges faced by agriculture today and in the near future.

  14. Identification and Characterization of Carboxylesterases from Brachypodium distachyon Deacetylating Trichothecene Mycotoxins

    Directory of Open Access Journals (Sweden)

    Clemens Schmeitzl

    2015-12-01

    Full Text Available Increasing frequencies of 3-acetyl-deoxynivalenol (3-ADON-producing strains of Fusarium graminearum (3-ADON chemotype have been reported in North America and Asia. 3-ADON is nearly nontoxic at the level of the ribosomal target and has to be deacetylated to cause inhibition of protein biosynthesis. Plant cells can efficiently remove the acetyl groups of 3-ADON, but the underlying genes are yet unknown. We therefore performed a study of the family of candidate carboxylesterases (CXE genes of the monocot model plant Brachypodium distachyon. We report the identification and characterization of the first plant enzymes responsible for deacetylation of trichothecene toxins. The product of the BdCXE29 gene efficiently deacetylates T-2 toxin to HT-2 toxin, NX-2 to NX-3, both 3-ADON and 15-acetyl-deoxynivalenol (15-ADON into deoxynivalenol and, to a lesser degree, also fusarenon X into nivalenol. The BdCXE52 esterase showed lower activity than BdCXE29 when expressed in yeast and accepts 3-ADON, NX-2, 15-ADON and, to a limited extent, fusarenon X as substrates. Expression of these Brachypodium genes in yeast increases the toxicity of 3-ADON, suggesting that highly similar genes existing in crop plants may act as susceptibility factors in Fusarium head blight disease.

  15. Final technical report for: Insertional Mutagenesis of Brachypodium distachyon DE-AI02-07ER64452

    Energy Technology Data Exchange (ETDEWEB)

    John, Vogel P. [DOE Joint Genome Institute, Walnut Creek, CA (United States)

    2015-10-29

    Several bioenergy grasses are poised to become a major source of energy in the United States. Despite their increasing importance, we know little about the basic biology underlying the traits that control the utility of grasses as energy crops. Better knowledge of grass biology (e.g. identification of the genes that control cell wall composition, plant architecture, cell size, cell division, reproduction, nutrient uptake, carbon flux, etc.) could be used to design rational strategies for crop improvement and shorten the time required to domesticate these species. The use of an appropriate model system is an efficient way to gain this knowledge. Brachypodium distachyon is a small annual grass with all the attributes needed to be a modern model organism including simple growth requirements, fast generation time, small stature, small genome size and self-fertility. These attributes led to the recommendation in the DOE’s “Breaking the Biological Barriers to Cellulosic Ethanol: A Joint Research Agenda” report to propose developing and using B. distachyon as a model for energy crops to accelerate their domestication. Strategic investments (e.g. genome sequencing) in B. distachyon by the DOE are now bearing fruit and B. distachyon is being used as a model grass by hundreds of laboratories worldwide. Sequence indexed insertional mutants are an extremely powerful tool for both forward and reverse genetics. They allow researchers to order mutants in any gene tagged in the collection by simply emailing a request. The goal of this project was to create a collection of sequence indexed insertional mutants (T-DNA lines) for the model grass Brachypodium distachyon in order to facilitate research by the scientific community. During the course of this grant we created a collection of 23,649 B. distachyon T-DNA lines and identified 26,112 unique insertion sites. The collection can be queried through the project website (http://jgi.doe.gov/our-science/science-programs/plant-genomics/brachypodium/brachypodium

  16. Evaluation of Brachypodium distachyon L-Tyrosine Decarboxylase Using L-Tyrosine Over-Producing Saccharomyces cerevisiae.

    Directory of Open Access Journals (Sweden)

    Shuhei Noda

    Full Text Available To demonstrate that herbaceous biomass is a versatile gene resource, we focused on the model plant Brachypodium distachyon, and screened the B. distachyon for homologs of tyrosine decarboxylase (TDC, which is involved in the modification of aromatic compounds. A total of 5 candidate genes were identified in cDNA libraries of B. distachyon and were introduced into Saccharomyces cerevisiae to evaluate TDC expression and tyramine production. It is suggested that two TDCs encoded in the transcripts Bradi2g51120.1 and Bradi2g51170.1 have L-tyrosine decarboxylation activity. Bradi2g51170.1 was introduced into the L-tyrosine over-producing strain of S. cerevisiae that was constructed by the introduction of mutant genes that promote deregulated feedback inhibition. The amount of tyramine produced by the resulting transformant was 6.6-fold higher (approximately 200 mg/L than the control strain, indicating that B. distachyon TDC effectively converts L-tyrosine to tyramine. Our results suggest that B. distachyon possesses enzymes that are capable of modifying aromatic residues, and that S. cerevisiae is a suitable host for the production of L-tyrosine derivatives.

  17. Transcriptome-wide Identification and Expression Analysis of Brachypodium distachyon Transposons in Response to Viral Infection

    Directory of Open Access Journals (Sweden)

    Tuğba Gürkök

    2017-10-01

    Full Text Available Transposable elements (TEs are the most abundant group of genomic elements in plants that can be found in genic or intergenic regions of their host genomes. Several stimuli such as biotic or abiotic stress have roles in either activating their transcription or transposition. Here the effect of the Panicum mosaic virus (PMV and its satellite virus (SPMV infection on the transposon transcription of the Brachypodium distachyon model plant was investigated. To evaluate the transcription activity of TEs, transcriptomic data of mock and virus inoculated plants were compared. Our results indicate that major components of TEs are retroelements in all RNA-seq libraries. The number of transcribed TEs detected in mock inoculated plants is higher than virus inoculated plants. In comparison with mock inoculated plants 13% of the TEs showed at least two folds alteration upon PMV infection and 21% upon PMV+SPMV infection. Rather than inoculation with PMV alone inoculation with PMV+SPMV together also increased various TE encoding transcripts expressions. MuDR-N78C_OS encoding transcript was strongly up-regulated against both PMV and PMV+SPMV infection. The synergism generated by PMV and SPMV together enhanced TE transcripts expressions than PMV alone. It was observed that viral infection induced the transcriptional activity of several transposons. The results suggest that increased expressions of TEs might have a role in response to biotic stress in B. distachyon. Identification of TEs which are taking part in stress can serve useful information for functional genomics and designing novel breeding strategies in developing stress resistance crops.

  18. Functional characterization of cinnamyl alcohol dehydrogenase and caffeic acid O-methyltransferase in Brachypodium distachyon

    Science.gov (United States)

    2013-01-01

    Background Lignin is a significant barrier in the conversion of plant biomass to bioethanol. Cinnamyl alcohol dehydrogenase (CAD) and caffeic acid O-methyltransferase (COMT) catalyze key steps in the pathway of lignin monomer biosynthesis. Brown midrib mutants in Zea mays and Sorghum bicolor with impaired CAD or COMT activity have attracted considerable agronomic interest for their altered lignin composition and improved digestibility. Here, we identified and functionally characterized candidate genes encoding CAD and COMT enzymes in the grass model species Brachypodium distachyon with the aim of improving crops for efficient biofuel production. Results We developed transgenic plants overexpressing artificial microRNA designed to silence BdCAD1 or BdCOMT4. Both transgenes caused altered flowering time and increased stem count and weight. Downregulation of BdCAD1 caused a leaf brown midrib phenotype, the first time this phenotype has been observed in a C3 plant. While acetyl bromide soluble lignin measurements were equivalent in BdCAD1 downregulated and control plants, histochemical staining and thioacidolysis indicated a decrease in lignin syringyl units and reduced syringyl/guaiacyl ratio in the transgenic plants. BdCOMT4 downregulated plants exhibited a reduction in total lignin content and decreased Maule staining of syringyl units in stem. Ethanol yield by microbial fermentation was enhanced in amiR-cad1-8 plants. Conclusion These results have elucidated two key genes in the lignin biosynthetic pathway in B. distachyon that, when perturbed, may result in greater stem biomass yield and bioconversion efficiency. PMID:23902793

  19. Daily changes in temperature, not the circadian clock, regulate growth rate in Brachypodium distachyon.

    Directory of Open Access Journals (Sweden)

    Dominick A Matos

    Full Text Available Plant growth is commonly regulated by external cues such as light, temperature, water availability, and internal cues generated by the circadian clock. Changes in the rate of growth within the course of a day have been observed in the leaves, stems, and roots of numerous species. However, the relative impact of the circadian clock on the growth of grasses has not been thoroughly characterized. We examined the influence of diurnal temperature and light changes, and that of the circadian clock on leaf length growth patterns in Brachypodium distachyon using high-resolution time-lapse imaging. Pronounced changes in growth rate were observed under combined photocyles and thermocycles or with thermocycles alone. A considerably more rapid growth rate was observed at 28°C than 12°C, irrespective of the presence or absence of light. In spite of clear circadian clock regulated gene expression, plants exhibited no change in growth rate under conditions of constant light and temperature, and little or no effect under photocycles alone. Therefore, temperature appears to be the primary cue influencing observed oscillations in growth rate and not the circadian clock or photoreceptor activity. Furthermore, the size of the leaf meristem and final cell length did not change in response to changes in temperature. Therefore, the nearly five-fold difference in growth rate observed across thermocycles can be attributed to proportionate changes in the rate of cell division and expansion. A better understanding of the growth cues in B. distachyon will further our ability to model metabolism and biomass accumulation in grasses.

  20. RNA-seq analysis of Brachypodium distachyon responses to Barley stripe mosaic virus infection

    Directory of Open Access Journals (Sweden)

    Guoxin Wang

    2017-02-01

    Full Text Available Barley stripe mosaic virus (BSMV is the type member of the genus Hordeivirus. Brachypodium distachyon line Bd3-1 shows resistance to the BSMV ND18 strain, but is susceptible to an ND18 double mutant (β NDTGB1R390K, T392K in which lysine is substituted for an arginine at position 390 and for threonine at position 392 of the triple gene block 1 (TGB1 protein. In order to understand differences in gene expression following infection with ND18 and double mutant ND18, Bd3-1 seedlings were subjected to RNA-seq analyses at 1, 6, and 14 days post inoculation (dpi. The results revealed that basal immunity genes involved in cellulose synthesis and pathogenesis-related protein biosynthesis were enhanced in incompatible interactions between Bd3-1 and ND18. Most of the differentially expressed transcripts are related to trehalose biosynthesis, ethylene, jasmonic acid metabolism, protein phosphorylation, protein ubiquitination, transcriptional regulation, and transport process, as well as pathogenesis-related protein biosynthesis. In compatible interactions between Bd3-1 and ND18 mutant, Bd3-1 developed weak basal resistance responses to the virus. Many genes involved in cellulose biosynthesis, protein amino acid phosphorylation, protein biosynthesis, protein glycosylation, glycolysis and cellular macromolecular complex assembly that may be related to virus replication, assembly and movement were up-regulated. Some genes involved in oxidative stress responses were also up-regulated at 14 dpi. BSMV ND18 mutant infection suppressed expression of genes functioning in regulation of transcription, protein kinase, cellular nitrogen compound biosynthetic process and photosynthesis. Differential expression patterns between compatible and incompatible interactions in Bd3-1 to the two BSMV strains provide important clues for understanding mechanism of resistance to BMSV in the model plant Brachypodium.

  1. QTLs for resistance to the false brome rust Puccinia brachypodii in the model grass Brachypodium distachyon L.

    Science.gov (United States)

    Barbieri, Mirko; Marcel, Thierry C; Niks, Rients E; Francia, Enrico; Pasquariello, Marianna; Mazzamurro, Valentina; Garvin, David F; Pecchioni, Nicola

    2012-02-01

    The potential of the model grass Brachypodium distachyon L. (Brachypodium) for studying grass-pathogen interactions is still underexploited. We aimed to identify genomic regions in Brachypodium associated with quantitative resistance to the false brome rust fungus Puccinia brachypodii . The inbred lines Bd3-1 and Bd1-1, differing in their level of resistance to P. brachypodii, were crossed to develop an F(2) population. This was evaluated for reaction to a virulent isolate of P. brachypodii at both the seedling and advanced growth stages. To validate the results obtained on the F(2), resistance was quantified in F(2)-derived F(3) families in two experiments. Disease evaluations showed quantitative and transgressive segregation for resistance. A new AFLP-based Brachypodium linkage map consisting of 203 loci and spanning 812 cM was developed and anchored to the genome sequence with SSR and SNP markers. Three false brome rust resistance QTLs were identified on chromosomes 2, 3, and 4, and they were detected across experiments. This study is the first quantitative trait analysis in Brachypodium. Resistance to P. brachypodii was governed by a few QTLs: two acting at the seedling stage and one acting at both seedling and advanced growth stages. The results obtained offer perspectives to elucidate the molecular basis of quantitative resistance to rust fungi.

  2. CG Methylation Covaries with Differential Gene Expression between Leaf and Floral Bud Tissues of Brachypodium distachyon.

    Directory of Open Access Journals (Sweden)

    Kyria Roessler

    Full Text Available DNA methylation has the potential to influence plant growth and development through its influence on gene expression. To date, however, the evidence from plant systems is mixed as to whether patterns of DNA methylation vary significantly among tissues and, if so, whether these differences affect tissue-specific gene expression. To address these questions, we analyzed both bisulfite sequence (BSseq and transcriptomic sequence data from three biological replicates of two tissues (leaf and floral bud from the model grass species Brachypodium distachyon. Our first goal was to determine whether tissues were more differentiated in DNA methylation than explained by variation among biological replicates. Tissues were more differentiated than biological replicates, but the analysis of replicated data revealed high (>50% false positive rates for the inference of differentially methylated sites (DMSs and differentially methylated regions (DMRs. Comparing methylation to gene expression, we found that differential CG methylation consistently covaried negatively with gene expression, regardless as to whether methylation was within genes, within their promoters or even within their closest transposable element. The relationship between gene expression and either CHG or CHH methylation was less consistent. In total, CG methylation in promoters explained 9% of the variation in tissue-specific expression across genes, suggesting that CG methylation is a minor but appreciable factor in tissue differentiation.

  3. An integrated physical, genetic and cytogenetic map of Brachypodium distachyon, a model system for grass research.

    Directory of Open Access Journals (Sweden)

    Melanie Febrer

    2010-10-01

    Full Text Available The pooid subfamily of grasses includes some of the most important crop, forage and turf species, such as wheat, barley and Lolium. Developing genomic resources, such as whole-genome physical maps, for analysing the large and complex genomes of these crops and for facilitating biological research in grasses is an important goal in plant biology. We describe a bacterial artificial chromosome (BAC-based physical map of the wild pooid grass Brachypodium distachyon and integrate this with whole genome shotgun sequence (WGS assemblies using BAC end sequences (BES. The resulting physical map contains 26 contigs spanning the 272 Mb genome. BES from the physical map were also used to integrate a genetic map. This provides an independent validation and confirmation of the published WGS assembly. Mapped BACs were used in Fluorescence In Situ Hybridisation (FISH experiments to align the integrated physical map and sequence assemblies to chromosomes with high resolution. The physical, genetic and cytogenetic maps, integrated with whole genome shotgun sequence assemblies, enhance the accuracy and durability of this important genome sequence and will directly facilitate gene isolation.

  4. Environmental niche variation and evolutionary diversification of the Brachypodium distachyon grass complex species in their native circum-Mediterranean range.

    Science.gov (United States)

    López-Alvarez, Diana; Manzaneda, Antonio J; Rey, Pedro J; Giraldo, Patricia; Benavente, Elena; Allainguillaume, Joël; Mur, Luis; Caicedo, Ana L; Hazen, Samuel P; Breiman, Adina; Ezrati, Smadar; Catalán, Pilar

    2015-07-01

    • We conducted environmental niche modeling (ENM) of the Brachypodium distachyon s.l. complex, a model group of two diploid annual grasses (B. distachyon, B. stacei) and their derived allotetraploid (B. hybridum), native to the circum-Mediterranean region. We (1) investigated the ENMs of the three species in their native range based on present and past climate data; (2) identified potential overlapping niches of the diploids and their hybrid across four Quaternary windows; (3) tested whether speciation was associated with niche divergence/conservatism in the complex species; and (4) tested for the potential of the polyploid outperforming the diploids in the native range.• Geo-referenced data, altitude, and 19 climatic variables were used to construct the ENMs. We used paleoclimate niche models to trace the potential existence of ancestral gene flow among the hybridizing species of the complex.• Brachypodium distachyon grows in higher, cooler, and wetter places, B. stacei in lower, warmer, and drier places, and B. hybridum in places with intermediate climatic features. Brachypodium hybridum had the largest niche overlap with its parent niches, but a similar distribution range and niche breadth.• Each species had a unique environmental niche though there were multiple niche overlapping areas for the diploids across time, suggesting the potential existence of several hybrid zones during the Pleistocene and the Holocene. No evidence of niche divergence was found, suggesting that species diversification was not driven by ecological speciation but by evolutionary history, though it could be associated to distinct environmental adaptations. © 2015 Botanical Society of America, Inc.

  5. Investigations of barley stripe mosaic virus as a gene silencing vector in barley roots and in Brachypodium distachyon and oat

    DEFF Research Database (Denmark)

    Pacak, Andrzej; Geisler, Katrin; Jørgensen, Bodil

    2010-01-01

    -expressed genes we wanted to explore the potential of BSMV for silencing genes in root tissues. Furthermore, the newly completed genome sequence of the emerging cereal model species Brachypodium distachyon as well as the increasing amount of EST sequence information available for oat (Avena species) have created...... (BdPDS) gene was obtained as shown by photobleaching as well as quantitative RT-PCR analysis. On the other hand, only very limited silencing of the oat AsPDS gene was observed in both hexaploid (A. sativa) and diploid (A. strigosa) oat. Finally, two modifications of the BSMV vector are presented...

  6. Accelerated Growth Rate and Increased Drought Stress Resilience of the Model Grass Brachypodium distachyon Colonized by Bacillus subtilis B26.

    Directory of Open Access Journals (Sweden)

    François Gagné-Bourque

    Full Text Available Plant growth-promoting bacteria (PGB induce positive effects in plants, for instance, increased growth and reduced abiotic stresses susceptibility. The mechanisms by which these bacteria impact the host plant are numerous, diverse and often specific. Here, we studied the agronomical, molecular and biochemical effects of the endophytic PGB Bacillus subtilis B26 on the full life cycle of Brachypodium distachyon Bd21, an established model species for functional genomics in cereal crops and temperate grasses. Inoculation of Brachypodium with B. subtilis strain B26 increased root and shoot weights, accelerated growth rate and seed yield as compared to control plants. B. subtilis strain B26 efficiently colonized the plant and was recovered from roots, stems and blades as well as seeds of Brachypodium, indicating that the bacterium is able to migrate, spread systemically inside the plant, establish itself in the aerial plant tissues and organs, and is vertically transmitted to seeds. The presence of B. subtilis strain B26 in the seed led to systemic colonization of the next generation of Brachypodium plants. Inoculated Brachypodium seedlings and mature plants exposed to acute and chronic drought stress minimized the phenotypic effect of drought compared to plants not harbouring the bacterium. Protection from the inhibitory effects of drought by the bacterium was linked to upregulation of the drought-response genes, DREB2B-like, DHN3-like and LEA-14-A-like and modulation of the DNA methylation genes, MET1B-like, CMT3-like and DRM2-like, that regulate the process. Additionally, total soluble sugars and starch contents increased in stressed inoculated plants, a biochemical indication of drought tolerance. In conclusion, we show a single inoculation of Brachypodium with a PGB affected the whole growth cycle of the plant, accelerating its growth rates, shortening its vegetative period, and alleviating drought stress effects. These effects are relevant to

  7. Digital imaging approaches for phenotyping whole plant nitrogen and phosphorus response in Brachypodium distachyon.

    Science.gov (United States)

    Poiré, Richard; Chochois, Vincent; Sirault, Xavier R R; Vogel, John P; Watt, Michelle; Furbank, Robert T

    2014-08-01

    This work evaluates the phenotypic response of the model grass (Brachypodium distachyon (L.) P. Beauv.) to nitrogen and phosphorus nutrition using a combination of imaging techniques and destructive harvest of shoots and roots. Reference line Bd21-3 was grown in pots using 11 phosphorus and 11 nitrogen concentrations to establish a dose-response curve. Shoot biovolume and biomass, root length and biomass, and tissue phosphorus and nitrogen concentrations increased with nutrient concentration. Shoot biovolume, estimated by imaging, was highly correlated with dry weight (R(2) > 0.92) and both biovolume and growth rate responded strongly to nutrient availability. Higher nutrient supply increased nodal root length more than other root types. Photochemical efficiency was strongly reduced by low phosphorus concentrations as early as 1 week after germination, suggesting that this measurement may be suitable for high throughput screening of phosphorus response. In contrast, nitrogen concentration had little effect on photochemical efficiency. Changes in biovolume over time were used to compare growth rates of four accessions in response to nitrogen and phosphorus supply. We demonstrate that a time series image-based approach coupled with mathematical modeling provides higher resolution of genotypic response to nutrient supply than traditional destructive techniques and shows promise for high throughput screening and determination of genomic regions associated with superior nutrient use efficiency. © 2014 CSIRO Journal of Integrative Plant Biology © 2014 Institute of Botany, Chinese Academy of Sciences This article has been contributed to by US Government employees and their work is in the public domain in the USA.

  8. Genome-Wide Analysis and Expression Profiles of the MYB Genes in Brachypodium distachyon.

    Science.gov (United States)

    Chen, Shoukun; Niu, Xin; Guan, Yuxiang; Li, Haifeng

    2017-10-01

    MYB transcription factors are widespread in plants and play key roles in plant development. Although MYB transcription factors have been thoroughly characterized in many plants, genome-wide analysis of the MYB gene family has not yet been undertaken in Brachypodium distachyon. In this study, 122 BdMYB transcription factors were identified, comprising 85 MYB-R2R3, 34 MYB-related and three MYB-R1R2R3. Phylogenetic analysis showed that BdMYBs, OsMYBs and AtMYBs with similar functions were clustered in the same subgroup, and the phylogenetic relationships of BdMYB transcription factors were supported by highly conserved motifs and gene structures. Two cis-elements were found in the promoters of BdMYB genes. One is related to plant growth/development, the other is related to stress responses. Gene Ontology (GO) analysis indicated that most of the BdMYB genes are involved in various biological processes. The chromosome distribution pattern strongly indicated that genome-wide tandem and segment duplication mainly contributed to the expansion of the BdMYB gene family. Synteny analysis showed that 56, 58 and 61 BdMYB genes were orthologous to rice, maize and sorghum, respectively. We further demonstrated that BdMYB genes have evolved under strong purifying selection. The expression profiles indicated that most BdMYB genes might participate in floral development and respond to abiotic stresses. Additionally, 338 pairs of proteins were predicted to interact by constructing the interaction network. This work laid the foundation and provided clues for understanding the biological functions of these transcription factors. © The Author 2017. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  9. Final technical report for Phenomic Analysis of Natural and Induced Variation in Brachypodium Distachyon DE-SC0001526

    Energy Technology Data Exchange (ETDEWEB)

    Vogel, John P. [USDA ARS Western Regional Research Center, Albany, NY (United States)

    2014-12-17

    The goal of this project was to apply high-throughput, non-destructive phenotyping (phenomics) to collections of natural variants and induced mutants of the model grass Brachypodium distachyon and characterize a small subset of that material in detail. B. distachyon is well suited to this phenomic approach because its small size and rapid generation time allow researchers to grow many plants under carefully controlled conditions. In addition, the simple diploid genetics, high quality genome sequence and existence of numerous experimental tools available for B. distachyon allow us to rapidly identify genes affecting specific phenotypes. Our phenomic analysis revealed great diversity in biofuel-relevant traits like growth rate, biomass and photosynthetic rate. This clearly demonstrated the feasibility of applying a phenomic approach to the model grass B. distachyon. We also demonstrated the utility of B. distachyon for studying mature root system, something that is virtually impossible to do with biomass crops. We showed tremendous natural variation in root architecture that can potentially be used to design crops with superior nutrient and water harvesting capability. Finally, we demonstrated the speed with which we can link specific genes to specific phenotypes by studying two mutants in detail. Importantly, in both cases, the specific biological lessons learned were grass-specific and could not have been learned from a dicot model system. Furthermore, one of the genes affects cell wall integrity and thus may be a useful target in the context of biomass crop improvement. Ultimately, all this information can be used to accelerate the creation of improved biomass crops.

  10. Enhanced Oxidative Stress Resistance through Activation of a Zinc Deficiency Transcription Factor in Brachypodium distachyon1[W][OPEN

    Science.gov (United States)

    Glover-Cutter, Kira M.; Alderman, Stephen; Dombrowski, James E.; Martin, Ruth C.

    2014-01-01

    Identification of viable strategies to increase stress resistance of crops will become increasingly important for the goal of global food security as our population increases and our climate changes. Considering that resistance to oxidative stress is oftentimes an indicator of health and longevity in animal systems, characterizing conserved pathways known to increase oxidative stress resistance could prove fruitful for crop improvement strategies. This report argues for the usefulness and practicality of the model organism Brachypodium distachyon for identifying and validating stress resistance factors. Specifically, we focus on a zinc deficiency B. distachyon basic leucine zipper transcription factor, BdbZIP10, and its role in oxidative stress in the model organism B. distachyon. When overexpressed, BdbZIP10 protects plants and callus tissue from oxidative stress insults, most likely through distinct and direct activation of protective oxidative stress genes. Increased oxidative stress resistance and cell viability through the overexpression of BdbZIP10 highlight the utility of investigating conserved stress responses between plant and animal systems. PMID:25228396

  11. Molecular Cloning and Functional Characterization of Two Brachypodium distachyon UBC13 Genes whose Products Promote K63-linked Polyubiquitination

    Directory of Open Access Journals (Sweden)

    Huiping eGuo

    2016-01-01

    Full Text Available Living organisms are constantly subject to DNA damage from environmental sources. Due to the sessile nature of plants, UV irradiation is a major genotoxic agent and imposes a significant threat on plant survival, genome stability and crop yield. In addition, other environmental chemicals can also influence the stability of the plant genome. Eukaryotic organisms have evolved a mechanism to cope with replication-blocking lesions and stabilize the genome. This mechanism is known as error-free DNA damage tolerance, and is mediated by K63-linked PCNA polyubiquitination. Genes related to K63-linked polyubiquitination have been isolated recently from model plants like Arabidopsis and rice, but we are unaware of such reports on the crop model Brachypodium distachyon. Here we report the identification and functional characterization of two B. distachyon UBC13 genes. Both Ubc13s form heterodimers with Uevs from other species, which are capable of catalyzing K63 polyubiquitination in vitro. Both genes can functionally rescue the yeast ubc13 null mutant from killing by DNA-damaging agents. These results suggest that Ubc13-Uev-promoted K63-linked polyubiquitination is highly conserved in eukaryotes including B. distachyon. Consistent with recent findings that K63-linked polyubiquitination is involved in several developmental and stress-responsive pathways, the expression of BdUbc13s appears to be constitutive and is regulated by abnormal temperatures.

  12. An efficient method for transient gene expression in monocots applied to modify the Brachypodium distachyon cell wall.

    Science.gov (United States)

    Fursova, Oksana; Pogorelko, Gennady; Zabotina, Olga A

    2012-07-01

    Agrobacterium-mediated transformation is widely used to produce insertions into plant genomes. There are a number of well-developed Agrobacterium-mediated transformation methods for dicotyledonous plants, but there are few for monocotyledonous plants. Three hydrolase genes were transiently expressed in Brachypodium distachyon plants using specially designed vectors that express the gene product of interest and target it to the plant cell wall. Expression of functional hydrolases in genotyped plants was confirmed using western blotting, activity assays, cell wall compositional analysis and digestibility tests. An efficient, new, Agrobacterium-mediated approach was developed for transient gene expression in the grass B. distachyon, using co-cultivation of mature seeds with bacterial cells. This method allows transformed tissues to be obtained rapidly, within 3-4 weeks after co-cultivation. Also, the plants carried transgenic tissue and maintained transgenic protein expression throughout plant maturation. The efficiency of transformation was estimated at around 5 % of initially co-cultivated seeds. Application of this approach to express three Aspergillus nidulans hydrolases in the Brachypodium cell wall successfully confirmed its utility and resulted in the expected expression of active microbial proteins and alterations of cell wall composition. Cell wall modifications caused by expression of A. nidulans α-arabinofuranosidase and α-galactosidase increased the biodegradability of plant biomass. This newly developed approach is a quick and efficient technique for expressing genes of interest in Brachypodium plants, which express the gene product throughout development. In the future, this could be used for broad functional genomics studies of monocots and for biotechnological applications, such as plant biomass modification for biofuel production.

  13. Fine mapping of the Bsr1 barley stripe mosaic virus resistance gene in the model grass Brachypodium distachyon.

    Directory of Open Access Journals (Sweden)

    Yu Cui

    Full Text Available The ND18 strain of Barley stripe mosaic virus (BSMV infects several lines of Brachypodium distachyon, a recently developed model system for genomics research in cereals. Among the inbred lines tested, Bd3-1 is highly resistant at 20 to 25 °C, whereas Bd21 is susceptible and infection results in an intense mosaic phenotype accompanied by high levels of replicating virus. We generated an F(6:7 recombinant inbred line (RIL population from a cross between Bd3-1 and Bd21 and used the RILs, and an F(2 population of a second Bd21 × Bd3-1 cross to evaluate the inheritance of resistance. The results indicate that resistance segregates as expected for a single dominant gene, which we have designated Barley stripe mosaic virus resistance 1 (Bsr1. We constructed a genetic linkage map of the RIL population using SNP markers to map this gene to within 705 Kb of the distal end of the top of chromosome 3. Additional CAPS and Indel markers were used to fine map Bsr1 to a 23 Kb interval containing five putative genes. Our study demonstrates the power of using RILs to rapidly map the genetic determinants of BSMV resistance in Brachypodium. Moreover, the RILs and their associated genetic map, when combined with the complete genomic sequence of Brachypodium, provide new resources for genetic analyses of many other traits.

  14. Analysis of global gene expression in Brachypodium distachyon reveals extensive network plasticity in response to abiotic stress.

    Directory of Open Access Journals (Sweden)

    Henry D Priest

    Full Text Available Brachypodium distachyon is a close relative of many important cereal crops. Abiotic stress tolerance has a significant impact on productivity of agriculturally important food and feedstock crops. Analysis of the transcriptome of Brachypodium after chilling, high-salinity, drought, and heat stresses revealed diverse differential expression of many transcripts. Weighted Gene Co-Expression Network Analysis revealed 22 distinct gene modules with specific profiles of expression under each stress. Promoter analysis implicated short DNA sequences directly upstream of module members in the regulation of 21 of 22 modules. Functional analysis of module members revealed enrichment in functional terms for 10 of 22 network modules. Analysis of condition-specific correlations between differentially expressed gene pairs revealed extensive plasticity in the expression relationships of gene pairs. Photosynthesis, cell cycle, and cell wall expression modules were down-regulated by all abiotic stresses. Modules which were up-regulated by each abiotic stress fell into diverse and unique gene ontology GO categories. This study provides genomics resources and improves our understanding of abiotic stress responses of Brachypodium.

  15. Infection of Brachypodium distachyon by formae speciales of Puccinia graminis: early infection events and host-pathogen incompatibility.

    Directory of Open Access Journals (Sweden)

    Melania Figueroa

    Full Text Available Puccinia graminis causes stem rust, a serious disease of cereals and forage grasses. Important formae speciales of P. graminis and their typical hosts are P. graminis f. sp. tritici (Pg-tr in wheat and barley, P. graminis f. sp. lolii (Pg-lo in perennial ryegrass and tall fescue, and P. graminis f. sp. phlei-pratensis (Pg-pp in timothy grass. Brachypodium distachyon is an emerging genetic model to study fungal disease resistance in cereals and temperate grasses. We characterized the P. graminis-Brachypodium pathosystem to evaluate its potential for investigating incompatibility and non-host resistance to P. graminis. Inoculation of eight Brachypodium inbred lines with Pg-tr, Pg-lo or Pg-pp resulted in sporulating lesions later accompanied by necrosis. Histological analysis of early infection events in one Brachypodium inbred line (Bd1-1 indicated that Pg-lo and Pg-pp were markedly more efficient than Pg-tr at establishing a biotrophic interaction. Formation of appressoria was completed (60-70% of germinated spores by 12 h post-inoculation (hpi under dark and wet conditions, and after 4 h of subsequent light exposure fungal penetration structures (penetration peg, substomatal vesicle and primary infection hyphae had developed. Brachypodium Bd1-1 exhibited pre-haustorial resistance to Pg-tr, i.e. infection usually stopped at appressorial formation. By 68 hpi, only 0.3% and 0.7% of the Pg-tr urediniospores developed haustoria and colonies, respectively. In contrast, development of advanced infection structures by Pg-lo and Pg-pp was significantly more common; however, Brachypodium displayed post-haustorial resistance to these isolates. By 68 hpi the percentage of urediniospores that only develop a haustorium mother cell or haustorium in Pg-lo and Pg-pp reached 8% and 5%, respectively. The formation of colonies reached 14% and 13%, respectively. We conclude that Brachypodium is an apt grass model to study the molecular and genetic components of

  16. Analysis of two heterologous flowering genes in ¤Brachypodium distachyon¤ demonstrates its potential as a grass model plant

    DEFF Research Database (Denmark)

    Olsen, P.; Lenk, I.; Jensen, Christian S.

    2006-01-01

    including close phylogenetic relationship to the temperate grasses, vernalisation requirement, high transformation efficiency, small genome size and a rapid life cycle. These requirements are all fulfilled by the small annual grass Brachypodium distachyon. As a first step towards implementing this plant...... date up to 10 weeks in plants of the T, generation. Furthermore, a positive correlation between Terminal Flower 1 expression level and delay in heading date was apparent for most of the lines. The short life cycle and fast transformation system of B. distachyon allowed heading date analyses in the T-1...... generation within the first year upon transformation. (c) 2006 Elsevier Ireland Ltd. All rights reserved....

  17. The family of DOF transcription factors in Brachypodium distachyon: phylogenetic comparison with rice and barley DOFs and expression profiling

    Directory of Open Access Journals (Sweden)

    Hernando-Amado Sara

    2012-11-01

    Full Text Available Abstract Background Transcription factors (TFs are proteins that have played a central role both in evolution and in domestication, and are major regulators of development in living organisms. Plant genome sequences reveal that approximately 7% of all genes encode putative TFs. The DOF (DNA binding with One Finger TF family has been associated with vital processes exclusive to higher plants and to their close ancestors (algae, mosses and ferns. These are seed maturation and germination, light-mediated regulation, phytohormone and plant responses to biotic and abiotic stresses, etc. In Hordeum vulgare and Oryza sativa, 26 and 30 different Dof genes, respectively, have been annotated. Brachypodium distachyon has been the first Pooideae grass to be sequenced and, due to its genomic, morphological and physiological characteristics, has emerged as the model system for temperate cereals, such as wheat and barley. Results Through searches in the B. distachyon genome, 27 Dof genes have been identified and a phylogenetic comparison with the Oryza sativa and the Hordeum vulgare DOFs has been performed. To explore the evolutionary relationship among these DOF proteins, a combined phylogenetic tree has been constructed with the Brachypodium DOFs and those from rice and barley. This phylogenetic analysis has classified the DOF proteins into four Major Cluster of Orthologous Groups (MCOGs. Using RT-qPCR analysis the expression profiles of the annotated BdDof genes across four organs (leaves, roots, spikes and seeds has been investigated. These results have led to a classification of the BdDof genes into two groups, according to their expression levels. The genes highly or preferentially expressed in seeds have been subjected to a more detailed expression analysis (maturation, dry stage and germination. Conclusions Comparison of the expression profiles of the Brachypodium Dof genes with the published functions of closely related DOF sequences from the cereal

  18. Investigations of barley stripe mosaic virus as a gene silencing vector in barley roots and in Brachypodium distachyon and oat

    Directory of Open Access Journals (Sweden)

    Nilsson Lena

    2010-11-01

    Full Text Available Abstract Background Gene silencing vectors based on Barley stripe mosaic virus (BSMV are used extensively in cereals to study gene function, but nearly all studies have been limited to genes expressed in leaves of barley and wheat. However since many important aspects of plant biology are based on root-expressed genes we wanted to explore the potential of BSMV for silencing genes in root tissues. Furthermore, the newly completed genome sequence of the emerging cereal model species Brachypodium distachyon as well as the increasing amount of EST sequence information available for oat (Avena species have created a need for tools to study gene function in these species. Results Here we demonstrate the successful BSMV-mediated virus induced gene silencing (VIGS of three different genes in barley roots, i.e. the barley homologues of the IPS1, PHR1, and PHO2 genes known to participate in Pi uptake and reallocation in Arabidopsis. Attempts to silence two other genes, the Pi transporter gene HvPht1;1 and the endo-β-1,4-glucanase gene HvCel1, in barley roots were unsuccessful, probably due to instability of the plant gene inserts in the viral vector. In B. distachyon leaves, significant silencing of the PHYTOENE DESATURASE (BdPDS gene was obtained as shown by photobleaching as well as quantitative RT-PCR analysis. On the other hand, only very limited silencing of the oat AsPDS gene was observed in both hexaploid (A. sativa and diploid (A. strigosa oat. Finally, two modifications of the BSMV vector are presented, allowing ligation-free cloning of DNA fragments into the BSMV-γ component. Conclusions Our results show that BSMV can be used as a vector for gene silencing in barley roots and in B. distachyon leaves and possibly roots, opening up possibilities for using VIGS to study cereal root biology and to exploit the wealth of genome information in the new cereal model plant B. distachyon. On the other hand, the silencing induced by BSMV in oat seemed too

  19. Genome-wide identification, phylogeny and expression analysis of AP2/ERF transcription factors family in Brachypodium distachyon.

    Science.gov (United States)

    Cui, Licao; Feng, Kewei; Wang, Mengxing; Wang, Meng; Deng, Pingchuan; Song, Weining; Nie, Xiaojun

    2016-08-15

    The AP2/ERF transcription factor is one of the most important gene families in plants, which plays the vital role in regulating plant growth and development as well as in response to diverse stresses. Although AP2/ERFs have been thoroughly characterized in many plant species, little is known about this family in the model plant Brachypodium distachyon, especially those involved in the regulatory network of stress processes. In this study, a comprehensive genome-wide search was performed to identify AP2/ERF gene family in Brachypodium and a total of 141 BdAP2/ERFs were obtained. Phylogenetic analysis classified them into four subfamilies, of which 112 belonged to ERF, four to RAV and 24 to AP2 as well as one to soloist subfamily respectively, which was in accordance with the number of AP2 domains and gene structure analysis. Chromosomal localization, gene structure, conserved protein motif and cis-regulatory elements as well as gene duplication events analysis were further performed to systematically investigate the evolutionary features of these BdAP2/ERF genes. Furthermore, the regulatory network between BdAP2/ERF and other genes were constructed using the orthology-based method, and 39 BdAP2/ERFs were found to be involved in the regulatory network and 517 network branches were identified. The expression profiles of BdAP2/ERF during development and under diverse stresses were investigated using the available RNA-seq and microarray data and ten tissue-specific and several stress-responsive BdAP2/ERF genes were identified. Finally, 11 AP2/ERF genes were selected to validate their expressions in different tissues and under different stress treatments using RT-PCR method and results verified that these AP2/ERFs were involved in various developmental and physiological processes. This study for the first time reported the characteristics of the BdAP2/ERF family, which will provide the invaluable information for further evolutionary and functional studies of AP2/ERF in

  20. Identification of genes that regulate phosphate acquisition and plant performance during arbuscular my corrhizal symbiosis in medicago truncatula and brachypodium distachyon

    Energy Technology Data Exchange (ETDEWEB)

    Harrison, Maria J [Boyce Thompson Institute, Ithaca, NY (United States); Hudson, Matthew E [Univ. of Illinois, Champaign, IL (United States)

    2015-11-24

    Most vascular flowering plants have the ability to form symbiotic associations with arbuscular mycorrhizal (AM) fungi. The symbiosis develops in the roots and can have a profound effect on plant productivity, largely through improvements in plant mineral nutrition. Within the root cortical cells, the plant and fungus create novel interfaces specialized for nutrient transfer, while the fungus also develops a network of hyphae in the rhizosphere. Through this hyphal network, the fungus acquires and delivers phosphate and nitrogen to the root. In return, the plant provides the fungus with carbon. In addition, to enhancing plant mineral nutrition, the AM symbiosis has an important role in the carbon cycle, and positive effects on soil health. Here we identified and characterized plant genes involved in the regulation and functioning of the AM symbiosis in Medicago truncatula and Brachypodium distachyon. This included the identification and and characterization of a M. truncatula transcription factors that are required for symbiosis. Additionally, we investigated the molecular basis of functional diversity among AM symbioses in B. distachyon and analysed the transcriptome of Brachypodium distachyon during symbiosis.

  1. In silico sequence analysis and homology modeling of predicted beta-amylase 7-like protein in Brachypodium distachyon L.

    Directory of Open Access Journals (Sweden)

    ERTUĞRUL FILIZ

    2014-04-01

    Full Text Available Beta-amylase (β-amylase, EC 3.2.1.2 is an enzyme that catalyses hydrolysis of glucosidic bonds in polysaccharides. In this study, we analyzed protein sequence of predicted beta-amylase 7-like protein in Brachypodium distachyon. pI (isoelectric point value was found as 5.23 in acidic character, while the instability index (II was found as 50.28 with accepted unstable protein. The prediction of subcellular localization was revealed that the protein may reside in chloroplast by using CELLO v.2.5. The 3D structure of protein was performed using comparative homology modeling with SWISS-MODEL. The accuracy of the predicted 3D structure was checked using Ramachandran plot analysis showed that 95.4% in favored region. The results of our study contribute to understanding of β-amylase protein structure in grass species and will be scientific base for 3D modeling of beta-amylase proteins in further studies.

  2. Expression profiling of marker genes responsive to the defence-associated phytohormones salicylic acid, jasmonic acid and ethylene in Brachypodium distachyon.

    Science.gov (United States)

    Kouzai, Yusuke; Kimura, Mamiko; Yamanaka, Yurie; Watanabe, Megumi; Matsui, Hidenori; Yamamoto, Mikihiro; Ichinose, Yuki; Toyoda, Kazuhiro; Onda, Yoshihiko; Mochida, Keiichi; Noutoshi, Yoshiteru

    2016-03-02

    Brachypodium distachyon is a promising model plants for grasses. Infections of Brachypodium by various pathogens that severely impair crop production have been reported, and the species accordingly provides an alternative platform for investigating molecular mechanisms of pathogen virulence and plant disease resistance. To date, we have a broad picture of plant immunity only in Arabidopsis and rice; therefore, Brachypodium may constitute a counterpart that displays the commonality and uniqueness of defence systems among plant species. Phytohormones play key roles in plant biotic stress responses, and hormone-responsive genes are used to qualitatively and quantitatively evaluate disease resistance responses during pathogen infection. For these purposes, defence-related phytohormone marker genes expressed at time points suitable for defence-response monitoring are needed. Information about their expression profiles over time as well as their response specificity is also helpful. However, useful marker genes are still rare in Brachypodium. We selected 34 candidates for Brachypodium marker genes on the basis of protein-sequence similarity to known marker genes used in Arabidopsis and rice. Brachypodium plants were treated with the defence-related phytohormones salicylic acid, jasmonic acid and ethylene, and their transcription levels were measured 24 and 48 h after treatment. Two genes for salicylic acid, 7 for jasmonic acid and 2 for ethylene were significantly induced at either or both time points. We then focused on 11 genes encoding pathogenesis-related (PR) 1 protein and compared their expression patterns with those of Arabidopsis and rice. Phylogenetic analysis suggested that Brachypodium contains several PR1-family genes similar to rice genes. Our expression profiling revealed that regulation patterns of some PR1 genes as well as of markers identified for defence-related phytohormones are closely related to those in rice. We propose that the Brachypodium immune

  3. Cell wall composition and digestibility alterations in Brachypodium distachyon achieved through reduced expression of the UDP-arabinopyranose mutase

    Directory of Open Access Journals (Sweden)

    David M. Rancour

    2015-06-01

    Full Text Available Nucleotide-activated sugars are essential substrates for plant cell-wall carbohydrate-polymer biosynthesis. The most prevalent grass cell wall sugars are glucose (Glc, xylose (Xyl, and arabinose (Ara. These sugars are biosynthetically related via the UDP-sugar interconversion pathway. We sought to target and generate UDP-sugar interconversion pathway transgenic Brachypodium distachyon lines resulting in cell wall carbohydrate composition changes with improved digestibility and normal plant stature. Both RNAi-mediated gene-suppression and constitutive gene-expression approaches were performed. Cell walls from 336 T0 transgenic plants with normal appearance were screened for complete carbohydrate composition. RNAi mutants of BdRGP1, a UDP-arabinopyranose mutase, resulted in large alterations in cell wall carbohydrate composition with significant decreases in cell wall Ara content but with minimal change in plant stature. Five independent RNAi-RGP1 T1 plant lines were used for in-depth analysis of plant cell walls. Real-time PCR analysis indicated that gene expression levels for BdRGP1, BdRGP2 and BdRGP3 were reduced in RNAi-RGP1 plants to 15-20% of controls. Cell wall Ara content was reduced by 23-51% of control levels. No alterations in cell wall Xyl and Glc content were observed. Corresponding decreases in cell wall ferulic acid (FA and ferulic acid-dimers (FA-dimers were observed. Additionally, cell wall p-coumarates (pCA were decreased. We demonstrate the cell wall pCA decrease corresponds to Ara-coupled pCA. Xylanase-mediated digestibility of RNAi-RGP1 Brachypodium cell walls resulted in a near two-fold increase of released total carbohydrate. However, cellulolytic hydrolysis of cell wall material was inhibited in leaves of RNAi-RGP1 mutants. Our results indicate that targeted manipulation of UDP-sugar biosynthesis can result in biomass with substantially altered compositions and highlights the complex effect cell wall composition has on

  4. p-Coumaroyl-CoA:monolignol transferase (PMT) acts specifically in the lignin biosynthetic pathway in Brachypodium distachyon

    Science.gov (United States)

    Petrik, Deborah L; Karlen, Steven D; Cass, Cynthia L; Padmakshan, Dharshana; Lu, Fachuang; Liu, Sarah; Le Bris, Philippe; Antelme, Sébastien; Santoro, Nicholas; Wilkerson, Curtis G; Sibout, Richard; Lapierre, Catherine; Ralph, John; Sedbrook, John C

    2014-01-01

    Grass lignins contain substantial amounts of p-coumarate (pCA) that acylate the side-chains of the phenylpropanoid polymer backbone. An acyltransferase, named p-coumaroyl-CoA:monolignol transferase (OsPMT), that could acylate monolignols with pCA in vitro was recently identified from rice. In planta, such monolignol-pCA conjugates become incorporated into lignin via oxidative radical coupling, thereby generating the observed pCA appendages; however p-coumarates also acylate arabinoxylans in grasses. To test the authenticity of PMT as a lignin biosynthetic pathway enzyme, we examined Brachypodium distachyon plants with altered BdPMT gene function. Using newly developed cell wall analytical methods, we determined that the transferase was involved specifically in monolignol acylation. A sodium azide-generated Bdpmt-1 missense mutant had no (lignin, and BdPMT RNAi plants had levels as low as 10% of wild-type, whereas the amounts of pCA acylating arabinosyl units on arabinoxylans in these PMT mutant plants remained unchanged. pCA acylation of lignin from BdPMT-overexpressing plants was found to be more than three-fold higher than that of wild-type, but again the level on arabinosyl units remained unchanged. Taken together, these data are consistent with a defined role for grass PMT genes in encoding BAHD (BEAT, AHCT, HCBT, and DAT) acyltransferases that specifically acylate monolignols with pCA and produce monolignol p-coumarate conjugates that are used for lignification in planta. PMID:24372757

  5. A DNA Barcoding Method to Discriminate between the Model Plant Brachypodium distachyon and Its Close Relatives B. stacei and B. hybridum (Poaceae)

    Science.gov (United States)

    López-Alvarez, Diana; López-Herranz, Maria Luisa; Betekhtin, Alexander; Catalán, Pilar

    2012-01-01

    Background Brachypodium distachyon s. l. has been widely investigated across the world as a model plant for temperate cereals and biofuel grasses. However, this annual plant shows three cytotypes that have been recently recognized as three independent species, the diploids B. distachyon (2n = 10) and B. stacei (2n = 20) and their derived allotetraploid B. hybridum (2n = 30). Methodology/Principal Findings We propose a DNA barcoding approach that consists of a rapid, accurate and automatable species identification method using the standard DNA sequences of complementary plastid (trnLF) and nuclear (ITS, GI) loci. The highly homogenous but largely divergent B. distachyon and B. stacei diploids could be easily distinguished (100% identification success) using direct trnLF (2.4%), ITS (5.5%) or GI (3.8%) sequence divergence. By contrast, B. hybridum could only be unambiguously identified through the use of combined trnLF+ITS sequences (90% of identification success) or by cloned GI sequences (96.7%) that showed 5.4% (ITS) and 4% (GI) rate divergence between the two parental sequences found in the allopolyploid. Conclusion/Significance Our data provide an unbiased and effective barcode to differentiate these three closely-related species from one another. This procedure overcomes the taxonomic uncertainty generated from methods based on morphology or flow cytometry identifications that have resulted in some misclassifications of the model plant and its allies. Our study also demonstrates that the allotetraploid B. hybridum has resulted from bi-directional crosses of B. distachyon and B. stacei plants acting either as maternal or paternal parents. PMID:23240000

  6. Molecular Characterization and Expression Profiling of Brachypodium distachyon L. Cystatin Genes Reveal High Evolutionary Conservation and Functional Divergence in Response to Abiotic Stress

    Directory of Open Access Journals (Sweden)

    Saminathan Subburaj

    2017-05-01

    Full Text Available Cystatin is a class of proteins mainly involved in cysteine protease inhibition and plant growth and development, as well as tolerance under various abiotic stresses. In this study, we performed the first comprehensive analysis of the molecular characterization and expression profiling in response to various abiotic stresses of the cystatin gene family in Brachypodium distachyon, a novel model plant for Triticum species with huge genomes. Comprehensive searches of the Brachypodium genome database identified 25 B. distachyon cystatin (BdC genes that are distributed unevenly on chromosomes; of these, nine and two were involved in tandem and segmental duplication events, respectively. All BdC genes had similar exon/intron structural organization, with three conserved motifs similar to those from other plant species, indicating their high evolutionary conservation. Expression profiling of 10 typical BdC genes revealed ubiquitous expression in different organs at varying expression levels. BdC gene expression in seedling leaves was particularly highly induced by various abiotic stresses, including the plant hormone abscisic acid and various environmental cues (cold, H2O2, CdCl2, salt, and drought. Interestingly, most BdC genes were significantly upregulated under multiple abiotic stresses, including BdC15 under all stresses, BdC7-2 and BdC10 under five stresses, and BdC7-1, BdC2-1, BdC14, and BdC12 under four stresses. The putative metabolic pathways of cytastin genes in response to various abiotic stresses mainly involve the aberrant protein degradation pathway and reactive oxygen species (ROS-triggered programmed cell death signaling pathways. These observations provide a better understanding of the structural and functional characteristics of the plant cystatin gene family.

  7. Phylogeny in defining model plants for lignocellulosic ethanol production: a comparative study of Brachypodium distachyon, wheat, maize, and Miscanthus x giganteus leaf and stem biomass.

    Directory of Open Access Journals (Sweden)

    Till Meineke

    Full Text Available The production of ethanol from pretreated plant biomass during fermentation is a strategy to mitigate climate change by substituting fossil fuels. However, biomass conversion is mainly limited by the recalcitrant nature of the plant cell wall. To overcome recalcitrance, the optimization of the plant cell wall for subsequent processing is a promising approach. Based on their phylogenetic proximity to existing and emerging energy crops, model plants have been proposed to study bioenergy-related cell wall biochemistry. One example is Brachypodium distachyon, which has been considered as a general model plant for cell wall analysis in grasses. To test whether relative phylogenetic proximity would be sufficient to qualify as a model plant not only for cell wall composition but also for the complete process leading to bioethanol production, we compared the processing of leaf and stem biomass from the C3 grasses B. distachyon and Triticum aestivum (wheat with the C4 grasses Zea mays (maize and Miscanthus x giganteus, a perennial energy crop. Lambda scanning with a confocal laser-scanning microscope allowed a rapid qualitative analysis of biomass saccharification. A maximum of 108-117 mg ethanol·g(-1 dry biomass was yielded from thermo-chemically and enzymatically pretreated stem biomass of the tested plant species. Principal component analysis revealed that a relatively strong correlation between similarities in lignocellulosic ethanol production and phylogenetic relation was only given for stem and leaf biomass of the two tested C4 grasses. Our results suggest that suitability of B. distachyon as a model plant for biomass conversion of energy crops has to be specifically tested based on applied processing parameters and biomass tissue type.

  8. Phylogeny in defining model plants for lignocellulosic ethanol production: a comparative study of Brachypodium distachyon, wheat, maize, and Miscanthus x giganteus leaf and stem biomass.

    Science.gov (United States)

    Meineke, Till; Manisseri, Chithra; Voigt, Christian A

    2014-01-01

    The production of ethanol from pretreated plant biomass during fermentation is a strategy to mitigate climate change by substituting fossil fuels. However, biomass conversion is mainly limited by the recalcitrant nature of the plant cell wall. To overcome recalcitrance, the optimization of the plant cell wall for subsequent processing is a promising approach. Based on their phylogenetic proximity to existing and emerging energy crops, model plants have been proposed to study bioenergy-related cell wall biochemistry. One example is Brachypodium distachyon, which has been considered as a general model plant for cell wall analysis in grasses. To test whether relative phylogenetic proximity would be sufficient to qualify as a model plant not only for cell wall composition but also for the complete process leading to bioethanol production, we compared the processing of leaf and stem biomass from the C3 grasses B. distachyon and Triticum aestivum (wheat) with the C4 grasses Zea mays (maize) and Miscanthus x giganteus, a perennial energy crop. Lambda scanning with a confocal laser-scanning microscope allowed a rapid qualitative analysis of biomass saccharification. A maximum of 108-117 mg ethanol·g(-1) dry biomass was yielded from thermo-chemically and enzymatically pretreated stem biomass of the tested plant species. Principal component analysis revealed that a relatively strong correlation between similarities in lignocellulosic ethanol production and phylogenetic relation was only given for stem and leaf biomass of the two tested C4 grasses. Our results suggest that suitability of B. distachyon as a model plant for biomass conversion of energy crops has to be specifically tested based on applied processing parameters and biomass tissue type.

  9. Construction of high quality Gateway™ entry libraries and their application to yeast two-hybrid for the monocot model plant Brachypodium distachyon

    Directory of Open Access Journals (Sweden)

    Kumimoto Roderick W

    2011-05-01

    Full Text Available Abstract Background Monocots, especially the temperate grasses, represent some of the most agriculturally important crops for both current food needs and future biofuel development. Because most of the agriculturally important grass species are difficult to study (e.g., they often have large, repetitive genomes and can be difficult to grow in laboratory settings, developing genetically tractable model systems is essential. Brachypodium distachyon (hereafter Brachypodium is an emerging model system for the temperate grasses. To fully realize the potential of this model system, publicly accessible discovery tools are essential. High quality cDNA libraries that can be readily adapted for multiple downstream purposes are a needed resource. Additionally, yeast two-hybrid (Y2H libraries are an important discovery tool for protein-protein interactions and are not currently available for Brachypodium. Results We describe the creation of two high quality, publicly available Gateway™ cDNA entry libraries and their derived Y2H libraries for Brachypodium. The first entry library represents cloned cDNA populations from both short day (SD, 8/16-h light/dark and long day (LD, 20/4-h light/dark grown plants, while the second library was generated from hormone treated tissues. Both libraries have extensive genome coverage (~5 × 107 primary clones each and average clone lengths of ~1.5 Kb. These entry libraries were then used to create two recombination-derived Y2H libraries. Initial proof-of-concept screens demonstrated that a protein with known interaction partners could readily re-isolate those partners, as well as novel interactors. Conclusions Accessible community resources are a hallmark of successful biological model systems. Brachypodium has the potential to be a broadly useful model system for the grasses, but still requires many of these resources. The Gateway™ compatible entry libraries created here will facilitate studies for multiple user

  10. Pushing the boundaries of resistance: insights from Brachypodium-rust interactions

    Directory of Open Access Journals (Sweden)

    Melania eFigueroa

    2015-07-01

    Full Text Available The implications of global population growth urge transformation of current food and bioenergy production systems to sustainability. Members of the family Poaceae are of particular importance both in food security and for their applications as biofuel substrates. For centuries, rust fungi have threatened the production of valuable crops such as wheat, barley, oat and other small grains; similarly, biofuel crops can also be susceptible to these pathogens. Emerging rust pathogenic races with increased virulence and recurrent rust epidemics around the world point out the vulnerability of monocultures. Basic research in plant immunity, especially in model plants, can make contributions to understanding plant resistance mechanisms and improve disease management strategies. The development of the grass Brachypodium distachyon as a genetically tractable model for monocots, especially temperate cereals and grasses, offers the possibility to overcome the experimental challenges presented by the genetic and genomic complexities of economically valuable crop plants. The numerous resources and tools available in Brachypodium have opened new doors to investigate the underlying molecular and genetic bases of plant-microbe interactions in grasses and evidence demonstrating the applicability and advantages of working with B. distachyon is increasing. Importantly, several interactions between B. distachyon and devastating plant pathogens, such rust fungi, have been examined in the context of non-host resistance. Here, we discuss the use of B. distachyon in these various pathosystems. Exploiting B. distachyon to understand the mechanisms underpinning disease resistance to non-adapted rust fungi may provide effective and durable approaches to fend off these pathogens. The close phylogenetic relationship among Brachypodium spp. and grasses with industrial and agronomic value support harnessing this model plant to improve cropping systems and encourage its use in

  11. Update on the genomics and basic biology of Brachypodium

    DEFF Research Database (Denmark)

    Catalan, Pilar; Chalhoub, Boulos; Chochois, Vincent

    2014-01-01

    The scientific presentations at the First International Brachypodium Conference (abstracts available at http://www.brachy2013.unimore.it) are evidence of the wide-spread adoption of Brachypodium distachyon as a model system. Furthermore, the wide range of topics presented (genome evolution, roots...

  12. Reconstructing the Evolution of Brachypodium Genomes Using Comparative Chromosome Painting.

    Directory of Open Access Journals (Sweden)

    Alexander Betekhtin

    Full Text Available Brachypodium distachyon is a model for the temperate cereals and grasses and has a biology, genomics infrastructure and cytogenetic platform fit for purpose. It is a member of a genus with fewer than 20 species, which have different genome sizes, basic chromosome numbers and ploidy levels. The phylogeny and interspecific relationships of this group have not to date been resolved by sequence comparisons and karyotypical studies. The aims of this study are not only to reconstruct the evolution of Brachypodium karyotypes to resolve the phylogeny, but also to highlight the mechanisms that shape the evolution of grass genomes. This was achieved through the use of comparative chromosome painting (CCP which hybridises fluorescent, chromosome-specific probes derived from B. distachyon to homoeologous meiotic chromosomes of its close relatives. The study included five diploids (B. distachyon 2n = 10, B. sylvaticum 2n = 18, B. pinnatum 2n = 16; 2n = 18, B. arbuscula 2n = 18 and B. stacei 2n = 20 three allotetraploids (B. pinnatum 2n = 28, B. phoenicoides 2n = 28 and B. hybridum 2n = 30, and two species of unknown ploidy (B. retusum 2n = 38 and B. mexicanum 2n = 40. On the basis of the patterns of hybridisation and incorporating published data, we propose two alternative, but similar, models of karyotype evolution in the genus Brachypodium. According to the first model, the extant genome of B. distachyon derives from B. mexicanum or B. stacei by several rounds of descending dysploidy, and the other diploids evolve from B. distachyon via ascending dysploidy. The allotetraploids arise by interspecific hybridisation and chromosome doubling between B. distachyon and other diploids. The second model differs from the first insofar as it incorporates an intermediate 2n = 18 species between the B. mexicanum or B. stacei progenitors and the dysploidic B. distachyon.

  13. Genome-Wide Analysis of miRNA targets in Brachypodium and Biomass Energy Crops

    Energy Technology Data Exchange (ETDEWEB)

    Green, Pamela J. [Univ. of Delaware, Newark, DE (United States)

    2015-08-11

    MicroRNAs (miRNAs) contribute to the control of numerous biological processes through the regulation of specific target mRNAs. Although the identities of these targets are essential to elucidate miRNA function, the targets are much more difficult to identify than the small RNAs themselves. Before this work, we pioneered the genome-wide identification of the targets of Arabidopsis miRNAs using an approach called PARE (German et al., Nature Biotech. 2008; Nature Protocols, 2009). Under this project, we applied PARE to Brachypodium distachyon (Brachypodium), a model plant in the Poaceae family, which includes the major food grain and bioenergy crops. Through in-depth global analysis and examination of specific examples, this research greatly expanded our knowledge of miRNAs and target RNAs of Brachypodium. New regulation in response to environmental stress or tissue type was found, and many new miRNAs were discovered. More than 260 targets of new and known miRNAs with PARE sequences at the precise sites of miRNA-guided cleavage were identified and characterized. Combining PARE data with the small RNA data also identified the miRNAs responsible for initiating approximately 500 phased loci, including one of the novel miRNAs. PARE analysis also revealed that differentially expressed miRNAs in the same family guide specific target RNA cleavage in a correspondingly tissue-preferential manner. The project included generation of small RNA and PARE resources for bioenergy crops, to facilitate ongoing discovery of conserved miRNA-target RNA regulation. By associating specific miRNA-target RNA pairs with known physiological functions, the research provides insights about gene regulation in different tissues and in response to environmental stress. This, and release of new PARE and small RNA data sets should contribute basic knowledge to enhance breeding and may suggest new strategies for improvement of biomass energy crops.

  14. Insight into the Karyotype Evolution of Brachypodium Species Using Comparative Chromosome Barcoding

    Science.gov (United States)

    Idziak, Dominika; Hazuka, Iwona; Poliwczak, Beata; Wiszynska, Anna; Wolny, Elzbieta; Hasterok, Robert

    2014-01-01

    Paleogenomic studies based on bioinformatic analyses of DNA sequences have enabled unprecedented insight into the evolution of grass genomes. They have revealed that nested chromosome fusions played an important role in the divergence of modern grasses. Nowadays, studies on karyotype evolution based on the sequence analysis can also be effectively complemented by the fine-scale cytomolecular approach. In this work, we studied the karyotype evolution of small genome grasses using BAC-FISH based comparative chromosome barcoding in four Brachypodium species: diploid B. distachyon (2n = 10) and B. sylvaticum (2n = 18), diploid (2n = 18) and allopolyploid (2n = 28) B. pinnatum as well as B. phoenicoides (2n = 28). Using BAC clones derived from the B. distachyon genomic libraries for the chromosomes Bd2 and Bd3, we identified the descending dysploidy events that were common for diploids with x = 9 and B. distachyon as well as two nested chromosome fusions that were specific only for B. distachyon. We suggest that dysploidy events that are shared by different lineages of the genus had already appeared in their common ancestor. We also show that additional structural rearrangements, such as translocations and duplications, contributed to increasing genome diversification in the species analysed. No chromosomes structured exactly like Bd2 and Bd3 were found in B. pinnatum (2n = 28) and B. phoenicoides. The structure of Bd2 and Bd3 homeologues belonging to the two genomes in the allopolyploids resembled the structure of their counterparts in the 2n = 18 diploids. These findings reinforce the hypothesis which excludes B. distachyon as a potential parent for Eurasian perennial Brachypodium allopolyploids. Our cytomolecular data elucidate some mechanisms of the descending dysploidy in monocots and enable reconstructions of the evolutionary events which shaped the extant karyotypes in both the genus Brachypodium and in grasses as a whole. PMID

  15. Insight into the karyotype evolution of brachypodium species using comparative chromosome barcoding.

    Directory of Open Access Journals (Sweden)

    Dominika Idziak

    Full Text Available Paleogenomic studies based on bioinformatic analyses of DNA sequences have enabled unprecedented insight into the evolution of grass genomes. They have revealed that nested chromosome fusions played an important role in the divergence of modern grasses. Nowadays, studies on karyotype evolution based on the sequence analysis can also be effectively complemented by the fine-scale cytomolecular approach. In this work, we studied the karyotype evolution of small genome grasses using BAC-FISH based comparative chromosome barcoding in four Brachypodium species: diploid B. distachyon (2n = 10 and B. sylvaticum (2n = 18, diploid (2n = 18 and allopolyploid (2n = 28 B. pinnatum as well as B. phoenicoides (2n = 28. Using BAC clones derived from the B. distachyon genomic libraries for the chromosomes Bd2 and Bd3, we identified the descending dysploidy events that were common for diploids with x = 9 and B. distachyon as well as two nested chromosome fusions that were specific only for B. distachyon. We suggest that dysploidy events that are shared by different lineages of the genus had already appeared in their common ancestor. We also show that additional structural rearrangements, such as translocations and duplications, contributed to increasing genome diversification in the species analysed. No chromosomes structured exactly like Bd2 and Bd3 were found in B. pinnatum (2n = 28 and B. phoenicoides. The structure of Bd2 and Bd3 homeologues belonging to the two genomes in the allopolyploids resembled the structure of their counterparts in the 2n = 18 diploids. These findings reinforce the hypothesis which excludes B. distachyon as a potential parent for Eurasian perennial Brachypodium allopolyploids. Our cytomolecular data elucidate some mechanisms of the descending dysploidy in monocots and enable reconstructions of the evolutionary events which shaped the extant karyotypes in both the genus Brachypodium and in grasses as a whole.

  16. Insight into the karyotype evolution of brachypodium species using comparative chromosome barcoding.

    Science.gov (United States)

    Idziak, Dominika; Hazuka, Iwona; Poliwczak, Beata; Wiszynska, Anna; Wolny, Elzbieta; Hasterok, Robert

    2014-01-01

    Paleogenomic studies based on bioinformatic analyses of DNA sequences have enabled unprecedented insight into the evolution of grass genomes. They have revealed that nested chromosome fusions played an important role in the divergence of modern grasses. Nowadays, studies on karyotype evolution based on the sequence analysis can also be effectively complemented by the fine-scale cytomolecular approach. In this work, we studied the karyotype evolution of small genome grasses using BAC-FISH based comparative chromosome barcoding in four Brachypodium species: diploid B. distachyon (2n = 10) and B. sylvaticum (2n = 18), diploid (2n = 18) and allopolyploid (2n = 28) B. pinnatum as well as B. phoenicoides (2n = 28). Using BAC clones derived from the B. distachyon genomic libraries for the chromosomes Bd2 and Bd3, we identified the descending dysploidy events that were common for diploids with x = 9 and B. distachyon as well as two nested chromosome fusions that were specific only for B. distachyon. We suggest that dysploidy events that are shared by different lineages of the genus had already appeared in their common ancestor. We also show that additional structural rearrangements, such as translocations and duplications, contributed to increasing genome diversification in the species analysed. No chromosomes structured exactly like Bd2 and Bd3 were found in B. pinnatum (2n = 28) and B. phoenicoides. The structure of Bd2 and Bd3 homeologues belonging to the two genomes in the allopolyploids resembled the structure of their counterparts in the 2n = 18 diploids. These findings reinforce the hypothesis which excludes B. distachyon as a potential parent for Eurasian perennial Brachypodium allopolyploids. Our cytomolecular data elucidate some mechanisms of the descending dysploidy in monocots and enable reconstructions of the evolutionary events which shaped the extant karyotypes in both the genus Brachypodium and in grasses as a whole.

  17. Sequencing and De Novo Transcriptome Assembly of Brachypodium sylvaticum (Poaceae

    Directory of Open Access Journals (Sweden)

    Samuel E. Fox

    2013-03-01

    Full Text Available Premise of the study: We report the de novo assembly and characterization of the transcriptomes of Brachypodium sylvaticum (slender false-brome accessions from native populations of Spain and Greece, and an invasive population west of Corvallis, Oregon, USA. Methods and Results: More than 350 million sequence reads from the mRNA libraries prepared from three B. sylvaticum genotypes were assembled into 120,091 (Corvallis, 104,950 (Spain, and 177,682 (Greece transcript contigs. In comparison with the B. distachyon Bd21 reference genome and GenBank protein sequences, we estimate >90% exome coverage for B. sylvaticum. The transcripts were assigned Gene Ontology and InterPro annotations. Brachypodium sylvaticum sequence reads aligned against the Bd21 genome revealed 394,654 single-nucleotide polymorphisms (SNPs and >20,000 simple sequence repeat (SSR DNA sites. Conclusions: To our knowledge, this is the first report of transcriptome sequencing of invasive plant species with a closely related sequenced reference genome. The sequences and identified SNP variant and SSR sites will provide tools for developing novel genetic markers for use in genotyping and characterization of invasive behavior of B. sylvaticum.

  18. Deep sequencing of Brachypodium small RNAs at the global genome level identifies microRNAs involved in cold stress response

    Directory of Open Access Journals (Sweden)

    Chong Kang

    2009-09-01

    Full Text Available Abstract Background MicroRNAs (miRNAs are endogenous small RNAs having large-scale regulatory effects on plant development and stress responses. Extensive studies of miRNAs have only been performed in a few model plants. Although miRNAs are proved to be involved in plant cold stress responses, little is known for winter-habit monocots. Brachypodium distachyon, with close evolutionary relationship to cool-season cereals, has recently emerged as a novel model plant. There are few reports of Brachypodium miRNAs. Results High-throughput sequencing and whole-genome-wide data mining led to the identification of 27 conserved miRNAs, as well as 129 predicted miRNAs in Brachypodium. For multiple-member conserved miRNA families, their sizes in Brachypodium were much smaller than those in rice and Populus. The genome organization of miR395 family in Brachypodium was quite different from that in rice. The expression of 3 conserved miRNAs and 25 predicted miRNAs showed significant changes in response to cold stress. Among these miRNAs, some were cold-induced and some were cold-suppressed, but all the conserved miRNAs were up-regulated under cold stress condition. Conclusion Our results suggest that Brachypodium miRNAs are composed of a set of conserved miRNAs and a large proportion of non-conserved miRNAs with low expression levels. Both kinds of miRNAs were involved in cold stress response, but all the conserved miRNAs were up-regulated, implying an important role for cold-induced miRNAs. The different size and genome organization of miRNA families in Brachypodium and rice suggest that the frequency of duplication events or the selection pressure on duplicated miRNAs are different between these two closely related plant species.

  19. Protein (Viridiplantae): 147430 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available Brachypodium distachyon MGGKAVLLVALLAVSLVVQIQADSGYTPTPVTPSPKPEKPPKGHKPPHHHHHAKPPAGSHKPAPPTATPP...TPAYKPPTATPPAPTPPKYTPSPKPPTPKPTPPTYTPTPKPPTPTPKPTPPTYKPAPKPTPPTYKPTPKPSPPTYPPKPTPPTYKPAPKPTPPTYKPAPKPTPPTYKPAPKPTPP...TYKPDPKPTPPTYKPAPKPAPKPTPPNYKPAPKPTPPSYKPAPKPTPPAPKPTPPTPPAYKPAPKPSPPTPAPPAYKPPTPTPPAYKTPTPSPPPPPYHH

  20. Protein (Viridiplantae): 268154 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ke, partial Brachypodium distachyon KVGADHDTRITPMSSEKLRNLGWKPREVEETLLDSVEYCRETGIL...MDNELWYFVAKTVAEETALEYAENNGLHVVTVCPCIVFGPQLQPTVNTSSELLIYVIKGGPNAISDMSWHIVDVHDVADALLLVYEKPELSGRYICAPNXISTKVVLELLKKTYPDYNYVMCKVGADHD

  1. Non-redundant functions of the dimeric ABA receptor BdPYL1 in the grass Brachypodium.

    Science.gov (United States)

    Pri-Tal, Oded; Shaar-Moshe, Lidor; Wiseglass, Gil; Peleg, Zvi; Mosquna, Assaf

    2017-09-11

    Abiotic stresses have severe detrimental effects on agricultural productivity worldwide. Abscisic acid (ABA) levels rise in response to abiotic stresses, and play a role in coordinating physiological responses. ABA elicits its effects by binding a family of soluble receptors, increasing affinity of the receptors to type 2C phosphatases (PP2Cs) leading to phosphatase inhibition. In the current study, we conducted a comprehensive analysis of the ABA signaling pathway in the cereal model grass Brachypodium distachyon. The Brachypodium genome encodes a family of 10 functionally conserved ABA receptors. The 10th in the series, BdPYL10, encodes a defective receptor and is likely a pseudogene. Combinatorial protein interaction assay further validated computational analysis, which grouped Brachypodium ABA receptors into three subfamilies, similarly to Arabidopsis classification. Brachypodium subfamily III receptors inhibited PP2C activity in vitro and complemented Arabidopsis quadruple (pyr1/pyl1/pyl2/pyl4) mutant. BdPYL1 T-DNA mutant exhibited clear ABA hyposensitivity phenotypes during seedling establishment and in mature plants. Single receptor predominance is in agreement with high transcriptional abundance of only a small Brachypodium ABA receptors subset, harboring the higher marginal significance of BdPYL1. Our findings suggest that unlike the highly redundant ABA core signaling components of Arabidopsis, Brachypodium encompasses a more compact and specialized ABA receptor apparatus. This organization may contribute to plant adaptations to ecological niches. These results lay the groundwork for targeting the prominent ABA receptors for stress perception in grasses, and reveal functional differences and commonalities between monocots and eudicots. © 2017 The Authors The Plant Journal © 2017 John Wiley & Sons Ltd.

  2. A role for barley CRYPTOCHROME1 in light regulation of grain dormancy and germination.

    Science.gov (United States)

    Barrero, Jose M; Downie, A Bruce; Xu, Qian; Gubler, Frank

    2014-03-01

    It is well known that abscisic acid (ABA) plays a central role in the regulation of seed dormancy and that transcriptional regulation of genes encoding ABA biosynthetic and degradation enzymes is responsible for determining ABA content. However, little is known about the upstream signaling pathways impinging on transcription to ultimately regulate ABA content or how environmental signals (e.g., light and cold) might direct such expression in grains. Our previous studies indicated that light is a key environmental signal inhibiting germination in dormant grains of barley (Hordeum vulgare), wheat (Triticum aestivum), and Brachypodium distachyon and that this effect attenuates as after-ripening progresses further. We found that the blue component of the light spectrum inhibits completion of germination in barley by inducing the expression of the ABA biosynthetic gene 9-cis-epoxycarotenoid dioxygenase and dampening expression of ABA 8'-hydroxylase, thus increasing ABA content in the grain. We have now created barley transgenic lines downregulating the genes encoding the blue light receptors CRYTOCHROME (CRY1) and CRY2. Our results demonstrate that CRY1 is the key receptor perceiving and transducing the blue light signal in dormant grains.

  3. Use of Agrobacterium rhizogenes strain 18r12v and paromomycin selection for transformation of Brachypodium distachyon and Brachypodium sylvaticum

    Science.gov (United States)

    The genetic transformation of monocot grasses is a resource intensive process, the quality and efficiency of which is dependent in part upon the method of DNA introduction, as well as the ability to effectively separate transformed from wildtype tissue. Agrobacterium-mediated transformation of Brac...

  4. A Role for Barley CRYPTOCHROME1 in Light Regulation of Grain Dormancy and Germination[W][OPEN

    Science.gov (United States)

    Barrero, Jose M.; Downie, A. Bruce; Xu, Qian; Gubler, Frank

    2014-01-01

    It is well known that abscisic acid (ABA) plays a central role in the regulation of seed dormancy and that transcriptional regulation of genes encoding ABA biosynthetic and degradation enzymes is responsible for determining ABA content. However, little is known about the upstream signaling pathways impinging on transcription to ultimately regulate ABA content or how environmental signals (e.g., light and cold) might direct such expression in grains. Our previous studies indicated that light is a key environmental signal inhibiting germination in dormant grains of barley (Hordeum vulgare), wheat (Triticum aestivum), and Brachypodium distachyon and that this effect attenuates as after-ripening progresses further. We found that the blue component of the light spectrum inhibits completion of germination in barley by inducing the expression of the ABA biosynthetic gene 9-cis-epoxycarotenoid dioxygenase and dampening expression of ABA 8’-hydroxylase, thus increasing ABA content in the grain. We have now created barley transgenic lines downregulating the genes encoding the blue light receptors CRYTOCHROME (CRY1) and CRY2. Our results demonstrate that CRY1 is the key receptor perceiving and transducing the blue light signal in dormant grains. PMID:24642944

  5. Characterization of FLOWERING LOCUS T1 (FT1 gene in Brachypodium and wheat.

    Directory of Open Access Journals (Sweden)

    Bo Lv

    Full Text Available The phase transition from vegetative to reproductive growth is a critical event in the life cycle of flowering plants. FLOWERING LOCUS T (FT plays a central role in the regulation of this transition by integrating signals from multiple flowering pathways in the leaves and transmitting them to the shoot apical meristem. In this study, we characterized FT homologs in the temperate grasses Brachypodium distachyon and polyploid wheat using transgenic and mutant approaches. Downregulation of FT1 by RNAi was associated with a significant downregulation of the FT-like genes FT2 and FT4 in Brachypodium and FT2 and FT5 in wheat. In a transgenic wheat line carrying a highly-expressed FT1 allele, FT2 and FT3 were upregulated under both long and short days. Overexpression of FT1 caused extremely early flowering during shoot regeneration in both Brachypodium and hexaploid wheat, and resulted in insufficient vegetative tissue to support the production of viable seeds. Downregulation of FT1 transcripts by RNA interference (RNAi resulted in non-flowering Brachypodium plants and late flowering plants (2-4 weeks delay in wheat. A similar delay in heading time was observed in tetraploid wheat plants carrying mutations for both FT-A1 and FT-B1. Plants homozygous only for mutations in FT-B1 flowered later than plants homozygous only for mutations in FT-A1, which corresponded with higher transcript levels of FT-B1 relative to FT-A1 in the early stages of development. Taken together, our data indicate that FT1 plays a critical role in the regulation of flowering in Brachypodium and wheat, and that this role is associated with the simultaneous regulation of other FT-like genes. The differential effects of mutations in FT-A1 and FT-B1 on wheat heading time suggest that different allelic combinations of FT1 homoeologs could be used to adjust wheat heading time to improve adaptation to changing environments.

  6. Functional characterization of cinnamyl alcohol dehydrogenase and caffeic acid O-methyltransferase in Brachypodium distachyon.

    Science.gov (United States)

    Lignin is a significant recalcitrant in the conversion of plant biomass to bioethanol. Cinnamyl alcohol dehydrogenase (CAD) and caffeic acid O-methyltransferase (COMT) catalyze key steps in the pathway of lignin monomer biosynthesis. Brown midrib mutants in Zea mays and Sorghum bicolor with impaired...

  7. Stress-induced endogenous siRNAs targeting regulatory intron sequences in Brachypodium.

    Science.gov (United States)

    Wang, Hsiao-Lin V; Dinwiddie, Brandon L; Lee, Herman; Chekanova, Julia A

    2015-02-01

    Exposure to abiotic stresses triggers global changes in the expression of thousands of eukaryotic genes at the transcriptional and post-transcriptional levels. Small RNA (smRNA) pathways and splicing both function as crucial mechanisms regulating stress-responsive gene expression. However, examples of smRNAs regulating gene expression remain largely limited to effects on mRNA stability, translation, and epigenetic regulation. Also, our understanding of the networks controlling plant gene expression in response to environmental changes, and examples of these regulatory pathways intersecting, remains limited. Here, to investigate the role of smRNAs in stress responses we examined smRNA transcriptomes of Brachypodium distachyon plants subjected to various abiotic stresses. We found that exposure to different abiotic stresses specifically induced a group of novel, endogenous small interfering RNAs (stress-induced, UTR-derived siRNAs, or sutr-siRNAs) that originate from the 3' UTRs of a subset of coding genes. Our bioinformatics analyses predicted that sutr-siRNAs have potential regulatory functions and that over 90% of sutr-siRNAs target intronic regions of many mRNAs in trans. Importantly, a subgroup of these sutr-siRNAs target the important intron regulatory regions, such as branch point sequences, that could affect splicing. Our study indicates that in Brachypodium, sutr-siRNAs may affect splicing by masking or changing accessibility of specific cis-elements through base-pairing interactions to mediate gene expression in response to stresses. We hypothesize that this mode of regulation of gene expression may also serve as a general mechanism for regulation of gene expression in plants and potentially in other eukaryotes. © 2015 Wang et al.; Published by Cold Spring Harbor Laboratory Press for the RNA Society.

  8. Brachypodium and gene discovery in oat

    Science.gov (United States)

    The hexaploid nature of the oat (Avena sativa) genome, coupled with its large genome and high repetitive element content, presents an obstacle to genome research in this crop. We assessed the potential value of the model grass Brachypodium as a surrogate genome for oat genome research, through compa...

  9. Molecular genetic investigations of root gravitropism and other complex growth behaviors using Arabidopsis and Brachypodium as models

    Science.gov (United States)

    Masson, Patrick; Barker, Richard; Miller, Nathan; Su, Shih-Hao; Su, Shih-Heng

    2016-07-01

    When growing on hard surfaces, Arabidopsis roots tend to grown downward, as dictated by positive gravitropism. At the same time, surface-derived stimuli promote a wavy pattern of growth that is superimposed to a rightward root-skewing trend. This behavior is believed to facilitate obstacle avoidance in soil. To better understand these complex behaviors, we have isolated and characterized mutations that affect them. Some of these mutations were shown to affect gravitropism whereas others did not. Within the latter group, most of the mutations affected mechanisms that control anisotropic cell expansion. We have also characterized mutations that affect early steps of gravity signal transduction within the gravity-sensing columella cells of the root cap. Upon reorientation within the gravity field, starch-filled plastids sediment to the bottom-side of these cells, triggering a pathway that leads to re-localization of auxin efflux facilitators to the bottom membrane. Lateral auxin transport toward the bottom flank ensues, leading to gravitropic curvature. Several of the mutations we characterized affect genes that encode proteins associated with the vesicle trafficking pathway needed for this cell polarization. Other mutations were shown to affect components of the plastid outer envelope protein import complex (TOC). Their functional analysis suggests an active role for plastids in gravity signal transduction, beyond a simple contribution as sedimenting gravity susceptors. Because most cultivated crops are monocots, not dicots like Arabidopsis, we have also initiated studies of root-growth behavior with Brachypodium distachyon. When responding to a gravistimulus, the roots of Brachypodium seedlings develop a strong downward curvature that proceeds until the tip reaches a ~50-degree curvature. At that time, an oscillatory tip movement occurs while the root continues its downward reorientation. These root-tip oscillations also occur if roots are allowed to simply grow

  10. RNA-seq in grain unveils fate of neo- and paleopolyploidization events in bread wheat (Triticum aestivum L.).

    Science.gov (United States)

    Pont, Caroline; Murat, Florent; Confolent, Carole; Balzergue, Sandrine; Salse, Jérôme

    2011-12-02

    Whole genome duplication is a common evolutionary event in plants. Bread wheat (Triticum aestivum L.) is a good model to investigate the impact of paleo- and neoduplications on the organization and function of modern plant genomes. We performed an RNA sequencing-based inference of the grain filling gene network in bread wheat and identified a set of 37,695 non-redundant sequence clusters, which is an unprecedented resolution corresponding to an estimated half of the wheat genome unigene repertoire. Using the Brachypodium distachyon genome as a reference for the Triticeae, we classified gene clusters into orthologous, paralogous, and homoeologous relationships. Based on this wheat gene evolutionary classification, older duplicated copies (dating back 50 to 70 million years) exhibit more than 80% gene loss and expression divergence while recent duplicates (dating back 1.5 to 3 million years) show only 54% gene loss and 36 to 49% expression divergence. We suggest that structural shuffling due to duplicated gene loss is a rapid process, whereas functional shuffling due to neo- and/or subfunctionalization of duplicates is a longer process, and that both shuffling mechanisms drive functional redundancy erosion. We conclude that, as a result of these mechanisms, half the gene duplicates in plants are structurally and functionally altered within 10 million years of evolution, and the diploidization process is completed after 45 to 50 million years following polyploidization.

  11. Cytomolecular analysis of ribosomal DNA evolution in a natural allotetraploid Brachypodium hybridum and its putative ancestors – dissecting complex repetitive structure of intergenic spacers

    Directory of Open Access Journals (Sweden)

    Natalia Borowska-Zuchowska

    2016-10-01

    Full Text Available Nucleolar dominance is an epigenetic phenomenon associated with nuclear 35S rRNA genes and consists in selective suppression of gene loci inherited from one of the progenitors in the allopolyploid. Our understanding of the exact mechanisms that determine this process is still fragmentary, especially in case of the grass species. This study aimed to shed some light on the molecular basis of this genome-specific inactivation of 35S rDNA loci in an allotetraploid Brachypodium hybridum (2n=30, which arose from the interspecific hybridization between two diploid ancestors that were very similar to modern B. distachyon (2n=10 and B. stacei (2n=20. Using fluorescence in situ hybridization with 25S rDNA and chromosome-specific BAC clones as probes we revealed that the nucleolar dominance is present not only in meristematic root-tip cells but also in differentiated cell fraction of B. hybridum. Additionally, the intergenic spacers (IGSs from both of the putative ancestors and the allotetraploid were sequenced and analyzed. The presumptive transcription initiation sites, spacer promoters and repeated elements were identified within the IGSs. Two different length variants, 2.3 kb and 3.5 kb, of IGSs were identified in B. distachyon and B. stacei, respectively, however only the IGS that had originated from B. distachyon-like ancestor was present in the allotetraploid. The amplification pattern of B. hybridum IGSs suggests that some genetic changes occurred in inactive B. stacei-like rDNA loci during the evolution of the allotetraploid. We hypothesize that their preferential silencing is an effect of structural changes in the sequence rather than just the result of the sole inactivation at the epigenetic level.

  12. Dicty_cDB: SHB481 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 5484_C09_E18ZE5_075 Brachypodium distachyon developing spike EST library Brachypodium distachyon cDNA...1 5484_C09_E18ZE5_075 Brachypodium distachyon developing spike EST library Brachypodium distachyon cDNA

  13. Population Structure in the Model Grass Brachypodium distachyon Is Highly Correlated with Flowering Differences across Broad Geographic Areas

    Directory of Open Access Journals (Sweden)

    Ludmila Tyler

    2016-07-01

    Full Text Available The small, annual grass (L. Beauv., a close relative of wheat ( L. and barley ( L., is a powerful model system for cereals and bioenergy grasses. Genome-wide association studies (GWAS of natural variation can elucidate the genetic basis of complex traits but have been so far limited in by the lack of large numbers of well-characterized and sufficiently diverse accessions. Here, we report on genotyping-by-sequencing (GBS of 84 , seven , and three accessions with diverse geographic origins including Albania, Armenia, Georgia, Italy, Spain, and Turkey. Over 90,000 high-quality single-nucleotide polymorphisms (SNPs distributed across the Bd21 reference genome were identified. Our results confirm the hybrid nature of the genome, which appears as a mosaic of -like and -like sequences. Analysis of more than 50,000 SNPs for the accessions revealed three distinct, genetically defined populations. Surprisingly, these genomic profiles are associated with differences in flowering time rather than with broad geographic origin. High levels of differentiation in loci associated with floral development support the differences in flowering phenology between populations. Genome-wide association studies combining genotypic and phenotypic data also suggest the presence of one or more photoperiodism, circadian clock, and vernalization genes in loci associated with flowering time variation within populations. Our characterization elucidates genes underlying population differences, expands the germplasm resources available for , and illustrates the feasibility and limitations of GWAS in this model grass.

  14. Using the Model Perennial Grass Brachypodium sylvaticum to Engineer Resistance to Multiple Abiotic Stresses

    Energy Technology Data Exchange (ETDEWEB)

    Gordon, Sean; Reguera, Maria; Sade, Nir; Cartwright, Amy; Tobias, Christian; Thilmony, Roger; Blumwald, Eduardo; Vogel, John

    2015-03-20

    We are using the perennial model grass Brachypodium sylvaticum to identify combinations of transgenes that enhance tolerance to multiple, simultaneous abiotic stresses. The most successful transgene combinations will ultimately be used to create improved switchgrass (Panicum virgatum L.) cultivars. To further develop B. sylvaticum as a perennial model grass, and facilitate our planned transcriptional profiling, we are sequencing and annotating the genome. We have generated ~40x genome coverage using PacBio sequencing of the largest possible size selected libraries (18, 22, 25 kb). Our initial assembly using only long-read sequence contained 320 Mb of sequence with an N50 contig length of 315 kb and an N95 contig length of 40 kb. This assembly consists of 2,430 contigs, the largest of which was 1.6 Mb. The estimated genome size based on c-values is 340 Mb indicating that about 20 Mb of presumably repetitive DNA remains yet unassembled. Significantly, this assembly is far superior to an assembly created from paired-end short-read sequence, ~100x genome coverage. The short-read-only assembly contained only 226 Mb of sequence in 19k contigs. To aid the assembly of the scaffolds into chromosome-scale assemblies we produced an F2 mapping population and have genotyped 480 individuals using a genotype by sequence approach. One of the reasons for using B. sylvaticum as a model system is to determine if the transgenes adversely affect perenniality and winter hardiness. Toward this goal, we examined the freezing tolerance of wild type B. sylvaticum lines to determine the optimal conditions for testing the freezing tolerance of the transgenics. A survey of seven accessions noted significant natural variation in freezing tolerance. Seedling or adult Ain-1 plants, the line used for transformation, survived an 8 hour challenge down to -6 oC and 50% survived a challenge down to -9 oC. Thus, we will be able to easily determine if the transgenes compromise freezing tolerance. In the

  15. Brachypodium sylvaticum, a model for perennial grasses: transformation and inbred line development.

    Science.gov (United States)

    Steinwand, Michael A; Young, Hugh A; Bragg, Jennifer N; Tobias, Christian M; Vogel, John P

    2013-01-01

    Perennial species offer significant advantages as crops including reduced soil erosion, lower energy inputs after the first year, deeper root systems that access more soil moisture, and decreased fertilizer inputs due to the remobilization of nutrients at the end of the growing season. These advantages are particularly relevant for emerging biomass crops and it is projected that perennial grasses will be among the most important dedicated biomass crops. The advantages offered by perennial crops could also prove favorable for incorporation into annual grain crops like wheat, rice, sorghum and barley, especially under the dryer and more variable climate conditions projected for many grain-producing regions. Thus, it would be useful to have a perennial model system to test biotechnological approaches to crop improvement and for fundamental research. The perennial grass Brachypodiumsylvaticum is a candidate for such a model because it is diploid, has a small genome, is self-fertile, has a modest stature, and short generation time. Its close relationship to the annual model Brachypodiumdistachyon will facilitate comparative studies and allow researchers to leverage the resources developed for B. distachyon. Here we report on the development of two keystone resources that are essential for a model plant: high-efficiency transformation and inbred lines. Using Agrobacterium tumefaciens-mediated transformation we achieved an average transformation efficiency of 67%. We also surveyed the genetic diversity of 19 accessions from the National Plant Germplasm System using SSR markers and created 15 inbred lines.

  16. Brachypodium sylvaticum, a model for perennial grasses: transformation and inbred line development.

    Directory of Open Access Journals (Sweden)

    Michael A Steinwand

    Full Text Available Perennial species offer significant advantages as crops including reduced soil erosion, lower energy inputs after the first year, deeper root systems that access more soil moisture, and decreased fertilizer inputs due to the remobilization of nutrients at the end of the growing season. These advantages are particularly relevant for emerging biomass crops and it is projected that perennial grasses will be among the most important dedicated biomass crops. The advantages offered by perennial crops could also prove favorable for incorporation into annual grain crops like wheat, rice, sorghum and barley, especially under the dryer and more variable climate conditions projected for many grain-producing regions. Thus, it would be useful to have a perennial model system to test biotechnological approaches to crop improvement and for fundamental research. The perennial grass Brachypodiumsylvaticum is a candidate for such a model because it is diploid, has a small genome, is self-fertile, has a modest stature, and short generation time. Its close relationship to the annual model Brachypodiumdistachyon will facilitate comparative studies and allow researchers to leverage the resources developed for B. distachyon. Here we report on the development of two keystone resources that are essential for a model plant: high-efficiency transformation and inbred lines. Using Agrobacterium tumefaciens-mediated transformation we achieved an average transformation efficiency of 67%. We also surveyed the genetic diversity of 19 accessions from the National Plant Germplasm System using SSR markers and created 15 inbred lines.

  17. Genetic structure and diversity of the selfing model grass Brachypodium stacei (Poaceae in Western Mediterranean: out of the Iberian Peninsula and into the islands

    Directory of Open Access Journals (Sweden)

    Valeriia Shiposha

    2016-09-01

    Full Text Available Annual Mediterranean species of the genus Brachypodium are promising model plants for energy crops since their selfing nature and short-life cycles are an advantage in breeding programs. The false brome, B. distachyon, has already been sequenced and new genomic initiatives have triggered the de-novo genome sequencing of its close relatives such as B. stacei, a species that was until recently mistaken for B. distachyon. However, the success of these initiatives hinges on detailed knowledge about the distribution of genetic variation within and among populations for the effective use of germplasm in a breeding program. Understanding population genetic diversity and genetic structure is also an important prerequisite for designing effective experimental populations for genomic wide studies. However, population genetic data are still limited in B. stacei. We therefore selected and amplified 10 nuclear microsatellite markers to depict patterns of population structure and genetic variation among 181 individuals from 19 populations of B. stacei occurring in its predominant range, the western Mediterranean area: mainland Iberian Peninsula, continental Balearic Islands and oceanic Canary Islands. Our genetic results support the occurrence of a predominant selfing system with extremely high levels of homozygosity across the analyzed populations. Despite the low level of genetic variation found, two different genetic clusters were retrieved, one clustering all SE Iberian mainland populations and the island of Minorca and another one grouping all S Iberian mainland populations, the Canary Islands and all Majorcan populations except one that clustered with the former group. These results, together with a high sharing of alleles (89% suggest different colonization routes from the mainland Iberian Peninsula into the islands. A recent colonization scenario could explain the relatively low levels of genetic diversity and low number of alleles found in the Canary

  18. Characterization of Phosphate Transporters BdPT4 and BdPT8 in Mycorrhizal and Non-Mychorrhizal Brachypodium distachyon

    DEFF Research Database (Denmark)

    Clausen, Signe Sandbech

    to support maximal growth at a low nutrient supply. Roots of most plant species are colonized by arbuscular mycorrhiza (AM) fungi, which increase the uptake of nutrients, in particular P. In grasses, however, AM colonization may result in growth depressions, which have conventionally been ascribed to fungal...... was generated by Agrobacterium tumefaciens-mediated transformation. The transgenic lines were characterized for effects on growth and plant P uptake, and their subcellular localization was moreover determined by confocal microscopy. Quantitative expression analysis of 11 BdPTs in AM and non-mycorrhizal (NM...

  19. High mature grain phytase activity in the Triticeae has evolved by duplication followed by neofunctionalization of the purple acid phosphatase phytase (PAPhy) gene

    DEFF Research Database (Denmark)

    Madsen, Claus Krogh; Dionisio, Giuseppe; Holme, Inger

    2013-01-01

    The phytase activity in food and feedstuffs is an important nutritional parameter. Members of the Triticeae tribe accumulate purple acid phosphatase phytases (PAPhy) during grain filling. This accumulation elevates mature grain phytase activities (MGPA) up to levels between ~650 FTU/kg for barley...... maintained the archaic function and drives expression during germination. Brachypodium is the only sequenced Poaceae sharing the PAPhy duplication. As for the Triticeae, the duplication is reflected in a high MGPA of ~4200 FTU/kg in Brachypodium. The sequence conservation of the paralogous loci...... on Brachypodium chromosomes 1 and 2 does not extend beyond the PAPhy gene. The results indicate that a single-gene segmental duplication may have enabled the evolution of high MGPA by creating functional redundancy of the parent PAPhy gene. This implies that similar MGPA levels may be out of reach in breeding...

  20. Effects of Environmental Conditions on the Fitness Penalty in Herbicide Resistant Brachypodium hybridum.

    Science.gov (United States)

    Frenkel, Eyal; Matzrafi, Maor; Rubin, Baruch; Peleg, Zvi

    2017-01-01

    Herbicide-resistance mutations may impose a fitness penalty in herbicide-free environments. Moreover, the fitness penalty associated with herbicide resistance is not a stable parameter and can be influenced by ecological factors. Here, we used two Brachypodium hybridum accessions collected from the same planted forest, sensitive (S) and target-site resistance (TSR) to photosystem II (PSII) inhibitors, to study the effect of agro-ecological parameters on fitness penalty. Both accessions were collected in the same habitat, thus, we can assume that the genetic variance between them is relatively low. This allow us to focus on the effect of PSII TSR on plant fitness. S plants grains were significantly larger than those of the TSR plants and this was associated with a higher rate of germination. Under low radiation, the TSR plants showed a significant fitness penalty relative to S plants. S plants exhibiting dominance when both types of plants were grown together in a low-light environment. In contrast to previous documented studies, under high-light environment our TSR accession didn't show any significant difference in fitness compared to the S accession. Nitrogen deficiency had significant effect on the R compared to the S accession and was demonstrated in significant yield reduction. TSR plants also expressed a high fitness penalty, relative to the S plants, when grown in competition with wheat plants. Two evolutionary scenarios can be suggested to explain the coexistence of both TSR and S plants in the same habitat. The application of PSII inhibitors may have created selective pressure toward TSR dominancy; termination of herbicide application gave an ecological advantage to S plants, creating changes in the composition of the seed bank. Alternatively, the high radiation intensities found in the Mediterranean-like climate may reduce the fitness penalty associated with TSR. Our results may suggest that by integrating non-herbicidal approaches into weed

  1. Cell wall composition throughout development for the model grass Brachypodium distanchyon

    Directory of Open Access Journals (Sweden)

    David eRancour

    2012-12-01

    Full Text Available Temperate perennial grasses are important worldwide as a livestock nutritive energy source and a potential feedstock for lignocellulosic biofuel production. The annual temperate grass Brachypodium distanchyon has been championed as a useful model system to facilitate biological research in agriculturally important temperate forage grasses based on phylogenetic relationships. To physically corroborate genetic predictions, we determined the chemical composition profiles of organ-specific cell walls throughout the development of two common diploid accessions of Brachypodium distanchyon, Bd21-3 and Bd21. Chemical analysis was performed on cell walls isolated from distinct organs (i.e. leaves, sheaths, stems and roots at three developmental stages of 1 12-day seedling, 2 vegetative-to-reproductive transition, and 3 mature seed-fill. In addition, we have included cell wall analysis of embryonic callus used for genetic transformations. Composition of cell walls based on components lignin, hydroxycinnamates, uronosyls, neutral sugars, and protein suggests that Brachypodium distanchyon is similar chemically to agriculturally important forage grasses. There were modest compositional differences in hydroxycinnamate profiles between accessions Bd21-3 and Bd21. In addition, when compared to agronomical important C3 grasses, more mature Brachypodium stem cell walls have a relative increase in glucose of 48% and a decrease in lignin of 36%. Though differences exists between Brachypodium and agronomical important C3 grasses, Brachypodium distanchyon should be still a useful model system for genetic manipulation of cell wall composition to determine the impact upon functional characteristics such as rumen digestibility or energy conversion efficiency for bioenergy production.

  2. Analysis of grain characters in temperate grasses reveals distinctive patterns of endosperm organization associated with grain shape.

    Science.gov (United States)

    Hands, Philip; Kourmpetli, Sofia; Sharples, Donna; Harris, Robert G; Drea, Sinéad

    2012-10-01

    Members of the core pooids represent the most important crops in temperate zones including wheat, barley, and oats. Their importance as crops is largely due to the grain, particularly the storage capabilities of the endosperm. In this study, a comprehensive survey of grain morphology and endosperm organization in representatives of wild and cultivated species throughout the core pooids was performed. As sister to the core pooid tribes Poeae, Aveneae, Triticeae, and Bromeae within the Pooideae subfamily, Brachypodium provides a taxonomically relevant reference point. Using macroscopic, histological, and molecular analyses distinct patterns of grain tissue organization in these species, focusing on the peripheral and modified aleurone, are described. The results indicate that aleurone organization is correlated with conventional grain quality characters such as grain shape and starch content. In addition to morphological and organizational variation, expression patterns of candidate gene markers underpinning this variation were examined. Features commonly associated with grains are largely defined by analyses on lineages within the Triticeae and knowledge of grain structure may be skewed as a result of the focus on wheat and barley. Specifically, the data suggest that the modified aleurone is largely restricted to species in the Triticeae tribe.

  3. Interação de bactérias benéficas associativas (Herbaspirillum seropedicae e Azospirillum brasilense) com diferentes espécies de gramíneas (Zea mays, Brachypodium distachyon e Setaria viridis)

    OpenAIRE

    Amaral, Fernanda Plucani do

    2014-01-01

    Tese (doutorado) - Universidade Federal de Santa Catarina, Centro de Ciências Agrárias, Programa de Pós-Graduação em Recursos Genéticos Vegetais, Florianópolis, 2014. O nitrogênio é um nutriente essencial no crescimento e desenvolvimento das plantas. A habilidade da planta em suprir a necessidade de nitrogênio necessária pode vir da fixação biológica de nitrogênio (FBN), através de interações com bactérias diazotróficas associativas. Azospirillum brasilense, que coloniza a rizosfera, e Her...

  4. Grain boundaries

    Energy Technology Data Exchange (ETDEWEB)

    Balluffi, R.W.; Bristowe, P.D.

    1991-01-01

    The present document is a progress report describing the work accomplished to date during the second year of our four-year grant (February 15, 1990--February 14, 1994) to study grain boundaries. The research was focused on the following three major efforts: Study of the atomic structure of grain boundaries by means of x-ray diffraction, transmission electron microscopy and computer modeling; study of short-circuit diffusion along grain boundaries; and development of a Thin-film Deposition/Bonding Apparatus for the manufacture of high purity bicrystals.

  5. Grain boundaries

    Science.gov (United States)

    Balluffi, R. W.; Bristowe, P. D.

    The present document is a progress report describing the work accomplished to date during the second year of our four-year grant (February 15, 1990 to February 14, 1994) to study grain boundaries. The research was focused on the following three major efforts: study of the atomic structure of grain boundaries by means of x-ray diffraction, transmission electron microscopy and computer modeling; study of short-circuit diffusion along grain boundaries; and development of a Thin-film Deposition/Bonding Apparatus for the manufacture of high purity bicrystals.

  6. Grado di cheratinizzazione dell'epitelio ruminale e valutazione dello stato corporeo in ovini tenuti su pascoli di Brachypodium rupestre

    Directory of Open Access Journals (Sweden)

    Paola Scocco

    2013-06-01

    Full Text Available L'articolo valuta e mette in correlazione i cambiamenti del grado di cheratinizzazione della mucosa ruminale con lo stato corporeo di ovini tenuti a pascolare per 20 giorni in un'area ad elevata copertura di paléo rupestre (Brachypodium rupestre. Il pascolo degli ovini in queste aree riduce il rischio di incendi boschivi. Tuttavia, l'assunzione di Brachypodium rupestre protratta per lunghi periodi può compromettere la salute generale degli animali. Lo scopo di questo studio è di determinare il periodo massimo di permanenza degli animali in queste aree. Ovini mantenuti su un pascolo semi-mesofilo sono stati utilizzati come gruppo di controllo. Nei giorni 1, 10 e 20 della sperimentazione, 5 animali di ogni gruppo sono stati sacrificati per la valutazione delle modificazioni del grado di cheratinizzazione dell'epitelio dell'atrio e del sacco ventrale del rumine. La valutazione dello stato corporeo, o body condition score (BCS, e il peso vivo (PV sono stati monitorati su altri 10 soggetti per gruppo. Il gruppo di controllo ha mostrato piccole variazioni del grado di cheratinizzazione del rumine che non hanno inciso negativamente sul BCS o sul PV. Il gruppo sperimentale ha mostrato un significativo incremento del grado di cheratinizzazione, già entro i primi dieci giorni, che ha portato ad un graduale abbassamento del BCS e ad un calo di peso tra il decimo e il ventesimo giorno. I dati ottenuti suggeriscono che al fine della prevenzione degli incendi boschivi gli ovini dovrebbero essere utilizzati a turno con periodi di permanenza nei pascoli ad alta copertura di Brachypodium rupestre non superiori ai 10-12 giorni.

  7. Unraveling the Transcriptional Basis of Temperature-Dependent Pinoxaden Resistance in Brachypodium hybridum.

    Science.gov (United States)

    Matzrafi, Maor; Shaar-Moshe, Lidor; Rubin, Baruch; Peleg, Zvi

    2017-01-01

    Climate change endangers food security and our ability to feed the ever-increasing human population. Weeds are the most important biotic stress, reducing crop-plant productivity worldwide. Chemical control, the main approach for weed management, can be strongly affected by temperature. Previously, we have shown that temperature-dependent non-target site (NTS) resistance of Brachypodium hybridum is due to enhanced detoxification of acetyl-CoA carboxylase inhibitors. Here, we explored the transcriptional basis of this phenomenon. Plants were characterized for the transcriptional response to herbicide application, high-temperature and their combination, in an attempt to uncover the genetic basis of temperature-dependent pinoxaden resistance. Even though most of the variance among treatments was due to pinoxaden application (61%), plants were able to survive pinoxaden application only when grown under high-temperatures. Biological pathways and expression patterns of members of specific gene families, previously shown to be involved in NTS metabolic resistance to different herbicides, were examined. Cytochrome P450, glucosyl transferase and glutathione-S-transferase genes were found to be up-regulated in response to pinoxaden application under both control and high-temperature conditions. However, biological pathways related to oxidation and glucose conjugation were found to be significantly enriched only under the combination of pinoxaden application and high-temperature. Analysis of reactive oxygen species (ROS) was conducted at several time points after treatment using a probe detecting H2O2/peroxides. Comparison of ROS accumulation among treatments revealed a significant reduction in ROS quantities 24 h after pinoxaden application only under high-temperature conditions. These results may indicate significant activity of enzymatic ROS scavengers that can be correlated with the activation of herbicide-resistance mechanisms. This study shows that up-regulation of genes

  8. Unraveling the Transcriptional Basis of Temperature-Dependent Pinoxaden Resistance in Brachypodium hybridum

    Science.gov (United States)

    Matzrafi, Maor; Shaar-Moshe, Lidor; Rubin, Baruch; Peleg, Zvi

    2017-01-01

    Climate change endangers food security and our ability to feed the ever-increasing human population. Weeds are the most important biotic stress, reducing crop-plant productivity worldwide. Chemical control, the main approach for weed management, can be strongly affected by temperature. Previously, we have shown that temperature-dependent non-target site (NTS) resistance of Brachypodium hybridum is due to enhanced detoxification of acetyl-CoA carboxylase inhibitors. Here, we explored the transcriptional basis of this phenomenon. Plants were characterized for the transcriptional response to herbicide application, high-temperature and their combination, in an attempt to uncover the genetic basis of temperature-dependent pinoxaden resistance. Even though most of the variance among treatments was due to pinoxaden application (61%), plants were able to survive pinoxaden application only when grown under high-temperatures. Biological pathways and expression patterns of members of specific gene families, previously shown to be involved in NTS metabolic resistance to different herbicides, were examined. Cytochrome P450, glucosyl transferase and glutathione-S-transferase genes were found to be up-regulated in response to pinoxaden application under both control and high-temperature conditions. However, biological pathways related to oxidation and glucose conjugation were found to be significantly enriched only under the combination of pinoxaden application and high-temperature. Analysis of reactive oxygen species (ROS) was conducted at several time points after treatment using a probe detecting H2O2/peroxides. Comparison of ROS accumulation among treatments revealed a significant reduction in ROS quantities 24 h after pinoxaden application only under high-temperature conditions. These results may indicate significant activity of enzymatic ROS scavengers that can be correlated with the activation of herbicide-resistance mechanisms. This study shows that up-regulation of genes

  9. Microbiota of kefir grains

    Directory of Open Access Journals (Sweden)

    Tomislav Pogačić

    2013-03-01

    Full Text Available Kefir grains represent the unique microbial community consisting of bacteria, yeasts, and sometimes filamentous moulds creating complex symbiotic community. The complexity of their physical and microbial structures is the reason that the kefir grains are still not unequivocally elucidated. Microbiota of kefir grains has been studied by many microbiological and molecular approaches. The development of metagenomics, based on the identification without cultivation, is opening new possibilities for identification of previously nonisolated and non-identified microbial species from the kefir grains. Considering recent studies, there are over 50 microbial species associated with kefir grains. The aim of this review is to summarise the microbiota composition of kefir grains. Moreover, because of technological and microbiological significance of the kefir grains, the paper provides an insight into the microbiological and molecular methods applied to study microbial biodiversity of kefir grains.

  10. Host status of false brome grass to the leaf rust fungus Puccinia brachypodii and the stripe rust fungus P. Striiformis

    NARCIS (Netherlands)

    Barbieri, M.; Marcel, T.C.; Niks, R.E.

    2011-01-01

    Purple false brome grass (Brachypodium distachyon) has recently emerged as a model system for temperate grasses and is also a potential model plant to investigate plant interactions with economically important pathogens such as rust fungi. We determined the host status of five Brachypodium species

  11. Microbiota of kefir grains

    OpenAIRE

    Tomislav Pogačić; Sanja Šinko; Šimun Zamberlin; Dubravka Samaržija

    2013-01-01

    Kefir grains represent the unique microbial community consisting of bacteria, yeasts, and sometimes filamentous moulds creating complex symbiotic community. The complexity of their physical and microbial structures is the reason that the kefir grains are still not unequivocally elucidated. Microbiota of kefir grains has been studied by many microbiological and molecular approaches. The development of metagenomics, based on the identification without cultivation, is opening new possibilities f...

  12. Grain Boundary Complexions

    Science.gov (United States)

    2014-05-01

    deter- mine bulk materials behavior and properties such as superplasticity, creep, fatigue, corrosion , strength and conductivity [2]. Grain boundary...interface (i.e. lattice mismatch accommodated by interface dislocations ), wetting transitions will not occur. A wetting transition is possible in the case...melting only starts around dislocations at low- angle grain boundaries; the grain boundary structure con- sists of isolated liquid pools separated by

  13. Compaction of cereal grain

    OpenAIRE

    Wychowaniec, J.; Griffiths, I.; Gay, A; Mughal, A.

    2013-01-01

    We report on simple shaking experiments to measure the compaction of a column of Firth oat grain. Such grains are elongated anisotropic particles with a bimodal polydispersity. In these experiments, the particle configurations start from an initially disordered, low-packing-fraction state and under vertical shaking evolve to a dense state with evidence of nematic-like structure at the surface of the confining tube. This is accompanied by an increase in the packing fraction of the grain.

  14. Compaction of cereal grain

    Science.gov (United States)

    Wychowaniec, J.; Griffiths, I.; Gay, A.; Mughal, A.

    2013-11-01

    We report on simple shaking experiments to measure the compaction of a column of Firth oat grain. Such grains are elongated anisotropic particles with a bimodal polydispersity. In these experiments, the particle configurations start from an initially disordered, low-packing-fraction state and under vertical shaking evolve to a dense state with evidence of nematic-like structure at the surface of the confining tube. This is accompanied by an increase in the packing fraction of the grain.

  15. Mycorrhizal symbiosis effects on growth of chalk false-brome (Brachypodium pinnatum) are dependent on the environmental light regime.

    Science.gov (United States)

    Füzy, Anna; Bothe, Hermann; Molnár, Edit; Biró, Borbála

    2014-03-01

    AMF (arbuscular mycorrhizal fungi) colonization of the grass chalk false-brome (Brachypodium pinnatum (L.) P. B.) was studied in selected habitats under spatially different light regimes: (a) shade condition under oak trees, (b) half shade in a shrubby area and (c) full-sun conditions on unshaded grassland. This study assessed the variations in AMF colonization of the grass dependent on the light supply in field habitats. Soil, root and shoot samples were collected four times during the vegetation period (in June, July, September and October). Root colonization, root and shoot biomass as well as soil water content were determined. The highest rate of AMF colonization was detected in June under half-sun and full-sun conditions, where about 50% of the roots were colonized. The average amount of arbuscules was less than 20% in the roots at the three sites, with the highest number of arbuscules in June, under half-sun and full-sun conditions, however, not under the trees. Overall, best mycorrhizal colonization occurred during summer, and its rate decreased in autumn. This tendency inversely correlated with the amount of precipitation, and thus with the water content of soils. The high colonization rate of the examined root samples, and also its seasonal fluctuation, might reflect the importance of the symbiosis where inorganic nutrients and water are the growth-limiting factors. The marginal AMF colonization of chalk false-brome under shade conditions indicates that plants do not use AMF under all stress conditions. When low light limits photosynthesis and thus growth of the plants, they dispense with the colonization of AMF in order to save the expenditure of organic carbon. Copyright © 2013 Elsevier GmbH. All rights reserved.

  16. Grain boundaries: Progress report

    Energy Technology Data Exchange (ETDEWEB)

    Balluffi, R.W.; Bristowe, P.D.

    1988-02-01

    Quantitative measurements of grain boundary structure factors using x-ray diffraction have been performed on low angle (001) twist boundaries in gold. Also, a computer atomistic simulation program is being implemented to examine the equilibrium properties of a series of boundaries in gold. Simulation of boundaries at room temperature have been performed. Electron microscopy of grain boundary melting in aluminum was also performed. Results indicated an absence of melting. (CBS)

  17. Why do interstellar grains exist?

    Science.gov (United States)

    Seab, C. G.; Hollenbach, D. J.; Mckee, C. F.; Tielens, Alexander G. G. M.

    1986-01-01

    There exists a discrepancy between calculated destruction rates of grains in the interstellar medium and postulated sources of new grains. This problem was examined by modelling the global life cycle of grains in the galaxy. The model includes: grain destruction due to supernovae shock waves; grain injection from cool stars, planetary nebulae, star formation, novae, and supernovae; grain growth by accretion in dark clouds; and a mixing scheme between phases of the interstellar medium. Grain growth in molecular clouds is considered as a mechanism or increasing the formation rate. To decrease the shock destruction rate, several new physical processes, such as partial vaporization effects in grain-grain collisions, breakdown of the small Larmor radius approximation for betatron acceleration, and relaxation of the steady-state shock assumption are included.

  18. Grain Boundary Segregation in Metals

    CERN Document Server

    Lejcek, Pavel

    2010-01-01

    Grain boundaries are important structural components of polycrystalline materials used in the vast majority of technical applications. Because grain boundaries form a continuous network throughout such materials, their properties may limit their practical use. One of the serious phenomena which evoke these limitations is the grain boundary segregation of impurities. It results in the loss of grain boundary cohesion and consequently, in brittle fracture of the materials. The current book deals with fundamentals of grain boundary segregation in metallic materials and its relationship to the grain boundary structure, classification and other materials properties.

  19. Influence of grain size and grain boundary recombination velocity on ...

    African Journals Online (AJOL)

    The plot of the diffusion capacitance allowed us to study the influence of the following parameters: grain size, grain boundary recombination velocity, junction recombination velocity and illumination wavelength on this capacitance. This study pointed out that junction and grain boundary recombination velocities play an ...

  20. FINE GRAIN NUCLEAR EMULSION

    Science.gov (United States)

    Oliver, A.J.

    1962-04-24

    A method of preparing nuclear track emulsions having mean grain sizes less than 0.1 microns is described. The method comprises adding silver nitrate to potassium bromide at a rate at which there is always a constant, critical excess of silver ions. For minimum size grains, the silver ion concentration is maintained at the critical level of about pAg 2.0 to 5.0 during prectpitation, pAg being defined as the negative logarithm of the silver ion concentration. It is preferred to eliminate the excess silver at the conclusion of the precipitation steps. The emulsion is processed by methods in all other respects generally similar to the methods of the prior art. (AEC)

  1. Grain alcohol study: summary

    Energy Technology Data Exchange (ETDEWEB)

    The study has concentrated upon a detailed examination of all considerations involved in the production, use, and marketing of ethyl alcohol (ethanol) as produced from the fermentation of agricultural grains. Each parameter was examined in the light of current energy markets and trends; new sources and technological, and processes for fermentation, the capability of the agricultural industry to support fermentation demand; the optimizaton of value of agricultural crops; and the efficiencies of combining related industries. Ahydrous (200 proof) ethanol makes an excellent blending component for all present automotive fuels and an excellent octane additive for unleaded fuels in proportions up to 35% without requiring modifications to current engines. There is no difference between ethanol produced by fermentation and ethanol produced synthetically from petroleum. The decision to produce ethanol one way or the other is purely economic. The agricultural industry can support a major expansion in the fermentation industry. The residue (distillers grains) from the fermentation of corn for ethanol is an excellent and economical feed for livestock and poultry. A reliable supply of distillers grain can assist in making the large beef feedlot operations more economically viable. The source materials, fuels, products and by-products of an ethanol plant, beef feedlot, gas biodigester plant, municipal waste recovery plant and a steam generated electrical plant are interrelated and mutually beneficial for energy efficiencies and economic gains when co-located. The study concludes that the establishment of such agricultural- environment industrial energy complexes, would provide a broad range of significant benefits to Indiana.

  2. Grain alcohol study: summary

    Energy Technology Data Exchange (ETDEWEB)

    The study has concentrated upon a detailed examination of all considerations involved in the production, use, and marketing of ethyl alcohol (Ethanol) as produced from the fermentation of agricultural grains. Each parameter was examined in the light of current energy markets and trends; new sources and technological, and processes for fermentation, the capability of the agricultural industry to support fermentaton demand; the optimization of value of agricultureal crops; and the efficiencies of combining related industries. Anhydrous (200 proof) ethanol makes an excellent blending component for all present automotive fuels and an excellent octane additive for unleaded fuels in proportions up to 35% without requiring modifications to current engines. There is no difference between ethanol produced by fermentation and ethanol produced synthetically from petroleum. The decision to produce ethanol one way or the other is purely economic. The agricultural industry can support a major expansion in the fermentation industry. The residue (distillers grains) from the fermentation of corn for ethanol is an excellent and economical feed for livestock and poultry. A reliable supply of distillers grains can assist in making the large beef feedlot operations more economically viable. The source materials, fuels, products and by-products of an ethanol plant, beef feedlot, gas biodigester plant, municipal waste recovery plant and a steam generated electrical plant are interrelated and mutually beneficial for energy efficiencies and economic gains when co-located. The study concludes that the establishment of such agricultural-environment industrial energy complexes, would provide a broad range of significant benefits to Indiana.

  3. Progress report on grain boundaries

    Science.gov (United States)

    Balluffi, R. W.; Bristowe, P. D.

    1989-06-01

    The research was focused on the following three major areas: (1) study of the atomic structure of grain boundaries by means of X-ray diffraction, transmission electron microscopy and computer modeling; (2) study of grain boundary phase transitions by electron microscopy and computer modeling; (3) investigation of the mechanism of high angle grain boundary migration. Results are briefly discussed.

  4. Progress report on grain boundaries

    Energy Technology Data Exchange (ETDEWEB)

    Balluffi, R.W.; Bristowe, P.D.

    1989-06-01

    The research was focused on the following three major areas: (1) study of the atomic structure of grain boundaries by means of x-ray diffraction, transmission electron microscopy and computer modeling; (2) study of grain boundary phase transitions by electron microscopy and computer modeling; (3) investigation of the mechanism of high angle grain boundary migration. Results are briefly discussed. 20 refs.

  5. Special Grain Boundaries in Ultrafine-Grained Tungsten

    Science.gov (United States)

    Dudka, O. V.; Ksenofontov, V. A.; Sadanov, E. V.; Starchenko, I. V.; Mazilova, T. I.; Mikhailovskij, I. M.

    2016-07-01

    Field ion microscopy and computer simulation were used for the study of an atomic structure high-angle grain boundary in hard-drawn ultrafine-grained tungsten wire. These boundaries with special misorientations are beyond the scope of the coincident site lattice model. It was demonstrated that the special non-coincident grain boundaries are the plane-matching boundaries, and rigid-body displacements of adjacent nanograins are normal to the misorientation axis. The vectors of rigid-body translations of grains are described by broad asymmetric statistical distribution. Mathematical modeling showed that special incommensurate boundaries with one grain oriented along the {211} plane have comparatively high cohesive energies. The grain-boundary dislocations ½ were revealed and studied at the line of local mismatch of {110} atomic planes of adjacent grains.

  6. Alternative grains in nutrition

    Directory of Open Access Journals (Sweden)

    Jevcsák Sz.

    2016-12-01

    Full Text Available Many people suffer from gluten sensitivity or gluten intolerance. They have to avoid or limit their gluten intake. Sorghum and millet are gluten-free cereals, wherefore persons with gluten sensitivity or gluten intolerance could consume them. Moreover, they have a lot of positive effects due to their phenolic compounds as phenol acid or flavonoid. Antioxidant activity in sorghum is especially high in comparison with other cereals. Our aim was to compare literature data about the chemical compositions of sorghum and millet with other grains.

  7. Evolution of Interstellar Grains

    Science.gov (United States)

    Allamandola, Lou J.; DeVincenzi, Donald L. (Technical Monitor)

    1998-01-01

    During the past two decades observations combined with laboratory simulations, have revolutionized our understanding of interstellar ice and dust, the raw materials from which planets, comets and stars form. Most interstellar material is concentrated in large molecular clouds where simple molecules are formed by dust-grain and gas-phase reactions. Gaseous species striking the cold (10K) dust stick, forming an icy grain mantle. This accretion, coupled with UV photolysis, produces a complex chemical mixture containing volatile, non-volatile, and isotopically fractionated species. Ices in molecular clouds contain the very simple molecules H2O, CH3OH, CO, CO2, H2, and perhaps some NH3 and H2CO, as well as more complex species. The evidence for these compounds, as well as carbon-rich materials, will be reviewed and the possible connections with comets and meteorites will be presented in the first part of the talk . The second part of the presentation will focus on interstellar/precometary ice photochemical evolution and the species likely to be found in comets. The chemical composition and photochemical evolution of realistic interstellar/pre-cometary ice analogs will be discussed. Ultraviolet photolysis of these ices produces H2, H2CO, CO2, CO, CH4, HCO, and more complex molecules. When ices representative of interstellar grains and comets are exposed to UV radiation at low temperature a series of moderately complex organic molecules are formed in the ice including: CH3CH2OH (ethanol), HC(=O)NH2 (formamide), CH3C(=O)NH2 (acetamide), and R-C=N (nitriles). Several of these are already known to be in the interstellar medium, and their presence indicates the importance of grain processing. After warming to room temperature an organic residue remains. This is composed primarily of hexamethylenetetramine (HMT, C6H12N4), with lesser amounts of polyoxymethylene-related species (POMs), amides, and ketones. This is in sharp contrast to the organic residues produced by

  8. Grain boundary melting in ice

    OpenAIRE

    Thomson, E. S.; Hansen-Goos, Hendrik; Wilen, L. A.; Wettlaufer, J. S.

    2012-01-01

    We describe an optical scattering study of grain boundary premelting in water ice. Ubiquitous long ranged attractive polarization forces act to suppress grain boundary melting whereas repulsive forces originating in screened Coulomb interactions and classical colligative effects enhance it. The liquid enhancing effects can be manipulated by adding dopant ions to the system. For all measured grain boundaries this leads to increasing premelted film thickness with increasing electrolyte concentr...

  9. PESTICIDES USE AMONG GRAIN MERCHANTS IN MUBI GRAIN ...

    African Journals Online (AJOL)

    AGROSEARCH UIL

    ABSTRACT. Food security in sub-Saharan Africa largely depends upon improved food productivity through the use of sustainable agricultural practices and the reduction of post-harvest losses caused by pests and diseases. This study was conducted in two major grain markets in Mubi to study pest control practices by grain ...

  10. Grain-filling, chlorophyll content in relation with grain yield ...

    African Journals Online (AJOL)

    The beginning of active phase of grain filling corresponded to the beginning of the degradation of chlorophyll content. The velocity of grain filling was negatively correlated to the number of days to heading (DH). Changes in photosynthesis most closely paralleled changes in chlorophyll content. All these changes occurred ...

  11. Substituting maize grain with barley grain in concentrates fed to ...

    African Journals Online (AJOL)

    The aim of the study was to determine the effect of substituting maize grain with barley grain in the diet of lactating Jersey cows grazing kikuyu-ryegrass pasture. Sixty Jersey cows were blocked in terms of number of days in milk, lactation number, milk yield and live weight and randomly assigned to one of five treatments (n ...

  12. Modelling of grain refinement driven by negative grain boundary energy

    Czech Academy of Sciences Publication Activity Database

    Fischer, F. D.; Zickler, G. A.; Svoboda, Jiří

    2017-01-01

    Roč. 97, č. 23 (2017), s. 1963-1977 ISSN 1478-6435 R&D Projects: GA ČR(CZ) GA15-06390S Institutional support: RVO:68081723 Keywords : grain refinement * grain nucleation * distribution concept * jump on distribution function Subject RIV: BJ - Thermodynamics Impact factor: 1.505, year: 2016

  13. The Antinutritional Components of Grains

    DEFF Research Database (Denmark)

    Madsen, Claus Krogh; Brinch-Pedersen, Henrik

    2016-01-01

    Grains provide humans and farmed animals with a very large proportion of the energy and macro- and micronutrients they need. Unfortunately, grains also contain compounds that interfere with the utilization of the nutrients by animals. These so-called antinutritionals may result in poor resource u...

  14. Methods of assessing grain-size distribution during grain growth

    DEFF Research Database (Denmark)

    Tweed, Cherry J.; Hansen, Niels; Ralph, Brian

    1985-01-01

    This paper considers methods of obtaining grain-size distributions and ways of describing them. In order to collect statistically useful amounts of data, an automatic image analyzer is used, and the resulting data are subjected to a series of tests that evaluate the differences between two related...... distributions (before and after grain growth). The distributions are measured from two-dimensional sections, and both the data and the corresponding true three-dimensional grain-size distributions (obtained by stereological analysis) are collected. The techniques described here are illustrated by reference...

  15. MATHEMATICAL MODEL OF GRAIN MICRONIZATION

    Directory of Open Access Journals (Sweden)

    V. A. Afanas’ev

    2014-01-01

    Full Text Available Summary. During micronisation grain moisture evaporates mainly in decreasing drying rate period. Grain layer located on the surface of the conveyor micronisers will be regarded as horizontal plate. Due to the fact that the micronisation process the surface of the grain evaporates little moisture (within 2-7 % is assumed constant plate thickness. Because in the process of micronization grain structure is changing, in order to achieve an exact solution of the equations necessary to take into account changes thermophysical, optical and others. Equation of heat transfer is necessary to add a term that is responsible for the infrared heating. Because of the small thickness of the grain, neglecting the processes occurring at the edge of the grain, that is actually consider the problem of an infinite plate. To check the adequacy of the mathematical model of the process of micronisation of wheat grain moisture content must be comparable to the function of time, obtained by solving the system of equations with the measured experimental data of experience. Numerical solution of a system of equations for the period of decreasing drying rate is feasible with the help of the Maple 14, substituting the values of the constants in the system. Calculation of the average relative error does not exceed 7- 10 %, and shows a good agreement between the calculated data and the experimental values.

  16. Grain mantles: The impact on grain evolution and selective extinction

    Science.gov (United States)

    Joseph, Charles L.

    1989-01-01

    Depletion studies are used to infer the presence of mantles and to constrain grain evolutionary models in the diffuse interstellar medium. The presence of these mantles appears to be important in the evolution of the grains inside diffuse as well as dense clouds. In dense clouds where the element-to-element abundances sometimes differ from those found in diffuse clouds, empirical relationships are starting to emerge between gas abundances and various types of peculiar selective extinction. These peculiar extinction curves may be the results of nonvolatile mantle formation on grain cores or may reflect chemical differences due to variations in the intrinsic metalicity from one cloud to another. A simple model of the time evolution of a parcel of gas and dust as observed by the depletion of two elements is presented. Different studies of grain evolution and selective extinction are discussed and compared.

  17. Properties of ultrasmall superconducting grains

    CERN Document Server

    Lorenzo, A D; Fazio, R; Giaquinta, G; Mastellone, A; Hekking, F W J

    1999-01-01

    We briefly review some properties of ultrasmall superconducting grains. The ground state and the first excited states of the grains are analyzed by studying the parity gap and the spectroscopic gap. Both quantities turn out to be parity dependent and universal functions of the ratio between the level spacing and the BCS gap, delta/DELTA. pairing correlations show up also in the thermodynamic quantities. The presence of a BCS interaction is responsible for an anomaly in the spin susceptibility as a function of temperature. This anomaly persists also in very small grains.

  18. Red grain mycetoma foot in Western Rajasthan

    OpenAIRE

    Mathur D; Prakash Prabhu; Gupta P; Purohit Asha; Vyas MCR

    1994-01-01

    Usually the colour of the grains seen in cases of mycetoma are either black or yellow. Recently there were reports that unusual red grains had been noticed in cases of mycetoma. A case of red grain mycetoma is reported.

  19. Grain boundary melting in ice

    Science.gov (United States)

    Thomson, E. S.; Hansen-Goos, Hendrik; Wettlaufer, J. S.; Wilen, L. A.

    2013-03-01

    We describe an optical scattering study of grain boundary premelting in water ice. Ubiquitous long ranged attractive polarization forces act to suppress grain boundary melting whereas repulsive forces originating in screened Coulomb interactions and classical colligative effects enhance it. The liquid enhancing effects can be manipulated by adding dopant ions to the system. For all measured grain boundaries this leads to increasing premelted film thickness with increasing electrolyte concentration. Although we understand that the interfacial surface charge densities qs and solute concentrations can potentially dominate the film thickness, we cannot directly measure them within a given grain boundary. Therefore, as a framework for interpreting the data we consider two appropriate qs dependent limits; one is dominated by the colligative effect and other is dominated by electrostatic interactions.

  20. Dense, finely, grained composite materials

    Science.gov (United States)

    Dunmead, Stephen D.; Holt, Joseph B.; Kingman, Donald D.; Munir, Zuhair A.

    1990-01-01

    Dense, finely grained composite materials comprising one or more ceramic phase or phase and one or more metallic and/or intermetallic phase or phases are produced by combustion synthesis. Spherical ceramic grains are homogeneously dispersed within the matrix. Methods are provided, which include the step of applying mechanical pressure during or immediately after ignition, by which the microstructures in the resulting composites can be controllably selected.

  1. Cereal grains, legumes and diabetes.

    Science.gov (United States)

    Venn, B J; Mann, J I

    2004-11-01

    This review examines the evidence for the role of whole grain foods and legumes in the aetiology and management of diabetes. MedLine and SilverPlatter ('Nutrition' and 'Food Science FSTA') databases were searched to identify epidemiological and experimental studies relating to the effects of whole grain foods and legumes on indicators of carbohydrate metabolism. Epidemiological studies strongly support the suggestion that high intakes of whole grain foods protect against the development of type II diabetes mellitus (T2DM). People who consume approximately 3 servings per day of whole grain foods are less likely to develop T2DM than low consumers (grains of potential benefit to glycaemic control including slow release carbohydrate and a high fibre content. A substantial increase in dietary intake of legumes as replacement food for more rapidly digested carbohydrate might therefore be expected to improve glycaemic control and thus reduce incident diabetes. This is consistent with the results of dietary intervention studies that have found improvements in glycaemic control after increasing the dietary intake of whole grain foods, legumes, vegetables and fruit. The benefit has been attributed to an increase in soluble fibre intake. However, prospective studies have found that soluble fibre intake is not associated with a lower incidence of T2DM. On the contrary, it is cereal fibre that is largely insoluble that is associated with a reduced risk of developing T2DM. Despite this, the addition of wheat bran to the diets of diabetic people has not improved indicators of glycaemic control. These apparently contradictory findings might be explained by metabolic studies that have indicated improvement in glucose handling is associated with the intact structure of food. For both grains and legumes, fine grinding disrupts cell structures and renders starch more readily accessible for digestion. The extent to which the intact structure of grains and legumes or the composition of

  2. Spinodal decomposition in fine grained materials

    Indian Academy of Sciences (India)

    Unknown

    A-rich grain boundary layer followed by a B-rich layer; the grain interior exhibits a spinodally decomposed microstructure, evolving slowly. Further, grain growth is suppressed completely during the decomposition process. Keywords. Spinodal decomposition; grain boundary effects; phase field models. 1. Introduction.

  3. Sticking properties of ice grains

    Science.gov (United States)

    Jongmanns, M.; Kumm, M.; Wurm, G.; Wolf, D. E.; Teiser, J.

    2017-06-01

    We study the size dependence of pull-off forces of water ice in laboratory experiments and numerical simulations. To determine the pull-off force in our laboratory experiments, we use a liquid nitrogen cooled centrifuge. Depending on its rotation frequency, spherical ice grains detach due to the centrifugal force which is related to the adhesive properties. Numerical simulations are conducted by means of molecular dynamics simulations of hexagonal ice using a standard coarse-grained water potential. The pull-off force of a single contact between two spherical ice grains is measured due to strain controlled simulations. Both, the experimental study and the simulations reveal a dependence between the pull-off force and the (reduced) particle radii, which differ significantly from the linear dependence of common contact theories.

  4. Sticking properties of ice grains

    Directory of Open Access Journals (Sweden)

    Jongmanns M.

    2017-01-01

    Full Text Available We study the size dependence of pull-off forces of water ice in laboratory experiments and numerical simulations. To determine the pull-off force in our laboratory experiments, we use a liquid nitrogen cooled centrifuge. Depending on its rotation frequency, spherical ice grains detach due to the centrifugal force which is related to the adhesive properties. Numerical simulations are conducted by means of molecular dynamics simulations of hexagonal ice using a standard coarse-grained water potential. The pull-off force of a single contact between two spherical ice grains is measured due to strain controlled simulations. Both, the experimental study and the simulations reveal a dependence between the pull-off force and the (reduced particle radii, which differ significantly from the linear dependence of common contact theories.

  5. Pesticides Use among Grain Merchants in Mubi Grain Markets of ...

    African Journals Online (AJOL)

    It is, therefore, recommended that farmers, retailers, distributors and all the pesticide workers should undergo regular training/workshop on the use and safety measures of pesticides. Also multimedia awareness activities in local language should be massively conducted. Key words: Pesticides, food security, grain merchants ...

  6. Why Is It Important to Eat Grains, Especially Whole Grains?

    Science.gov (United States)

    ... and folate), and minerals ( iron , magnesium , and selenium). Dietary fiber from whole grains or other foods, may help reduce blood cholesterol levels and may lower risk of heart disease, obesity, and type 2 diabetes. Fiber is important for proper bowel function. It ...

  7. 75 FR 81965 - Grain Inspection Advisory Committee Reestablishment

    Science.gov (United States)

    2010-12-29

    ... Grain Inspection, Packers and Stockyards Administration Grain Inspection Advisory Committee Reestablishment AGENCY: Grain Inspection, Packers and Stockyards Administration, USDA. ACTION: Notice to... Grain Inspection, Packers and Stockyards Administration (GIPSA) Grain Inspection Advisory Committee...

  8. NUTRITIONAL CHARACTERIZATION OF GRAIN AMARANTH ...

    African Journals Online (AJOL)

    IBUKUN

    season. With a toasted flavor similar to popcorn when cooked, amaranth seeds are small in size but a good source of carbohydrate and protein (15-17 percent by weight). It is rich in the amino acids methionine, cycteine and has the highest content of lysine compared with all grains. It also has three times the fiber of wheat.

  9. Plant growth responses to elevated atmospheric CO2 are increased by phosphorus sufficiency but not by arbuscular mycorrhizas

    DEFF Research Database (Denmark)

    Jakobsen, Iver; Smith, Sally E.; Smith, F. Andrew

    2016-01-01

    ) symbiosis in Medicago truncatula and Brachypodium distachyon grown under the same conditions. The focus was on eCO2 effects on vegetative growth, efficiency in acquisition and use of P, and expression of phosphate transporter (PT) genes. Growth responses to eCO2 were positive at P sufficiency, but under low...

  10. Protein (Viridiplantae): 357135950 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 024:4077 3398:4077 4447:6301 4734:6301 38820:6301 4479:6301 359160:5167 147368:5263 147385:5263 15367:5263 15368:5263 PREDICTED: becl...in-1-like protein-like Brachypodium distachyon MKPKAAGGGGDKGRGVDPSLPRFKCQECHRALVVIG

  11. A synteny-based draft genome sequence of the forage grass Lolium perenne

    DEFF Research Database (Denmark)

    Byrne, Stephen; Nagy, Istvan; Pfeifer, Matthias

    2015-01-01

    Here we report the draft genome sequence of perennial ryegrass (Lolium perenne), an economically important forage and turf grass species that is widely cultivated in temperate regions worldwide. It is classified along with wheat, barley, oats and Brachypodium distachyon in the Pooideae sub...

  12. Protein (Viridiplantae): 357154578 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 024:2267 3398:2267 4447:1254 4734:1254 38820:1254 4479:1254 359160:945 147368:917 147385:917 15367:917 15368:917 PREDICTED: LOW QUALI...TY PROTEIN: serine/threonine-protein kinase Nek6-like Brachypodium distachyon MRPAA

  13. Protein (Viridiplantae): 357134432 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 8024:5377 3398:5377 4447:5981 4734:5981 38820:5981 4479:5981 359160:5029 147368:5115 147385:5115 15367:5115 15368:5115 PREDICTED: bor...on transporter 4-like Brachypodium distachyon MEHKKTLFKGVIEDFRGRAACYKQDWHNGFSSGFRIL

  14. Protein (Viridiplantae): 357135844 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 8024:5377 3398:5377 4447:5981 4734:5981 38820:5981 4479:5981 359160:5029 147368:5115 147385:5115 15367:5115 15368:5115 PREDICTED: bor...on transporter 4-like Brachypodium distachyon MDLLRNPFKGVVADVKGRASWYKDDWVAGLRAGFRIL

  15. Concepts on Low Temperature Mechanical Grain Growth

    Energy Technology Data Exchange (ETDEWEB)

    Sharon, John Anthony [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States). Metallurgy and Materials Joining Dept.; Boyce, Brad Lee [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States). Metallurgy and Materials Joining Dept.

    2013-11-01

    In metals, as grain size is reduced below 100nm, conventional dislocation plasticity is suppressed resulting in improvements in strength, hardness, and wears resistance. Existing and emerging components use fine grained metals for these beneficial attributes. However, these benefits can be lost in service if the grains undergo growth during the component’s lifespan. While grain growth is traditionally viewed as a purely thermal process that requires elevated temperature exposure, recent evidence shows that some metals, especially those with nanocrystalline grain structure, can undergo grain growth even at room temperature or below due to mechanical loading. This report has been assembled to survey the key concepts regarding how mechanical loads can drive grain coarsening at room temperature and below. Topics outlined include the atomic level mechanisms that facilitate grain growth, grain boundary mobility, and the impact of boundary structure, loading scheme, and temperature.

  16. Grain centre mapping - 3DXRD measurements of average grain characteristics

    DEFF Research Database (Denmark)

    Oddershede, Jette; Schmidt, Søren; Lyckegaard, Allan

    2014-01-01

    Three-Dimensional X-ray Diraction (3DXRD) Microscopy is a generic term covering a variety of dierent techniques for characterising the mi- crostructure within the bulk of polycrystalline materials. One strategy | namely grain centre mapping | enables fast measurements of the av- erage characteris......Three-Dimensional X-ray Diraction (3DXRD) Microscopy is a generic term covering a variety of dierent techniques for characterising the mi- crostructure within the bulk of polycrystalline materials. One strategy | namely grain centre mapping | enables fast measurements of the av- erage...... and the closely related boxscan method is given. Both validation experiments and applications for in situ studies of microstructural changes during plastic deformation and crack growth are given. Finally an outlook with special emphasis on coupling the measured results with modelling is given....

  17. Emission of dislocations from grain boundaries by grain boundary dissociation

    Science.gov (United States)

    Hoagland, Richard G.; Valone, Steven M.

    2015-01-01

    In this article, we examine the conditions that favour the emission of Shockley partial dislocations (SPDs) that standoff from a grain boundary (GB) plane by a few lattice parameters as part of the atomic structure of some GBs. To do so, we consider GBs to be formed by the operation of arrays of intrinsic grain boundary dislocations (GBDs) that create the tilt and twist misorientation, and the lattice mismatch between the two crystal grains adjoining the GB. The conditions to be considered that favour SPDs are the following: (1) Frank's rule, (2) the proper sequential arrangement of partial dislocations to bound an intrinsic stacking fault and (3) the equilibrium stand-off distance (ESD). We apply an isotropic elasticity analysis to compute the ESD, in the absence of an applied stress, for SPDs emerging from asymmetric tilt GBs in two FCC metals, Cu and Al. The ESD is shown to be dependent on the glide plane orientation relative to the GB plane and on the position of the glide planes, relative to the position of the GBDs. An applied stress increases the ESD up to a critical stress that removes the SPDs without limit from the GB. We examine the effect of the stacking fault energy on the ESD and critical stress. The critical stress is effectively linearly dependent on the stacking fault energy. Finally, we present results of atomistic simulations of asymmetric tilt Σ11[1 0 1]{4 1 4}||{2 5 2} GBs in Cu bicrystal models subject to shock loading that behave in a manner similar to the elasticity predictions. The atomistic simulations reveal additional behaviour associated with elastic incompatibility between the two grains in the bicrystal models.

  18. Molecule Formation on Interstellar Grains

    Science.gov (United States)

    Vidali, G.

    2011-05-01

    The first experiments that were expressively designed to be applicable to hydrogen formation reactions in the ISM measured the efficiency of formation of molecular hydrogen on a polycrystalline olivine (Pirronello et al. (1997a)). It soon turned out that more was needed, and research began on the mechanism of reaction, on the in uence of the surface morphology, and on the excitation of the just- ormed molecule. In this review, I summarize what we learned from these and other experiments, and where more work is needed: in the elementary steps of reaction, in the bridging of the laboratory-ISM gap (large ux/large surface - small ux/small grain) using simulations, and in using realistic samples of dust grains. Understanding what experiments can and cannot deliver will help in designing and targeting observations, and vice-versa.

  19. Crop rotations for grain production

    OpenAIRE

    Olesen, Jørgen E.; Rasmussen, Ilse Ankær; Askegaard, Margrethe

    2000-01-01

    There is an increasing demand for organically grown cereal grains in Denmark, which is expected to cause a change in the typical organic farm structure away from dairy farming and towards arable farming. Such a change may reduce the stability of the farming systems, because of decreasing soil fertility and problems with weed control. There have only been a limited number of studies under temperate conditions in Europe and North America, where different crop rotations have been compared under ...

  20. Structure and properties of grain boundaries

    Science.gov (United States)

    Balluffi, R. W.; Bristowe, P. D.

    1984-03-01

    Results were obtained in the following areas: determination of relative grain boundary energies by the rotating crystallite method; simple structural unit model for core dependent properties of tilt boundaries; twist boundary energies for metals with long ranged pairwise interatomic potentials; structural unit/grain boundary dislocation model for grain boundary structure; detection of expansion of boundaries using diffraction; effect of secondary relaxations on diffraction from high-(SIGMA) 001 twist boundaries; and mechanism of grain boundary migration.

  1. Effect of Transplanting Times on Rate and Duration of Grain Filling, Final Grain Weight and Grain Yield of Rice Cultivars

    Directory of Open Access Journals (Sweden)

    A. Vahdati-Rad

    2016-05-01

    Full Text Available In order to investigate the effects of temperature and radiation on rate and duration of grain filling and final grain weight in rice cultivars, a split plot experiment based on randomized complete block design with three replications was conducted at different transplanting times at the research field of University of Guilan, Rasht, Iran in 2013. Factors were: transplanting dates in main plots (5 May, 20 May and 5 June and rice cultivars (Hashemi, Ali Kazemi, Sangejo, Khazar, Dorfak and Gouhar in sub plots. The greatest grain weight (31.9 mg was obtained in Gouhar at 20 May and the smallest grain weight (20.4 mg was observed in Sangejo at 5 June transplanting dates. The longest effective filling period (32.9 days was achieved in Gouhar at 5 May transplanting date and the shortest grain filling duration (13.9 days was obtained in Hashemi. The greatest grain filling rate (1.62 mg day-1 was obtained in the Hashemi and the smallest rate (0.92 mg day-1 was observed in Gouhar. Significant correlations were observed between cumulative temperature and radiation with final grain weight (R = 0.689. There were significant and positive correlations between the cumulative temperature and irradiance with grain filling duration, in contrary to negative correlations with grain filling rate and grain filling period. The results of this experiment showed that the grain filling duration plays a greater role, than grain filling rate, in determination of the grain weight. It could be concluded that an early transplanting (5 May brings about favorable temperature and radiation conditions for an appropriate grain filling period and a greater final grain weight.

  2. Small grains and IRAS colors

    Science.gov (United States)

    Boulanger, F.; Beichman, C.; Helou, G.; Desert, F. X.; Perault, M.

    1988-01-01

    The paper studies how infrared colors of dust emission from the interstellar medium vary with the energy density of the radiation field on the basis of IRAS observation of the California Nebula. The data suggest that color variations result from a combinatin of equilibrium emission from large grains, and nonequilibrium emission from small grains, with destruction of the small grains emitting at 12 microns at high energy density; it is estimated that 80 percent of these small particles are destroyed for an energy density in ultraviolet photons larger than 50 times that of the average interstellar radiation field in the solar neighborhood. In a color-color diagram, I(v)(60 microns)/I(v)(100 microns) versus I(v)(12 microns)/I(v)(25 microns), the California Nebula measurements at various distances to the ionizing star Zeta Per follow a sequence similar to that of galaxies. This result shows that the position of a galaxy along this sequence is a measure of the intensity of the radiation field in the regions responsible for the infrared emission.

  3. Grain Boundary Energies in Copper.

    Science.gov (United States)

    Omar, Ramli

    Available from UMI in association with The British Library. Requires signed TDF. The dependence of grain boundary energy on boundary orientation was studied in copper annealed at 1000 ^circC. Grain boundary orientations and the disorientations across the boundaries were measured. A rotation matrix notation is used to interpret selected area electron channelling patterns observed in a scanning electron microscope. The Herring and Shewmon torque terms were investigated using wire specimens having a "bamboo" structure. The Herring torque terms were determined using the Hess relation. The (110) section of the Sigma 11 gamma-plot (i.e. the variation of grain boundary energy with boundary orientation) was evaluated. In this plot, minima in energies were found at the (311) and (332) mirror planes. Sigma 3 and Sigma9 boundaries were investigated in sheet specimens. The (110) and (111) sections of the Sigma3 gamma -plot were evaluated. In addition to the sharp cusps occurring at the Sigma3 {111} planes, the further shallower cusps occur at the incoherent Sigma 3 boundaries with the interfacial planes approximately parallel to {322} in one crystal and {11.44} in the other crystal. Flat and curved Sigma9 boundaries were investigated. The break up of Sigma9 boundaries into two Sigma3 boundaries and the relation between the Sigma3 and Sigma 9 gamma-plots was also examined. The (110) section of the Sigma9 gamma-plot was constructed.

  4. Red grain mycetoma foot in Western Rajasthan

    Directory of Open Access Journals (Sweden)

    Mathur D

    1994-01-01

    Full Text Available Usually the colour of the grains seen in cases of mycetoma are either black or yellow. Recently there were reports that unusual red grains had been noticed in cases of mycetoma. A case of red grain mycetoma is reported.

  5. Structure and chemistry of the sorghum grain

    Science.gov (United States)

    Sorghum is grown around the world and often under harsh and variable environmental conditions. Combined with the high degree of genetic diversity present in sorghum, this can result in substantial variability in grain composition and grain quality. While similar to other cereal grains such as maize ...

  6. Bioactive compounds in whole grain wheat

    NARCIS (Netherlands)

    Mateo Anson, N.

    2010-01-01

    Bread can be healthier! Consuming whole-grain foods can prevent cardiovascular diseases, type-2 diabetes and metabolic syndrome. This is due to bioactive compounds in whole grain, such as antioxidants and anti-inflammatory compounds. We found that the different fractions of a wheat grain vary much

  7. Determination of grain boundary geometry using TEM

    NARCIS (Netherlands)

    Jang, H.; Farkas, D.; Hosson, J.T.M. De

    An experimental method to obtain the grain boundary geometry using the transmission electron microscope is presented. The method allows Σ determination including grain boundary plane orientation. In order to determine the specialness of the grain boundary, three different criteria for maximum

  8. Grain-size sorting and slope failure in experimental subaqueous grain flows

    NARCIS (Netherlands)

    Kleinhans, M.G.; Asch, Th.W.J. van

    2005-01-01

    Grain-size sorting in subaqueous grain flows of a continuous range of grain sizes is studied experimentally with three mixtures. The observed pattern is a combination of stratification and gradual segregation. The stratification is caused by kinematic sieving in the grain flow. The segregation is

  9. Ferroelectric domain continuity over grain boundaries

    DEFF Research Database (Denmark)

    Mantri, Sukriti; Oddershede, Jette; Damjanovic, Dragan

    2017-01-01

    Formation and mobility of domain walls in ferroelectric materials is responsible for many of their electrical and mechanical properties. Domain wall continuity across grain boundaries has been observed since the 1950's and is speculated to affect the grain boundary-domain interactions, thereby...... orientation. We have also incorporated the effect of grain boundary ferroelectric polarization charge created when any two domains meet at the grain boundary plane. The probability of domain wall continuity for three specific grain misorientations is studied. Use of this knowledge to optimize processing...

  10. Grain storage at farm and warehouses level

    Directory of Open Access Journals (Sweden)

    Neacşu, A. N.

    2010-12-01

    Full Text Available Grain storage is very important because the quality of flour obtained from grain will be found in the finished products’ quality. Grains must be stored in well established conditions regarding temperature, humidity, airflow, trying to avoid the risk of being attacked by rodents and insects. If these conditions are not complied with, some qualitative deficits of the grains - such as mould at pH, infestation, fermentation etc. - may appear. The storage methods are those responsible for maintaining a good quality of the grains.

  11. Barnett relaxation in non-symmetric grains

    Science.gov (United States)

    Kolasi, Erald; Weingartner, Joseph C.

    2017-10-01

    Barnett relaxation, first described by Purcell in 1979, appears to play a major role in the alignment of grains with the interstellar magnetic field. In 1999, Lazarian and Draine proposed that Barnett relaxation and its relative, nuclear relaxation, can induce grains to flip. If this thermal flipping is rapid then the dynamical effect of torques that are fixed relative to the grain body can be greatly reduced. To date, detailed studies of Barnett relaxation have been confined to grains exhibiting dynamic symmetry. In 2009, Weingartner argued that internal relaxation cannot induce flips in any grains, whether they exhibit dynamic symmetry or not. In this work, we develop approximate expressions for the dissipation rate and diffusion coefficient for Barnett relaxation. We revisit the issue of internally induced thermal flipping, finding that it cannot occur for grains with dynamic symmetry, but does occur for grains lacking dynamic symmetry.

  12. Whole grains and health: from theory to practice--highlights of The Grains for Health Foundation's Whole Grains Summit 2012.

    Science.gov (United States)

    McKeown, Nicola M; Jacques, Paul F; Seal, Chris J; de Vries, Jan; Jonnalagadda, Satya S; Clemens, Roger; Webb, Densie; Murphy, Lee Anne; van Klinken, Jan-Willem; Topping, David; Murray, Robyn; Degeneffe, Dennis; Marquart, Leonard F

    2013-05-01

    The Grains for Health Foundation's Whole Grains Summit, held May 19-22, 2012 in Minneapolis, was the first meeting of its kind to convene >300 scientists, educators, food technologists, grain breeders, food manufacturers, marketers, health professionals, and regulators from around the world. Its goals were to identify potential avenues for collaborative efforts and formulate new approaches to whole-grains research and health communications that support global public health and business. This paper summarizes some of the challenges and opportunities that researchers and nutrition educators face in expanding the knowledge base on whole grains and health and in translating and disseminating that knowledge to consumers. The consensus of the summit was that effective, long-term, public-private partnerships are needed to reach across the globe and galvanize the whole-grains community to collaborate effectively in translating whole-grains science into strategies that increase the availability and affordability of more healthful, grain-based food products. A prerequisite of that is the need to build trust among diverse multidisciplinary professionals involved in the growing, producing, marketing, and regulating of whole-grain products and between the grain and public health communities.

  13. 77 FR 76452 - Grain Inspection Advisory Committee Reestablishment

    Science.gov (United States)

    2012-12-28

    ... Doc No: 2012-31281] DEPARTMENT OF AGRICULTURE Grain Inspection, Packers and Stockyards Administration Grain Inspection Advisory Committee Reestablishment AGENCY: Grain Inspection, Packers and Stockyards... of Agriculture has reestablished the Grain Inspection, Packers and Stockyards Administration (GIPSA...

  14. DEVELOPMENT OF GRAIN MARKET IN UKRAINE

    Directory of Open Access Journals (Sweden)

    Aleksandr Maslak

    2015-11-01

    Full Text Available The subject of the research is a set of theoretical, methodological and practical fundamentals of organizational and economic functioning are integrated agricultural formations in the grain market of Ukraine. The methodological basis of research is the complex analysis of economic processes in the grain market in Ukraine and the world. During research we used such methods as method of systematization and comparison, statistic, economic, balance, constructive, target-oriented, and the methods of induction and deduction, analogy and comparison. Main aim of this article is the analysis of the situation on the grain market in Ukraine, defining the role of integrated agricultural formations in this market, improving the organizational-economic mechanism of its functioning, identifies ways of improving the competitiveness of Ukraine among world exporters of grain. Using results of the studies we examined trends grain market in Ukraine; influence of businesses in grain production; analysis of constraints to improve production efficiency of grain; defined domestic (internal needs of grain in Ukraine; assessed the status and expediency transformation infrastructure of the grain market of Ukraine; defined priority directions of development of the grain market in Ukraine. As a result of the preparation of articles, it is obtained the following conclusions: Ukraine is the world's largest producers and exporters of grain, the production of integrated agricultural units to a third of the total grain; technical condition of farm does not meet the needs of production; the domestic market is unable to provide the existing demand for grain production, contributing to export growth; Ukraine has a number of problems due to increased grain production, namely the shortage of storage capacity for the storage of grain, limited performance transshipment of grain in port elevators and imperfection and depreciation of transport systems; solving the existing problems is

  15. Coarse-graining complex dynamics

    DEFF Research Database (Denmark)

    Sibani, Paolo

    2013-01-01

    Continuous Time Random Walks (CTRW) are widely used to coarse-grain the evolution of systems jumping from a metastable sub-set of their configuration space, or trap, to another via rare intermittent events. The multi-scaled behavior typical of complex dynamics is provided by a fat-tailed distribu......Continuous Time Random Walks (CTRW) are widely used to coarse-grain the evolution of systems jumping from a metastable sub-set of their configuration space, or trap, to another via rare intermittent events. The multi-scaled behavior typical of complex dynamics is provided by a fat......-tailed distribution of the waiting time between consecutive jumps. We first argue that CTRW are inadequate to describe macroscopic relaxation processes for three reasons: macroscopic variables are not self-averaging, memory effects require an all-knowing observer,and different mechanisms whereby the jumps affect......: while CTRW make use of a renewal process involving identical traps of infinite size, RD embodies a dynamical entrenchment into a hierarchy of traps which are finite in size and possess different degrees of meta-stability. We show in particular how RD produces the stretched exponential, power...

  16. Contribution of grain boundary related strain accommodation to deformation of ultrafine-grained palladium

    Energy Technology Data Exchange (ETDEWEB)

    Ivanisenko, Yu., E-mail: julia.ivanisenko@kit.edu [Karlsruhe Institute of Technology, Institute of Nanotechnology, Hermann-von-Helmholtz-Platz 1, 76344 Eggenstein-Leopoldshafen (Germany); Enikeev, N.A. [Institute of Physics of Advanced Materials, Ufa State Aviation Technical University, K. Marx Str. 12, 450000 Ufa (Russian Federation); Laboratory for Mechanics of Bulk Nanostructured Materials, Saint Petersburg State University, Universitetsky Prospekt 28, Peterhof, 198504 Saint Petersburg (Russian Federation); Yang, K. [Robert Bosch GmbH, AE/EAI2, D71701 Schwieberdingen (Germany); Smoliakov, A.; Soloviev, V.P. [Russian Federal Nuclear Center All-Russian Research Institute of Experimental Physics (VNIIEF), Mira Ave, 37, 607188 Sarov (Russian Federation); Fecht, H. [Institut für Mikro, und Nanomaterialien, Universität Ulm, D-89081 Ulm (Germany); Hahn, H. [Karlsruhe Institute of Technology, Institute of Nanotechnology, Hermann-von-Helmholtz-Platz 1, 76344 Eggenstein-Leopoldshafen (Germany); KIT-TUD Joint Research Laboratory Nanomaterials, Technische Universität Darmstadt, D-64287 Darmstadt (Germany)

    2016-06-21

    Ultrafine-grained Pd specimens with a mean grain size of 130 nm were compressed by 10% in a scanning electron microscope and the strain-induced change in orientations of grains was measured by in-situ electron-backscattering diffraction. A comparison of grain orientations before and after compression straining revealed substantial grain rotations. The analysis of the results performed using polycrystal plasticity simulation showed that the variation of orientations with strain cannot be explained only by crystallographic dislocation slip. A large portion of strain is proved to be accommodated via cooperative non-crystallographic grain rotation.

  17. Grain size distribution in sheared polycrystals

    Science.gov (United States)

    Sarkar, Tanmoy; Biswas, Santidan; Chaudhuri, Pinaki; Sain, Anirban

    2017-12-01

    Plastic deformation in solids induced by external stresses is of both fundamental and practical interest. Using both phase field crystal modeling and molecular dynamics simulations, we study the shear response of monocomponent polycrystalline solids. We subject mesocale polycrystalline samples to constant strain rates in a planar Couette flow geometry for studying its plastic flow, in particular its grain deformation dynamics. As opposed to equilibrium solids where grain dynamics is mainly driven by thermal diffusion, external stress/strain induce a much higher level of grain deformation activity in the form of grain rotation, coalescence, and breakage, mediated by dislocations. Despite this, the grain size distribution of this driven system shows only a weak power-law correction to its equilibrium log-normal behavior. We interpret the grain reorganization dynamics using a stochastic model.

  18. Contour fractal analysis of grains

    Science.gov (United States)

    Guida, Giulia; Casini, Francesca; Viggiani, Giulia MB

    2017-06-01

    Fractal analysis has been shown to be useful in image processing to characterise the shape and the grey-scale complexity in different applications spanning from electronic to medical engineering (e.g. [1]). Fractal analysis consists of several methods to assign a dimension and other fractal characteristics to a dataset describing geometric objects. Limited studies have been conducted on the application of fractal analysis to the classification of the shape characteristics of soil grains. The main objective of the work described in this paper is to obtain, from the results of systematic fractal analysis of artificial simple shapes, the characterization of the particle morphology at different scales. The long term objective of the research is to link the microscopic features of granular media with the mechanical behaviour observed in the laboratory and in situ.

  19. World grain takes a spill.

    Science.gov (United States)

    Brown, L R

    1992-01-01

    World grain production decreased 5% in 1991, which combined with the 90 million in population increase resulted in a 6.4% decline/person. This is the largest drop ever recorded. Currently world production is off 9% from the all time high in 1984 of 757 pounds/person. There are many signs that this trend will continue. Soil erosion continues to decrease the amount of available farm land, irrigation water logs fields, deforestation and desertification, air pollution, acid rain and increased ultra violet light form depleting ozone are all adding to the problem. Currently in the US 28 million acres idle as part of commodity supply management and 34 million acres are designated threatened and are in Conservation Reserve. However, even with this area put into production, the total area worldwide is still smaller than it was in 1984.

  20. Contour fractal analysis of grains

    Directory of Open Access Journals (Sweden)

    Guida Giulia

    2017-01-01

    Full Text Available Fractal analysis has been shown to be useful in image processing to characterise the shape and the grey-scale complexity in different applications spanning from electronic to medical engineering (e.g. [1]. Fractal analysis consists of several methods to assign a dimension and other fractal characteristics to a dataset describing geometric objects. Limited studies have been conducted on the application of fractal analysis to the classification of the shape characteristics of soil grains. The main objective of the work described in this paper is to obtain, from the results of systematic fractal analysis of artificial simple shapes, the characterization of the particle morphology at different scales. The long term objective of the research is to link the microscopic features of granular media with the mechanical behaviour observed in the laboratory and in situ.

  1. Supercube grains leading to a strong cube texture and a broad grain size distribution after recrystallization

    DEFF Research Database (Denmark)

    Lin, F.X.; Zhang, Y. B.; Pantleon, W.

    2015-01-01

    growth rates. However, most other cube grains do not grow preferentially. Because of the few supercube grains, the grain size distribution after recrystallization is broad. Reasons for the higher growth rates of supercube grains are discussed, and are related to the local deformed microstructure.......This work revisits the classical subject of recrystallization of cold-rolled copper. Two characterization techniques are combined: three-dimensional X-ray diffraction using synchrotron X-rays, which is used to measure the growth kinetics of individual grains in situ, and electron backscatter...... diffraction, which is used for statistical analysis of the microstructural evolution. As the most striking result, the strong cube texture after recrystallization is found to be related to a few super large cube grains, which were named supercube grains. These few supercube grains become large due to higher...

  2. Grain Unloading of Arsenic Species in Rice

    Energy Technology Data Exchange (ETDEWEB)

    Carey, Anne-Marie; Scheckel, Kirk G.; Lombi, Enzo; Newville, Matt; Choi, Yongseong; Norton, Gareth J.; Charnock, John M.; Feldmann, Joerg; Price, Adam H.; Meharg, Andrew A. (EPA); (U. South Australia); (Manchester); (Aberdeen); (UC)

    2010-01-11

    Rice (Oryza sativa) is the staple food for over half the world's population yet may represent a significant dietary source of inorganic arsenic (As), a nonthreshold, class 1 human carcinogen. Rice grain As is dominated by the inorganic species, and the organic species dimethylarsinic acid (DMA). To investigate how As species are unloaded into grain rice, panicles were excised during grain filling and hydroponically pulsed with arsenite, arsenate, glutathione-complexed As, or DMA. Total As concentrations in flag leaf, grain, and husk, were quantified by inductively coupled plasma mass spectroscopy and As speciation in the fresh grain was determined by x-ray absorption near-edge spectroscopy. The roles of phloem and xylem transport were investigated by applying a {+-} stem-girdling treatment to a second set of panicles, limiting phloem transport to the grain in panicles pulsed with arsenite or DMA. The results demonstrate that DMA is translocated to the rice grain with over an order magnitude greater efficiency than inorganic species and is more mobile than arsenite in both the phloem and the xylem. Phloem transport accounted for 90% of arsenite, and 55% of DMA, transport to the grain. Synchrotron x-ray fluorescence mapping and fluorescence microtomography revealed marked differences in the pattern of As unloading into the grain between DMA and arsenite-challenged grain. Arsenite was retained in the ovular vascular trace and DMA dispersed throughout the external grain parts and into the endosperm. This study also demonstrates that DMA speciation is altered in planta, potentially through complexation with thiols.

  3. O(minus 2) grain boundary diffusion and grain growth in pure dense MgO

    Science.gov (United States)

    Kapadia, C. M.; Leipold, M. H.

    1973-01-01

    Grain growth behavior in fully dense compacts of MgO of very high purity was studied, and the results compared with other similar behaving materials. The activation energy for the intrinsic self-diffusion of Mg(2minus) is discussed along with the grain boundary diffusion of O(2minus). Grain boundary diffusion of O(2minus) is proposed as the controlling mechanism for grain growth.

  4. Plagioclase-Rich Itokawa Grains: Space Weathering, Exposure Ages, and Comparison to Lunar Soil Grains

    Science.gov (United States)

    Keller, L. P.; Berge, E.

    2017-01-01

    Regolith grains returned by the Hayabusa mission to asteroid 25143 Itokawa provide the only samples currently available to study the interaction of chondritic asteroidal material with the space weathering environment. Several studies have documented the surface alterations observed on the regolith grains, but most of these studies involved olivine because of its abundance. Here we focus on the rarer Itokawa plagioclase grains, in order to allow comparisons between Itokawa and lunar soil plagioclase grains for which an extensive data set exists.

  5. Test of the Additive-Dominance Model of grain weight and grain ...

    African Journals Online (AJOL)

    Two oat, parental genotypes, I.L82-1657 (pistillate) and 10589 Cn (staminate) with different grain weight characteristics were hybridized to obtain 6 backcross generations viz. P1, P2 ... However, additive gene effect was important in the control of all the grain weight variables except the primary: secondary grain yield ratio.

  6. Stabilisation of the grain market by the flexible use of grain for bioethanol

    NARCIS (Netherlands)

    Helming, J.F.M.; Pronk, A.; Woltjer, I.

    2010-01-01

    This report reviews whether the grain market and grain price can be stabilised by the variation of the use of grain in the EU-27's production of bioethanol. The time horizon of this study is 2020, whereby account is taken of the minimum 10% obligation for biofuel use in the EU-27. An economic

  7. Insect pest management in stored grain

    Science.gov (United States)

    Stored grain is vulnerable to attach by a variety of insect pests, that can generally be classified as external or internal feeders. Infestations primarily occur after grain is stored, though there is some evidence that infestations can occur in the field right before harvest. There are a variety of...

  8. Grain boundaries in high temperature superconductors

    NARCIS (Netherlands)

    Hilgenkamp, Johannes W.M.; Mannhart, J.

    2002-01-01

    Since the first days of high-Tc superconductivity, the materials science and the physics of grain boundaries in superconducting compounds have developed into fascinating fields of research. Unique electronic properties, different from those of the grain boundaries in conventional metallic

  9. Effect of grain boundary misorientation on discontinuous ...

    Indian Academy of Sciences (India)

    Administrator

    showed that the discontinuous precipitation (DP) reaction rate was dependent on the geometry of the grain boundary in ... 80% thickness reduction) had no effect on the frequency of special-grain boundaries. Keywords. AZ91 alloy .... increasing solute concentration, the influence of the ener- getics and kinetics is diminished ...

  10. Spectral coarse grained controllability of complex networks

    Science.gov (United States)

    Wang, Pei; Xu, Shuang

    2017-07-01

    With the accumulation of interaction data from various systems, a fundamental question in network science is how to reduce the sizes while keeping certain properties of complex networks. Combined the spectral coarse graining theory and the structural controllability of complex networks, we explore the structural controllability of undirected complex networks during coarse graining processes. We evidence that the spectral coarse grained controllability (SCGC) properties for the Erdös-Rényi (ER) random networks, the scale-free (SF) random networks and the small-world (SW) random networks are distinct from each other. The SW networks are very robust, while the SF networks are sensitive during the coarse graining processes. As an emergent properties for the dense ER networks, during the coarse graining processes, there exists a threshold value of the coarse grained sizes, which separates the controllability of the reduced networks into robust and sensitive to coarse graining. Investigations on some real-world complex networks indicate that the SCGC properties are varied among different categories and different kinds of networks, some highly organized social or biological networks are more difficult to be controlled, while many man-made power networks and infrastructure networks can keep the controllability properties during the coarse graining processes. Furthermore, we speculate that the SCGC properties of complex networks may depend on their degree distributions. The associated investigations have potential implications in the control of large-scale complex networks, as well as in the understanding of the organization of complex networks.

  11. Understanding Solidification Based Grain Refinement in Steels

    Science.gov (United States)

    2014-12-18

    can be modified to improve properties for grain refined steels. Tec finical Approach Grain size reduction is regularly practiced in steel mills...determine how small rare earth oxides are distributed in the steel. Since no examination of nano sized particles in the matrix was conducted in the

  12. Grain transport mechanics in shallow overland flow

    Science.gov (United States)

    A physical model based on continuum multiphase flow is described to represent saltating transport of grains in shallow overland flow. The two phase continuum flow of water and sediment considers coupled St.Venant type equations. The interactive cumulative effect of grains is incorporated by a disper...

  13. Grain transport mechanics in shallow flow

    Science.gov (United States)

    A physical model based on continuum multiphase flow is described to represent saltating transport of grains in shallow overland flows. The two-phase continuum flow of water and sediment considers coupled St.Venant type equations. The interactive cumulative effect of grains is incorporated by a dispe...

  14. Spinodal decomposition in fine grained materials

    Indian Academy of Sciences (India)

    We have used a phase field model to study spinodal decomposition in polycrystalline materials in which the grain size is of the same order of magnitude as the characteristic decomposition wavelength ( λ S D ). In the spirit of phase field models, each grain () in our model has an order parameter ( η i ) associated with it; ...

  15. Grain Boundary Engineering of Electrodeposited Thin Films

    DEFF Research Database (Denmark)

    Alimadadi, Hossein

    of the favorable boundaries that break the network of general grain boundaries. Successful dedicated synthesis of a textured nickel film fulfilling the requirements of grain boundary engineered materials, suggests improved boundary specific properties. However, the textured nickel film shows fairly low......Grain boundary engineering aims for a deliberate manipulation of the grain boundary characteristics to improve the properties of polycrystalline materials. Despite the emergence of some successful industrial applications, the mechanism(s) by which the boundary specific properties can be improved...... to engineer new materials. In this study, one of the most widely used electrolytes for electrodeposition is chosen for the synthesis of nickel films and based on thorough characterization of the boundaries the potentials in grain boundary engineering are outlined. The internal structure of the nickel films...

  16. Short Communication. Effect of phosphorus nutrition and grain position within maize cob on grain phosphorus accumulation

    Directory of Open Access Journals (Sweden)

    Muhamamad Nadeem

    2014-04-01

    Full Text Available Nutritional status of grains may vary due to external nutrient supply and their position within parent maize cob. Phosphorus (P is the least mobile nutrient in the soil and therefore newly growing seedlings are largely dependent on the stored grain P contents which are accumulated during the crop maturity period. Objective of this study was to access the effects of different P applications and grain positions on P and dry matter contents in grains. Phosphorus application and grain position has significant (p<0.05 effects on P contents in grains whereas dry weight and P content are highly correlated. Grain weight and P contents decreased linearly from base to apical position possibly due to flow of nutrients from base towards apical position within cob. Significantly higher grain dry weight (0.35±0.01 g and P contents (962±57 µg P are recorded in high P application (92.50 kg ha-1 rate on base position whereas minimum grain dry weight (0.14±0.01 g and P contents (219±11 µg P were recorded on apical grain position in low P application (5.60 kg ha-1 rate. The results suggest that for better seedling P nutrition especially in soils of low inherent P, maize grains should be selected from base or middle position where maximum dry weight and P contents are concentrated to support the seedlings to reach at growth at which roots are capable of external P uptake.

  17. Nanoscale grain growth behaviour of CoAl intermetallic synthesized ...

    Indian Academy of Sciences (India)

    The results of isothermal annealing showed that the grain growth behaviour can be explained by the parabolic grain growth law. The grains were at nanometric scale after isothermal annealing up to 0.7 m. The grain growth exponent remained constant above 873 K indicating that grain growth mechanism does not change ...

  18. A constitutive model of nanocrystalline metals based on competing grain boundary and grain interior deformation mechanisms

    KAUST Repository

    Gurses, Ercan

    2011-12-01

    In this work, a viscoplastic constitutive model for nanocrystalline metals is presented. The model is based on competing grain boundary and grain interior deformation mechanisms. In particular, inelastic deformations caused by grain boundary diffusion, grain boundary sliding and dislocation activities are considered. Effects of pressure on the grain boundary diffusion and sliding mechanisms are taken into account. Furthermore, the influence of grain size distribution on macroscopic response is studied. The model is shown to capture the fundamental mechanical characteristics of nanocrystalline metals. These include grain size dependence of the strength, i.e., both the traditional and the inverse Hall-Petch effects, the tension-compression asymmetry and the enhanced rate sensitivity. © 2011 Elsevier B.V. All rights reserved.

  19. Automated grain size measurements from airborne remote sensing for long profile measurements of fluvial grain sizes

    Science.gov (United States)

    Carbonneau, Patrice E.; Bergeron, Normand; Lane, Stuart N.

    2005-11-01

    Recent research has demonstrated that image processing can be applied to derive surficial median grain size data automatically from high-resolution airborne digital imagery in fluvial environments. However, at the present time, automated grain size measurement is limited to the dry exposed bed areas of the channel. This paper shows that the application area of automated grain size mapping can be extended in order to include the shallow wetted areas of the channel. The paper then proceeds to illustrate how automated grain size measurement in both dry and shallow wetted areas can be used to measure grain sizes automatically for long river lengths. For the present study, this results in a median grain size profile covering an 80 km long river which is constructed from over three million automated grain size measurements.

  20. Rheology of grain-boundary sliding and grain interlocking at high temperatures

    Energy Technology Data Exchange (ETDEWEB)

    Sakai, M.; Muto, H. [Toyohashi Univ. of Technology (Japan). Dept. of Materials Science

    1999-03-01

    A two-dimensional array of elastic hexagonal grains embedded in an contiguous fluid is used as a model for grain-boundary sliding and grain interlocking. The viscoelastic constitutive equation, in a phenomenological sense, is of a nonlinear Maxwell type, comprising a strain-dependent dashpot and an elastic spring connected in series. The squeezing-in/out processes and mechanisms of grain-boundary fluid essentially give rise to the rheological nonlinearity. The experimental results in stress relaxation tests of a {beta}-spodumene glass-ceramic under simple shear are characterized in a light of the nonlinear constitutive equation. It is emphasized that stress relaxation test is one of the important test techniques which enable one to study quantitatively the rheological behavior of polycrystalline ceramics with grain-boundary sliding and grain interlocking without any difficulties and ambiguities accompanied by stress-induced grain-boundary cavities which so often appear in conventional creep tests. (orig.) 9 refs.

  1. Grain dissection as a grain size reducing mechanism during ice microdynamics

    Science.gov (United States)

    Steinbach, Florian; Kuiper, Ernst N.; Eichler, Jan; Bons, Paul D.; Drury, Martin R.; Griera, Albert; Pennock, Gill M.; Weikusat, Ilka

    2017-04-01

    Ice sheets are valuable paleo-climate archives, but can lose their integrity by ice flow. An understanding of the microdynamic mechanisms controlling the flow of ice is essential when assessing climatic and environmental developments related to ice sheets and glaciers. For instance, the development of a consistent mechanistic grain size law would support larger scale ice flow models. Recent research made significant progress in numerically modelling deformation and recrystallisation mechanisms in the polycrystalline ice and ice-air aggregate (Llorens et al., 2016a,b; Steinbach et al., 2016). The numerical setup assumed grain size reduction is achieved by the progressive transformation of subgrain boundaries into new high angle grain boundaries splitting an existing grain. This mechanism is usually termed polygonisation. Analogue experiments suggested, that strain induced grain boundary migration can cause bulges to migrate through the whole of a grain separating one region of the grain from another (Jessell, 1986; Urai, 1987). This mechanism of grain dissection could provide an alternative grain size reducing mechanism, but has not yet been observed during ice microdynamics. In this contribution, we present results using an updated numerical approach allowing for grain dissection. The approach is based on coupling the full field theory crystal visco-plasticity code (VPFFT) of Lebensohn (2001) to the multi-process modelling platform Elle (Bons et al., 2008). VPFFT predicts the mechanical fields resulting from short strain increments, dynamic recrystallisation process are implemented in Elle. The novel approach includes improvements to allow for grain dissection, which was topologically impossible during earlier simulations. The simulations are supported by microstructural observations from NEEM (North Greenland Eemian Ice Drilling) ice core. Mappings of c-axis orientations using the automatic fabric analyser and full crystallographic orientations using electron

  2. Strontium and barium isotopes in presolar silicon carbide grains measured with CHILI-two types of X grains

    Science.gov (United States)

    Stephan, Thomas; Trappitsch, Reto; Davis, Andrew M.; Pellin, Michael J.; Rost, Detlef; Savina, Michael R.; Jadhav, Manavi; Kelly, Christopher H.; Gyngard, Frank; Hoppe, Peter; Dauphas, Nicolas

    2018-01-01

    We used CHILI, the Chicago Instrument for Laser Ionization, a new resonance ionization mass spectrometer developed for isotopic analysis of small samples, to analyze strontium, zirconium, and barium isotopes in 22 presolar silicon carbide grains. Twenty of the grains showed detectable strontium and barium, but none of the grains had enough zirconium to be detected with CHILI. Nine grains were excluded from further consideration since they showed very little signals (barium. Among the 11 remaining grains, we found three X grains. The discovery of three supernova grains among only 22 grains was fortuitous, because only ∼1% of presolar silicon carbide grains are type X, but was confirmed by silicon isotopic measurements of grain residues with NanoSIMS. While one of the X grains showed strontium and barium isotope patterns expected for supernova grains, the two other supernova grains have 87Sr/86Sr barium isotopic composition constrain their individual formation conditions in Type II supernovae.

  3. Grain interaction effects in polycrystalline Cu

    DEFF Research Database (Denmark)

    Thorning, C.; Somers, Marcel A.J.; Wert, John A.

    2005-01-01

    Crystal orientation maps for a grain in a deformed Cu polycrystal have been analysed with the goal of understanding the effect of grain interactions on orientation subdivision. The polycrystal was incrementally strained in tension to 5, 8, 15 and 25% extension; a crystal orientation map was measu......Crystal orientation maps for a grain in a deformed Cu polycrystal have been analysed with the goal of understanding the effect of grain interactions on orientation subdivision. The polycrystal was incrementally strained in tension to 5, 8, 15 and 25% extension; a crystal orientation map...... range of Tailor solutions for axisymmetric strain; grain interactions are not required to account for the coarse domain structure. Special orientation domains extend 20-100 µm into the grain at various locations around its periphery. The special orientation domain morphologies include layers along...... boundary segments, lobes that may be further subdivided, and plates. Detailed analysis of the crystal rotations in the special domains provides strong evidence that they result from grain interactions....

  4. Roundness of grains in cellular microstructures

    Science.gov (United States)

    Lutz, F. H.; Mason, J. K.; Lazar, E. A.; MacPherson, R. D.

    2017-08-01

    Many physical systems are composed of polyhedral cells of varying sizes and shapes. These structures are simple in the sense that no more than three faces meet at an edge and no more than four edges meet at a vertex. This means that individual cells can usually be considered as simple, three-dimensional polyhedra. This paper is concerned with determining the distribution of combinatorial types of such polyhedral cells. We introduce the terms fundamental and vertex-truncated types and apply these concepts to the grain growth microstructure as a testing ground. For these microstructures, we demonstrate that most grains are of particular fundamental types, whereas the frequency of vertex-truncated types decreases exponentially with the number of truncations. This can be explained by the evolutionary process through which grain growth structures are formed and in which energetically unfavorable surfaces are quickly eliminated. Furthermore, we observe that these grain types are "round" in a combinatorial sense: there are no "short" separating cycles that partition the polyhedra into two parts of similar sizes. A particular microstructure derived from the Poisson-Voronoi initial condition is identified as containing an unusually large proportion of round grains. This microstructure has an average of 14.036 faces per grain and is conjectured to be more resistant to topological change than the steady-state grain growth microstructure.

  5. RF installation for the grain disinfestation

    CERN Document Server

    Zajtzev, B V; Kobetz, A F; Rudiak, B I

    2001-01-01

    The ecologically pure method of grain product disinfestations through the grain treatment with the RF electric field is described. The experimental data obtained showed that with strengths of the electrical RF field of E=5 kV/cm and frequency of 80 MHz the relative death rate is 100%.The time of the grain treatment it this case is 1 sec. The pulses with a duration of 600 mu s and repetition rate of 2 Hz were used, the duration of the front was 10 mu s. The schematic layout of installation with a productivity of 50 tones/h and power of 10 kW is given.

  6. Grain refinement control in TIG arc welding

    Science.gov (United States)

    Iceland, W. F.; Whiffen, E. L. (Inventor)

    1975-01-01

    A method for controlling grain size and weld puddle agitation in a tungsten electrode inert gas welding system to produce fine, even grain size and distribution is disclosed. In the method the frequency of dc welding voltage pulses supplied to the welding electrode is varied over a preselected frequency range and the arc gas voltage is monitored. At some frequency in the preselected range the arc gas voltage will pass through a maximum. By maintaining the operating frequency of the system at this value, maximum weld puddle agitation and fine grain structure are produced.

  7. Optical sizing of irregular snow grains

    Directory of Open Access Journals (Sweden)

    A. A. Kokhanovsky

    2011-09-01

    Full Text Available We discuss a possibility of snow grain size determination using spectral reflectance measurements in the near-infrared part of the electromagnetic spectrum. Errors related to often made assumption of the sphericity of grains are studied. Also we introduce a new method for the snow albedo and snow pollution monitoring using measurements in the visible part of the electromagnetic theory. Both exact and approximate methods of the radiative transfer are used for the solution of corresponding inverse problem. It is assumed that snow grains can be presented as randomly distributed irregular fractal particles. The developed techniques are applied to both ground and satellite data.

  8. Dynamic grain growth during superplastic deformation

    Energy Technology Data Exchange (ETDEWEB)

    Rabinovich, M.Kh. [Ufa State Aviation-Technical Univ. (Russian Federation); Trifonov, V.G. [Russian Academy of Sciences, Ufa (Russian Federation). Inst. for Metals Superplasticity Problems

    1996-05-01

    Superplastic deformation (SPD) causes the accelerated anisotropic grain growth. This process results in the formation of structure which is quasistable during superplastic deformation and unstable after deformation. The degree of instability is determined by the size of grains, their shape coefficient which depends on the nature of an alloy and is equal to 1.1--1.5 after SPD, and by the unbalance of triple junctions at boundaries. Alloying of metals can affect the thermodynamic force and mechanism of dynamic anisotropic grain growth and correspondingly influence the parameters of superplasticity in alloys.

  9. Design of Grain Dryers’ Control System

    Science.gov (United States)

    Li, Shizhuang; Cao, Shukun; Meng, Wenjing

    2017-06-01

    TMS320F28335 which is a TI high-performance TMS320C28x series 32-bit floating point DSP processor is used as the core of the controller, and the hardware is designed, which includes temperature collection, temperature and humidity collection, moisture detection and motor control. The development environment of the system CCS, and then for the characteristics of grain dryer control system, the control system software modular design, the use of fuzzy control method to achieve food grain motor control, and MATLAB simulation analysis, Fuzzy control is used to control the feasibility of the grain moisture.

  10. CASS Ferrite and Grain Structure Relationship

    Energy Technology Data Exchange (ETDEWEB)

    Ruud, Clayton O. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Ramuhalli, Pradeep [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Meyer, Ryan M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Diaz, Aaron A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Anderson, Michael T. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

    2016-07-13

    This document summarizes the results of research conducted at Pacific Northwest National Laboratory (PNNL) to determine whether, based on experimental measurements, a correlation existed between grain structure in cast austenitic stainless steel (CASS) piping and ferrite content of the casting alloy. The motivation for this research lies in the fact that ultrasonic testing (UT) is strongly influenced by CASS grain structure; knowledge of this grain structure may help improve the ability to interpret UT responses, thereby improving the overall reliability of UT inspections of CASS components.

  11. Grain boundaries: Annual technical progress report

    Energy Technology Data Exchange (ETDEWEB)

    Balluffi, R.W.; Bristowe, P.D.

    1988-04-28

    The present document is a progress report describing the work accomplished on the study of grain of gold. The research that was proposed initially for this period consisted of studies of the atomistics structure of grain boundaries by means of combined x-ray diffraction and computer modeling and of grain boundary phase transitions by electron microscopy and computer modeling. Progress has been made on both of these areas which is described in more detail. A list of reports describing the research completely during the first year is presented.

  12. Whole Grains: Hearty Options for a Healthy Diet

    Science.gov (United States)

    Healthy Lifestyle Nutrition and healthy eating Find out why whole grains are better than refined grains and how to ... 18, 2017 Original article: http://www.mayoclinic.org/healthy-lifestyle/nutrition-and-healthy-eating/in-depth/whole-grains/art- ...

  13. Grain operator miffed at port administration

    Index Scriptorium Estoniae

    2006-01-01

    Ventspils Grain Terminal saatis president Vaira Vike-Freibergale ja mitmetele ministritele kirja sõnumiga, et Ventspilsi Vabasadama (Ventspils Free Port) administratsiooni tegevus takistab terminali äritegevust

  14. Barium Isotopes in Single Presolar Grains

    Science.gov (United States)

    Pellin, M. J.; Davis, A. M.; Savina, M. R.; Kashiv, Y.; Clayton, R. N.; Lewis, R. S.; Amari, S.

    2001-01-01

    Barium isotopic compositions of single presolar grains were measured by laser ablation laser resonant ionization mass spectrometry and the implications of the data for stellar processes are discussed. Additional information is contained in the original extended abstract.

  15. The NGDC Seafloor Sediment Grain Size Database

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NGDC (now NCEI) Seafloor Sediment Grain Size Database contains particle size data for over 17,000 seafloor samples worldwide. The file was begun by NGDC in 1976...

  16. Volume dependence of computed grain boundary energy

    Energy Technology Data Exchange (ETDEWEB)

    Bristowe, P.D.; Brokman, A.

    1980-08-01

    Over the past five years there have been numerous studies of grain boundary structure using the method of computer molecular statics which assume pairwise central potentials for the interatomic interaction. Emphasis is usually placed on relative grain boundary energies but these may be inaccurate due to various, but related, approximations and constraints implicity imposed on the calculation-namely central forces, finite model size, fixed border conditions and volume dependent contributions to the energy of the system. It is the purpose of this work to clarify how these particular properties of the model can affect the computed grain boundary energy and demonstrate instances in which the quoted energy has strictly been inaccurate. The implication of these results, especially on how they affect the method of relaxation and the resulting grain boundary structure is discussed.

  17. Antioxidant Properties of Whole Grain Cereals

    OpenAIRE

    Čukelj, Nikolina; Novotny, Dubravka; Ćurić, Duška

    2010-01-01

    Cereals have a long history of use by humans. Cereals and cereal products are staple foods, and are important source of energy, carbohydrate, protein, fibre, vitamins (E, B) and minerals (Zn, Mg, Fe) in both developed and developing countries. The health aspects of whole grain cereals have long been known, but the antioxidant profile of whole grains has only recently been introduced to the antioxidant research community where mostly fruits and vegetables are in focus. In vitro experiments con...

  18. Organic Wheat Farming Improves Grain Zinc Concentration

    OpenAIRE

    Helfenstein, Julian; Müller, Isabel; Grüter, Roman; Bhullar, Gurbir S.; Mandloi, Lokendra; Papritz, Andreas; Siegrist, Michael; Schulin, Rainer

    2016-01-01

    Zinc (Zn) nutrition is of key relevance in India, as a large fraction of the population suffers from Zn malnutrition and many soils contain little plant available Zn. In this study we compared organic and conventional wheat cropping systems with respect to DTPA (diethylene triamine pentaacetic acid)-extractable Zn as a proxy for plant available Zn, yield, and grain Zn concentration. We analyzed soil and wheat grain samples from 30 organic and 30 conventional farms in Madhya Pradesh (central I...

  19. Fine-grained Dutch named entity recognition

    OpenAIRE

    Desmet, Bart; Hoste, Veronique

    2014-01-01

    This paper describes the creation of a fine-grained named entity annotation scheme and corpus for Dutch, and experiments on automatic main type and subtype named entity recognition. We give an overview of existing named entity annotation schemes, and motivate our own, which describes six main types (persons, organizations, locations, products, events and miscellaneous named entities) and finer-grained information on subtypes and metonymic usage. This was applied to a one-million-word subset o...

  20. Evaluation of special grains bean lines for grain yield, cooking time and mineral concentrations

    Directory of Open Access Journals (Sweden)

    Nerinéia Dalfollo Ribeiro

    2014-03-01

    Full Text Available Genetic variability of 32 inbred special grains bean lines was investigated for grain yield, mass of 100 grains, cooking time, and mineral concentrations in grains, and Z index was used for selection of superior lines in most of the characters. IAC Centauro, IAC Galante, Xamego, Ouro Branco, Montcalm, and Hooter lines presented high yield grain, short cooking time (less than 24 min, and high potassium (>14 g kg-1 dry matter [DM], calcium (>1.42 g kg-1 DM, iron (>97.60 mg kg-1 DM, zinc (>29.05 mg kg-1 DM and copper (>8.67 mg kg-1 DM concentrations, and their dietary use is therefore recommended. Cal-96 line presents higher Z index for grain yield and for the most of the minerals, and its use is recommended for crosses for the development of superior lines.

  1. SEM analysis of weathered grains: Pretreatment effects

    Science.gov (United States)

    Cremeens, D. L.; Darmody, R. G.; Jansen, I. J.

    1987-05-01

    Fresh microcline, albite, and almandine, along with soil grains, were treated with various traditional pretreatments prior to observation with scanning electron microscopy (SEM). The grains were observed with SEM and given ratings for each of several surface properties to determine which pretreatments produced clean surfaces on soil grains without laboratory-induced damage on the fresh mineral grains. Gentle overnight shaking in 2% sodium bicarbonate at pH 9.5 produced the most effective cleaning of soil grains with the least amount of induced damage to fresh mineral samples. This pretreatment was equivalent to that given the control samples (shaken overnight in distilled water) for observations of etch pits on fresh mineral samples within a 25% equivalence (or negligible difference) interval. Ultrasonification, hydrogen peroxide, and boiling hydrochloric acid caused the most damage to mineral samples, mainly in the form of 0.5-μm etch pits. Boiling hydrochloric acid, boiling nitric acid, and stannous chloride resulted in increased coated surfaces on soil grains.

  2. Control and Characterization of Individual Grains and Grain Boundaries in Graphene Grown by Chemical Vapour Deposition

    Science.gov (United States)

    2011-06-01

    field (B). Figure 5c presents low temperature (4.3 K) magnetoresistance (Rxx(B)) measurements across the grain boundary compared to Rxx(B) measured within...voltage leads labelled in the legend. c, Four-terminal magnetoresistance (Rxx) measured at 4.3 K within each graphene grain and across the grain boundary...graphene nanoribbons. Nature 444, 347–349 (2006). 37. Huang, M. Y. et al. Phonon softening and crystallographic orientation of strained graphene studied by

  3. Selection of common bean lines with high grain yield and high grain calcium and iron concentrations

    Directory of Open Access Journals (Sweden)

    Nerinéia Dalfollo Ribeiro

    2014-02-01

    Full Text Available Genetic improvement of common bean nutritional quality has advantages in marketing and can contribute to society as a food source. The objective of this study was to evaluate the genetic variability for grain yield, calcium and iron concentrations in grains of inbred common bean lines obtained by different breeding methods. For this, 136 F7 inbred lines were obtained using the Pedigree method and 136 F7 inbred lines were obtained using the Single-Seed Descent (SSD method. The lines showed genetic variability for grain yield, and concentrations of calcium and iron independently of the method of advancing segregating populations. The Pedigree method allows obtaining a greater number of lines with high grain yield. Selection using the SSD method allows the identification of a larger number of lines with high concentrations of calcium and iron in grains. Weak negative correlations were found between grain yield and calcium concentration (r = -0.0994 and grain yield and iron concentration (r = -0.3926. Several lines show genetic superiority for grain yield and concentrations of calcium and iron in grains and their selection can result in new common bean cultivars with high nutritional quality.

  4. Mechanism of secondary recrystallization of Goss grains in grain-oriented electrical steel

    Science.gov (United States)

    Hayakawa, Yasuyuki

    2017-01-01

    Abstract Since its invention by Goss in 1934, grain-oriented (GO) electrical steel has been widely used as a core material in transformers. GO exhibits a grain size of over several millimeters attained by secondary recrystallization during high-temperature final batch annealing. In addition to the unusually large grain size, the crystal direction in the rolling direction is aligned with , which is the easy magnetization axis of α-iron. Secondary recrystallization is the phenomenon in which a certain very small number of {110} (Goss) grains grow selectively (about one in 106 primary grains) at the expense of many other primary recrystallized grains. The question of why the Goss orientation is exclusively selected during secondary recrystallization has long been a main research subject in this field. The general criterion for secondary recrystallization is a small and uniform primary grain size, which is achieved through the inhibition of normal grain growth by fine precipitates called inhibitors. This paper describes several conceivable mechanisms of secondary recrystallization of Goss grains mainly based on the selective growth model. PMID:28804524

  5. Organic Wheat Farming Improves Grain Zinc Concentration

    Science.gov (United States)

    Helfenstein, Julian; Müller, Isabel; Grüter, Roman; Bhullar, Gurbir; Mandloi, Lokendra; Papritz, Andreas; Siegrist, Michael; Schulin, Rainer; Frossard, Emmanuel

    2016-01-01

    Zinc (Zn) nutrition is of key relevance in India, as a large fraction of the population suffers from Zn malnutrition and many soils contain little plant available Zn. In this study we compared organic and conventional wheat cropping systems with respect to DTPA (diethylene triamine pentaacetic acid)-extractable Zn as a proxy for plant available Zn, yield, and grain Zn concentration. We analyzed soil and wheat grain samples from 30 organic and 30 conventional farms in Madhya Pradesh (central India), and conducted farmer interviews to elucidate sociological and management variables. Total and DTPA-extractable soil Zn concentrations and grain yield (3400 kg ha-1) did not differ between the two farming systems, but with 32 and 28 mg kg-1 respectively, grain Zn concentrations were higher on organic than conventional farms (t = -2.2, p = 0.03). Furthermore, multiple linear regression analyses revealed that (a) total soil zinc and sulfur concentrations were the best predictors of DTPA-extractable soil Zn, (b) Olsen phosphate taken as a proxy for available soil phosphorus, exchangeable soil potassium, harvest date, training of farmers in nutrient management, and soil silt content were the best predictors of yield, and (c) yield, Olsen phosphate, grain nitrogen, farmyard manure availability, and the type of cropping system were the best predictors of grain Zn concentration. Results suggested that organic wheat contained more Zn despite same yield level due to higher nutrient efficiency. Higher nutrient efficiency was also seen in organic wheat for P, N and S. The study thus suggests that appropriate farm management can lead to competitive yield and improved Zn concentration in wheat grains on organic farms. PMID:27537548

  6. Organic Wheat Farming Improves Grain Zinc Concentration.

    Directory of Open Access Journals (Sweden)

    Julian Helfenstein

    Full Text Available Zinc (Zn nutrition is of key relevance in India, as a large fraction of the population suffers from Zn malnutrition and many soils contain little plant available Zn. In this study we compared organic and conventional wheat cropping systems with respect to DTPA (diethylene triamine pentaacetic acid-extractable Zn as a proxy for plant available Zn, yield, and grain Zn concentration. We analyzed soil and wheat grain samples from 30 organic and 30 conventional farms in Madhya Pradesh (central India, and conducted farmer interviews to elucidate sociological and management variables. Total and DTPA-extractable soil Zn concentrations and grain yield (3400 kg ha-1 did not differ between the two farming systems, but with 32 and 28 mg kg-1 respectively, grain Zn concentrations were higher on organic than conventional farms (t = -2.2, p = 0.03. Furthermore, multiple linear regression analyses revealed that (a total soil zinc and sulfur concentrations were the best predictors of DTPA-extractable soil Zn, (b Olsen phosphate taken as a proxy for available soil phosphorus, exchangeable soil potassium, harvest date, training of farmers in nutrient management, and soil silt content were the best predictors of yield, and (c yield, Olsen phosphate, grain nitrogen, farmyard manure availability, and the type of cropping system were the best predictors of grain Zn concentration. Results suggested that organic wheat contained more Zn despite same yield level due to higher nutrient efficiency. Higher nutrient efficiency was also seen in organic wheat for P, N and S. The study thus suggests that appropriate farm management can lead to competitive yield and improved Zn concentration in wheat grains on organic farms.

  7. Organic Wheat Farming Improves Grain Zinc Concentration.

    Science.gov (United States)

    Helfenstein, Julian; Müller, Isabel; Grüter, Roman; Bhullar, Gurbir; Mandloi, Lokendra; Papritz, Andreas; Siegrist, Michael; Schulin, Rainer; Frossard, Emmanuel

    2016-01-01

    Zinc (Zn) nutrition is of key relevance in India, as a large fraction of the population suffers from Zn malnutrition and many soils contain little plant available Zn. In this study we compared organic and conventional wheat cropping systems with respect to DTPA (diethylene triamine pentaacetic acid)-extractable Zn as a proxy for plant available Zn, yield, and grain Zn concentration. We analyzed soil and wheat grain samples from 30 organic and 30 conventional farms in Madhya Pradesh (central India), and conducted farmer interviews to elucidate sociological and management variables. Total and DTPA-extractable soil Zn concentrations and grain yield (3400 kg ha-1) did not differ between the two farming systems, but with 32 and 28 mg kg-1 respectively, grain Zn concentrations were higher on organic than conventional farms (t = -2.2, p = 0.03). Furthermore, multiple linear regression analyses revealed that (a) total soil zinc and sulfur concentrations were the best predictors of DTPA-extractable soil Zn, (b) Olsen phosphate taken as a proxy for available soil phosphorus, exchangeable soil potassium, harvest date, training of farmers in nutrient management, and soil silt content were the best predictors of yield, and (c) yield, Olsen phosphate, grain nitrogen, farmyard manure availability, and the type of cropping system were the best predictors of grain Zn concentration. Results suggested that organic wheat contained more Zn despite same yield level due to higher nutrient efficiency. Higher nutrient efficiency was also seen in organic wheat for P, N and S. The study thus suggests that appropriate farm management can lead to competitive yield and improved Zn concentration in wheat grains on organic farms.

  8. The HEALTHGRAIN definition of 'whole grain'.

    Science.gov (United States)

    van der Kamp, Jan Willem; Poutanen, Kaisa; Seal, Chris J; Richardson, David P

    2014-01-01

    Most cereal products, like white bread, pasta, and biscuits, are based on flour after removal of bran and germ, the two parts of grain kernels containing most of the dietary fibre and other bioactive components. In the past decade, consumers have been rediscovering whole grain-based products and the number of wholegrain products has increased rapidly. In most countries in Europe and worldwide, however, no legally endorsed definition of wholegrain flour and products exists. Current definitions are often incomplete, lacking descriptions of the included grains and the permitted flour manufacturing processes. The consortium of the HEALTHGRAIN EU project (FP6-514008, 2005-2010) identified the need for developing a definition of whole grain with the following scope: 1) more comprehensive than current definitions in most EU countries; 2) one definition for Europe - when possible equal to definitions outside Europe; 3) reflecting current industrial practices for production of flours and consumer products; 4) useful in the context of nutritional guidelines and for labelling purposes. The definition was developed in a range of discussion meetings and consultations and was launched in 2010 at the end of the HEALTHGRAIN project. The grains included are specified: a wide range of cereal grains from the Poaceae family, and the pseudo-cereals amaranth, buckwheat, quinoa, and wild rice. The definition also describes manufacturing processes allowed for producing wholegrain flours. This paper compares the HEALTHGRAIN definition with previous definitions, provides more comprehensive explanations than in the definition itself regarding the inclusion of specific grains, and sets out the permitted flour manufacturing processes.

  9. Increased Night Temperature Negatively Affects Grain Yield, Biomass and Grain Number in Chilean Quinoa.

    Science.gov (United States)

    Lesjak, Jurka; Calderini, Daniel F

    2017-01-01

    Quinoa high nutritive value increases interest worldwide, especially as a crop that could potentially feature in different cropping systems, however, climate change, particularly rising temperatures, challenges this and other crop species. Currently, only limited knowledge exists regarding the grain yield and other key traits response to higher temperatures of this crop, especially to increased night temperatures. In this context, the main objective of this study was to evaluate the effect of increased night temperature on quinoa yield, grain number, individual grain weight and processes involved in crop growth under the environmental conditions (control treatment) and night thermal increase at two phases: flowering (T1) and grain filling (T2) in southern Chile. A commercial genotype, Regalona, and a quinoa accession (Cod. BO5, N°191, grain bank from Semillas Baer, hereby referred to as Accession) were used, due to their adaptability to Southern Chilean conditions and contrasting grain yield potential, grain weight and size of plants. Temperature was increased ≈4°C above the ambient from 8 pm until 9 am the next morning. Control treatments reached a high grain yield (600 and 397 g m-2, i.e., Regalona and Accession). Temperature increase reduced grain yield by 31% under T1 treatment and 12% when under T2 in Regalona and 23 and 26% in Accession, respectively. Aboveground biomass was negatively affected by the thermal treatments and a positive linear association was found between grain yield and aboveground biomass across treatments. By contrast, the harvest index was unaffected either by genotype, or by thermal treatments. Grain number was significantly affected between treatments and this key trait was linearly associated with grain yield. On the other hand, grain weight showed a narrow range of variation across treatments. Additionally, leaf area index was not affected, but significant differences were found in SPAD values at the end of T1 treatment, compared

  10. Performance of organic grain legumes in Tuscany

    Directory of Open Access Journals (Sweden)

    Valentina Moschini

    2014-03-01

    Full Text Available In 2005-2007 growing season, few varieties of field bean, high protein pea and white lupin were compared in an organic farm of Central Italy (Mugello area, Tuscany, to evaluate their agronomic performance in terms of grain yield, nutritional quality and competitive ability against weeds. The experiment was performed under rain-fed conditions. Furthermore, grain legumes features were compared between two different sowing seasons (autumnal vs late-winter for two years, in order to get information on the best time of sowing of these species, and the stability of yields of different genotypes in those climatic and soil conditions. These legumes could be an alternative protein source to external soybean, a high-risk alimentary source of genetically modified organisms, in the organic livestock sector. The main findings indicate that higher yields in grain and crude protein were obtained with the pea species and in particular with cultivars Hardy (4.0 t/ha grain yield; 626 kg/ha crude protein yield and Classic (3.1 t/ha grain yield; 557 kg/ha crude protein yield; followed by field bean cv. Chiaro di Torre Lama (2.9 t/ha grain yield; 624 kg/ha crude protein yield and cv. Vesuvio (2.5 t/ha grain yield; 549 kg/ha crude protein yield. Furthermore the field bean is interesting for the stability of yield in both years despite climatic conditions rather different. The white lupin has showed the lower yield but the best values of grain quality, with higher values in lupin Multitalia for dry matter, crude protein and ether extract and in lupin Luxe also for crude fibre, respect to the other legumes analysed. Among lupin varieties, lupin Multitalia showed the best yield results for the pedo-climatic conditions of Mugello area (0.9 t/ha lupin Multitalia; 0.2 t/ha lupin Luxe. The total yield of organic grain legumes, in the experimental site, is resulted higher with an autumnal seeding respect to the late-winter seeding (2.8 t/ha vs 1.9 t/ha.

  11. A New Grain Refiner for Ferritic Steels

    Science.gov (United States)

    Li, Ming; Li, Jian-Min; Zheng, Qing; Qiu, Dong; Wang, Geoff; Zhang, Ming-Xing

    2017-12-01

    A new grain refiner, LaB6, was identified for ferritic steels based on the crystallographic calculation using the edge-to-edge matching model. Addition of 0.5 wt pct LaB6 led to a reduction of the average grain size from 765 to 92 μm and the proportion of the columnar structure from 35 to 8 pct in an as-cast Fe-4Si ferritic alloy. Although LaB6 was supposed to act as an active inoculant for δ-ferrite, thermodynamic calculation indicated that LaB6 is not thermodynamically stable in the melt of the Fe-4Si alloy. It was subject to decompose into La and B solutes. Consequently, both La and B reacted with Fe, O and S, forming different compounds. Microstructural examination at room temperature observed La2SO2 and La2O3 particles within the ferrite grains and Fe2B along the grain boundaries in the samples. Through EBSD analysis, a reproducible orientation relationship between ferrite and La2SO2 was identified. In addition, the edge-to-edge matching calculation also predicted the high potency for La2SO2 to be an effective nucleant for δ-ferrite. It was considered that the grain refinement of LaB6 was attributed to the enhanced heterogeneous nucleation of δ-ferrite by La2SO2, and the solute effect of B due to the high Q-value in ferrite.

  12. Grain Boundaries From Theory to Engineering

    CERN Document Server

    Priester, Louisette

    2013-01-01

    Grain boundaries are a main feature of crystalline materials. They play a key role in determining the properties of materials, especially when grain size decreases and even more so with the current improvements of  processing tools and methods that allow us to control various elements in a polycrystal. This book presents the theoretical basis of the study of  grain boundaries and aims to open up new lines of research in this area. The treatment is light on mathematical approaches while emphasizing practical examples; the issues they raise are discussed with reference to theories. The general approach of the book has two main goals: to lead the reader from the concept of ‘ideal’ to ‘real’ grain boundaries; to depart from established knowledge and address the opportunities emerging through "grain boundary engineering",  the control of morphological and crystallographic features that affect material properties. The book is divided in three parts:  I ‘From interganular order to disorder’ deals wit...

  13. Interstellar grain chemistry and organic molecules

    Science.gov (United States)

    Allamandola, L. J.; Sandford, S. A.

    1990-01-01

    The detection of prominant infrared absorption bands at 3250, 2170, 2138, 1670 and 1470 cm(-1) (3.08, 4.61, 4.677, 5.99 and 6.80 micron m) associated with molecular clouds show that mixed molecular (icy) grain mantles are an important component of the interstellar dust in the dense interstellar medium. These ices, which contain many organic molecules, may also be the production site of the more complex organic grain mantles detected in the diffuse interstellar medium. Theoretical calculations employing gas phase as well as grain surface reactions predict that the ices should be dominated only by the simple molecules H2O, H2CO, N2, CO, O2, NH3, CH4, possibly CH3OH, and their deuterated counterparts. However, spectroscopic observations in the 2500 to 1250 cm(-1)(4 to 8 micron m) range show substantial variation from source reactions alone. By comparing these astronomical spectra with the spectra of laboratory-produced analogs of interstellar ices, one can determine the composition and abundance of the materials frozen on the grains in dense clouds. Experiments are described in which the chemical evolution of an interstellar ice analog is determined during irradiation and subsequent warm-up. Particular attention is paid to the types of moderately complex organic materials produced during these experiments which are likely to be present in interstellar grains and cometary ices.

  14. A New Grain Refiner for Ferritic Steels

    Science.gov (United States)

    Li, Ming; Li, Jian-Min; Zheng, Qing; Qiu, Dong; Wang, Geoff; Zhang, Ming-Xing

    2017-10-01

    A new grain refiner, LaB6, was identified for ferritic steels based on the crystallographic calculation using the edge-to-edge matching model. Addition of 0.5 wt pct LaB6 led to a reduction of the average grain size from 765 to 92 μm and the proportion of the columnar structure from 35 to 8 pct in an as-cast Fe-4Si ferritic alloy. Although LaB6 was supposed to act as an active inoculant for δ-ferrite, thermodynamic calculation indicated that LaB6 is not thermodynamically stable in the melt of the Fe-4Si alloy. It was subject to decompose into La and B solutes. Consequently, both La and B reacted with Fe, O and S, forming different compounds. Microstructural examination at room temperature observed La2SO2 and La2O3 particles within the ferrite grains and Fe2B along the grain boundaries in the samples. Through EBSD analysis, a reproducible orientation relationship between ferrite and La2SO2 was identified. In addition, the edge-to-edge matching calculation also predicted the high potency for La2SO2 to be an effective nucleant for δ-ferrite. It was considered that the grain refinement of LaB6 was attributed to the enhanced heterogeneous nucleation of δ-ferrite by La2SO2, and the solute effect of B due to the high Q-value in ferrite.

  15. Volatile organic compounds of whole grain soft winter wheat

    Science.gov (United States)

    The aroma from volatile organic compounds (VOCs) is an indicator of grain soundness and also an important quality attribute of grain foods. To identify the inherent VOCs of wheat grain unaffected by fungal infestation and other extrinsic factors, grains of nine soft wheat varieties were collected at...

  16. Magnetic fluctuations in nanosized goethite (alpha-FeOOH) grains

    DEFF Research Database (Denmark)

    Madsen, Daniel Esmarch; Gontard, Lionel Cervera; Kasama, Takeshi

    2009-01-01

    at the grain boundaries between nanometer-sized grains, leading to a weakened magnetic coupling between the grains. We show that the Mossbauer data of goethite can be explained by fluctuations of the sublattice magnetization directions in such weakly coupled grains. It is likely that the influence of defects...

  17. Conditional differential cryptanalysis of 105 round Grain v1

    DEFF Research Database (Denmark)

    Banik, Subhadeep

    2016-01-01

    In this paper we propose conditional differential cryptanalysis of 105 round Grain v1. This improves the attack proposed on 97 round Grain v1 by Knellwolf et al at Asiacrypt 2010. We take the help of the tool ΔGrain KSA, to track the differential trails introduced in the internal state of Grain v1...

  18. test of the additive-dominance model of grain weight and grain ...

    African Journals Online (AJOL)

    AVENA SATI VA L, GENOTYPES. SOWM Reuben. Sokoine University of Agriculture, Department of Crop Science,. P. O. Box 3005, Morogoro, Tanzania. ABSTRACT. An investigation of the genetic mechanisms controlling grain weights for the primary and secondary grains uniformity expressed in primary: secondary ...

  19. Evolution of orientations and deformation structures within individual grains in cold rolled columnar grained nickel

    DEFF Research Database (Denmark)

    Wu, G.L.; Godfrey, A.; Winther, Grethe

    2011-01-01

    Columnar grained Ni is used as a model material allowing simultaneous non-surface investigations of the evolution of crystallographic orientations and deformation microstructures within individual grains as a function of rolling strain up to ε=0.7. Electron channelling contrast and electron...

  20. Grain boundaries. Progress report, February 15, 1990--October 15, 1990

    Energy Technology Data Exchange (ETDEWEB)

    Balluffi, R.W.; Bristowe, P.D.

    1990-12-31

    The following are reported: structural studies (dislocation structure of Ni/Ag interphase boundary, structural complexity in grain boundaries with covalent bonding, relation between microscopic properties of two semiconducting grain boundaries and their orientations, diffraction effects due to double positioning in (111) Au bicrystals, sensitivity of diffraction profiles to grain boundary segregation, solute segregation at grain boundaries in Au, 4-body interatomic potential for Si for defect calculations); boundary migration studies (molecular dynamics study of grain boundary migration without participation of grain boundary dislocations); study of short-circuit diffusion along grain boundaries and its dependence on boundary structure; and thin-film deposition/bonding apparatus for manufacturing high-purity bicrystals.

  1. INFLUENCE OF ABNORMAL AUSTENITE GRAIN GRAIN GROWTH IN QUENCHED ABNT 5135 STEEL

    Directory of Open Access Journals (Sweden)

    Camila de Brito Ferreira

    2015-03-01

    Full Text Available Grain size in the steels is a relevant aspect in quenching and tempering heat treatments. It is known that high austenitizing temperature and long time provide an increase in austenitic grain sizes. Likewise, after hardening of low alloy steel, the microstructure consists of martensite and a volume fraction of retained austenite. This paper evaluates the influence of austenite grain size on the volume fraction of retained austenite measured by metallographic analyses and X-ray diffraction. The Mi and Mf temperatures were calculated using an empirical equation and experimentally determined by differential thermal analysis. The mechanical behavior of the steel was evaluated by Vickers microhardness testing. Differently from other results published in the literature that steel hardenability increases with the austenite grain size, it was observed that the increase in austenite grain promotes greater volume fraction of retained austenite after water quenching.

  2. Heterogeneous lamella structure unites ultrafine-grain strength with coarse-grain ductility.

    Science.gov (United States)

    Wu, Xiaolei; Yang, Muxin; Yuan, Fuping; Wu, Guilin; Wei, Yujie; Huang, Xiaoxu; Zhu, Yuntian

    2015-11-24

    Grain refinement can make conventional metals several times stronger, but this comes at dramatic loss of ductility. Here we report a heterogeneous lamella structure in Ti produced by asymmetric rolling and partial recrystallization that can produce an unprecedented property combination: as strong as ultrafine-grained metal and at the same time as ductile as conventional coarse-grained metal. It also has higher strain hardening than coarse-grained Ti, which was hitherto believed impossible. The heterogeneous lamella structure is characterized with soft micrograined lamellae embedded in hard ultrafine-grained lamella matrix. The unusual high strength is obtained with the assistance of high back stress developed from heterogeneous yielding, whereas the high ductility is attributed to back-stress hardening and dislocation hardening. The process discovered here is amenable to large-scale industrial production at low cost, and might be applicable to other metal systems.

  3. Abnormal Grain Growth Suppression in Aluminum Alloys

    Science.gov (United States)

    Hales, Stephen J. (Inventor); Claytor, Harold Dale (Inventor); Alexa, Joel A. (Inventor)

    2015-01-01

    The present invention provides a process for suppressing abnormal grain growth in friction stir welded aluminum alloys by inserting an intermediate annealing treatment ("IAT") after the welding step on the article. The IAT may be followed by a solution heat treatment (SHT) on the article under effectively high solution heat treatment conditions. In at least some embodiments, a deformation step is conducted on the article under effective spin-forming deformation conditions or under effective superplastic deformation conditions. The invention further provides a welded article having suppressed abnormal grain growth, prepared by the process above. Preferably the article is characterized with greater than about 90% reduction in area fraction abnormal grain growth in any friction-stir-welded nugget.

  4. Structure of grain boundaries in hexagonal materials

    CERN Document Server

    Sarrazit, F

    1998-01-01

    which allows the behaviour of line-defects to be studied in complex interfacial processes. The work presented in this thesis describes experimental and theoretical aspects associated with the structure of grain boundaries in hexagonal materials. It has been found useful to classify grain boundaries as low-angle, special or general on the basis of their structure. High-angle grain boundaries were investigated in tungsten carbide (WC) using conventional electron microscopy techniques, and three examples characteristic of the interfaces observed in this material were studied extensively. Three-dimensionally periodic patterns are proposed as plausible reference configurations, and the Burgers vectors of observed interfacial dislocations were predicted using a theory developed recently. The comparison of experimental observations with theoretical predictions proved to be difficult as contrast simulation techniques require further development for analysis to be completed confidently. Another part of this work invol...

  5. MIDDLEMEN IN THE MARKET FOR GRAIN: CHANGES AND COMPARISONS

    Directory of Open Access Journals (Sweden)

    Mary Eschelbach Hansen

    2000-01-01

    Full Text Available The role of middlemen in the market for grain changed with the advent of standardized grain grading. Prior to grain grading, economies of scale were limited because of the requirement that middlemen develop strong personal reputations though the maintenance of multi-faceted relationships with clients. Grain grading homogenized grain, making it possible for middlemen to take advantage of economies of scale in their operations.

  6. An Optical Study of Ice Grain Boundaries

    Science.gov (United States)

    Thomson, Erik S.

    The equilibrium phase geometry and evolution of polycrystals underlies the nature of materials. In particular, grain boundaries dominate the total interfacial area within polycrystalline materials. Our experimental studies are motivated by the importance of the structure, evolution, and thermodynamic behavior of grain boundaries near bulk melting temperatures. Ice is singled out as a material of interest due to its geophysical importance and its advantageous optical properties. An experimental apparatus and light reflection technique is designed to measure grain boundary melting in ice bicrystals, in thermodynamic equilibrium The technique allows continuous monitoring of reflected light intensity from the grain boundary as the temperature and solutal composition are systematically varied. For each sample the individual crystal orientations are also measured. The type and concentration of impurity in the liquid is controlled and the temperature is continuously recorded and controlled over a range near the melting point. An optical model of the interface is developed in order to convert experimental reflection data into a physical measurement of the liquidity of the grain boundary. Solutions are found for reflection and transmission amplitude coefficients for waves propagating from an arbitrarily oriented uniaxial anisotropic material into an isotropic material. This general model is used to determine solutions for three layer, ice/water/ice, systems with crystals of arbitrary orientation, and is broadly applicable to layered materials. Experimental results show thicker grain boundary liquid layers than expected from classical colligative effects. A physically realistic model of intermolecular interactions succeeds in bounding the measurements. These measurements may have important implications for understanding a wide range of effects in polycrystalline materials. Likewise, the experimental techniques and optical theory may be applied to other systems of broad

  7. Optimal energy management in grain drying.

    Science.gov (United States)

    Gunasekaran, S

    1986-01-01

    Grain drying is very specific to the geographic location, kind of drying system, and the type of grain. Under a given set of conditions, the optimal system can be selected based on careful evaluation. However, a good choice of drying systems, procedures, and management practices can be made from the information already available. The review of several grain-drying procedures has provided some insight in making a quick evaluation of the process and arriving at the most suitable system for a particular application. Despite extensive research efforts, the present knowledge of grain drying is yet insufficient to optimally design each drying process with respect to capacity, quality, and energy requirement. There is a need for incorporating grain and air parameters more accurately. It is also important to develop comprehensive drying simulation models to encompass agronomic practices, such as planting and harvesting. Recent efforts indicate a strong influence of planting and harvesting strategies on optimal drying and storage system selection. Results of the varietal trials at Ohio State University indicate that it is now possible to select midseason varieties, which dry down rapidly, without sacrificing yield. Also, low moisture at harvest is important to the energy management process because it affects total drying time and energy required. It is also important from a quality standpoint because kernel damage increases rapidly at harvesting moisture levels above 25%. The trend in grain-dryer design has shifted from focusing on drying capacity and operation reliability to energy consumption. The development in design of energy efficient continuous-flow dryers has been significant. Multistage concurrentflow dryers are excellent examples. Various aspects of dryer staging for efficient operation and control are yet to be determined. Recirculation of the exhaust air is a proven method of improving energy efficiency. Likewise, in batch-in-bin systems, stirring and

  8. Theoretical Analysis of Non-equilibrium Grain Boundaries Diffusion Properties Recovery during Ultra-fine Grain Metals and Alloys Annealing

    Directory of Open Access Journals (Sweden)

    Vladimir N. Chuvil’deev

    2013-01-01

    Full Text Available The article presents the results of theoretical analysis of non-equilibrium grain boundaries diffusion properties recovery during ultra-fine grain (UFG materials annealing, produced by severe plastic deformation (SPD method. The paper proves that activation energy and grain boundary diffusion coefficient of UFG materials depend on density of defects, cumulated by grain boundary during SPD.Annealing causes diffusion redistribution of defects in grain boundaries, which results in diffusion properties change. Diffusion properties recovery rate depends on grain size and it is much higher in UFG materials than in coarse-grained materials.

  9. Factors of wheat grain resistance to Fusarium head blight

    Directory of Open Access Journals (Sweden)

    Charlotte MARTIN

    2017-05-01

    Full Text Available Fusarium head blight (FHB, caused by Fusarium graminearum, is an important wheat disease that affects grain yield and conformation, and contaminates grains with mycotoxins, including the trichothecene deoxynivalenol (DON. The impacts of Fusarium infections on grain filling, grain deformation and rheological properties were assessed under different environmental conditions. Genotypes with elevated grain anthocyanin content were used. Resistance of seven wheat varieties and breeding lines was assessed with artificial infections in the field. Grains from infected and control plots were assessed for proportion of Fusarium damaged kernels, grain filling (thousand kernel weight and DON accumulation. Biochemical and rheological properties of harvested grain were also assessed. Grain resistance to Fusarium has several components, including resistance against DON accumulation, deformation and stability of grain filling. These mechanisms are interdependent but act independently. Resistance against DON contamination was highly influenced by environmental conditions, but environment had little effect on the other resistance components. Anthocyanins and protein concentrations were unchanged in infected grains, suggesting that FHB does not affect grain biosynthesis processes but impacts the transport of assimilates caused by changes in grain composition. We suggest that this is the reason for the alterations of rheological properties. The greater the grain resistance, the less was the impact on dough properties. This study suggests that the resilience of rheological properties under FHB infection pressure is an additional component of grain resistance to the disease.

  10. Theoretical Analysis of Non-equilibrium Grain Boundaries Diffusion Properties Recovery during Ultra-fine Grain Metals and Alloys Annealing

    OpenAIRE

    Vladimir N. Chuvil’deev; Vladimir I. Kopylov; Aleksey V. Nokhrin; Olga E. Pirozhnikova

    2013-01-01

    The article presents the results of theoretical analysis of non-equilibrium grain boundaries diffusion properties recovery during ultra-fine grain (UFG) materials annealing, produced by severe plastic deformation (SPD) method. The paper proves that activation energy and grain boundary diffusion coefficient of UFG materials depend on density of defects, cumulated by grain boundary during SPD.Annealing causes diffusion redistribution of defects in grain boundaries, which results in diffusion pr...

  11. Assessment of MARMOT Grain Growth Model

    Energy Technology Data Exchange (ETDEWEB)

    Fromm, B. [Idaho National Lab. (INL), Idaho Falls, ID (United States). Fuel Modeling and Simulation Dept.; Zhang, Y. [Idaho National Lab. (INL), Idaho Falls, ID (United States). Fuel Modeling and Simulation Dept.; Schwen, D. [Idaho National Lab. (INL), Idaho Falls, ID (United States). Fuel Modeling and Simulation Dept.; Brown, D. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Pokharel, R. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2015-12-01

    This report assesses the MARMOT grain growth model by comparing modeling predictions with experimental results from thermal annealing. The purpose here is threefold: (1) to demonstrate the validation approach of using thermal annealing experiments with non-destructive characterization, (2) to test the reconstruction capability and computation efficiency in MOOSE, and (3) to validate the grain growth model and the associated parameters that are implemented in MARMOT for UO2. To assure a rigorous comparison, the 2D and 3D initial experimental microstructures of UO2 samples were characterized using non-destructive Synchrotron x-ray. The same samples were then annealed at 2273K for grain growth, and their initial microstructures were used as initial conditions for simulated annealing at the same temperature using MARMOT. After annealing, the final experimental microstructures were characterized again to compare with the results from simulations. So far, comparison between modeling and experiments has been done for 2D microstructures, and 3D comparison is underway. The preliminary results demonstrated the usefulness of the non-destructive characterization method for MARMOT grain growth model validation. A detailed analysis of the 3D microstructures is in progress to fully validate the current model in MARMOT.

  12. Physical properties of sunflower grains after drying

    Directory of Open Access Journals (Sweden)

    Paulo Carteri Coradi

    2015-12-01

    Full Text Available The knowledge of the physical properties of the grains is important for the optimization of post-harvest operations. This study aimed to evaluate the effects of convective drying with different air temperatures (45, 55, 65 and 75 °C the physical properties of sunflower seeds. The drying sunflower grains was performed in convection oven with forced air. In natural conditions, samples of 5 kg of pellets were used for each repetition drying. During the drying process, the grains samples were weighed periodically until they reach 10% (wet basis, w.b., then were subjected to evaluations of physical properties. According to the results it was observed that the porosity, apparent density, thousand kernel weight to the drag coefficient, roundness, sphericity and width of sunflower seed did not change with increasing temperature drying air. It was concluded that the drying air temperatures of 45 °C and 55 retained the initial physical characteristics of sunflower seeds. The temperature of the drying air of 75 °C had greater influence on changes in volumetric shrinkage of the grains.

  13. Malta and the Nineteenth Century Grain Trade

    DEFF Research Database (Denmark)

    Sharp, Paul Richard

    2009-01-01

    It is often assumed that Britain's colonies followed the British doctrine of free trade in the second half of the nineteenth century. Malta, which became a British colony in 1814, did indeed become an early free trader. However, she failed to liberalize the grain trade, even when the mother country...

  14. Malta and the Nineteenth Century Grain Trade

    DEFF Research Database (Denmark)

    Sharp, Paul Richard

    It is often assumed that Britain's colonies followed the British doctrine of free trade in the second half of the nineteenth century. Malta, which became a British colony in 1814, did indeed become an early free trader. However, she failed to liberalize the grain trade, even when the mother country...

  15. Interactions between Dislocations and Grain Boundaries

    NARCIS (Netherlands)

    Soer, Wouter Anthon

    2006-01-01

    Dislocations (line defects) and grain boundaries (planar defects) are two types of lattice defects that are crucial to the deformation behavior of metals. Permanent deformation of a crystalline material is microscopically associated with the nucleation and propagation of dislocations, and extensive

  16. Texture measurements in fine grained polyphase aggregates

    Science.gov (United States)

    Kilian, R.; Heilbronner, R.; Stünitz, H.

    2009-04-01

    When analyzing natural and experimental microstructures, we routinely use the two methods for orientation imaging and texture measurements: (a) the computer-integrated polarization microscopy (CIP, Panozzo Heilbronner & Pauli, 1993) and (b) the electron back scatter diffractometry (EBSD, e.g. Kunze et al., 1994). The CIP method yields orientation maps and pole figures of c-axes (of uni-axial materials), while the EBSD method yields complete textural data for all crystallographic orientations. In order to compare the orientation images the Euler maps (obtained from EBSD) are recalculated and presented with the more intuitive colour look-up tables (CLUTs) of the CIP method. In this contribution we compare and contrast the results achieved by these two methods using two different samples taken from a metagranodiorite (Kilian et al., 2009): (1) a coarse grained mylonitic rock with polycrystalline quartz aggregates and (2) a very fine grained ultramylonitic rock with single quartz grains dispersed in a polymineralic matrix. For the coarse grained sample (1) both methods yield the same (strong) c-axis pole figure: the geometry of the c-axis polefigure as well as the texture intensity (maximum of polefigure) are identical. The texture of sample (2) - where small quartz grains are dispersed in the polymineralic matrix - is very weak to random. The CIP and EBSD c-axis pole figures are different and - as noted previously - these differences arise from a machine specific bias of the EBSD (Schmocker 2002). In addition to texture analysis, both methods are capable of image segmentation (identification and separation of individual grains in the orientation image) as well as shape and grain size analysis. However due to the entirely different approach taken, the results may differ significantly. For example, when deriving the grain size distribution for sample (2) EBSD (combined with with the OIM® analysis software) yields a positively skewed histogram (with the mode occurring

  17. Coarse grained model for semiquantitative lipid simulations

    NARCIS (Netherlands)

    Marrink, SJ; de Vries, AH; Mark, AE

    2004-01-01

    This paper describes the parametrization of a new coarse grained (CG) model for lipid and surfactant systems. Reduction of the number of degrees of freedom together with the use of short range potentials makes it computationally very efficient. Compared to atomistic models a gain of 3-4 orders of

  18. Traditional grains boost nutrition in rural India

    International Development Research Centre (IDRC) Digital Library (Canada)

    The availability of affordable and nutritious alternative grains and legumes could help alleviate poverty and nutrition insecurity in rural. India, particularly among vulnerable women and children. The research. This project, supported by IDRC and DFATD through the. Canadian International Food Security Research Fund.

  19. The Grain Group. The Food Guide Pyramid.

    Science.gov (United States)

    Frost, Helen

    This booklet for young children is part of a series that supports national science standards related to physical health and nutrition, describing and illustrating the importance of using the Food Guide Pyramid and eating sufficient servings of grains. Colorful photographs support early readers in understanding the text. The repetition of words and…

  20. Pollen Grains, Random Walks and Einstein

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 12. Pollen Grains, Random Walks and Einstein. Sriram Ramaswamy. Volume 10 Issue 12 December 2005 pp 106-124. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/reso/010/12/0106-0124 ...

  1. Pollen Grains, Random Walks and Einstein

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 5; Issue 3. Pollen Grains, Random Walks and Einstein. Sriram Ramaswamy. General Article Volume 5 Issue 3 March 2000 pp 16-34. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/reso/005/03/0016-0034 ...

  2. The valuation of commercial grain silos

    African Journals Online (AJOL)

    The determination of income projections, capitalisation rates, discount rates and depreciation percentages in the three methods are virtually impossible to calculate, due to grain silos rarely being sold on the open market (Purnell, 2015). It is clear that one of the methods of valuation will have to be applied to the valuation of.

  3. Structures and transitions in tungsten grain boundaries

    Energy Technology Data Exchange (ETDEWEB)

    Frolov, T. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Zhu, Q. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Marian, J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Rudd, R. E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2017-02-07

    The objective of this study is to develop a computational methodology to predict structure, energies of tungsten grain boundaries as a function of misorientation and inclination. The energies and the mobilities are the necessary input for thermomechanical model of recrystallization of tungsten for magnetic fusion applications being developed by the Marian Group at UCLA.

  4. REPLACEMENT OF BARLEY GRAINS AND DEHYDRATED ...

    African Journals Online (AJOL)

    S. A. Kadi, A. Mouhous, F. Djellal, T.Gidenne

    1 janv. 2017 ... ISSN 1112-9867. Available online at http://www.jfas.in ndamental and Applied Sciences is licensed under a Creative Commons Attribution-NonCom. License. Libraries Resource Directory. We are listed under Research Associations category. T OF BARLEY GRAINS AND DEHYDRATED ALFALFA BY SU.

  5. Grain Unloading Of Arsenic Species In Rice

    Science.gov (United States)

    Rice (Oryza sativa) is the staple food for over half the world's population yet may represent a significant dietary source of inorganic arsenic (As), a nonthreshold, class 1 human carcinogen. Rice grain As is dominated by the inorganic species, and the organic species dim...

  6. Local Alignments for Fine-Grained Categorization

    NARCIS (Netherlands)

    Gavves, E.; Fernando, B.; Snoek, C.G.M.; Smeulders, A.W.M.; Tuytelaars, T.

    2015-01-01

    The aim of this paper is fine-grained categorization without human interaction. Different from prior work, which relies on detectors for specific object parts, we propose to localize distinctive details by roughly aligning the objects using just the overall shape. Then, one may proceed to the

  7. Yield stress of ultrafine-grained or nanocrystalline materials with a bimodal grain size distribution

    Science.gov (United States)

    Pande, C. S.; DeGiorgi, V. G.; E Moser, A.

    2018-02-01

    An attractive processing route for enhancing the yield strength of high-strength nanocrystalline metals and alloys while maintaining high ductility is to develop a bimodal grain size distribution (GSD), in which, supposedly, the finer grains provide strength, and the coarser grains maintain or even enhance ductility. We present a theoretical model predicting the strength of such a system, and show, analytically, how the yield stress is related to the various parameters of the bimodal GSD, such as volume fraction of the two components of the bimodal distribution and their standard deviations.

  8. Grain legume protein quality: a hot subject

    Directory of Open Access Journals (Sweden)

    Vaz Patto, Maria Carlota

    2016-06-01

    Full Text Available Grain legumes, also called pulses, play a key role in the nutritional improvement of food and feed. These legumes are important sources of protein as well as other nutritional compounds. Today, protein is one of the most sought after ingredients in the market and grain legumes represent one of the most sustainable protein sources. However, not all grain legume proteins are nutritionally equal. Their quality varies and depends on their amino acid composition and digestibility. In this article, we review concepts related to grain legume protein quality and discuss challenges regarding their genetic improvement. A comprehensive database of grain legume amino acid profiles and protein digestibility is needed to address the matter of protein quality in grain legume breeding. This database will be enhanced by quantitative information on digestibility-reducing bioactive compounds and the development of reliable screening tools. The achievement of higher protein quality grain legume varieties, better adjusted to animal and human requirements, will cut dietary protein content, associated costs and nitrogen excretion, thus reducing the environmental impact.Las leguminosas grano tienen un alto potencial en alimentación humana y animal siendo una importante fuente de proteínas así como de otros compuestos beneficiosos para la nutrición y salud. La proteína es uno de los ingredientes más demandados y las leguminosas grano son una delas fuentes más sostenible de proteína. Sin embargo, no todas las leguminosas grano son igual de nutritivas, variando la calidad con la composición de aminoácidos y su digestibilidad. En este artículo revisaremos los conceptos de calidad de la proteína y discutiremos las posibilidades de mejora genética. Para abordar con éxito la mejora de la calidad de la proteína será de gran ayuda disponer de bases de datos con los perfiles de aminoácidos y de digestibilidad, así como de información cuantitativa sobre los

  9. Direct observation of the effects of cellulose synthesis inhibitors using live cell imaging of Cellulose Synthase (CESA) in Physcomitrella patens

    OpenAIRE

    Tran, Mai L.; McCarthy, Thomas W.; Sun, Hao; Wu, Shu-Zon; Norris, Joanna H.; Bezanilla, Magdalena; Vidali, Luis; Anderson, Charles T.; Roberts, Alison W.

    2018-01-01

    Results from live cell imaging of fluorescently tagged Cellulose Synthase (CESA) proteins in Cellulose Synthesis Complexes (CSCs) have enhanced our understanding of cellulose biosynthesis, including the mechanisms of action of cellulose synthesis inhibitors. However, this method has been applied only in Arabidopsis thaliana and Brachypodium distachyon thus far. Results from freeze fracture electron microscopy of protonemal filaments of the moss Funaria hygrometrica indicate that a cellulose s...

  10. A synteny-based draft genome sequence of the forage grass Lolium perenne

    OpenAIRE

    Byrne Stephen L.; Nagy Istvan; Pfeifer Matthisas; Armstead Ian; Swain Suresh; Studer Bruno; Mayer Klaus; Campbell Jacqueline D.; Czaban Adrian; Hentrup Stephan; Paniz Frank; Bendixen Christian; Hedegaard Jakob; Caccamo Mario; Asp Torben

    2015-01-01

    Here we report the draft genome sequence of perennial ryegrass (Lolium perenne) an economically important forage and turf grass species that is widely cultivated in temperate regions worldwide. It is classified along with wheat barley oats and Brachypodium distachyon in the Pooideae sub family of the grass family (Poaceae). Transcriptome data was used to identify 28 455 gene models and we utilized macro co linearity between perennial ryegrass and barley and synteny within the grass family to ...

  11. Outcomes Following Traumatic Grain Elevator Injuries.

    Science.gov (United States)

    Tolefree, Sydnei; Truong, Anthony; Ward, Jeanette; Dong, Fanglong; Ablah, Elizabeth; Haan, James

    2017-01-01

    The absence of a comprehensive database of grain elevator-associated injuries hinders accurate evaluation of injury prevalence and may lead to discordant information about injury frequencies. The main purpose of this study was to identify the most common mechanisms of injury related to grain elevator events. Comparisons of hospital outcomes between patients who sustained traumatic injuries associated with grain elevators at Occupational Safety and Health Administration (OSHA)-regulated industrial sites versus those on OSHA-exempt farming operations were also made. A retrospective review was conducted of all patients' presenting with grain elevator-related injuries at a level-1 trauma center between January 1, 2003, and December 31, 2013. Data collected included demographics, mechanism of injury, injury severity, hospitalization details, and discharge disposition. Data were summarized, and comparisons were made between the groups. All patients (N = 18) in the study were male, with a mean age of 37 years. Falls and being caught in equipment each accounted for 27.8% of injuries. Among the 18 patients, there were a total of 37 injuries. The majority of injuries were either lower extremity (29.7%) or chest injuries (21.6%). The average hospital length of stay was 4 ± 4.5 days, and one patient required mechanical ventilation. There were no reported deaths. The literature reports entrapments as the leading cause of grain elevator-related injuries; however, this study found that falls and being caught in equipment were the most common mechanisms of injury. This suggests that a greater emphasis should be placed on fall prevention and equipment safety.

  12. Grain- to multiple-grain-scale deformation processes during diffusion creep of forsterite + diopside aggregate: 2. Grain boundary sliding-induced grain rotation and its role in crystallographic preferred orientation in rocks

    Science.gov (United States)

    Maruyama, G.; Hiraga, T.

    2017-08-01

    Polycrystalline samples composed of either tabular or equiaxed forsterite grains +diopside (5 and 20 vol %) were deformed with a grid etched onto the lateral surface. In Part 1 of this study, we identified grain boundary sliding (GBS) and rigid body-like grain rotation during deformation by diffusion creep where samples with tabular forsterite grains were shown to develop low-index plane grain boundaries that result in crystallographic preferred orientation (CPO). Here we examine how grain rotation depends on the sample strain, grain size, phases, grain shapes, and orientations relative to the compression axis and long axes of tabular forsterite grains. Based on these results, we model grain rotation due to GBS that occurs preferentially along low-index plane boundaries. The model reproduces all of the characteristics of grain rotation and together with the observed grain rotation rates in tabular and equiaxed grain samples, we estimate that low-index plane boundaries have a lower viscosity by a factor of 3 relative to general grain boundaries, which results in the development of CPO during diffusion creep. The observed constant rotation rate of 0.4 (radian/strain) in equiaxed-grain samples and in tabular-grain samples deformed to a strain of >0.5 is considered to be a minimum and further, a material-independent rotation rate during diffusion creep, indicating grain rotation as a primary microprocess during diffusion creep. We discuss the possible consequences of GBS-induced grain rotation and CPO development in rock microstructure and the seismic properties of the Earth's mantle.

  13. (Investigations of ultrasonic wave interactions with grain boundaries and grain imperfections)

    Energy Technology Data Exchange (ETDEWEB)

    1990-01-01

    The main objective of our research is to obtain a better understanding of ultrasonic wave interaction with interfaces in polycrystalline materials. This report discusses two recently developed experimental techniques: scanning acoustic microscope and optical point sensors. As for general wave propagation problems in anisotropic media, four major topics are discussed in separate sections. First, single boundaries between large bicrystals are considered. The reflection and transmission coefficients of such interfaces are calculated for imperfect boundary conditions by using the finite interface stiffness approach. Ultrasonic transmission through multiple-grain structures are investigated by computer simulation based on the statistical evaluation of repeated acoustical wave interactions with individual grain boundaries. The number of grains interacting with the propagating acoustical wave is considered to be high enough to approximate the wave-material interaction as scattering on elastic inhomogeneities. The grain scattering induced attenuation of Rayleigh waves is investigated in polycrystalline materials. 41 refs., 43 figs.

  14. ESTIMATING THE INTENSITY OF GERM-GRAIN MODELS WITH OVERLAPPING GRAINS

    Directory of Open Access Journals (Sweden)

    Hamid Ghorbani

    2011-05-01

    Full Text Available Formulas are derived for the spherical contact distribution of a planar germ-grain model Z with circular grains where the germs formeither a 'segment cluster' process or a 'line-based' Poisson point process. They are used in order to estimate the intensityl of the germprocess by means of the spherical contact distribution function. As an application the number of dislocations on a silicon wafer is estimated.

  15. Abnormal grain growth in AISI 304L stainless steel

    Energy Technology Data Exchange (ETDEWEB)

    Shirdel, M., E-mail: mshirdel1989@ut.ac.ir [School of Metallurgy and Materials Engineering, College of Engineering, University of Tehran, P.O. Box 11155-4563, Tehran (Iran, Islamic Republic of); Mirzadeh, H., E-mail: hmirzadeh@ut.ac.ir [School of Metallurgy and Materials Engineering, College of Engineering, University of Tehran, P.O. Box 11155-4563, Tehran (Iran, Islamic Republic of); Advanced Metalforming and Thermomechanical Processing Laboratory, School of Metallurgy and Materials Engineering, University of Tehran, Tehran (Iran, Islamic Republic of); Parsa, M.H., E-mail: mhparsa@ut.ac.ir [School of Metallurgy and Materials Engineering, College of Engineering, University of Tehran, P.O. Box 11155-4563, Tehran (Iran, Islamic Republic of); Center of Excellence for High Performance Materials, School of Metallurgy and Materials Engineering, University of Tehran, Tehran (Iran, Islamic Republic of); Advanced Metalforming and Thermomechanical Processing Laboratory, School of Metallurgy and Materials Engineering, University of Tehran, Tehran (Iran, Islamic Republic of)

    2014-11-15

    The microstructural evolution during abnormal grain growth (secondary recrystallization) in 304L stainless steel was studied in a wide range of annealing temperatures and times. At relatively low temperatures, the grain growth mode was identified as normal. However, at homologous temperatures between 0.65 (850 °C) and 0.7 (900 °C), the observed transition in grain growth mode from normal to abnormal, which was also evident from the bimodality in grain size distribution histograms, was detected to be caused by the dissolution/coarsening of carbides. The microstructural features such as dispersed carbides were characterized by optical metallography, X-ray diffraction, scanning electron microscopy, energy dispersive X-ray analysis, and microhardness. Continued annealing to a long time led to the completion of secondary recrystallization and the subsequent reappearance of normal growth mode. Another instance of abnormal grain growth was observed at homologous temperatures higher than 0.8, which may be attributed to the grain boundary faceting/defaceting phenomenon. It was also found that when the size of abnormal grains reached a critical value, their size will not change too much and the grain growth behavior becomes practically stagnant. - Highlights: • Abnormal grain growth (secondary recrystallization) in AISI 304L stainless steel • Exaggerated grain growth due to dissolution/coarsening of carbides • The enrichment of carbide particles by titanium • Abnormal grain growth due to grain boundary faceting at very high temperatures • The stagnancy of abnormal grain growth by annealing beyond a critical time.

  16. Development of two-stage grain grinder

    Directory of Open Access Journals (Sweden)

    V. N. Trubnikov

    2016-01-01

    Full Text Available The most important task in the development of the diet of farm animals feeding is a selection of the most balanced in its composition and most nutritious feeds, which are safe and meet all the necessary requirements at the same time. To evaluate the productive value of feeds and their effectiveness the rate of food productive action η was proposed. This ratio reflects the productive part of the total value of the exchange energy of the daily feed ration and is an essential criterion of the feed quality indicators. In the feed rations of animals the most expensive, but energy-rich feed is a mixed fodder, a mixture of grinded seeds of agricultural crops and protein, mineral and vitamin additives. In the diet for its nutritional value, this feed product is for cattle – 50, pigs – 60… 100 and birds – 100%. The basic operation in the production of mixed fodder is seeds grinding, i.e. their destruction under the influence of external forces, exceeding the forces of molecular adhesion of the grains particles. To grind the grain different ways are used: chopping, grinding, impact «in flight», crushing, etc. In the production of mixed fodder on the existing production equipment, there is the problem of getting the grain mixed fodder the necessary degree of grinding and uniform in its particle size distribution at the same time. When receiving too coarse grinding there is a problem of difficult digestibility of mixed fodder by farm animals. Moreover grinding process is accompanied by a high energy consumption. Grain grinder, the principle of which is based on the implementation of two ways of grinding grain: splitting and impact «in flight» is proposed. The proposed constructive solutions allow to obtain a high-performance technical means for crushing seeds of crops, as well as reduce energy costs that arise during the course of the process of obtaining of mixed fodder. The methodology justification of degree of grain grinding by

  17. Grain Refinement of Permanent Mold Cast Copper Base Alloys

    Energy Technology Data Exchange (ETDEWEB)

    M.Sadayappan; J.P.Thomson; M.Elboujdaini; G.Ping Gu; M. Sahoo

    2005-04-01

    Grain refinement is a well established process for many cast and wrought alloys. The mechanical properties of various alloys could be enhanced by reducing the grain size. Refinement is also known to improve casting characteristics such as fluidity and hot tearing. Grain refinement of copper-base alloys is not widely used, especially in sand casting process. However, in permanent mold casting of copper alloys it is now common to use grain refinement to counteract the problem of severe hot tearing which also improves the pressure tightness of plumbing components. The mechanism of grain refinement in copper-base alloys is not well understood. The issues to be studied include the effect of minor alloy additions on the microstructure, their interaction with the grain refiner, effect of cooling rate, and loss of grain refinement (fading). In this investigation, efforts were made to explore and understand grain refinement of copper alloys, especially in permanent mold casting conditions.

  18. Preservative property of Aframomum danielli fractions in stored grains

    African Journals Online (AJOL)

    AJB SERVER

    2007-02-05

    Pruthi, 1980). Essential oils of thyme and oregano are effective fumi- gants against fungi which attack stored grains. This property strengthens the probability of their use as alternative chemicals in the storage of grains (Pasteur et.

  19. Collisions between grains in a turbulent gas. [in interstellar medium

    Science.gov (United States)

    Voelk, H. J.; Morfill, G. E.; Roeser, S.; Jones, F. C.

    1980-01-01

    Turbulent gas motions will induce random velocities of small dust grains that are imbedded in the gas. Within large eddies the friction forces from the gas lead to strongly correlated velocities for neighboring grains, whereas small eddies cause uncorrelated grain motions. The nonlinear response of a grain to eddy motion is calculated. This leads to a turbulent pressure within the dust component as well as to collisions between pairs of grains. The results are evaluated numerically for a Kolmogoroff spectrum and turbulent collision rates are calculated for molecular clouds and protostellar environments. Whereas grain-grain collisions should not modify the initial size distribution in molecular clouds to a significant extent, they will lead to an entirely different grain population in protostars.

  20. Interpretation of single grain De distributions and calculation of De

    CSIR Research Space (South Africa)

    Jacobs, Z

    2006-03-01

    Full Text Available distribution obtained using the single aliquot measurement protocol on each grain that had previously received a known laboratory dose; after systematic rejection of grains that did not pass defined acceptance criteria, over dispersion of 7% was found...

  1. Longitudinal Decline in Lung Function Measurements among Saskatchewan Grain Workers

    Directory of Open Access Journals (Sweden)

    Punam Pahwa

    2003-01-01

    Full Text Available OBJECTIVE: To evaluate the relationship between the long term effects of grain dust and decline in lung function among grain elevator workers in Saskatchewan, studied over a 15-year period.

  2. Grain boundary and triple junction diffusion in nanocrystalline copper

    Energy Technology Data Exchange (ETDEWEB)

    Wegner, M., E-mail: m.wegner@uni-muenster.de; Leuthold, J.; Peterlechner, M.; Divinski, S. V., E-mail: divin@uni-muenster.de [Institut für Materialphysik, Universität Münster, Wilhelm-Klemm-Straße 10, D-48149, Münster (Germany); Song, X., E-mail: xysong@bjut.edu.cn [College of Materials Science and Engineering, Beijing University of Technology, 100124 Beijing (China); Wilde, G. [Institut für Materialphysik, Universität Münster, Wilhelm-Klemm-Straße 10, D-48149, Münster (Germany); Institute of Nanochemistry and Nanobiology, School of Environmental and Chemical Engineering, Shanghai University, 200444 Shanghai (China)

    2014-09-07

    Grain boundary and triple junction diffusion in nanocrystalline Cu samples with grain sizes, 〈d〉, of ∼35 and ∼44 nm produced by spark plasma sintering were investigated by the radiotracer method using the {sup 63}Ni isotope. The measured diffusivities, D{sub eff}, are comparable with those determined previously for Ni grain boundary diffusion in well-annealed, high purity, coarse grained, polycrystalline copper, substantiating the absence of a grain size effect on the kinetic properties of grain boundaries in a nanocrystalline material at grain sizes d ≥ 35 nm. Simultaneously, the analysis predicts that if triple junction diffusion of Ni in Cu is enhanced with respect to the corresponding grain boundary diffusion rate, it is still less than 500⋅D{sub gb} within the temperature interval from 420 K to 470 K.

  3. Fatigue in tension perpendicular to the grain

    DEFF Research Database (Denmark)

    Clorius, Christian Odin; Pedersen, Martin Bo Uhre; Hoffmeyer, Preben

    1999-01-01

    Traditinally fatigue resistance is quantified as number of cycles to failure at a given stress level. A previous study by the authors showed that fatigue in compression parallel to the grain is governed partly by duration of load and partly by an effect of loading, i.e. a combination of a creep...... and on dowel type joints with slotted in steel plates. In series of ten, the small specimens are taken to fatigue failure in uniform tension at square wave shaped load cycles at 0.01 Hz and 0.1 Hz. In order to test the predictive validity of the result from the small tension specimens, fatigue experiments...... mechanism and a mechanism connected to damage introduce in the loading sequences. The purpose of the present study is to disentangle the effect of duration of load from the effect of load oscillation in fatigue in tension perpendicular to the grain. Fatigue experiments are made on small specimens...

  4. Fatigue In Tension Perpendicular to the Grain

    DEFF Research Database (Denmark)

    Clorius, Christian Odin; Pedersen, Martin Uhre; Hoffmeyer, Preben

    2004-01-01

    Traditionally fatigue resistance is quantified as number of cycles to failure at a given stress level. A previous study by the authors showed that fatigue in compression parallel to the grain is governed partly by duration of load and partly by an effect of loading, i.e. a combination of a creep...... and on dowel type joints with slotted in steel plates. In series of ten, the small specimens are taken to fatigue failure in uniform tension at square wave shaped load cycles at 0.01 Hz and 0.1 Hz. In arder to test the predictive validity of the result from the small tension specimens, fatigue experiments...... mechanism and a mechanism connected to damage introduced in the loading sequences. The purpose of the present study is to disentangle the effect of duration of load from the effect of load oscillation in fatigue in tension perpendicular to the grain. Fatigue experiments are made on small specimens...

  5. Composite grains: Application to circumstellar dust

    Directory of Open Access Journals (Sweden)

    D. B. Vaidya

    2011-09-01

    Full Text Available Using the discrete dipole approximation (DDA we calculate the absorption efficiency of the composite grain, made up of a host silicate spheroid and inclusions of graphite, in the spectral region 5.0-25.0μm. We study the absorption as a function of the voulume fraction of the inclusions. In particular, we study the variation in the 10.0μm and 18.0μm emission features with the volume fraction of the inclusions. Using the extinction efficiencies, of the composite grains we calculate the infrared fluxes at several dust temperatures and compare the model curves with the observed infrared emission curves (IRAS-LRS, obtained for circumstellar dust shells around oxygen rich M-type stars.

  6. Argyrophilic grain disease: An underestimated tauopathy

    Directory of Open Access Journals (Sweden)

    Roberta Diehl Rodriguez

    Full Text Available Argyrophilic grain disease (AGD is an under-recognized, distinct, highly frequent sporadic tauopathy, with a prevalence reaching 31.3% in centenarians. The most common AGD manifestation is slowly progressive amnestic mild cognitive impairment, accompanied by a high prevalence of neuropsychiatric symptoms. AGD diagnosis can only be achieved postmortem based on the finding of its three main pathologic features: argyrophilic grains, oligodendrocytic coiled bodies and neuronal pretangles. AGD is frequently seen together with Alzheimer's disease-type pathology or in association with other neurodegenerative diseases. Recent studies suggest that AGD may be a defense mechanism against the spread of other neuropathological entities, particularly Alzheimer's disease. This review aims to provide an in-depth overview of the current understanding on AGD.

  7. Combining ability of white grain popcorn populations

    Directory of Open Access Journals (Sweden)

    Carlos Alberto Scapim

    2006-01-01

    Full Text Available The objectives of this study were to indicate the best improvement strategy and select parents to begin animprovement program of white grain popcorn based on the combining ability and heterosis of eight populations selected inexperiments in the northwestern region of Paraná. The traits plant and ear height, grain yield and popping expansion wereevaluated. The base populations, the F1 and five controls were evaluated in Maringá, state of Paraná, over the course of twoyears. Heterosis for popping expansion was very low and the best improvement strategy is to raise the values of poppingexpansion up to commercial levels through intrapopulation improvement of the populations BRS Angela and SC 002. Intenseselection must be applied to reduce plant and ear height; interpopulation selection must not be initiated at this moment.

  8. Review of water footprint components of grain

    Science.gov (United States)

    Ahmad, Wan Amiza Amneera Wan; Meriam Nik Sulaiman, Nik; Zalina Mahmood, Noor

    2017-06-01

    Burgeoning global population, economic development, agriculture and prevailing climate pattern are among aspects contributed to water scarcity. In low and middle income countries, agriculture takes the highest share among water user sector. Demand for grain is widespread all over the globe. Hence, this study review published papers regarding quantification of water footprint of grain. Review shows there are various methods in quantifying water footprint. In ascertaining water footprint, three (green, blue, grey) or two (green, blue) components of water footprint involved. However, there was a study introduced new term in evaluating water footprint, white water footprint. The vulnerability of varying methods is difficulty in conducting comparative among water footprint. Salient source in contributing high water footprint also varies. In some studies, green water footprint play major role. Conversely, few studies found out blue water footprint most contributing component in water footprint. This fluctuate pattern influenced by various aspects, namely, regional climatic characteristics, crop yield and crop types.

  9. STUDY ON GRAIN MARKET IN THE WORLD

    Directory of Open Access Journals (Sweden)

    Elena COFAS

    2013-01-01

    Full Text Available In the global economy, the market occupies a representative place because the grain is grown on a large area and it is important both to ensure food security and safety, but also for animal feed. In order to accomplish this study we have used certain indicators, of which the most representative are: acreage, production obtained, yield per hectare, food consumption, imports, exports and last but not least the price. World market of cereals has increased in the past decade due to increased consumption of cereals, especially in less developed countries economically. World grain market evolution in the analyzed period was disrupted on one side by the global economic crisis and on the other side by bad weather changes that occur on a global scale and have had a negative impact on acreage, production achieved, prices etc. According to forecasts the global market for cereals is expected to increase trade with cerereale, while diminishing stocks.

  10. Economic efficiency of the maize grain

    Directory of Open Access Journals (Sweden)

    Ana Mariana Dincu

    2014-10-01

    Full Text Available In this work, was calculated and the level of profitability for several levels of production for grain maize cultivation. We chose corn because it is one of the most important forage crops, we could say even the largest, occupying third place among cultivated plants worldwide. Along with wheat and barley, the food is the biggest part of the population in the world, directly or converted to animal products. Maize can be used in animal feed in various forms. The most used is corn grain, which is characterized by a very high nutritional value, this product is properly regarded as a feed concentrate. Culture of maize have been designed two levels of production: 4000 kg / ha and 6000 kg / ha.

  11. DEVELOPING A MODEL OF COOKING GRAIN BATCH

    Directory of Open Access Journals (Sweden)

    E. N. Konstantinov

    2014-01-01

    Full Text Available Summary. By batch cooking of grain accumulated considerable experimental and production material. However, the theory of this process has not been developed to the desired extent. It is shown that the mathematical modeling of the process of cooking the grain batch can be used as a basis for non-stationary diffusion equation and its numerical solution based on the grid method. It is shown that in addition to non-stationary diffusion process by using the grid method can take into account the temperature processes and the theory of swelling of the starch granules. The values of the activation energy of diffusion bound moisture in grains and the pre-exponential value were determined. To describe the swelling of the starch granules used solutions sufficiently numerous studies, and the selected model based on chemical reaction kinetics of the second order. Elaboration of the model of cooking done on experimental data for wheat grits, and concluded the need to address the gap of the starch granules during swelling and separation of layers of material adjacent to the liquid phase during the entire process until the complete cooking of cereal grits. An enlarged under a microscope photos edge dry and tenderized particles showing swelling of the starch granules and the isolation of the outer layer of the particle. Simultaneously taken into account in the model dynamics of temperature changes during heating and mixing the grain of cooking. The simulation results are identified according to a pilot study of cooking barley grits. Found that the developed model accurately describes the results of the pilot study. It is shown that the mathematical model based on the non-stationary diffusion equation, excluding the effects of temperature and swelling of the starch granulestheory gives too high of cooking time.

  12. Genetic engineering for high methionine grain legumes.

    Science.gov (United States)

    Müntz, K; Christov, V; Saalbach, G; Saalbach, I; Waddell, D; Pickardt, T; Schieder, O; Wüstenhagen, T

    1998-08-01

    Methionine (Met) is the primary limiting essential amino acid in grain legumes. The imbalance in amino acid composition restricts their biological value (BV) to 55 to 75% of that of animal protein. So far improvement of the BV could not be achieved by conventional breeding. Therefore, genetic engineering was employed by several laboratories to resolve the problem. Three strategies have been followed. A) Engineering for increased free Met levels; B) engineering of endogenous storage proteins with increased numbers of Met residues; C) transfer of foreign genes encoding Met-rich proteins, e.g. the Brazil nut 2S albumin (BNA) and its homologue from sunflower, into grain legumes. The latter strategy turned out to be most promising. In all cases the gene was put under the control of a developmentally regulated seed specific promoter and transferred into grain legumes using the bacterial Agrobacterium tumefaciens-system. Integration into and copy numbers in the plant genome as well as Mendelian inheritance and gene dosage effects were verified. After correct precursor processing the mature 2S albumin was intracellularly deposited in protein bodies which are part of the vacuolar compartment. The foreign protein amounted to 5 to 10% of the total seed protein in the best transgenic lines of narbon bean (Vicia narbonensis L., used in the authors' laboratories), lupins (Lupinus angustifolius L., used in CSIRO, Australia), and soybean (Glycine max (L.) Merr., used by Pioneer Hi-Bred, Inc., USA). In the narbon bean the increase of Met was directly related to the amount of 2S albumin in the transgenic seeds, but in soybean it remained below the theoretically expected value. Nevertheless, trangenic soybean reached 100%, whereas narbon bean and lupins reached approximately 80% of the FAO-standard for nutritionally balanced food proteins. These results document that the Met problem of grain legumes can be resolved by genetic engineering.

  13. Avoided Crossings in Small Metal Grains

    Science.gov (United States)

    Adam, S.; Waintal, X.; Brouwer, P. W.

    2002-03-01

    The effect of spin-orbit scattering in a generic small metal grain causes neighbouring Zeeman split energies to repel forming an avoided crossing. The magnitude of the avoided crossing energy depends on the direction of the magnetic field and the strength of the spin-orbit scattering. We use Random Matrix Theory to calculate the statistical distribution of minimal energy separations of an avoided crossing for the case of weak spin-orbit scattering.

  14. Grain-scale Dynamics in Explosives

    Energy Technology Data Exchange (ETDEWEB)

    Reaugh, J E

    2002-09-30

    High explosives can have reactions to external stimuli that range from mild pressure bursts to full detonation. The ability to predict these responses is important for understanding the performance as well as the safety and reliability of these important materials. At present, we have only relatively simple phenomenological computational models for the behavior of high explosives under these conditions. These models are limited by the assumption that the explosive can be treated as homogeneous. In reality the explosive is a highly heterogeneous composite of irregular crystallites and plastic binder. The heterogeneous nature of explosives is responsible for many of their unique mechanical and chemical properties. We use computational models to simulate the response of explosives to external mechanical stimuli at the grain-scale level. The ultimate goal of this work is to understand the detailed processes involved with the material response, so that we can develop realistic material models, which can be used in a hydrodynamics/multi-physics code to model real systems. The new material models will provide a more realistic description of the explosive system during the most critical period of ignition and initiation. The focus of this work is to use the results of grain-scale simulations to develop an advanced macroscopic reactive flow model that is consistent with our understanding of the grain-scale details, and that can incorporate such information quantitatively. The objective is to connect changes to observed properties of the explosive (grain size distribution, binder thickness distribution, void shape, size, and separation distribution, binder mechanical properties, etc.) with predictions of the resulting sensitivity and performance.

  15. Biomonitoring of ochratoxin A in grain workers.

    Science.gov (United States)

    Degen, G H; Mayer, S; Blaszkewicz, M

    2007-06-01

    Handling agricultural commodities such as grain can result in an inhalation of mycotoxin-containing dusts. Ochratoxin A (OTA) is particularly well suited for biomonitoring studies due to its long half-life in blood, and served as a marker toxin to investigate whether or not exposure to dusts in occupational contexts may result in elevated OTA blood serum levels. OTA analysis was performed for blood samples (n=61) obtained from a cohort of male workers employed at granaries of several grain handling companies in Germany. OTA was analyzed in plasma extracts by HPLC with fluorimetric detection; calibration curves were run for each batch of samples collected between July 2005 and March 2006, and the level of detection was 0.05 ng/ml plasma. The OTA plasma levels of the 61 grain workers ranged between 0.07 ng/ml and 0.75 ng/ml. The mean (0.28±0.13 ng/ml) and median (0.26 ng/ml) OTA value for this cohort was similar to average values previously reported for the German population. Our results gave no indication that OTA in excess of those originating from typical dietary sources was ingested by these workers. Although measurable OTA concentrations have been found in dust samples collected at the corresponding workplaces (Mayeret al, this issue), the biomonitoring data do not provide evidence for a significant inhalatory burden of OTA in grain workers. Since deoxynivalenol and zearalenone were also detected in the dust samples in concentrations much higher than that of OTA, additional research should try to assess the potential relevance of an inhalation exposure to these mycotoxins.

  16. Coarse-graining polymers as soft colloids

    OpenAIRE

    Louis, A.A.; Bolhuis, P. G.; Finken, R.; Krakoviack, V.; de Meijer, E. J.; Hansen, J. P.

    2001-01-01

    We show how to coarse grain polymers in a good solvent as single particles, interacting with density-independent or density-dependent interactions. These interactions can be between the centres of mass, the mid-points or end-points of the polymers. We also show how to extend these methods to polymers in poor solvents and mixtures of polymers. Treating polymers as soft colloids can greatly speed up the simulation of complex many-polymer systems, including polymer-colloid mixtures.

  17. Consumption of whole grains in French children, adolescents and adults

    OpenAIRE

    Bellisle, France; Hébel, Pascale; Colin, Justine; Reyé, Béatrice; Hopkins, Sinead

    2017-01-01

    The consumption of whole grain foods is associated with many nutritional, health and weight control benefits. The present study assessed whole grain intake in France on the basis of a 7?d dietary survey in a representative sample of children, adolescents and adults (Comportements et Consommations Alimentaires en France 2010 survey). Special care was taken to identify and assess the intake of all whole grains. All foods consumed were considered, with no lower limit on whole grain content. For ...

  18. Communication Optimizations for Fine-Grained UPCApplications

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Wei-Yu; Iancu, Costin; Yelick, Katherine

    2005-07-08

    Global address space languages like UPC exhibit high performance and portability on a broad class of shared and distributed memory parallel architectures. The most scalable applications use bulk memory copies rather than individual reads and writes to the shared space, but finer-grained sharing can be useful for scenarios such as dynamic load balancing, event signaling, and distributed hash tables. In this paper we present three optimization techniques for global address space programs with fine-grained communication: redundancy elimination, use of split-phase communication, and communication coalescing. Parallel UPC programs are analyzed using static single assignment form and a data flow graph, which are extended to handle the various shared and private pointer types that are available in UPC. The optimizations also take advantage of UPC's relaxed memory consistency model, which reduces the need for cross thread analysis. We demonstrate the effectiveness of the analysis and optimizations using several benchmarks, which were chosen to reflect the kinds of fine-grained, communication-intensive phases that exist in some larger applications. The optimizations show speedups of up to 70 percent on three parallel systems, which represent three different types of cluster network technologies.

  19. Grain Surface Models and Data for Astrochemistry

    Science.gov (United States)

    Cuppen, H. M.; Walsh, C.; Lamberts, T.; Semenov, D.; Garrod, R. T.; Penteado, E. M.; Ioppolo, S.

    2017-10-01

    The cross-disciplinary field of astrochemistry exists to understand the formation, destruction, and survival of molecules in astrophysical environments. Molecules in space are synthesized via a large variety of gas-phase reactions, and reactions on dust-grain surfaces, where the surface acts as a catalyst. A broad consensus has been reached in the astrochemistry community on how to suitably treat gas-phase processes in models, and also on how to present the necessary reaction data in databases; however, no such consensus has yet been reached for grain-surface processes. A team of {˜}25 experts covering observational, laboratory and theoretical (astro)chemistry met in summer of 2014 at the Lorentz Center in Leiden with the aim to provide solutions for this problem and to review the current state-of-the-art of grain surface models, both in terms of technical implementation into models as well as the most up-to-date information available from experiments and chemical computations. This review builds on the results of this workshop and gives an outlook for future directions.

  20. Multiple age components in individual molybdenite grains

    Science.gov (United States)

    Aleinikoff, John N.; Creaser, Robert A.; Lowers, Heather; Magee, Charles W.; Grauch, Richard I.

    2012-01-01

    Re–Os geochronology of fractions composed of unsized, coarse, and fine molybdenite from a pod of unusual monazite–xenotime gneiss within a granulite facies paragneiss, Hudson Highlands, NY, yielded dates of 950.5 ± 2.5, 953.8 ± 2.6, and 941.2 ± 2.6 Ma, respectively. These dates are not recorded by co-existing zircon, monazite, or xenotime. SEM–BSE imagery of thin sections and separated grains reveals that most molybdenite grains are composed of core and rim plates that are approximately perpendicular. Rim material invaded cores, forming irregular contacts, probably reflecting dissolution/reprecipitation. EPMA and LA-ICP-MS analyses show that cores and rims have different trace element concentrations (for example, cores are relatively enriched in W). On the basis of inclusions of zircon with metamorphic overgrowths, we conclude that molybdenite cores and rims formed after high-grade regional metamorphism. The discovery of cores and rims in individual molybdenite grains is analogous to multi-component U-Pb geochronometers such as zircon, monazite, and titanite; thus, molybdenite should be carefully examined before dating to ensure that the requirement of age homogeneity is fulfilled.

  1. Fungicide and insecticide residues in rice grains

    Directory of Open Access Journals (Sweden)

    Gustavo Mack Teló

    2017-01-01

    Full Text Available The objective of this study was to analyse residues of fungicides and insecticides in rice grains that were subjected to different forms of processing. Field work was conducted during three crop seasons, and fungicides and insecticides were applied at different crop growth stages on the aerial portion of the rice plants. Azoxystrobin, difenoconazole, propiconazole, tebuconazole, and trifloxystrobin fungicides were sprayed only once at the R2 growth stage or twice at the R2 and R4 growth stages; cypermethrin, lambda-cyhalothrin, permethrin, and thiamethoxam insecticides were sprayed at the R2 growth stage; and permethrin was sprayed at 5-day intervals from the R4 growth stage up to one day prior to harvest. Pesticide residues were analysed in uncooked, cooked, parboiled, polished and brown rice grains as well as rice hulls during the three crop seasons, for a total of 1458 samples. The samples were analysed by gas chromatography with electron capture detection (GC-ECD using modified QuEChERS as the extraction method. No fungicide or insecticide residues were detected in rice grain samples; however, azoxystrobin and cypermethrin residues were detected in rice hull samples.

  2. Photoemission from glass dust grains: First results

    Science.gov (United States)

    Nouzak, Libor; Pechal, Radim; Pavlu, Jiri; Safrankova, Jana; Nemecek, Zdenek

    2013-04-01

    Dust grains are widely present in both interstellar space as well as on numerous space objects like the Moon or asteroids. Quite often, the dust consists of large amount of SiO2. While every object in the space is exposed to impacting particles from the Sun (photons, electrons, and ions), the dust grains become charged. Interesting phenomena (e.g., Lunar horizon glow, dust fountains, and levitation) may appear as a consequence of different conditions at the light and dark lunar sides. Although they where observed already during Apollo and Surveyor missions, these effects are still not fully understood. We present laboratory measurements carried on the single SiO2 grain of micron size caught in the electrodynamic trap and exposed to UV and electron irradiations. Analyzing the dust motion (oscilation frequency and position), we can evaluate its specific charge. In this paper, we are comparing equilibrium charge-to-mass ratios given by a secondary electron emission induced by 400 eV electrons (about a maximum of the secondary emission) and by the UV-induced photoemission from the He I lamp (? 21 eV). Initial results indicate that the resulting charge is about twice larger for photoemission.

  3. The valuation of commercial grain silos | Winckler | Acta Structilia

    African Journals Online (AJOL)

    A grain silo is a unique form of real estate because of its construction, use and income generation. ... Silos are, in essence, income-producing properties, but because the tenant is the owner of grain and oilseed, the income produced by the silo fluctuates from year to year depending on the size of annual grain harvests.

  4. Effects and mechanisms of grain refinement in aluminium alloys

    Indian Academy of Sciences (India)

    Grain refinement plays a crucial role in improving characteristics and properties of cast and wrought aluminium alloys. Generally Al–Ti and Al–Ti–B master alloys are added to the aluminium alloys to grain refine the solidified product. The mechanism of grain refinement is of considerable controversy in the scientific literature ...

  5. Grain refinement of AZ31 magnesium alloy by electromagnetic ...

    Indian Academy of Sciences (India)

    The effects of electromagnetic stirring and Al4C3 grain refiner on the grain refinement of semicontinuously cast AZ31 magnesium alloy were discussed in this investigation. The results indicate that electromagnetic stirring has an effective refining effect on the grain size of AZ31 magnesium alloy under the effect of Al4C3 ...

  6. Optimizing harvesting operations on a large-scale grain farm

    NARCIS (Netherlands)

    Kampen, van J.H.

    1969-01-01

    1. The object of this study is the optimization of the grain harvesting operations by minimizing the total harvest costs under weather conditions prevailing in the centre of the Netherlands. The sequential grain harvesting operations consist of: combining-loading of grain

  7. Whole grain foods and health – a Scandinavian perspective

    Directory of Open Access Journals (Sweden)

    Wenche Frølich

    2013-02-01

    Full Text Available The food-based dietary guidelines in the Scandinavian countries that recommend an intake of minimum 75 g whole grain per 10 MJ (2,388 kcal per day are mainly derived from prospective cohort studies where quantitative but little qualitative details are available on whole grain products. The objective of the current paper is to clarify possible differences in nutritional and health effects of the types of whole grain grown and consumed in the Scandinavian countries. A further objective is to substantiate how processing may influence the nutritional value and potential health effects of different whole grains and whole grain foods. The most commonly consumed whole grain cereals in the Scandinavian countries are wheat, rye, and oats with a considerable inter-country variation in the consumption patterns and with barley constituting only a minor role. The chemical composition of these different whole grains and thus the whole grain products consumed vary considerably with regard to the content of macro- and micronutrients and bioactive components. A considerable amount of scientific substantiation shows that processing methods of the whole grains are important for the physiological and health effects of the final whole grain products. Future research should consider the specific properties of each cereal and its processing methods to further identify the uniqueness and health potentials of whole grain products. This would enable the authorities to provide more specific food-based dietary guidelines in relation to whole grain to the benefit of both the food industry and the consumer.

  8. Ethics and quality assessment of cowpea grains sold in southern ...

    African Journals Online (AJOL)

    International Journal of Tropical Agriculture and Food Systems ... Good grains in each bag had the financial value of seven thousand, four hundred and twenty Naira, while the bad grains had the financial estimate of three thousand and seventy ... price of ten thousand five hundred Naira per bag of Iron white cowpea grain.

  9. Acceptability and nutritional contribution of grain amaranth recipes ...

    African Journals Online (AJOL)

    Grain amaranth is a highly nutritious crop. It is high in proteins and its proteins are of high quality. Compared to common starchy staples, grain amaranth also contains higher levels calcium, zinc, iron as well as vitamins A, E and folic acid. Grain amaranth has also been reported to exhibit nutraceutical properties. Despite its ...

  10. Grain iron density variability among new farmer-preferred ...

    African Journals Online (AJOL)

    Grain micronutrient content assessment is important in breeding pearl millet, in order to maintain or improve its high nutritional quality. Grain samples of 12 farmer-preferred pearl millet varieties produced in four representative environments in Niger during the 2013 rainy season were assessed for Fe, Zn, Al and P grain ...

  11. Effects and mechanisms of grain refinement in aluminium alloys

    Indian Academy of Sciences (India)

    Unknown

    Abstract. Grain refinement plays a crucial role in improving characteristics and properties of cast and wrought aluminium alloys. Generally Al–Ti and Al–Ti–B master alloys are added to the aluminium alloys to grain refine the solidified product. The mechanism of grain refinement is of considerable controversy in the scientific ...

  12. A synteny-based draft genome sequence of the forage grass Lolium perenne.

    Science.gov (United States)

    Byrne, Stephen L; Nagy, Istvan; Pfeifer, Matthias; Armstead, Ian; Swain, Suresh; Studer, Bruno; Mayer, Klaus; Campbell, Jacqueline D; Czaban, Adrian; Hentrup, Stephan; Panitz, Frank; Bendixen, Christian; Hedegaard, Jakob; Caccamo, Mario; Asp, Torben

    2015-11-01

    Here we report the draft genome sequence of perennial ryegrass (Lolium perenne), an economically important forage and turf grass species that is widely cultivated in temperate regions worldwide. It is classified along with wheat, barley, oats and Brachypodium distachyon in the Pooideae sub-family of the grass family (Poaceae). Transcriptome data was used to identify 28,455 gene models, and we utilized macro-co-linearity between perennial ryegrass and barley, and synteny within the grass family, to establish a synteny-based linear gene order. The gametophytic self-incompatibility mechanism enables the pistil of a plant to reject self-pollen and therefore promote out-crossing. We have used the sequence assembly to characterize transcriptional changes in the stigma during pollination with both compatible and incompatible pollen. Characterization of the pollen transcriptome identified homologs to pollen allergens from a range of species, many of which were expressed to very high levels in mature pollen grains, and are potentially involved in the self-incompatibility mechanism. The genome sequence provides a valuable resource for future breeding efforts based on genomic prediction, and will accelerate the development of new varieties for more productive grasslands. © 2015 The Authors The Plant Journal © 2015 John Wiley & Sons Ltd.

  13. Ultrafast analysis of individual grain behavior during grain growth by parallel computing

    Science.gov (United States)

    Kühbach, M.; Barrales-Mora, L. A.; Mießen, C.; Gottstein, G.

    2015-08-01

    The possibility to characterize in an automatized way the spatial-temporal evolution of individual grains and their properties is essential to the understanding of annealing phenomena. The development of advanced experimental techniques, computational models and tools helps the acquisition of real time and real space-resolved datasets. Whereas the reconstruction of 3D grain representatives from serial-sectioning or tomography datasets becomes more common and microstructure simulations on parallel computers become ever larger and longer lasting, few efforts have materialized in the development of tools that allow the continuous tracking of properties at the grain scale. In fact, such analyses are often left neglected in practice due to the large size of the datasets that exceed the available physical memory of a computer or the shared-memory cluster. We identified the key tasks that have to be solved in order to define suitable and lean data structures and computational methods to evaluate spatio-temporal grain property datasets by working with parallel computer architectures. This is exemplified with data from grain growth simulations.

  14. Supplying materials needed for grain growth characterizations of nano-grained UO2

    Energy Technology Data Exchange (ETDEWEB)

    Mo, Kun [Argonne National Lab. (ANL), Argonne, IL (United States); Miao, Yinbin [Argonne National Lab. (ANL), Argonne, IL (United States); Yun, Di [Argonne National Lab. (ANL), Argonne, IL (United States); Jamison, Laura M. [Argonne National Lab. (ANL), Argonne, IL (United States); Lian, Jie [Rensselaer Polytechnic Inst., Troy, NY (United States); Yao, Tiankei [Rensselaer Polytechnic Inst., Troy, NY (United States)

    2015-09-30

    This activity is supported by the US Nuclear Energy Advanced Modeling and Simulation (NEAMS) Fuels Product Line (FPL) and aims at providing experimental data for the validation of the mesoscale simulation code MARMOT. MARMOT is a mesoscale multiphysics code that predicts the coevolution of microstructure and properties within reactor fuel during its lifetime in the reactor. It is an important component of the Moose-Bison-Marmot (MBM) code suite that has been developed by Idaho National Laboratory (INL) to enable next generation fuel performance modeling capability as part of the NEAMS Program FPL. In order to ensure the accuracy of the microstructure based materials models being developed within the MARMOT code, extensive validation efforts must be carried out. In this report, we summarize our preliminary synchrotron radiation experiments at APS to determine the grain size of nanograin UO2. The methodology and experimental setup developed in this experiment can directly apply to the proposed in-situ grain growth measurements. The investigation of the grain growth kinetics was conducted based on isothermal annealing and grain growth characterization as functions of duration and temperature. The kinetic parameters such as activation energy for grain growth for UO2 with different stoichiometry are obtained and compared with molecular dynamics (MD) simulations.

  15. Heterologous expression and transcript analysis of gibberellin biosynthetic genes of grasses reveals novel functionality in the GA3ox family.

    Science.gov (United States)

    Pearce, Stephen; Huttly, Alison K; Prosser, Ian M; Li, Yi-dan; Vaughan, Simon P; Gallova, Barbora; Patil, Archana; Coghill, Jane A; Dubcovsky, Jorge; Hedden, Peter; Phillips, Andrew L

    2015-06-05

    The gibberellin (GA) pathway plays a central role in the regulation of plant development, with the 2-oxoglutarate-dependent dioxygenases (2-ODDs: GA20ox, GA3ox, GA2ox) that catalyse the later steps in the biosynthetic pathway of particularly importance in regulating bioactive GA levels. Although GA has important impacts on crop yield and quality, our understanding of the regulation of GA biosynthesis during wheat and barley development remains limited. In this study we identified or assembled genes encoding the GA 2-ODDs of wheat, barley and Brachypodium distachyon and characterised the wheat genes by heterologous expression and transcript analysis. The wheat, barley and Brachypodium genomes each contain orthologous copies of the GA20ox, GA3ox and GA2ox genes identified in rice, with the exception of OsGA3ox1 and OsGA2ox5 which are absent in these species. Some additional paralogs of 2-ODD genes were identified: notably, a novel gene in the wheat B genome related to GA3ox2 was shown to encode a GA 1-oxidase, named as TaGA1ox-B1. This enzyme is likely to be responsible for the abundant 1β-hydroxylated GAs present in developing wheat grains. We also identified a related gene in barley, located in a syntenic position to TaGA1ox-B1, that encodes a GA 3,18-dihydroxylase which similarly accounts for the accumulation of unusual GAs in barley grains. Transcript analysis showed that some paralogs of the different classes of 2-ODD were expressed mainly in a single tissue or at specific developmental stages. In particular, TaGA20ox3, TaGA1ox1, TaGA3ox3 and TaGA2ox7 were predominantly expressed in developing grain. More detailed analysis of grain-specific gene expression showed that while the transcripts of biosynthetic genes were most abundant in the endosperm, genes encoding inactivation and signalling components were more highly expressed in the seed coat and pericarp. The comprehensive expression and functional characterisation of the multigene families encoding the 2-ODD

  16. 7 CFR 868.310 - Grades and grade requirements for the classes Long Grain Milled Rice, Medium Grain Milled Rice...

    Science.gov (United States)

    2010-01-01

    ... and objectionable seeds (number in 500 grams) Red rice and damaged kernels (singly or combined... Grain Milled Rice, Medium Grain Milled Rice, Short Grain Milled Rice, and Mixed Milled Rice. (See also Â... Milled Rice Principles Governing Application of Standards § 868.310 Grades and grade requirements for the...

  17. Proteomics of Rice Grain under High Temperature Stress

    Directory of Open Access Journals (Sweden)

    Toshiaki eMitsui

    2013-03-01

    Full Text Available Recent proteomic analyses revealed dynamic changes of metabolisms during rice grain development. Interestingly, proteins involved in glycolysis, citric acid cycle, lipid metabolism, and proteolysis were accumulated at higher levels in mature grain than those of developing stages. High temperature stress in rice ripening period causes damaged (chalky grains which have loosely packed round shape starch granules. The high temperature stress response on protein expression is complicated, and the molecular mechanism of the chalking of grain is obscure yet. Here, the current state on the proteomics research of rice grain grown under high temperature stress is briefly overviewed.

  18. Grain damage, phase mixing and plate-boundary formation

    Science.gov (United States)

    Bercovici, David; Skemer, Philip

    2017-07-01

    The generation of plate tectonics on Earth relies on complex mechanisms for shear localization, as well as for the retention and reactivation of weak zones in the cold ductile lithosphere. Pervasive mylonitization, wherein zones of high deformation coincide with extensive mineral grain size reduction, is an important clue to this process. In that regard, the grain-damage model of lithospheric weakening provides a physical framework for both mylonitization and plate generation, and accounts for the competition between grain size reduction by deformation and damage, and healing by grain growth. Zener pinning at the evolving interface between mineral components, such as olivine and pyroxene, plays a key role in helping drive grains to small mylonitic sizes during deformation, and then retards their growth once deformation ceases. The combined effects of damage and pinning, however, rely on the efficiency of inter-grain mixing between phases (e.g., olivine and pyroxene) and grain dispersal, which likely depends on grain size itself. Here we present a new model for inter-grain mixing and damage and the onset of rapid mixing. The model considers the competition between the formation of new grains behind a receding interphase triple junction (e.g., olivine growing into a boundary between two pyroxene grains) and their severance or spalling during progressive deformation and damage. The newly formed grains of one phase are then transported along the opposing phase's grain-boundaries and the two phases become dispersed at the grain-scale in a growing mixed layer. The small intermixed grains also affect the grain evolution of the surrounding host grains by Zener pinning, and hence influence the rheology and growth of the mixed layer. As the grains in the mixed layer shrink, subsequently spalled new grains are also smaller, causing a feedback that leads to more rapid mixing and shear localization in the mixed layer. The early stages of mixing can be compared to laboratory

  19. Mechanically induced grain boundary motion in Al-bicrystals

    Energy Technology Data Exchange (ETDEWEB)

    Gorkaya, Tatiana; Molodov, Dmitri A.; Gottstein, Guenter [Institut fuer Metallkunde und Metallphysik der RWTH Aachen (Germany)

    2010-07-01

    The mechanically induced migration of planar grain boundaries in Al-bicrystals was experimentally measured. The novel tensile/compression module for scanning electron microscope was utilized for in-situ measurements of grain boundary motion at elevated temperatures. From the measured temperature dependence of boundary mobility the migration activation parameters for investigated boundaries were determined. Normal boundary motion was observed to be coupled to a shear of the crystal in the region traversed by the grain boundary during its motion. The measured ratios of the normal grain boundary motion to the lateral translation of grains were compared with geometrical models of stress induced boundary migration.

  20. Jamming of Cylindrical Grains in Featureless Vertical Channels

    Science.gov (United States)

    Baxter, G. William; Barr, Nicholas; Weible, Seth; Friedl, Nicholas

    2013-03-01

    We study jamming of low aspect-ratio cylindrical Delrin grains falling through a featureless vertical channel. With a grain height less than the grain diameter, these grains resemble aspirin tablets, poker chips, or coins. Unidisperse grains are allowed to fall under the influence of gravity through a uniform channel of square cross-section where the channel width is greater than the grain size and constant along the length of the channel. Channel widths are chosen so that no combination of grain heights and diameters is equal to the channel width. Collections of grains sometimes form jams, stable structures in which the grains are supported by the channel walls and not by grains or walls beneath them. The probability of a jam occurring and the jam's strength are influenced by the grain dimensions and channel width. We will present experimental measurements of the jamming probability and jam strength and discuss the relationship of these results to other experiments and theories. Supported by an Undergraduate Research Grant from Penn State Erie, The Behrend College

  1. A new approach to grain boundary engineering for nanocrystalline materials.

    Science.gov (United States)

    Kobayashi, Shigeaki; Tsurekawa, Sadahiro; Watanabe, Tadao

    2016-01-01

    A new approach to grain boundary engineering (GBE) for high performance nanocrystalline materials, especially those produced by electrodeposition and sputtering, is discussed on the basis of some important findings from recently available results on GBE for nanocrystalline materials. In order to optimize their utility, the beneficial effects of grain boundary microstructures have been seriously considered according to the almost established approach to GBE. This approach has been increasingly recognized for the development of high performance nanocrystalline materials with an extremely high density of grain boundaries and triple junctions. The effectiveness of precisely controlled grain boundary microstructures (quantitatively characterized by the grain boundary character distribution (GBCD) and grain boundary connectivity associated with triple junctions) has been revealed for recent achievements in the enhancement of grain boundary strengthening, hardness, and the control of segregation-induced intergranular brittleness and intergranular fatigue fracture in electrodeposited nickel and nickel alloys with initial submicrometer-grained structure. A new approach to GBE based on fractal analysis of grain boundary connectivity is proposed to produce high performance nanocrystalline or submicrometer-grained materials with desirable mechanical properties such as enhanced fracture resistance. Finally, the potential power of GBE is demonstrated for high performance functional materials like gold thin films through precise control of electrical resistance based on the fractal analysis of the grain boundary microstructure.

  2. A new approach to grain boundary engineering for nanocrystalline materials

    Directory of Open Access Journals (Sweden)

    Shigeaki Kobayashi

    2016-11-01

    Full Text Available A new approach to grain boundary engineering (GBE for high performance nanocrystalline materials, especially those produced by electrodeposition and sputtering, is discussed on the basis of some important findings from recently available results on GBE for nanocrystalline materials. In order to optimize their utility, the beneficial effects of grain boundary microstructures have been seriously considered according to the almost established approach to GBE. This approach has been increasingly recognized for the development of high performance nanocrystalline materials with an extremely high density of grain boundaries and triple junctions. The effectiveness of precisely controlled grain boundary microstructures (quantitatively characterized by the grain boundary character distribution (GBCD and grain boundary connectivity associated with triple junctions has been revealed for recent achievements in the enhancement of grain boundary strengthening, hardness, and the control of segregation-induced intergranular brittleness and intergranular fatigue fracture in electrodeposited nickel and nickel alloys with initial submicrometer-grained structure. A new approach to GBE based on fractal analysis of grain boundary connectivity is proposed to produce high performance nanocrystalline or submicrometer-grained materials with desirable mechanical properties such as enhanced fracture resistance. Finally, the potential power of GBE is demonstrated for high performance functional materials like gold thin films through precise control of electrical resistance based on the fractal analysis of the grain boundary microstructure.

  3. Numerical Investigation of Grain Coarsening and Coalescence Model

    Science.gov (United States)

    Muradova, Aliki D.; Hristopulos, Dionisios T.

    2015-01-01

    A kinetic nonlinear model of mass transfer, grain coarsening and coalescence with potential applications in sintering processes is studied. The model involves nonlinear differential equations that determine the transport of mass between grains. The rate of mass transfer is controlled by the activation energy (an Arrhenius factor) leading to a nonlinear model of mass transfer and grain coarsening. The resulting dynamical system of coupled nonlinear differential equations with random initial conditions (i.e., initial grain mass configuration) is solved by means of the Runge-Kutta method. An analysis of the fixed points of the two-grain system is carried out, and the solution of the multi-grain system is studied. We incorporate coalescence of smaller grains with larger neighbors using a cellular automaton step in the evolution of the system.

  4. The Evolution of the Whole Grain Partnership in Denmark

    DEFF Research Database (Denmark)

    Greve, Carsten; Neess, Rikke Iben

    This paper is about the evolution of the Whole Grain Partnership in Denmark. The partnership’s objective is to increase public health by encouraging Danes to eat more whole grain. The partnership also provides a business opportunity for the food industry to expand the market for whole grain...... products. The Whole Grain Partnership is a campaign organization supported by 35 partners from government, health NGOs and the food industry. A public‐private partnership holds much promise and presents an exciting opportunity to increase whole grain intake for the benefit of public health. Before......, whereas it was only 6% previously. 43% of Danish children now eat the recommended daily intake, whereas it was only 7% previously. This paper focuses on three interrelated questions: 1. Why was the Whole Grain Partnership established? 2. How is the Whole Grain Partnership organized, and how does...

  5. Nanocrystalline and ultrafine grain copper obtained by mechanical attrition

    Directory of Open Access Journals (Sweden)

    Rodolfo Rodríguez Baracaldo

    2011-03-01

    Full Text Available This article presents a method for the sample preparation and characterisation of bulk copper having grain size lower than 1 μm (ultra-fine grain and lower than 100 nm grain size (nanocrystalline. Copper is initially manufactured by a milling/alloying me- chanical method thereby obtaining a powder having a nanocrystalline structure which is then consolidated through a process of warm compaction at high pressure. Microstructural characterisation of bulk copper samples showed the evolution of grain size during all stages involved in obtaining it. The results led to determining the necessary conditions for achieving a wide range of grain sizes. Mechanical characterisation indicated an increase in microhardness to values of around 3.40 GPa for unconsolida- ted nanocrystalline powder. Compressivee strength was increased by reducing the grain size, thereby obtaining an elastic limit of 650 MPa for consolidated copper having a ~ 62 nm grain size.

  6. The Pinning by Particles of Low and High Angle Grain Boundaries during Grain Growth

    DEFF Research Database (Denmark)

    Tweed, C.J.; Ralph, B.; Hansen, Niels

    1984-01-01

    and coworkers. These estimates of local driving pressures have shown that they are similar for both the low and the high angle boundaries encountered in the samples. The pinning effects by particles at high angle boundaries are in general accord with the model due to Zener whilst those at low angle boundaries......A study has been made using transmission electron microscopy of the pinning of grain boundaries in aluminium during grain growth by fine dispersions of alumina particles. The boundary parameters have been determined with precision and the pinning effects measured using an approach due to Ashby...

  7. A Nondestructive Method of Grain Microstructure Determination

    Energy Technology Data Exchange (ETDEWEB)

    Lai, J.

    2004-09-03

    Customarily, a material has been sectioned to study its internal grain microstructure and thus in the process is destroyed. Using x-rays, however, there are two nondestructive methods of determining the sources of diffraction spots and hence the internal grain microstructure of a sample. One technique consists of placing a wire in the path of a diffracted ray so that its image is prevented from appearing on the detector screen. Ray-tracing is then done to locate the source within the sample from whence the rays emanate. In this experiment, we investigate the other technique of determining source location by recording diffraction patterns at ten equally-spaced detector distances and then graphing the data with reasonable-fit lines using the least-squares fitting routine. We then perform a ray-tracing triangulation technique to pinpoint the location of the source from which the rays are coming. Cluster analyses are employed and plots of ray number versus pixel position of certain points at some particular detector distances are created. An error propagation analysis is then carried out as a check to the cluster analyses and graphs of error deviation along the detector path versus ray number are constructed. With statistical error analyses and construction of error boxes using chosen pixel error deviations and delta z error values, the best error measurement using the detector method was found to be plus/minus 100 microns. In this study, it was found that the detector method provided a much poorer resolution than the traditional wire technique of which there is a source size precision of within 1-5 microns. The detector method, though, is sufficient for large-grain material studies.

  8. Black grain mycetoma caused by Leptosphaeria tompkinsii.

    Science.gov (United States)

    Machmachi, H; Godineau, N; Develoux, M; Bretagne, S; Bazeli, A; Amsellem, D; Desnos-Ollivier, M; Poirat, J B

    2011-02-01

    Leptosphaeria tompkinsii is a dematiaceous fungus which is rarely reported as an agent of black-grain mycetoma. We present a case involving a mycetoma of the hand of a former farmer from Mali, West Africa, who has been a resident in France for 27 years. The patient was successfully treated with surgery and the use of oral itraconazole for 6 months. Species identification was based on sexual reproductive structures observed on potato-carrot agar media and the use of internal transcribed spacer sequencing.

  9. Mycobiota of Serbian wheat grain in 2010

    Directory of Open Access Journals (Sweden)

    Stanojev Zagorka N.

    2013-01-01

    Full Text Available This research focused on the assessment of the infection level of sampled wheat grains with phytopathogenic fungi. The samples were taken from the localities Rimski Šančevi and Sombor. The research investigated the impact of localities to intensity of fungal infection by fungi from genus Fusarium and Alternaria. Isolates from genus Fusarium and Alternaria were determined to species level. Pathogenicity of Fusarium and Alternaria isolates from different localities to wheat seedlings was also established. [Projekat Ministarstva nauke Republike Srbije, br. III 46005: Genetic divergence, technological quality and storage of cereals and pseudocereals from organic production

  10. Fine-Grained Concrete of Composite Binder

    Science.gov (United States)

    Fediuk, R.; Pak, A.; Kuzmin, D.

    2017-11-01

    The article is devoted to the application of industrial wastes for the production of high-quality concretes with specified characteristics. The composite binders with low water demand (BLW) have been developed. Their strength is approximately twice the strength of the initial cement, and dilute BLW with 50 - 70% of the ground slag or quartz sand in their composition provide the same strength as the original Portland cement. It was proved that the quartzite sand screening can be used as a filler in the preparation of fine-grained concretes.

  11. 77 FR 65855 - Cancellation of Indianapolis Grain Inspection & Weighing Service, Inc. Designation; Selection of...

    Science.gov (United States)

    2012-10-31

    ... Grain Inspection, Packers and Stockyards Administration Cancellation of Indianapolis Grain Inspection... Indianapolis, IN Area AGENCY: Grain Inspection, Packers and Stockyards Administration, USDA. ACTION: Notice...), as amended. Indianapolis informed the Grain Inspection, Packers and Stockyards Administration (GIPSA...

  12. 78 FR 51138 - Partial Cancellation of Fremont Grain Inspection Department Inc. Designation; Selection of...

    Science.gov (United States)

    2013-08-20

    ... Grain Inspection, Packers and Stockyards Administration Partial Cancellation of Fremont Grain Inspection... Area AGENCY: Grain Inspection, Packers and Stockyards Administration, USDA. ACTION: Notice. SUMMARY... the Grain Inspection, Packers and Stockyards Administration (GIPSA) that it wanted to cancel its...

  13. Modulation of phytochrome signaling networks for improved biomass accumulation using a bioenergy crop model

    Energy Technology Data Exchange (ETDEWEB)

    Mockler, Todd C. [Donald Danforth Plant Science Center, Saint Louis, MO (United States)

    2016-11-07

    Plant growth and development, including stem elongation, flowering time, and shade-avoidance habits, are affected by wavelength composition (i.e., light quality) of the light environment. the molecular mechanisms underlying light perception and signaling pathways in plants have been best characterized in Arabidopsis thaliana where dozens of genes have been implicated in converging, complementary, and antagonistic pathways communicating light quality cues perceived by the phytochrome (red/far-red) cryptochrome (blue) and phototropin (blue) photorecptors. Light perception and signaling have been studied in grasses, including rice and sorghum but in much less detail than in Arabidopsis. During the course of the Mocker lab's DOE-funded wrok generating a gene expression atlas in Brachypodium distachyon we observed that Brachypodium plants grown in continuous monochromatic red light or continuous white light enriched in far-red light accumulated significantly more biomass and exhibited significantly greater seed yield than plants grown in monochromatic blue light or white light. This phenomenon was also observed in two other grasses, switchgrass and rice. We will systematically manipulate the expression of genes predicted to function in Brachypodium phytochrome signaling and assess the phenotypic consequences in transgenic Brachypodium plants in terms of morphology, stature, biomass accumulation, and cell wall composition. We will also interrogate direct interactions between candidate phytochrome signaling transcription factors and target promoters using a high-throughput yeast one-hybrid system. Brachypodium distachyon has emerged as a model grass species and is closely related to candidate feedstock crops for bioethanol production. Identification of genes capable of modifying growth characteristics of Brachypodium, when misexpressed, in particular increasing biomass accumulation, by modulating photoreceptor signaling will provide valuable candidates for

  14. Grain boundary and grain interior conduction in {gamma}'-Bi{sub 2}MoO{sub 6}

    Energy Technology Data Exchange (ETDEWEB)

    Vera, C.M.C. [Laboratorio de Peliculas Delgadas, Facultad de Ingenieria, Universidad de Buenos Aires, Paseo Colon 850, 1063 Buenos Aires (Argentina)]. E-mail: cvera@fi.uba.ar; Aragon, R. [Laboratorio de Peliculas Delgadas, Facultad de Ingenieria, Universidad de Buenos Aires, Paseo Colon 850, 1063 Buenos Aires (Argentina); CINSO, CONICET, CITEFA, Lasalle 4397, Villa Martelli, Buenos Aires (Argentina)

    2005-07-25

    Impedance spectroscopy of fine grained (<10 {mu}m) {gamma}'-Bi{sub 2}MoO{sub 6} samples, in the frequency range of 0.1 Hz-250 kHz, relevant to sensor applications, up to 800 deg. C, has been used to characterize grain boundary and grain interior contributions to conduction. Above 500 deg. C, the grain boundary contribution is no longer rate limiting and conduction is dominated by the grain interior component. The corresponding activation energies are 0.98 eV for grain boundary and 0.73 eV for grain interior components. The weak dependence of conductivity on oxygen partial pressure below 500 deg. C can be attributed to electrode-electrolyte interface phenomena, whereas the robust response to ethanol is commensurate with changes in intrinsic ionic conductivity.

  15. [5-n-alkylresorcinols of whole grain cereals and whole grain cereal products as biomarkers of healthy food].

    Science.gov (United States)

    Kulawinek, Mariola; Kozubek, Arkadiusz

    2007-01-01

    Epidemiological studies suggest that consumption of whole grain cereals and whole grain cereal products have many benefical health effects, including reducing risk of diabetes, obesity, coronary heart diseases, stroke and even some cancers. Precise knowledge protective compounds present in cereal grains can be achieved only when specific biomarkers (biological marker, indicator), that could provide estimation of grain cereals absorption and intake, are established and determined. 5-n-alkylresorcinols (main fraction of phenolic compounds in cereals), because of their specific occurrence only in bran fraction, obtained in refining of milling fractions process, could be a very good candidate to play the role of biomarker of whole grain intake. They are absorbed by animals and humans, present in human plasma and as metabolites in urine. Because composition of saturated homologues of 5-n-alkylresorcinols is different in rye and wheat grains, they could be used as an indicator of the intake of the specific type of cereals and whole grain cereal products.

  16. Image - Rice Grain Scanner: a three-dimensional fully automated assessment of grain size and quality traits

    Directory of Open Access Journals (Sweden)

    Rubens Marschalek

    2016-12-01

    Full Text Available The Image is a scanner developed as a grain classifier for quality control at the rice industry based on Brazilian official norms. It orders the dehulled grains ensuring that each grain would pass individually, in free fall, while the grain is analysed from different sides, covering its whole surface. It ensures a precise three-dimensional measurement of grain size, chalkiness, defects of the grain, milling quality, given out a total of 39 traits/classes/defects/values, which are sent to a excel Microsoft spreadsheet. This is managed through a digital platform which analysis routine and layout were developed and designed by Selgron and Epagri to fit the needs of research. The scanner and its software reach outputs that enhance rice breeding efficiency for grain quality, performing it faster, precisely and with a high-throughput phenotyping than ever before, especially interesting in very early breeding generations.

  17. Effect of Selenium, Molybdenum and Zinc on Seedling Growth and Frequency of Grain Weevil (Sitophilus granarius in Triticale Grain

    Directory of Open Access Journals (Sweden)

    Rudolf Kastori

    2009-01-01

    Full Text Available The effects of different doses (0, 90, 270, 810 kg/ha of selenium, molybdenum and zinc microelements on their translocation and accumulation in grains, seedling growth and grain infestation were examined under field conditions on a calcareous chernozem soil.Thirteen years after the application of selenium, molybdenum and zinc, significant translocation and accumulation of these elements in the grain were established, indicating a long-term effect of these microelements on triticale plants. The highest degree of accumulation in grains and seedling shoots was found for selenium, then molybdenum, while the detected amounts of zinc were significantly lower. The degree of accumulation of all threemicroelements in the grain and seedling shoot increased as doses increased. Translocation index from shoot to grain at the grain-filling phase was the highest when zinc was used, then selenium, and the lowest when molybdenum was applied. The highest translocationindex from the grain during germination into seedling shoots was obtained with zinc, then molybdenum and selenium. Translocation indexes of the investigated elements significantly decreased as the doses of elements increased. Dry weight of seedling shoots decreasedas molybdenum and zinc in grain increased. High selenium concentration moderately stimulated seedling development, pointing out a high tolerance of triticale to higher concentration of this microelement at initial development stages. Infestatation with grain weevil was provoked by high concentrations of these microelements in the grain. High concentrations of zinc and selenium, in particular, significantly decreased the percentage of damaged grains, while molybdenum moderately increased their numbers. The effect of zincand molybdenum may be attributed to their chemical effect, while selenium effect may also be referred to a negative effect of the volatile selenium compound. The effect of selenium, molybdenum and zinc contamination of grains

  18. Coarse graining flow of spin foam intertwiners

    CERN Document Server

    Dittrich, Bianca; Seth, Cameron J; Steinhaus, Sebastian

    2016-01-01

    Simplicity constraints play a crucial role in the construction of spin foam models, yet their effective behaviour on larger scales is scarcely explored. In this article we introduce intertwiner and spin net models for the quantum group $\\text{SU}(2)_k \\times \\text{SU}(2)_k$, which implement the simplicity constraints analogous to 4D Euclidean spin foam models, namely the Barrett-Crane (BC) and the Engle-Pereira-Rovelli-Livine/Freidel-Krasnov (EPRL/FK) model. These models are numerically coarse grained via tensor network renormalization, allowing us to trace the flow of simplicity constraints to larger scales. In order to perform these simulations we have substantially adapted tensor network algorithms, which we discuss in detail. The BC and the EPRL/FK model behave very differently under coarse graining: While the unique BC intertwiner model is a fixed point and therefore constitutes a 2D topological phase, BC spin net models flow away from the initial simplicity constraints and converge to several different ...

  19. Oats: A multi-functional grain

    Directory of Open Access Journals (Sweden)

    Purvi Varma

    2016-01-01

    Full Text Available Oats are predominantly a European and North American crop, as they have cool moist climate; Russia, Canada, the United States, Finland, and Poland are leading oat producing countries. Oats have been used as livestock and human foods since ancient times. Oats (Avena sativa is a class of cereal grain essentially grown for human consumption as well as for livestock fodder. Food industry fundamentally alter agricultural commodities into foods making it edible, palatable as well as appealing; by innumerable physical and chemical operations increasing shelf-life, bioavailability of the nutrients, stabilizing colour, flavour along with increase in the economic value of the grain. Recent observational and human interventional studies indicate that oats can have an impact on various non-communicable diseases like cardiovascular disease, diabetes; obesity and hypertension etc. Therefore it is important to increase awareness of oats and its health benefits among individuals thereby encouraging them to increase the frequency of oats in the diet. In the year 1997, USFDA approved the use of a health claim "3g/day of oat Beta- glucan may help lower blood total and low-density lipoprotein (LDL-C cholesterol". Over all consumption of oats has increased in the recent years due to its nutritional benefits; presence of Beta-glucan, antioxidants like Avenanthramides, vitamin E (tocotrienols and tocopherols.

  20. Carbon footprint of grain production in China.

    Science.gov (United States)

    Zhang, Dan; Shen, Jianbo; Zhang, Fusuo; Li, Yu'e; Zhang, Weifeng

    2017-06-29

    Due to the increasing environmental impact of food production, carbon footprint as an indicator can guide farmland management. This study established a method and estimated the carbon footprint of grain production in China based on life cycle analysis (LCA). The results showed that grain production has a high carbon footprint in 2013, i.e., 4052 kg ce/ha or 0.48 kg ce/kg for maize, 5455 kg ce/ha or 0.75 kg ce/kg for wheat and 11881 kg ce/ha or 1.60 kg ce/kg for rice. These footprints are higher than that of other countries, such as the United States, Canada and India. The most important factors governing carbon emissions were the application of nitrogen fertiliser (8-49%), straw burning (0-70%), energy consumption by machinery (6-40%), energy consumption for irrigation (0-44%) and CH4 emissions from rice paddies (15-73%). The most important carbon sequestration factors included returning of crop straw (41-90%), chemical nitrogen fertiliser application (10-59%) and no-till farming practices (0-10%). Different factors dominated in different crop systems in different regions. To identity site-specific key factors and take countermeasures could significantly lower carbon footprint, e.g., ban straw burning in northeast and south China, stopping continuous flooding irrigation in wheat and rice production system.

  1. The recrystallized grain size piezometer for quartz

    Science.gov (United States)

    Stipp, Michael; Tullis, Jan

    2003-11-01

    In order to determine a recrystallized grain size piezometer for quartz, we deformed Black Hills quartzite in a molten salt assembly in a Griggs apparatus at 1.5 GPa, 800 to 1100°C, and strain rates between 2*10-7 and 2*10-4 s-1, conditions which include dislocation creep regimes 2 and 3 of Hirth and Tullis [1992]. Flow stresses ranged from 34 +/- 16 to 268 +/- 38 MPa with corresponding recrystallized grain sizes from 46 +/- 15 to 3.2 +/- 0.7 μm. The data are well fit by a single piezometer relation, D = 103.56+/- 0.27 * σ-1.26 +/- 0.13, with no change in slope at the regime 2-3 transition and no effect of temperature or α/β stability field. Another experimental piezometer relation for regime 1 of Hirth and Tullis [1992] differs in slope, suggesting that different recrystallization mechanisms require different piezometer calibrations.

  2. Deuterium enrichment of the interstellar grain mantle

    Science.gov (United States)

    Das, Ankan; Sahu, Dipen; Majumdar, Liton; Chakrabarti, Sandip K.

    2016-01-01

    We carry out Monte Carlo simulation to study deuterium enrichments of interstellar grain mantles under various physical conditions. Based on the physical properties, various types of clouds are considered. We find that in diffuse cloud regions, very strong radiation fields persists and hardly a few layers of surface species are formed. In translucent cloud regions with a moderate radiation field, significant number of layers would be produced and surface coverage is mainly dominated by photo-dissociation products such as, C, CH3, CH2D, OH and OD. In the intermediate dense cloud regions (having number density of total hydrogen nuclei in all forms ˜2 × 104 cm-3), water and methanol along with their deuterated derivatives are efficiently formed. For much higher density regions (˜106 cm-3), water and methanol productions are suppressed but surface coverages of CO, CO2, O2 and O3 are dramatically increased. We find a very high degree of fractionation of water and methanol. Observational results support a high fractionation of methanol but surprisingly water fractionation is found to be low. This is in contradiction with our model results indicating alternative routes for de-fractionation of water. Effects of various types of energy barriers are also studied. Moreover, we allow grain mantles to interact with various charged particles (such as H+, Fe+, S+ and C+) to study the stopping power and projected range of these charged particles on various target ices.

  3. Transmission Electron Microscopy of Itokawa Regolith Grains

    Science.gov (United States)

    Keller, Lindsay P.; Berger, E. L.

    2013-01-01

    Introduction: In a remarkable engineering achievement, the JAXA space agency successfully recovered the Hayabusa space-craft in June 2010, following a non-optimal encounter and sur-face sampling mission to asteroid 25143 Itokawa. These are the first direct samples ever obtained and returned from the surface of an asteroid. The Hayabusa samples thus present a special op-portunity to directly investigate the evolution of asteroidal sur-faces, from the development of the regolith to the study of the effects of space weathering. Here we report on our preliminary TEM measurements on two Itokawa samples. Methods: We were allocated particles RA-QD02-0125 and RA-QD02-0211. Both particles were embedded in low viscosity epoxy and thin sections were prepared using ultramicrotomy. High resolution images and electron diffraction data were ob-tained using a JEOL 2500SE 200 kV field-emission scanning-transmission electron microscope. Quantitative maps and anal-yses were obtained using a Thermo thin-window energy-dispersive x-ray (EDX) spectrometer. Results: Both particles are olivine-rich (Fo70) with µm-sized inclusions of FeS and have microstructurally complex rims. Par-ticle RA-QD02-0125 is rounded and has numerous sub-µm grains attached to its surface including FeS, albite, olivine, and rare melt droplets. Solar flare tracks have not been observed, but the particle is surrounded by a continuous 50 nm thick, stuctur-ally disordered rim that is compositionally similar to the core of the grain. One of the surface adhering grains is pyrrhotite show-ing a S-depleted rim (8-10 nm thick) with nanophase Fe metal grains (<5 nm) decorating the outermost surface. The pyrrhotite displays a complex superstructure in its core that is absent in the S-depleted rim. Particle RA-QD02-0211 contains solar flare particle tracks (2x109 cm-2) and shows a structurally disordered rim 100 nm thick. The track density corresponds to a surface exposure of 103-104 years based on the track production rate

  4. Polysaccharide production by kefir grains during whey fermentation.

    Science.gov (United States)

    Rimada, P S; Abraham, A G

    2001-11-01

    Fermentation of deproteinised whey with kefir grains CIDCA AGK1 was studied focusing on polysaccharide production from lactose. Kefir grains were able to acidify whey at different rates depending on the grain/whey ratio. During fermentation, kefir grains increased their weight and a water-soluble polysaccharide was released to the media. Exopolysaccharide concentration increased with fermentation time, reaching values of 57.2 and 103.4 mg/l after 5 days of fermentation in cultures with 10 and 100 g kefir grains/l, respectively. The polysaccharide fraction quantified after fermentation corresponded to the soluble fraction, because part of the polysaccharide became a component of the grain. Weight of kefir grains varied depending on the time of fermentation. Polysaccharide production was affected by temperature. Although the highest concentration of polysaccharide in the media was observed at 43 degrees C at both grain/whey ratios, the weight of the grains decreased in these conditions. In conclusion, kefir grains were able to acidify deproteinised whey, reducing lactose concentration, increasing their weight and producing a soluble polysaccharide.

  5. Airtight storage of moist wheat grain improves bioethanol yields

    Directory of Open Access Journals (Sweden)

    Piens Kathleen

    2009-08-01

    Full Text Available Abstract Background Drying is currently the most frequently used conservation method for cereal grain, which in temperate climates consumes a major part of process energy. Airtight storage of moist feed grain using the biocontrol yeast Pichia anomala as biopreservation agent can substantially reduce the process energy for grain storage. In this study we tested the potential of moist stored grain for bioethanol production. Results The ethanol yield from moist wheat was enhanced by 14% compared with the control obtained from traditionally (dry stored grain. This enhancement was observed independently of whether or not P. anomala was added to the storage system, indicating that P. anomala does not impair ethanol fermentation. Starch and sugar analyses showed that during pre-treatment the starch of moist grain was better degraded by amylase treatment than that of the dry grain. Additional pre-treatment with cellulose and hemicellulose-degrading enzymes did not further increase the total ethanol yield. Sugar analysis after this pre-treatment showed an increased release of sugars not fermentable by Saccharomyces cerevisiae. Conclusion The ethanol yield from wheat grain is increased by airtight storage of moist grain, which in addition can save substantial amounts of energy used for drying the grain. This provides a new opportunity to increase the sustainability of bioethanol production.

  6. Knowledge, perceptions, and consumption of whole grains among university students.

    Science.gov (United States)

    Williams, Brock A; Mazier, M J Patricia

    2013-01-01

    Differences in knowledge, perceptions, and consumption of whole grains were compared between students who had taken an introductory university nutrition course and those who had not. The sample consisted of two groups: 109 students who had completed a nutrition course and 61 who had not. The two samples were drawn from second-year nursing students and students in second-year psychology courses, respectively. All students completed a 25-item questionnaire. Chi-square tests were used to identify associations between completion of a nutrition course and responses. Nutrition education students had more knowledge of whole grain recommendations, of whole grains available in stores, and of whole grains as a factor in disease risk reduction (pwhole grain health claims, reported a greater preference for the taste of whole grains, and had a greater than mean intake of whole grain cereals (pwhole grains than on students' consumption frequency or knowledge of whole grains. Further study may provide more information on nutrition education and whole grains.

  7. Consumption of whole grains in French children, adolescents and adults.

    Science.gov (United States)

    Bellisle, France; Hébel, Pascale; Colin, Justine; Reyé, Béatrice; Hopkins, Sinead

    2014-11-28

    The consumption of whole grain foods is associated with many nutritional, health and weight control benefits. The present study assessed whole grain intake in France on the basis of a 7 d dietary survey in a representative sample of children, adolescents and adults (Comportements et Consommations Alimentaires en France 2010 survey). Special care was taken to identify and assess the intake of all whole grains. All foods consumed were considered, with no lower limit on whole grain content. For the majority of foods, details regarding the whole grain contents were obtained from brand information and quantitative nutrient declarations on food labels. Over half of the respondents reported never consuming any whole grain. In participants who did, consumption levels were very low (about 9·1 g/d in children and 14·4 g/d in adults). The main food sources of whole grains were breakfast cereals in children and adolescents and bread in adults. Consumers of whole grains had higher daily intakes of fibre and several vitamins and minerals than non-consumers. In adults but not in children, the OR for overweight/obesity decreased significantly as the level of whole grain consumption increased. Although a majority of French consumers comply with the national recommendation to consume a starchy food with each meal, they do so with minimal consumption of whole grain foods.

  8. [Effect of processing on the antioxidant activity of amaranth grain].

    Science.gov (United States)

    Queiroz, Yara Severino de; Manólio Soares, Rosana Aparecida; Capriles, Vanessa Dias; Torres, Elizabeth Aparecida Ferraz da Silva; Areas, José Alfredo Gomes

    2009-12-01

    Amaranth has attracted increasing interest over recent decades because of its nutritional, functional and agricultural characteristics. Amaranth grain can be cooked, popped, toasted, extruded or milled for consumption. This study investigated the effect of these processes on the antioxidant activity of amaranth grain. Total phenolic content and in vitro antioxidant activity were determined according to two methods: inhibition of lipid oxidation using the beta-carotene/linoleic acid system and the antioxidant activity index using the Rancimat apparatus. The processing reduced the mean total phenolics content in amaranth grain from 31.7 to 22.0 mg of gallic acid equivalent/g of dry residue. It was observed that the ethanol extract from toasted grain was the only one that presented a lower antioxidant activity index compared with the raw grain (1.3 versus 1.7). The extrusion, toasting and popping processes did not change the capacity to inhibit amaranth lipid oxidation (55%). However, cooking increased the inhibition of lipid oxidation (79%), perhaps because of the longer time at high temperatures in this process (100 degrees C/10 min). The most common methods for processing amaranth grain caused reductions in the total phenolics content, although the antioxidant activity of popped and extruded grain, evaluated by the two methods, was similar to that of the raw grain. Both raw and processed amaranth grain presents antioxidant potential. Polyphenols, anthocyanins, flavonoids, tocopherols, vitamin C levels and Maillard reaction products may be related to the antioxidant activity of this grain.

  9. Grain Accumulation of Selenium Species in Rice (Oryza sativa L.)

    Energy Technology Data Exchange (ETDEWEB)

    Carey, Anne-Marie; Scheckel, Kirk G.; Lombi, Enzo; Newville, Matt; Choi, Yongseong; Norton, Gareth J.; Price, Adam H.; Meharg, Andrew A. (EPA); (U. South Australia); (Aberdeen); (UC)

    2012-09-05

    Efficient Se biofortification programs require a thorough understanding of the accumulation and distribution of Se species within the rice grain. Therefore, the translocation of Se species to the filling grain and their spatial unloading were investigated. Se species were supplied via cut flag leaves of intact plants and excised panicle stems subjected to a {+-} stem-girdling treatment during grain fill. Total Se concentrations in the flag leaves and grain were quantified by inductively coupled plasma mass spectrometry. Spatial accumulation was investigated using synchrotron X-ray fluorescence microtomography. Selenomethionine (SeMet) and selenomethylcysteine (SeMeSeCys) were transported to the grain more efficiently than selenite and selenate. SeMet and SeMeSeCys were translocated exclusively via the phloem, while inorganic Se was transported via both the phloem and xylem. For SeMet- and SeMeSeCys-fed grain, Se dispersed throughout the external grain layers and into the endosperm and, for SeMeSeCys, into the embryo. Selenite was retained at the point of grain entry. These results demonstrate that the organic Se species SeMet and SeMeSeCys are rapidly loaded into the phloem and transported to the grain far more efficiently than inorganic species. Organic Se species are distributed more readily, and extensively, throughout the grain than selenite.

  10. Grain size of fine-grained windblown sediment: a powerful proxy for process identification

    NARCIS (Netherlands)

    Vandenberghe, J.

    2013-01-01

    Dust transport by the wind is not a uniform process but may occur in different modes according to source area conditions and transport height and distance. Subsequently, these differences are expressed in terms of grain-size and fluxes of the aeolian deposits. Transport distances may vary from

  11. Structural disjoining potential for grain-boundary premelting and grain coalescence from molecular-dynamics simulations

    Science.gov (United States)

    Fensin, Saryu J.; Olmsted, David; Buta, Dorel; Asta, Mark; Karma, Alain; Hoyt, J. J.

    2010-03-01

    We describe a molecular-dynamics framework for the direct calculation of the short-ranged structural forces underlying grain-boundary premelting and grain coalescence in solidification. The method is applied in a comparative study of (i) a Σ9⟨115⟩120° twist and (ii) a Σ9⟨110⟩{411} symmetric tilt boundary in a classical embedded-atom model of elemental Ni. Although both boundaries feature highly disordered structures near the melting point, the nature of the temperature dependence of the width of the disordered regions in these boundaries is qualitatively different. The former boundary displays behavior consistent with a logarithmically diverging premelted layer thickness as the melting temperature is approached from below, while the latter displays behavior featuring a finite grain-boundary width at the melting point. It is demonstrated that both types of behavior can be quantitatively described within a sharp-interface thermodynamic formalism involving a width-dependent interfacial free energy, referred to as the disjoining potential. The disjoining potential for boundary (i) is calculated to display a monotonic exponential dependence on width, while that of boundary (ii) features a weak attractive minimum. The results of this work are discussed in relation to recent simulation and theoretical studies of the thermodynamic forces underlying grain-boundary premelting.

  12. 7 CFR 810.804 - Grades and grade requirements for mixed grain.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Grades and grade requirements for mixed grain. 810.804... OFFICIAL UNITED STATES STANDARDS FOR GRAIN United States Standards for Mixed Grain Grades and Grade Requirements § 810.804 Grades and grade requirements for mixed grain. (a) U.S. Mixed Grain (grade). Mixed grain...

  13. Multi-phase-field study of the effects of anisotropic grain-boundary properties on polycrystalline grain growth

    Science.gov (United States)

    Miyoshi, Eisuke; Takaki, Tomohiro

    2017-09-01

    Numerical studies of the effects of anisotropic (misorientation-dependent) grain-boundary energy and mobility on polycrystalline grain growth have been carried out for decades. However, conclusive knowledge has yet to be obtained even for the simplest two-dimensional case, which is mainly due to limitations in the computational accuracy of the grain-growth models and computer resources that have been employed to date. Our study attempts to address these problems by utilizing a higher-order multi-phase-field (MPF) model, which was developed to accurately simulate grain growth with anisotropic grain-boundary properties. In addition, we also employ general-purpose computing on graphics processing units to accelerate MPF grain-growth simulations. Through a series of simulations of anisotropic grain growth, we succeeded in confirming that both the anisotropies in grain-boundary energy and mobility affect the morphology formed during grain growth. On the other hand, we found the grain growth kinetics in anisotropic systems to follow parabolic law similar to isotropic growth, but only after an initial transient period.

  14. Whole grain cereals: functional components and health benefits.

    Science.gov (United States)

    Borneo, Rafael; León, Alberto Edel

    2012-02-01

    Cereal-based food products have been the basis of the human diet since ancient times. Dietary guidelines all over the world are recommending the inclusion of whole grains because of the increasing evidence that whole grains and whole-grain-based products have the ability to enhance health beyond the simple provision of energy and nutrients. In this review we will examine the main chemical components present in whole grains that may have health enhancing properties (dietary fiber, inulin, beta-glucan, resistant starch, carotenoids, phenolics, tocotrienols, and tocopherols) and the role that whole grains may play in disease prevention (cardiovascular diseases and strokes, hypertension, metabolic syndrome, type 2 diabetes mellitus, obesity, as well as different forms of cancer). The knowledge derived from the functional properties of the different chemical components present in whole grains will aid in the formulation and development of new food products with health enhancing characteristics.

  15. Segregation ratios of colored grains in F1 hybrid wheat

    Directory of Open Access Journals (Sweden)

    Zifeng Guo

    2012-01-01

    Full Text Available Nutritious and functional foods from wheat have received great attention in recent years. Colored-grain wheat contains a large number of nutrients such as anthocyanins and hence the breeding is interesting. In this work, colored-grained wheat lines of mixed pollination of einkorn wheat (Triticum boeoticum, AA and French rye (French Secale cereale, RR were used as male parents and wheat line Y1642 (derived from common wheat and Agropyron elongatum, AABBDD was used as the female parent. These colored wheat were used for diallel cross to study the segregation ratios of F1 colored grains. Results show that the color inheritance of purple-grained wheat follows a maternal inheritance pattern and that the blue-grained wheat expresses xenia in most cases. In some circumstances, the grains with different color shades appear in the same spike.

  16. Austenite grain growth calculation of 0.028% Nb steel

    Directory of Open Access Journals (Sweden)

    Priadi D.

    2011-01-01

    Full Text Available Modeling of microstructural evolution has become a powerful tool for materials and process design by providing quantitative relationships for microstructure, composition and processing. Insufficient attention has been paid to predicting the austenite grain growth of microalloyed steel and the effect of undissolved microalloys. In this research, we attempted to calculate a mathematical model for austenite grain growth of 0.028% Nb steel, which can account for abnormal grain growth. The quantitative calculation of austenite grain growth generated from this model fit well with the experimental grain growth data obtained during reheating of niobium steels. The results of this study showed that increasing the temperature increases the austenite grain size, with a sharp gradient observed at higher temperatures.

  17. Influence of subgrain boundaries on coarsening of grain structures

    Science.gov (United States)

    Zöllner, D.; Skrotzki, W.

    2017-05-01

    In the present work, the influence of subgrain boundaries on the coarsening kinetics of individual grains embedded in an average environment as well as within a grain structure is investigated. It is found that a specific introduction of subgrain boundaries not only influences the speed with which grains shrink or grow, but in contrast to the von Neumann-Mullins-law, a distinct manipulation of the location of the subgrain boundaries allows even grains with few edges to grow, while grains with many edges shrink. During these circumstances one fact stays the same: the area of the individual grains is a linear function of annealing time as long as the environment does not change.

  18. Whole grain foods and health : a Scandinavian perspective

    OpenAIRE

    Frølich, Wenche; Åman, Per; Tetens, Inge

    2013-01-01

    The food-based dietary guidelines in the Scandinavian countries that recommend an intake of minimum 75 g whole grain per 10 MJ (2,388 kcal) per day are mainly derived from prospective cohort studies where quantitative but little qualitative details are available on whole grain products. The objective of the current paper is to clarify possible differences in nutritional and health effects of the types of whole grain grown and consumed in the Scandinavian countries. A further objective is to s...

  19. Grain processing effects on starch utilization by ruminants.

    Science.gov (United States)

    Theurer, C B

    1986-11-01

    Starch utilization may be markedly enhanced by proper grain processing; however, extent of improvement is primarily dependent upon the ruminant species, grain source and method of processing. Grain processing has less impact on starch digestion by sheep than cattle. The magnitude of improvement is inverse to the starch digestion values for nonprocessed (or minimally processed) grains. Utilization of sorghum grain starch is improved most by extensive processing, and then corn, with little improvement in barley starch digestion. Studies comparing processing effects on barley or wheat starch utilization by cattle were not found. Steam-flaking consistently improves digestibility of starch by cattle fed corn- or sorghum grain-based diets over whole, ground or dry-rolled processes. Other extensive processing methods appear to enhance starch digestibility of corn and sorghum grain to a similar extent as steam-flaking, but comparative data are too limited to quantitate adequately effects of these methods. This improvement in starch utilization appears to be the primary reason for enhanced feed conversion of cattle fed diets high in these processed grains. The major site of cereal grain starch digestion is usually the rumen. Processing increases microbial degradation of starch in the rumen and decreases amounts of starch digested post-ruminally. Rates of in vitro amylolytic attack of starch in cereal grains by both ruminal microbial and pancreatic enzyme sources are improved by processing methods employing proper combinations of moisture, heat and pressure. In vitro and in situ studies suggest that much of the increase in ruminal starch fermentation with steam-flaking is due to changes in starch granular structure, which produces additive effects beyond those of decreasing particle size. Thus, efficiency of ruminal starch fermentation by cattle appears to be improved by proper processing of corn and sorghum grain. Processing and grain source studies both suggest that

  20. Anomalous permittivity in fine-grain barium titanate

    Science.gov (United States)

    Ostrander, Steven Paul

    Fine-grain barium titanate capacitors exhibit anomalously large permittivity. It is often observed that these materials will double or quadruple the room temperature permittivity of a coarse-grain counterpart. However, aside from a general consensus on this permittivity enhancement, the properties of the fine-grain material are poorly understood. This thesis examines the effect of grain size on dielectric properties of a self-consistent set of high density undoped barium titanate capacitors. This set included samples with grain sizes ranging from submicron to ˜20 microns, and with densities generally above 95% of the theoretical. A single batch of well characterized powder was milled, dry-pressed then isostatically-pressed. Compacts were fast-fired, but sintering temperature alone was used to control the grain size. With this approach, the extrinsic influences are minimized within the set of samples, but more importantly, they are normalized between samples. That is, with a single batch of powder and with identical green processing, uniform impurity concentration is expected. The fine-grain capacitors exhibited a room temperature permittivity of ˜5500 and dielectric losses of ˜2%. The Curie-temperature decreased by {˜}5sp°C from that of the coarse-grain material, and the two ferroelectric-ferroelectric phase transition temperatures increased by {˜}10sp°C. The grain size induced permittivity enhancement was only active in the tetragonal and orthorhombic phases. Strong dielectric anomalies were observed in samples with grain size as small as {˜}0.4\\ mum. It is suggested that the strong first-order character observed in the present data is related to control of microstructure and stoichiometry. Grain size effects on conductivity losses, ferroelectric losses, ferroelectric dispersion, Maxwell-Wagner dispersion, and dielectric aging of permittivity and loss were observed. For the fine-grain material, these observations suggest the suppression of domain wall

  1. Consumer Knowledge, Food Label Use and Grain Consumption

    OpenAIRE

    Lin, Biing-Hwan; Yen, Steven T.

    2005-01-01

    Responding to mounting evidence of the association between whole-grain consumption and a reduced risk of heart problems and other diseases as well as body weight maintenance, the U.S. Government has strongly encouraged its citizens to increase consumption of whole grains. However, compared against the 2005 Federal dietary recommendations, in 1994-96 only 6 percent of Americans met the current recommended whole-grain consumption. To narrow this huge gap between actual and recommended consumpti...

  2. The Long American Grain Invasion of Britain

    DEFF Research Database (Denmark)

    Sharp, Paul Richard

    This paper provides evidence that transatlantic commodity market integration began prior to the "first era of globalization" at the end of the nineteenth century. It does so by giving a long term perspective to the story of the development of an Atlantic Economy in wheat between the United States...... and Britain. Both trade statistics and contemporary comment reveal the importance of this trade from the middle to late eighteenth century, long before the so-called grain invasion of the late nineteenth century. Using data on imports from America and a large volume of substantiating primary evidence......, specific periods are identified when market integration might have been possible. Using price data for wheat in America and Britain, some evidence is found that markets were integrated, but this process was continuously being interrupted by "exogenous" events, such as trade policy, war and politics...

  3. On the Nature of Interstellar Grains

    Science.gov (United States)

    Hoyle, F.; Wickramasinghe, C.

    Data on interstellar extinction are interpreted to imply an identification of interstellar grains with naturally freeze-dried bacteria and algae. The total mass of such bacterial and algal cells in the galaxy is enormous, ~1040 g. The identification is based on Mie scattering calculations for an experimentally determined size distribution of bacteria. Agreement between our model calculations and astronomical data is remarkably precise over the wavelength intervals 1 μ-1 bacteria. The λ2200 Å interstellar absorption feature could be due to `degraded' cellulose strands which form spherical graphitic particles, but could equally well be due to protein-lipid-nucleic acid complexes in bacteria and viruses. Interstellar extinction at wavelengths λ < 1800 Å could be due to scattering by virus particles.

  4. Grain surface heating in cryogenic environment

    Science.gov (United States)

    Ramazanov, T. S.; Moldabekov, Zh. A.; Muratov, M. M.

    2017-05-01

    The surface temperature of the dust particle in cryogenic complex plasmas at gas pressure 0.6-10 Pa is considered. It is shown that at low pressure the dust particle surface temperature is significantly higher than that of the background gas, as a result of which the atom drag force is comparable with the screened Coulomb interaction and even exceeds it for the large-size dust particles. As the gas temperature near the grain surface is a slowly decreasing function of distance with asymptotic ˜1/r behavior, for correct description of the cryogenic complex plasma at low gas pressure, it is important to include effects related to the dust particle surface temperature.

  5. Steady-state grain growth in UO{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Galinari, C.M.; Lameiras, F.S. [CDTN/CNEN, Belo Horizonte (Brazil)

    1998-06-05

    The authors have observed steady-state grain growth in sintered UO{sub 2} pellets of nuclear purity at 2,003 K under H{sub 2}. The behavior of the grain size distribution at different instants is consistent with the grain growth model proposed by one of the authors. The total number of grains was estimated using the Saltykov`s method, and the evolution is in accordance with the model proposed by Rhines and Craig. The parabolic growth law was observed for the mean intercept length with n = 0.4.

  6. Austenite and ferrite grain size evolution in plain carbon steel

    Energy Technology Data Exchange (ETDEWEB)

    Militzer, M.; Giumelli, A.; Hawbolt, E.B.; Meadowcroft, T.R. [British Columbia Univ., Vancouver, BC (Canada)

    1995-01-01

    Grain size evolution in a 0.17%C, 0.74%Mn plain carbon steel is investigated using a Gleeble 1500 thermomechanical simulator. Austenite grain growth measurements in the temperature range from 900 to 1150{degrees}C have been used to validate the Abbruzzese and Luecke model, which is recommended for simulating grain growth during reheating. For run-out table conditions, the ferrite grain size decreases from 1l{mu}m to 4{mu}m when the cooling rate from the austenite is increased from 1 to 80{degrees}C/s.

  7. Jamming of Monodisperse Cylindrical Grains in Featureless Vertical Channels

    Science.gov (United States)

    Friedl, Nicholas; Baxter, G. William

    2014-03-01

    We study jamming of low aspect-ratio cylindrical Delrin grains falling through a featureless vertical channel under the influence of gravity. These grains have an aspect-ratio less than two (H/D aspirin tablets, 35mm film canisters, poker chips, or coins. Monodisperse grains are allowed to fall under the influence of gravity through a uniform channel of square cross-section where the channel width is greater than the grain size and constant along the length of the channel. No combination of grain heights and diameters is equal to the channel width. Collections of grains sometimes form jams, stable structures in which the grains are supported by the channel walls and not by grains or walls beneath them. The probability of a jam occurring and the jam's strength are influenced by the grain dimensions and channel width. We will present experimental measurements of the jamming probability and jam strength and discuss the relationship of these results to other experiments and theories. Supported by an Undergraduate Research Grant from Penn State Erie, The Behrend College.

  8. Oxygen-induced giant grain growth in Ag films

    Science.gov (United States)

    Birnbaum, A. J.; Thompson, C. V.; Steuben, J. C.; Iliopoulos, A. P.; Michopoulos, J. G.

    2017-10-01

    Thin film crystallites typically exhibit normal or abnormal growth with maximum grain size limited by energetic and geometric constraints. Although epitaxial methods have been used to produce large single crystal regions, they impose limitations that preclude some compelling applications. The generation of giant grain thin film materials has broad implications for fundamental property analysis and applications. This work details the production of giant grains in Ag films (2.5 μm-thick), ranging in size from ≈50 μm to 1 mm, on silicon nitride films upon silicon substrates. The presence of oxygen during film deposition plays a critical role in controlling grain size and orientation.

  9. Electrostatic forces on grains near asteroids and comets

    Directory of Open Access Journals (Sweden)

    Hartzell Christine

    2017-01-01

    Full Text Available Dust on and near the surface of small planetary bodies (e.g. asteroids, the Moon, Mars’ moons is subject to gravity, cohesion and electrostatic forces. Due to the very low gravity on small bodies, the behavior of small dust grains is driven by non-gravitational forces. Recent work by Scheeres et al. has shown that cohesion, specifically van der Waals force, is significant for grains on asteroids. In addition to van der Waals cohesion, dust grains also experience electrostatic forces, arising from their interaction with each other (through tribocharging and the solar wind plasma (which produces both grain charging and an external electric field. Electrostatic forces influence both the interactions of grains on the surface of small bodies as well as the dynamics of grains in the plasma sheath above the surface. While tribocharging between identical dielectric grains remains poorly understood, we have recently expanded an existing charge transfer model to consider continuous size distributions of grains and are planning an experiment to test the charge predictions produced. Additionally, we will present predictions of the size of dust grains that are capable of detaching from the surface of small bodies.

  10. Analysis of airborne pollen grains in Kırklareli

    OpenAIRE

    ERKAN, Perihan; BIÇAKCI, Adem; Aybeke, Mehmet; Malyer, Hulusi

    2011-01-01

    A continuous aeropalynological survey of the atmosphere of Kırklareli was carried out from January 2002 to December 2003 by means of the gravimetric method using Durham apparatus. Weekly pollen grains in per cm2 were calculated. During these 2 years, a total of 11,758 pollen grains were recorded. Pollen fall in the years 2002-2003 comprised grains belonging 46 taxa. Of these taxa, 26 belonged to arboreal and 20 taxa non-arboreal plants. In 2002, 6011 pollen grains and, in 2003, 5747 pollen gr...

  11. Production and Recoil Loss of Cosmogenic Nuclides in Presolar Grains

    Science.gov (United States)

    Trappitsch, Reto; Leya, Ingo

    2016-05-01

    Presolar grains are small particles that condensed in the vicinity of dying stars. Some of these grains survived the voyage through the interstellar medium (ISM) and were incorporated into meteorite parent bodies at the formation of the Solar System. An important question is when these stellar processes happened, I.e., how long presolar grains were drifting through the ISM. While conventional radiometric dating of such small grains is very difficult, presolar grains are irradiated with galactic cosmic rays (GCRs) in the ISM, which induce the production of cosmogenic nuclides. This opens the possibility to determine cosmic-ray exposure (CRE) ages, I.e., how long presolar grains were irradiated in the ISM. Here, we present a new model for the production and loss of cosmogenic 3He, 6,7Li, and 21,22Ne in presolar SiC grains. The cosmogenic production rates are calculated using a state-of-the-art nuclear cross-section database and a GCR spectrum in the ISM consistent with recent Voyager data. Our findings are that previously measured 3He and 21Ne CRE ages agree within the (sometimes large) 2σ uncertainties and that the CRE ages for most presolar grains are smaller than the predicted survival times. The obtained results are relatively robust since interferences from implanted low-energy GCRs into the presolar SiC grains and/or from cosmogenic production within the meteoroid can be neglected.

  12. Faceting of twin grain boundaries in polysilicon films

    Energy Technology Data Exchange (ETDEWEB)

    Nakhodkin, Nikolay; Rodionova, Tatyana [Department of Radiophysics, Kiev National Taras Shevchenko University (Ukraine); Kulish, Nikolay [Department of Physics, Kiev National Taras Shevchenko University (Ukraine)

    2010-02-15

    The faceting of grain boundaries (GB) under annealing in phosphorus-doped polysilicon films, produced by low-pressure chemical vapor deposition, has been investigated by transmission electron microscopy. It has been shown that the facet types and facet density depend on annealing temperature. It has been found that GB facets are generally parallel with close-packed planes in coincidence site lattice. A correlation between GB faceting and grain-growth mechanisms has been considered. It has been shown that faceting takes place both under normal and abnormal grain growth. It is revealed that twinning plays the key role for GB faceting under normal grain growth. (Abstract Copyright [2010], Wiley Periodicals, Inc.)

  13. Carbohydrates--the good, the bad and the whole grain

    National Research Council Canada - National Science Library

    Brand-Miller, Jennie; McMillan-Price, Joanna; Steinbeck, Katherine; Caterson, Ian

    2008-01-01

    .... Conventional high carbohydrate diets, even when based on whole grain foods, increase postprandial glycaemia and insulinemia and may compromise weight control via mechanisms relating to appetite...

  14. Enzymatic polishing of cereal grains for improved nutrient retainment

    National Research Council Canada - National Science Library

    Singh, Anshu; Karmakar, Sandipan; Jacob, B Samuel; Bhattacharya, Patrali; Kumar, S P. Jeevan; Banerjee, Rintu

    ... processing technologies. Application of enzyme for depolymerisation of carbohydrates present in bran layer of grain is becoming an efficient method for phenolic mobilization and dietary fiber solubilisation...

  15. Ultrasonic backscatter from elongated grains using line focused ultrasound.

    Science.gov (United States)

    Kube, Christopher M; Arguelles, Andrea P; Turner, Joseph A

    2018-01-01

    Ultrasonic backscattering from polycrystalline materials with elongated grains is investigated. A normal incident line-focus transducer is employed such that refracted longitudinal and transverse waves are focused within the polycrystal and scatter at grain boundaries back to the transducer. A ray-based scattering model is developed to explain the dependence of the statistics of scattering measurements on grain elongation. The spatial variance of measured scattered signals from Al alloy (7475-T7) is compared to the model. This work promotes the ultrasonic backscatter technique for monitoring grain elongation of metals using one transducer with access to a single sample face. Copyright © 2017 Elsevier B.V. All rights reserved.

  16. New Process for Grain Refinement of Aluminum. Final Report

    Energy Technology Data Exchange (ETDEWEB)

    Dr. Joseph A. Megy

    2000-09-22

    A new method of grain refining aluminum involving in-situ formation of boride nuclei in molten aluminum just prior to casting has been developed in the subject DOE program over the last thirty months by a team consisting of JDC, Inc., Alcoa Technical Center, GRAS, Inc., Touchstone Labs, and GKS Engineering Services. The Manufacturing process to make boron trichloride for grain refining is much simpler than preparing conventional grain refiners, with attendant environmental, capital, and energy savings. The manufacture of boride grain refining nuclei using the fy-Gem process avoids clusters, salt and oxide inclusions that cause quality problems in aluminum today.

  17. A comparison between corn and grain sorghum fermentation rates, Distillers Dried Grains with Solubles composition, and lipid profiles.

    Science.gov (United States)

    Johnston, David J; Moreau, Robert A

    2017-02-01

    The aim of this study was to determine if the compositional difference between grain sorghum and corn impact ethanol yields and coproduct value when grain sorghum is incorporated into existing corn ethanol facilities. Fermentation properties of corn and grain sorghum were compared utilizing two fermentation systems (conventional thermal starch liquefaction and native starch hydrolysis). Fermentation results indicated that protease addition influenced the fermentation rate and yield for grain sorghum, improving yields by 1-2% over non-protease treated fermentations. Distillers Dried Grains with Solubles produced from sorghum had a statistically significant higher yields and significantly higher protein content relative to corn. Lipid analysis of the Distillers Dried Grains with Solubles showed statistically significant differences between corn and sorghum in triacylglycerol, diacylglycerol and free fatty acid levels. Published by Elsevier Ltd.

  18. Grain- to multiple-grain-scale deformation processes during diffusion creep of forsterite + diopside aggregate: 1. Direct observations

    Science.gov (United States)

    Maruyama, G.; Hiraga, T.

    2017-08-01

    We uniaxially deformed fine-grained ( 1 μm) forsterite + diopside (5 and 20 vol %) aggregates in the diffusion creep regime. Prior to deformation, line markers were milled on a lateral surface of a cylindrical sample to detect single- to multiple-grain-scale deformation. We performed deformation experiments and observations of the marker-etched surface after sample cooling multiple times on the same specimens. The strain measured at the scale of several tens of grains from macroscopic shortening of the markers parallel to the compression axis is consistent with the total strain of the sample. However, microscopically, the markers are intensely segmented and rotated at the grain scale increasing with the sample strain. Meanwhile, essentially, no deformation is observed within the grains in most of the samples. The surface microstructures, including the deformation of the markers, reveal the serial operations of grain boundary migration, grain boundary sliding, rigid body grain rotation, and grain neighbor switching, which correspond well to processes expected in diffusion-controlled superplasticity. This sequence is commonly observed in both samples consisting of forsterite grains of tabular and equiaxed grain shapes, which have been shown to develop notable crystallographic preferred orientation (CPO) and random (or weak) CPO, respectively, during diffusion creep. Intragranular regions of relatively larger forsterite grains in the specimens deformed at stresses near the transition between deformation mechanisms from diffusion creep to dislocation creep reveal marker deformation and formation of surface creases and subgrain boundaries, which indicate intragranular dislocation processes. Overall, the surface microstructures reflect the deformation state of the materials well.

  19. Method of aeration disinfecting and drying grain in bulk and pretreating seeds and a transverse blow silo grain dryer therefor

    Science.gov (United States)

    Danchenko, Vitaliy G [Dnipropetrovsk, UA; Noyes, Ronald T [Stillwater, OK; Potapovych, Larysa P [Dnipropetrovsk, UA

    2012-02-28

    Aeration drying and disinfecting grain crops in bulk and pretreating seeds includes passing through a bulk of grain crops and seeds disinfecting and drying agents including an ozone and air mixture and surrounding air, subdividing the disinfecting and drying agents into a plurality of streams spaced from one another in a vertical direction, and passing the streams at different heights through levels located at corresponding heights of the bulk of grain crops and seeds transversely in a substantially horizontal direction.

  20. Grain-to-Grain Variations in NbC Particle Size Distributions in an Austenitic Stainless Steel

    DEFF Research Database (Denmark)

    Barlow, Claire; Ralph, B.; Silverman, B.

    1979-01-01

    Quantitative information has been obtained concerning the size distributions of NbC precipitate particles in different grains in a deformed and aged austenitic stainless steel specimen. The precipitate size distributions obtained differ from one grain to another. The average disparity measured...... between the mean precipitate sizes was a function of the distance betwen the grains compared. The results obtained are considered in terms of differences in precipitation behaviour due to variations in the levels of plastic strain in constituent grains of the deformed specimen....

  1. Effect of grain size and grain boundary defects on electrical and magnetic properties of Cr doped ZnO nanoparticles

    Science.gov (United States)

    Aljawfi, Rezq Naji; Rahman, F.; Batoo, Khalid M.

    2014-05-01

    Nanostructure of Zn1-xCrxO (x = 0.0, 0.05 and 0.1) were synthesized successfully through sol-gel route. The effects of grain size and grain boundary defects on the electrical and magnetic properties have been investigated. X-ray diffraction (XRD) and selected area electron diffraction (SAED) results reveal the single-phase character. Crystallite sizes were obtained from the XRD patterns whose values are decreasing from ˜27 to ˜16 nm with increase in Cr content from 0% to 10% respectively. X-ray photoelectron spectroscopy (XPS) confirms the incorporation of Cr3+/Cr2+ ions in the lattice structure of ZnO, which causes decreasing in the valence electron density of Zn. Dielectric constant (ɛ) has been explained in the light of Maxwell-Wagner interfacial model, which differentiates between the structure of grain-core and grain-boundary. Complex impedance spectroscopy has been used to separate the grain and grain boundary contributions, the high resistivity values (107 Ω) can be attributed to the dominance of grain boundary resistance. The samples exhibit room temperature ferromagnetic (RT-FM) behavior, which has been discussed based on BMP model and effect of grain/grain boundary structure.

  2. Grain orientation distribution and development of grain line in highly ordered Bi4Si3O12 micro-crystals

    OpenAIRE

    Zhang Z.G.; Wang X.F.; Tian Q.Q.

    2010-01-01

    Bismuth silicate (Bi4Si3O12) micro-crystals with a grain line structure were grown by a sintering method under atmosphere pressure. The as-grown products were studied using Xray diffraction (XRD) and Environmental scanning electron microscopy (ESEM). The grain orientation law was tested by the One-Sample Kolmogorov-Smirnov (K-S) test. The result shows Bi4Si3O12 grains are always distributed in pairs on both sides of a stable line. On one side of a line, the angle between grain orientation and...

  3. High night temperatures during grain number determination reduce wheat and barley grain yield: a field study.

    Science.gov (United States)

    García, Guillermo A; Dreccer, M Fernanda; Miralles, Daniel J; Serrago, Román A

    2015-11-01

    Warm nights are a widespread predicted feature of climate change. This study investigated the impact of high night temperatures during the critical period for grain yield determination in wheat and barley crops under field conditions, assessing the effects on development, growth and partitioning crop-level processes driving grain number per unit area (GN). Experiments combined: (i) two contrasting radiation and temperature environments: late sowing in 2011 and early sowing in 2013, (ii) two well-adapted crops with similar phenology: bread wheat and two-row malting barley and (iii) two temperature regimes: ambient and high night temperatures. The night temperature increase (ca. 3.9 °C in both crops and growing seasons) was achieved using purpose-built heating chambers placed on the crop at 19:000 hours and removed at 7:00 hours every day from the third detectable stem node to 10 days post-flowering. Across growing seasons and crops, the average minimum temperature during the critical period ranged from 11.2 to 17.2 °C. Wheat and barley grain yield were similarly reduced under warm nights (ca. 7% °C(-1) ), due to GN reductions (ca. 6% °C(-1) ) linked to a lower number of spikes per m(2) . An accelerated development under high night temperatures led to a shorter critical period duration, reducing solar radiation capture with negative consequences for biomass production, GN and therefore, grain yield. The information generated could be used as a starting point to design management and/or breeding strategies to improve crop adaptation facing climate change. © 2015 John Wiley & Sons Ltd.

  4. Increasing abscisic acid levels by immunomodulation in barley grains induces precocious maturation without changing grain composition

    OpenAIRE

    Staroske, Nicole; Conrad, Udo; Kumlehn, Jochen; Hensel, G?tz; Radchuk, Ruslana; Erban, Alexander; Kopka, Joachim; Weschke, Winfriede; Weber, Hans

    2016-01-01

    Abscisic acid (ABA) accumulates in seeds during the transition to the seed filling phase. ABA triggers seed maturation, storage activity, and stress signalling and tolerance. Immunomodulation was used to alter the ABA status in barley grains, with the resulting transgenic caryopses responding to the anti-ABA antibody gene expression with increased accumulation of ABA. Calculation of free versus antibody-bound ABA reveals large excess of free ABA, increasing signficantly in caryopses from 10 d...

  5. Euhedral metallic-Fe-Ni grains in extraterrestrial samples

    Science.gov (United States)

    Rubin, Alan E.

    1993-01-01

    Metallic Fe-Ni is rare in terrestrial rocks, being largely restricted to serpentinized peridotites and volcanic rocks that assimilated carbonaceous material. In contrast, metallic Fe-Ni is nearly ubiquitous among extraterrestrial samples (i.e., meteorites, lunar rocks, and interplanetary dust particles). Anhedral grains are common. For example, in eucrites and lunar basalts, most of the metallic Fe-Ni occurs interstitially between silicate grains and thus tends to have irregular morphologies. In many porphyritic chondrules, metallic Fe-Ni and troilite form rounded blebs in the mesostasis because their precursors were immiscible droplets. In metamorphosed ordinary chondrites, metallic Fe-Ni and troilite form coarse anhedral grains. Some of the metallic Fe-Ni and troilite grains has also been mobilized and injected into fractures in adjacent silicate grains where local shock-reheating temperatures reached the Fe-FeS eutectic (988 C). In interplanetary dust particles metallic Fe-Ni most commonly occurs along with sulfide as spheroids and fragments. Euhedral metallic Fe-Ni grains are extremely rare. Several conditions must be met before such grains can form: (1) grain growth must occur at free surfaces, restricting euhedral metallic Fe-Ni grains to systems that are igneous or undergoing vapor-deposition; (2) the metal (+/-) sulfide assemblage must have an appropriate bulk composition so that taenite is the liquidus phase in igneous systems or the stable condensate phase in vapor-deposition systems; and (3) metallic Fe-Ni grains must remain underformed during subsequent compaction, thermal metamorphism, and shock. Because of these restrictions, the occurrence of euhedral metallic Fe-Ni grains in an object can potentially provide important petrogenetic information. Despite its rarity, euhedral metallic Fe-Ni occurs in a wide variety of extraterrestrial materials. Some of these materials formed in the solar nebula; others formed on parent body surfaces by meteoroid

  6. Field grain losses and insect pest management practices in ...

    African Journals Online (AJOL)

    A farm survey was conducted in subsistence farming communities to document the major grain crops, insect pests, indigenous pest control methods (PCM) and farmer perceptions of grain losses associated with identifiable pest species and perceived efficacies of the PCMs. Maize, beans and sorghum were identified as the ...

  7. 78 FR 76098 - Rail Transportation of Grain, Rate Regulation Review

    Science.gov (United States)

    2013-12-16

    ... Surface Transportation Board 49 CFR Chapter X Rail Transportation of Grain, Rate Regulation Review AGENCY... shippers and provide effective protection against unreasonable freight rail transportation rates. DATES.... SUPPLEMENTARY INFORMATION: On November 2, 2006, the Board held a hearing in Rail Transportation of Grain, Docket...

  8. Graphical Selection of Sieve Mesh for Grain Sieves | Ahmed ...

    African Journals Online (AJOL)

    A graphical method was established to obtain the accurate screen apertures of sieves used for separating grain seeds from foreign matter at maximum efficiency thereby facilitating the proper design of a cleaning system. The method depends upon the statistical analysis of the physical/mechanical properties of both grain ...

  9. Chemical composition of hulled, dehulled and naked oat grains ...

    African Journals Online (AJOL)

    In grain samples of hulled (5 samples), dehulled (5 samples) and naked (4 samples) oats, the following components were determined: chemical composition (ash, crude protein, crude fat, crude fibre and its components) and amino acids and fatty acid composition. The grain of naked and dehulled oats contained ...

  10. Brewer's spent grain: A review of its potentials and applications ...

    African Journals Online (AJOL)

    Brewer's spent grain: A review of its potentials and applications. S Aliyu, M Bala. Abstract. Most developing nations continuously produce abundant agro-industrial residues such as brewer's spent grain (BSG), which are underexploited. BSG as the main by-product of brewing industry, representing approximately 85% of ...

  11. Particle Size Distribution in Milled Sorghum Grains of Different ...

    African Journals Online (AJOL)

    Sorghum bicolor (L) Moench] coded V3, V6 and V8 was determined by sieve analysis. The moisture content of the grains ranged between 9.83 and 10.60%, wet weight basis. The milling was carried out on whole grains using a laboratory pin mill ...

  12. Dynamic recrystallization and grain growth in olivine rocks

    NARCIS (Netherlands)

    Kellermann Slotemaker, A.

    2006-01-01

    A mechanism based description of the rheology of olivine is essential for modeling of upper mantle geodynamics. Previously, mantle flow has been investigated using flow laws for grain size insensitive (GSI) dislocation creep and/or grain size sensitive (GSS) diffusion creep of olivine. Generally,

  13. Relevance of standardization and grading in marketing of grains in ...

    African Journals Online (AJOL)

    This study examines the relevance of standardization and grading as a facilitating function in marketing of grains. The various measurement units, their acceptability and adoption by the consumers and traders along with the relationship of prices to different grades of grains was critically assessed. The study revealed that ...

  14. Classification system for rain fed wheat grain cultivars using artificial ...

    African Journals Online (AJOL)

    Artificial neural network (ANN) models have found wide applications, including prediction, classification, system modeling and image processing. Image analysis based on texture, morphology and color features of grains is essential for various applications as wheat grain industry and cultivation. In order to classify the rain ...

  15. relevance of standardization and grading in marketing of grains

    African Journals Online (AJOL)

    and distribution as well as storage functions constituted an essential link in marketing channel of grains and wereinvolved in carrying out the essential function of standardization and grading. The other set of people involved were farmers and departmental stores that also trade in grains, they constituted only about 6% of ...

  16. Marketing Of Agricultural Food Grains In Selected Markets In Zaria ...

    African Journals Online (AJOL)

    Evidence supporting this view includes the finding that little storage takes place by traders in the urban daily market of Zaria. In the urban markets trader's monthly purchases are about equal to monthly sales. There is a conterminous flow of grains to these urban markets from the rural areas. The large amount of grains is ...

  17. Computer-aided analysis of grain growth in metals

    DEFF Research Database (Denmark)

    Klimanek, P.; May, C.; Richter, H.

    1993-01-01

    Isothermal grain growth in aluminium, copper and alpha-iron was investigated experimentally at elevated temperatures and quantitatively interpreted by computer simulation on the base of a statistical model described in [4,5,6]. As it is demonstrated for the grain growth kinetics, the experimental...... data can be fitted satisfactorly....

  18. Small scale farmers' knowledge on grain losses from bean bruchid ...

    African Journals Online (AJOL)

    The grain loss causes shortage, food insecurity, high prices and reduced intake; denying farmers' s access and affordability. In this study, 53.9% of farmers used pesticides, while they were not trained on safe use, as a result 99% of them cooked and sold treated grains without waiting for recommended post treatment period.

  19. sorghum head bug infestation and mould infection on the grain

    African Journals Online (AJOL)

    ACSS

    2017-08-01

    Aug 1, 2017 ... Biotechnology 26:64 -69. Das, I.K. and Govardhan, C. 2015. Minimization of floret infection by fungi causing grain mold in sorghum (Sorghum bicolor) through use of fungicides. Indian. Phytopathology 68 (1): 67-72. Forbes, G.A., Bandyopadhyay, R. and Garcia,. G. 1992. A review of sorghum grain mould, ...

  20. A Madurella mycetomatis Grain Model in Galleria mellonella Larvae.

    Directory of Open Access Journals (Sweden)

    Wendy Kloezen

    Full Text Available Eumycetoma is a chronic granulomatous subcutaneous infectious disease, endemic in tropical and subtropical regions and most commonly caused by the fungus Madurella mycetomatis. Interestingly, although grain formation is key in mycetoma, its formation process and its susceptibility towards antifungal agents are not well understood. This is because grain formation cannot be induced in vitro; a mammalian host is necessary to induce its formation. Until now, invertebrate hosts were never used to study grain formation in M. mycetomatis. In this study we determined if larvae of the greater wax moth Galleria mellonella could be used to induce grain formation when infected with M. mycetomatis. Three different M. mycetomatis strains were selected and three different inocula for each strain were used to infect G. mellonella larvae, ranging from 0.04 mg/larvae to 4 mg/larvae. Larvae were monitored for 10 days. It appeared that most larvae survived the lowest inoculum, but at the highest inoculum all larvae died within the 10 day observation period. At all inocula tested, grains were formed within 4 hours after infection. The grains produced in the larvae resembled those formed in human and in mammalian hosts. In conclusion, the M. mycetomatis grain model in G. mellonella larvae described here could serve as a useful model to study the grain formation and therapeutic responses towards antifungal agents in the future.

  1. A Madurella mycetomatis Grain Model in Galleria mellonella Larvae

    Science.gov (United States)

    Kloezen, Wendy; van Helvert-van Poppel, Marilyn; Fahal, Ahmed H.; van de Sande, Wendy W. J.

    2015-01-01

    Eumycetoma is a chronic granulomatous subcutaneous infectious disease, endemic in tropical and subtropical regions and most commonly caused by the fungus Madurella mycetomatis. Interestingly, although grain formation is key in mycetoma, its formation process and its susceptibility towards antifungal agents are not well understood. This is because grain formation cannot be induced in vitro; a mammalian host is necessary to induce its formation. Until now, invertebrate hosts were never used to study grain formation in M. mycetomatis. In this study we determined if larvae of the greater wax moth Galleria mellonella could be used to induce grain formation when infected with M. mycetomatis. Three different M. mycetomatis strains were selected and three different inocula for each strain were used to infect G. mellonella larvae, ranging from 0.04 mg/larvae to 4 mg/larvae. Larvae were monitored for 10 days. It appeared that most larvae survived the lowest inoculum, but at the highest inoculum all larvae died within the 10 day observation period. At all inocula tested, grains were formed within 4 hours after infection. The grains produced in the larvae resembled those formed in human and in mammalian hosts. In conclusion, the M. mycetomatis grain model in G. mellonella larvae described here could serve as a useful model to study the grain formation and therapeutic responses towards antifungal agents in the future. PMID:26173126

  2. research note disappearance of processed maize grain in the rumen

    African Journals Online (AJOL)

    By comparison only 5 per cent of unpro- cessed maize grain disappeared within 24 hours and after six days about 80 per bent of the original DM of unpro- cessed maze were still left in the dacron bags. These results are in agreement with the results of Orskov er a/. (1978) who used barley as grain source. lo0. = h r'o. Eso.

  3. Barley distillers grains as a protein supplement for dairy cows.

    Science.gov (United States)

    Weiss, W P; Erickson, D O; Erickson, G M; Fisher, G R

    1989-04-01

    Dried distillers grains produced from a mix of 65% barley and 35% corn were evaluated in digestion and lactation experiments. Dried barley distillers grains had 56% NDF, 29% CP, 3% amino acid N, 2.5% NDIN (55% of total N), and 1.8% ADIN (39% of total N). Wet barley distillers grains had 38% NDF, 27% CP, 2.7% amino acid N, .5% NDIN (12% of total N), and .8% ADIN (19% of total N). Digestibility of DM and N was similar among lactating dairy cows fed diets containing approximately 25% corn silage DM, 15% alfalfa silage DM, 15% alfalfa hay DM, plus varying amounts of a corn-barley concentrate mix and supplemental CP from soybean meal, barley distillers grains, or from 1:1 mixture of soybean meal and barley distillers grains. Digestibility of ADIN, NDF, and ADF increased with increasing amounts of barley distillers grains in the diet. Similar diets were fed to 60 Holstein cows for 84 d in a lactation experiment. Source of supplemental protein did not affect milk production (22.5 kg/d), FCM (20.4 kg/d), milk fat percent (3.6%), or DM intake (19.0 kg/d). Milk protein percent was decreased by feeding barley distillers grains. It was concluded that barley distillers grains were an acceptable protein source for dairy cows and that ADIN and NDF might not be appropriate measures of the nutritional value of this product.

  4. Grain Structure Control of Additively Manufactured Metallic Materials

    Directory of Open Access Journals (Sweden)

    Fuyao Yan

    2017-11-01

    Full Text Available Grain structure control is challenging for metal additive manufacturing (AM. Grain structure optimization requires the control of grain morphology with grain size refinement, which can improve the mechanical properties of additive manufactured components. This work summarizes methods to promote fine equiaxed grains in both the additive manufacturing process and subsequent heat treatment. Influences of temperature gradient, solidification velocity and alloy composition on grain morphology are discussed. Equiaxed solidification is greatly promoted by introducing a high density of heterogeneous nucleation sites via powder rate control in the direct energy deposition (DED technique or powder surface treatment for powder-bed techniques. Grain growth/coarsening during post-processing heat treatment can be restricted by presence of nano-scale oxide particles formed in-situ during AM. Grain refinement of martensitic steels can also be achieved by cyclic austenitizing in post-processing heat treatment. Evidently, new alloy powder design is another sustainable method enhancing the capability of AM for high-performance components with desirable microstructures.

  5. Nutritional characterization of grain amaranth grown in Nigeria for ...

    African Journals Online (AJOL)

    Amaranths cruentus is a flowering plant species that yields the nutritious staple amaranth grain. Zinc in grain amaranth is reported to contribute to boosting the immune system and iron is required by enzymes for oxygen metabolism. This study is to exploit the multi-benefits of amaranth which ranged from improved ...

  6. Mineral Elements Content of some Coarse Grains used as staple ...

    African Journals Online (AJOL)

    In comparison with Recommended Dietary Allowances of essential and trace metals set by international standard organizations, the coarse grains analyzed in this work contribute little to the provision of essential and trace elements requirements. Keywords: Mineral Elements, Coarse Grains, Staple Food, Kano, Nigeria.

  7. Sugarcane aphid spatial distribution in grain sorghum fields

    Science.gov (United States)

    Sorghum is an important summer grain crop in the United States. In 2014, the U.S. produced 432 million bushels of sorghum valued at $1.67 billion on more than 6 million acres. The sugarcane aphid, Melanaphis sacchari (Zehntner), was discovered in damaging numbers in grain sorghum, Sorghum bicolor ...

  8. Comparison of triticale cultivars with maize grain for finishing lambs

    African Journals Online (AJOL)

    Grains from five triticale cultivars on the South African market ... enriched whole grain mixtures for feedlot lambs, although their FCR ... wheat or maize. McCloy et al. (1971) and Reddy et al. (1975), on the other hand, reported that triticale depressed animal perform- ance. Results obtained by sheep piroducers in the winter ...

  9. Expression of lipoxygenase isoenzymes in developing barley grains

    NARCIS (Netherlands)

    Schmitt, N.F.; Mechelen, J.R. van

    1997-01-01

    Expression of lipoxygenase was studied in whole developing barley grains from 5 days after flowering (DAF) to full maturity. Lipoxygenase showed two distinct peaks of activity. The first peak of activity occurred in the early stages of grain development from 5 until 20 DAF, whereas the second peak

  10. Porous and Fluffy Grains in the Regions of Anomalous Extinction

    Indian Academy of Sciences (India)

    tribpo

    coagulation a single grain consists of an assembly of small particles stuck together loosely; i.e., the particles are porous and fluffy. Hence, there is a need for models of electromagnetic scattering by porous and fluffy grains. Exact solutions to Maxwell's equations are known to calculate absorption, scattering and extinction of ...

  11. Economic Perspectives on Organic Grains: Past, Present, and Future

    Science.gov (United States)

    The organic food industry has seen tremendous growth over the past decade. This growth has led to an increase in demand for organic grains, and has been accompanied by an increase in the number of organic farms and an expansion in organic grain acreage in the U.S. Through this period, price premium...

  12. Mechanism of cube grain nucleation during recrystallization of ...

    Indian Academy of Sciences (India)

    The subject of cube texture nucleation i.e. cube grain nucleation, from the deformed state of aluminium and copper is of scientific curiosity with concurrent technological implications. There are essentially two models currently in dispute over the mechanism of cube grain nucleation i.e. the differential stored energy model ...

  13. Grain quality characteristics of imported rice in Ghana: Implications ...

    African Journals Online (AJOL)

    The rice brands came from Asia and the USA. The rice type from Asia was found to be Jasmine-styled aromatic long grained with low amylose content and gelatinisation temperature, whereas those of USA were conventional long grain with intermediate amylose content and gelatinisation temperature. These findings were ...

  14. Selenium concentration of maize grain in South Africa and possible ...

    African Journals Online (AJOL)

    A total of 896 maize grain samples were obtained from all the maize silos throughout South Africa (231 silos) and analysed for selenium (Se) content. This information was used to compile a regional distribution map of the Se content of maize grain in South Africa. Of the samples analysed, 94% contained below 50 μg ...

  15. Whole grain foods and health - A Scandinavian perspective

    DEFF Research Database (Denmark)

    Frølich, Wenche; Aman, Per; Tetens, Inge

    2013-01-01

    The food-based dietary guidelines in the Scandinavian countries that recommend an intake of minimum 75 g whole grain per 10 MJ (2,388 kcal) per day are mainly derived from prospective cohort studies where quantitative but little qualitative details are available on whole grain products. The objec...

  16. Thin layer drying kinetics of amaranth (Amaranthus cruentus) grains ...

    African Journals Online (AJOL)

    An experimental solar tent dryer under natural convection was used to study thin layer drying kinetics of amaranth (Amaranthus cruentus) grains. Drying of grains in the dryer was carried out on a drying rack having two layers; top and bottom. The ambient temperature and relative humidity ranged from 22.6–30.4oC and ...

  17. Heterosis and combining ability for grain yield and yield component ...

    African Journals Online (AJOL)

    Combining ability analysis for grain yield and yield component traits in maize were carried out in 8×8 diallel cross. The analysis of variance showed there is highly significant variation between the genotypes for all the traits considered. Year of testing was significant only for days to maturity and grain yield per hectare.

  18. Feeding potential of summer grain crop residues for woolled sheep ...

    African Journals Online (AJOL)

    Oesophageal samples were separated into grain and straw (including weeds) !o determine the grain:straw ratio and were analysed for dry matter (DM), organic matter (OM), crude protein (CP) and in vitro digestible organic matter (MOM). Digestible organic matter and protein intake of sheep generally decreased with.

  19. Quantitative trait locus (QTL) analysis of percentage grains ...

    African Journals Online (AJOL)

    user

    2011-03-28

    Mar 28, 2011 ... manipulative network and formative mechanisms of rice chalkiness. In the present study, amplified fragment length poly- morphism (AFLP) markers and ... replicates of 100 grains per entry were assessed by visual assessment. The mean percentage of chalky grains represented the PGC score for each line.

  20. Nitrogen dose and plant density effects on popcorn grain yield ...

    African Journals Online (AJOL)

    Popcorn (Zea mays everta Sturt.) is a popular and nutritious snack food. Environmental factors affecting grain yield and yield-related components of popcorn are needed to compensate increasing demand. This research was conducted to determine the effects of nitrogen fertilizer application rates and plant densities on grain ...

  1. Grain Growth in Samples of Aluminum Containing Alumina Particles

    DEFF Research Database (Denmark)

    Tweed, C. J.; Hansen, Niels; Ralph, B.

    1983-01-01

    A study of the two-dimensional and three-dimensional grain size distributions before and after grain growth treatments has been made in samples having a range of oxide contents. In order to collect statistically useful amounts of data, an automatic image analyzer was used and the resulting data w...

  2. Towards realistic molecular dynamics simulations of grain boundary mobility

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, J., E-mail: zhou@imm.rwth-aachen.de [Institut fuer Metallkunde und Metallphysik, Rheinisch-Westfaelische Technische Hochschule (RWTH), Aachen (Germany); Mohles, V. [Institut fuer Metallkunde und Metallphysik, Rheinisch-Westfaelische Technische Hochschule (RWTH), Aachen (Germany)

    2011-09-15

    In order to investigate grain boundary migration by molecular dynamics (MD) simulations a new approach involving a crystal orientation-dependent driving force has been developed by imposing an appropriate driving force on grain boundary atoms and enlarging the effective range of driving force. The new approach has been validated by the work of the driving force associated with the motion of grain boundaries. With the new approach the relation between boundary migration velocity and driving force is found to be nonlinear, as was expected from rate theory for large driving forces applied in MD simulations. By evaluating grain boundary mobility nonlinearly for a set of symmetrical <1 1 1> tilt boundaries in aluminum at high temperature, high-angle grain boundaries were shown to move much faster than low-angle grain boundaries. This agrees well with experimental findings for recrystallization and grain growth. In comparison with the available data the simulated mobility of a 38.21{sup o{Sigma}}7 boundary was found to be significantly lower than other MD simulation results and comparable with the experimental values. Furthermore, the average volume involved during atomic jumps for boundary migration is determined in MD simulations for the first time. The large magnitude of the volume indicates that grain boundary migration is accomplished by the correlated motion of atom groups.

  3. Changes in the Nutrient Composition of Brewery Spent Grain ...

    African Journals Online (AJOL)

    BSN

    protein fraction. This is true, especially in the feeding of monogastrics. This paper investigates the possible enhancement of the nutrient composition brewery spent sorghum grain through solid state natural fermentation. Materials and methods. Fermentation Procedure: Twenty grams. (20g) each of dry spent sorghum grain ...

  4. evaluation of grain nutritional quality and resistant starch content in ...

    African Journals Online (AJOL)

    USER

    in each of the study sites, using a Hege Machine model 125C; and the grains were later threshed. TABLE 2. Kenyan bread wheat varieties and their characteristics. Variety. Year of. Description. Yield release. (t ha-1). Robin. 2011. Red, hard grain, resistant to stem rust especially Ug99 strain and spring. 8.1 growth habits.

  5. Cavitation-aided grain refinement in aluminium alloys

    NARCIS (Netherlands)

    Atamanenko, T.V.

    2010-01-01

    This thesis deals with grain refinement under the influence of ultrasonic-driven cavitation in aluminium casting processes. Three major goals of this research were: (1) to identify the mechanism of the cavitation-aided grain refinement at different stages of solidification; (2) to reveal the

  6. Vernonia amygdalina and Ocimum gratissimum as grain protectants ...

    African Journals Online (AJOL)

    The plant extracts showed efficiency against the test insect with respect to adult mortality, larval and progeny emergence and percentage grain damage. Adult mortality was highest (88.9%) in maize grains treated with 3% (v/w) of the leaf extracts 3 days post treatment. It was observed that leaf extracts of V. amygdalina and ...

  7. Mycopopulations of grain and flour of wheat, corn and buckwheat

    Directory of Open Access Journals (Sweden)

    Plavšić Dragana V.

    2017-01-01

    Full Text Available According to the nutritive characteristics, whole grain flour is a high quality product, due to its high vitamin, mineral, and dietary fiber content. However, the cereal grains are susceptible to the series of contamination during the ripening, harvesting, processing and storage. The aim of this work was to determine mold presence in grains and flour of wheat, corn and buckwheat. The determination of total number and identification of isolated genera and species of molds were the subject of this research. All samples were contaminated with the molds. The total number of molds per 100 cereal grains was between 60 cfu (wheat and 120 cfu (buckwheat. The total number of molds in the samples of flour ranged from 6.0x101 cfu/g in white wheat flour to 5.0 x102 cfu/g in buckwheat whole grain flour (DG18 medium. Eight fungal genera (Alternaria, Aspergillus, Cladosporium, Chrysonilia, Fusarium, Penicillium, Rhizopus and Scopulariopsis and fifteen species were isolated. The largest number of species of molds was isolated from the genus Aspergillus. About 66.7% of isolated fungi belonged to potentially toxigenic species. The results pointed out the necessity of grain surface treatment, preceding the milling of grains in wheat, corn and whole grain buckwheat flour production.

  8. Insights into a hydration regulating system in Cupressus pollen grains.

    Science.gov (United States)

    Danti, R; Della Rocca, G; Calamassi, R; Mori, B; Mariotti Lippi, M

    2011-08-01

    Hydration, rupture and exine opening due to the sudden and large expansion of intine are typical of taxoid-type pollen grains. A hemispheric outgrowth external to the exine was observed on Cupressus and Juniperus pollen grains before the intine swelling and exine release. However, the actual existence of this permanent or temporary structure and its precise role in pollen hydration is still being debated. The aim of this paper is to collect information on the actual presence of this peculiar outgrowth on the surface of the Cupressus pollen grain, its structure, composition and function. Pollen grains of several Cupressus species were observed using various techniques and methodologies, under light and fluorescence microscopy, phase-contrast microscopy, confocal microscopy, scanning electron microscopy, and an environmental scanning electron microscope. Observations were also performed on other species with taxoid-type pollen grains. A temporary structure located just above the pore was observed on Cupressus pollen grains, as well as on other taxoid-type pollens. It is hemispheric, layered, and consists of polysaccharides and proteins. The latter are confined to its inner part. Its presence seems to regulate the entrance of water into the grains at the beginning of pollen hydration. The presence of a temporary structure over the pore of taxoid-type pollen grains was confirmed and its structure was resolved using several stains and observation techniques. This structure plays a role in the first phases of pollen hydration.

  9. Grain dehullers: less toil, more food for Africans | IDRC ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2010-10-28

    Oct 28, 2010 ... Before grains like millet or sorghum can be milled into flour or used for other purposes, the hulls must be removed. This chore, when carried out in traditional fashion by hand, is tedious and physically demanding. The grains must be softened by soaking, then vigorously pounded with a large pestle in a ...

  10. Genetic Potential of Winter Wheat Grain Quality in Central Asia

    Science.gov (United States)

    Abugaliyeva, Aigul I.; Morgounov, Alexey I.

    2016-01-01

    The grain quality of winter wheat varies significantly by cultivars and growing region, not previously differentiated by end-use (baking, confectionery, etc.) in the national breeding programs. In these conditions it is advisable to determine the genetic potential and analyze the actual grain quality. Determining the genetic potential requires the…

  11. Nanoscale grain growth behaviour of CoAl intermetallic synthesized ...

    Indian Academy of Sciences (India)

    Administrator

    ing up to 0⋅7 Tm. The grain growth exponent remained constant above 873 K indicating that grain growth mechanism does not change at ... nanocrystalline CoAl under isothermal annealing at temperatures above 873 K (T/Tm ≥ 0⋅5). Keywords. ..... Wu S P, Zhao Q Y, Zheng L Q and Ding X H 2011 Solid State. Sci. 13 548.

  12. Grain yield stability of new maize varieties in Nigeria | Ogunbodede ...

    African Journals Online (AJOL)

    The hybrid maize varieties and four of the seven OPs were found to be stable in grain production across the locations. Significant genotype x location interaction was also observed for both sets of maize varieties. The best hybrid (8522-2) combined stability with high grain yield and wide adaptability. This variety may thus be ...

  13. Effect of stress-induced grain growth during room temperature ...

    Indian Academy of Sciences (India)

    -induced grain ... The TEM observations reveal that stress-induced grain growth during tensile deformation is significantly suppressed for the nc Ni–Co alloys rich in Co in sharp contrast to those poor in Co. We believe that sufficient solutes ...

  14. Size modification of recent pollen grains under different treatments

    NARCIS (Netherlands)

    Reitsma, Tj.

    1969-01-01

    The effect of various chemicals on the size of recent pollen grains of Corylus avellana L. and Quercus robur L. was studied. The size of acetolysed grains was affected by the treatment prior to acetolysis and moreover by the duration of acetolysis. Preparation methods, which produce comparable sizes

  15. Molecular investigations on grain filling rate under terminal heat ...

    African Journals Online (AJOL)

    Ezedom Theresa

    2013-07-10

    Jul 10, 2013 ... Grain yield under post anthesis high temperature stress is largely influenced by grain filling rate (GFR). To investigate ... 75% of the progenies showed no difference while 25% showed significant difference in GFR under high temperature .... timely (normal) and late (terminal heat stress) conditions. Data on.

  16. Problems Associated with Marketing of some Selected Grains in ...

    African Journals Online (AJOL)

    The study is aimed at determining the various problems associated with marketing of marketing of major grains in Niger State, with reference to Bosso Local Government Area. Purpose sampling techniques was use to select 100 grains marketers from four markets in the area. Data collected for analysis include ...

  17. Selenium concentration of maize grain in South Africa and possible ...

    African Journals Online (AJOL)

    Casey W

    Abstract. A total of 896 maize grain samples were obtained from all the maize silos throughout South Africa. (231 silos) and analysed for selenium (Se) content. This information was used to compile a regional distribution map of the Se content of maize grain in South Africa. Of the samples analysed, 94% contained below 50 ...

  18. Does Whole Grain Consumption Alter Gut Microbiota and Satiety?

    Directory of Open Access Journals (Sweden)

    Danielle N. Cooper

    2015-05-01

    Full Text Available This review summarizes recent studies examining whole grain consumption and its effect on gut microbiota and satiety in healthy humans. Studies comparing whole grains to their refined grain counterparts were considered, as were studies comparing different grain types. Possible mechanisms linking microbial metabolism and satiety are described. Clinical trials show that whole grain wheat, maize, and barley alter the human gut microbiota, but these findings are based on a few studies that do not include satiety components, so no functional claims between microbiota and satiety can be made. Ten satiety trials were evaluated and provide evidence that whole oats, barley, and rye can increase satiety, whereas the evidence for whole wheat and maize is not compelling. There are many gaps in the literature; no one clinical trial has examined the effects of whole grains on satiety and gut microbiota together. Once understanding the impact of whole grains on satiety and microbiota is more developed, then particular grains might be used for better appetite control. With this information at hand, healthcare professionals could make individual dietary recommendations that promote satiety and contribute to weight control.

  19. Laboratory Studies Of Circumstellar Carbonaceous Grain Formation

    Science.gov (United States)

    Contreras, Cesar; Sciamma-O'Brien, Ella; Salama, Farid

    2014-06-01

    The study of the formation processes of dust is essential to understand the budget of extraterrestrial organic molecules. Although dust with all its components plays an important role in the evolution of interstellar (IS) chemistry and in the formation of organic molecules, little is known on the formation processes of carbonaceous dust. We report the progress that was recently achieved in this domain using NASA Ames’ COSmIC facility (Contreras & Salama 2013, ApJS, 208, 6). PAHs are important chemical building blocks of IS dust. They are detected in IDPs and in meteoritic samples. Additionally, observational, laboratory, and theoretical studies have shown that PAHs are an important, ubiquitous component of the ISM. The formation of PAHs from smaller molecules has not been extensively studied. Therefore, we have performed laboratory experiments to study the dynamic processes of carbon grain formation, starting from the smallest hydrocarbon molecules into the formation of larger PAH and further into nanograins. Studies of IS dust analogs formed from a variety of PAH and hydrocarbon precursors as well as species that include the atoms O, N, and S, have recently been performed in our laboratory using the COSmIC facility to provide conditions that simulate IS and circumstellar environments. The species formed in the COSmiC chamber through a pulsed discharge nozzle plasma source are detected and characterized with a cavity ringdown spectrometer coupled to a time-of-flight mass spectrometer, thus providing both spectroscopic and ion mass information in-situ. Analysis of solid soot particles was also conducted using scanning electron microscopy at the UCSC/NASA Ames’ MACS facility. The SEM analysis of the deposition of soot from methane and acetylene precursors seeded in argon plasmas provide examples on the types of nanoparticles and micrograins that are produced in these gas mixtures under our experimental conditions. From these measurements, we derive information on

  20. Dark grains of sand: a geological storytelling

    Science.gov (United States)

    Gallo Maresca, Magda

    2017-04-01

    In the secondary Italian school the Earth science learning begins at first year, in synergy with other natural science subjects such as Astronomy, Chemistry and Biology. Italian teachers have to focus on the landscape geomorphological aspects and often Earth processes are difficult to display since they are related to certain phenomena happened during the past and often far from the involved country. In order to better understand the environment surrounding us, very simple and poor materials, like sands, allow the teachers to create attractive lab experiences. According to the IBSE (Inquiry Based Science Education) approach, a learning unit has been implemented starting from a walking along the light carbonate beaches of the Adriatic sea: a smart look to the sands ("engage step"), stroke the students fantasy pushing them to explore some strange black grains on the sands. Dirty sands? Or rock landscape, soil degradation and Ofanto river and coastal processes (erosion, transportation and deposition)? This was the teaching challenge. Due to the youngest age, a third level, guided inquiry, was adopted so the teacher is the "guide of inquiry" encouraging the students using the research question ("Why is the sand dark?", "Do all sands look the same?", "Where does it come from?") and driving the students around their investigation plans ("How can I measure grain size?"). A procedure to answer the above questions and validate the results and explanations has been implemented to allow the students to be proactive in their study. During the learning activities will be the students to ask for field trip to elaborate their new knowledge, verify and visualize the speculated processes. The teaching skills allow to address several geosciences domains such as mineralogy, petrology, regional geology and geodynamics as well as other scientific disciplines such as mathematics (more specifically statistics), forensic science and even life sciences (the presence of bioclasts might

  1. The influence of grain size, grain color, and suspended-sediment concentration on light attenuation: why fine-grained terrestrial sediment is bad for coral reef ecosystems

    Science.gov (United States)

    Storlazzi, Curt; Norris, Benjamin; Rosenberger, Kurt

    2015-01-01

    Sediment has been shown to be a major stressor to coral reefs globally. Although many researchers have tested the impact of sedimentation on coral reef ecosystems in both the laboratory and the field and some have measured the impact of suspended sediment on the photosynthetic response of corals, there has yet to be a detailed investigation on how properties of the sediment itself can affect light availability for photosynthesis. We show that finer-grained and darker-colored sediment at higher suspended-sediment concentrations attenuates photosynthetically active radiation (PAR) significantly more than coarser, lighter-colored sediment at lower concentrations and provide PAR attenuation coefficients for various grain sizes, colors, and suspended-sediment concentrations that are needed for biophysical modeling. Because finer-grained sediment particles settle more slowly and are more susceptible to resuspension, they remain in the water column longer, thus causing greater net impact by reducing light essential for photosynthesis over a greater duration. This indicates that coral reef monitoring studies investigating sediment impacts should concentrate on measuring fine-grained lateritic and volcanic soils, as opposed to coarser-grained siliceous and carbonate sediment. Similarly, coastal restoration efforts and engineering solutions addressing long-term coral reef ecosystem health should focus on preferentially retaining those fine-grained soils rather than coarse silt and sand particles.

  2. Cyclitols in maturing grains of wheat, triticale and barley

    Directory of Open Access Journals (Sweden)

    Lesław B. Lahuta

    2011-01-01

    Full Text Available In the present study, the feeding of stem-flag leaf-ear explants of wheat, triticale and barley with d-chiro-inositol and d-pinitol was used for modification of the composition of soluble carbohydrates in grains without genetic transformation of plants. Maturing grains indicated ability to uptake exogenously applied cyclitols, not occurring naturally in cereal plants, and synthesized their a-d-galactosides. The pattern of changes in soluble carbohydrates during grain maturation and germination was not disturbed by the uptake and accumulation of cyclitols. Both, d-chiro-inositol and d-pinitol as well as their a-d-galactosides can be an additional pool of soluble carbohydrates accumulated by maturing grains, without decreasing seeds viability. This is the first report indicating the possibility of introduction of cyclitols with potentially human health benefits properties into cereal grains.

  3. Prediction on Austenite Grain Growth in High Carbon Steel

    Directory of Open Access Journals (Sweden)

    MA Han

    2017-01-01

    Full Text Available The austenite grain growth behavior of Ti-bearing and Ti-free steel was investigated using confocal laser scanning microscope (CLSM and transmission electron microscope (TEM.Samples were held for 60min at 1123-1473K and then austenite grain sizes for different holding time at a series of temperatures were measured.The results show that austenite grain size of both steels increases with the increase of temperature.Besides,the austenite grain size of both steels grows with the holding time,which meets parabolic equation.The second phase particle was observed.The equation of Ostwald ripening was introduced to calculate the size of particle,and the volume fraction equation of second phase particle was applied to calculate the volume fraction of particle.Meanwhile,the modified Gladman model was adopted to predict austenite grain growth.The predicted results agree well with the measured results.

  4. Science at the interface : grain boundaries in nanocrystalline metals.

    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez, Mark Andrew; Follstaedt, David Martin; Knapp, James Arthur; Brewer, Luke N.; Holm, Elizabeth Ann; Foiles, Stephen Martin; Hattar, Khalid M.; Clark, Blythe B.; Olmsted, David L.; Medlin, Douglas L.

    2009-09-01

    Interfaces are a critical determinant of the full range of materials properties, especially at the nanoscale. Computational and experimental methods developed a comprehensive understanding of nanograin evolution based on a fundamental understanding of internal interfaces in nanocrystalline nickel. It has recently been shown that nanocrystals with a bi-modal grain-size distribution possess a unique combination of high-strength, ductility and wear-resistance. We performed a combined experimental and theoretical investigation of the structure and motion of internal interfaces in nanograined metal and the resulting grain evolution. The properties of grain boundaries are computed for an unprecedented range of boundaries. The presence of roughening transitions in grain boundaries is explored and related to dramatic changes in boundary mobility. Experimental observations show that abnormal grain growth in nanograined materials is unlike conventional scale material in both the level of defects and the formation of unfavored phases. Molecular dynamics simulations address the origins of some of these phenomena.

  5. Pure iron grains are rare in the universe.

    Science.gov (United States)

    Kimura, Yuki; Tanaka, Kyoko K; Nozawa, Takaya; Takeuchi, Shinsuke; Inatomi, Yuko

    2017-01-01

    The abundant forms in which the major elements in the universe exist have been determined from numerous astronomical observations and meteoritic analyses. Iron (Fe) is an exception, in that only depletion of gaseous Fe has been detected in the interstellar medium, suggesting that Fe is condensed into a solid, possibly the astronomically invisible metal. To determine the primary form of Fe, we replicated the formation of Fe grains in gaseous ejecta of evolved stars by means of microgravity experiments. We found that the sticking probability for the formation of Fe grains is extremely small; only a few atoms will stick per hundred thousand collisions so that homogeneous nucleation of metallic Fe grains is highly ineffective, even in the Fe-rich ejecta of type Ia supernovae. This implies that most Fe is locked up as grains of Fe compounds or as impurities accreted onto other grains in the interstellar medium.

  6. Rapid grain size fining in modern and Pliocene Himalayan rivers

    Science.gov (United States)

    Dubille, Matthieu; Lave, Jerome

    2013-04-01

    Rapid grain size changes between two main units of a sedimentary megacycle in a foreland basin are commonly interpreted to result from changes in tectonic activity or climate in the adjacent mountain range. In central Nepal, the Cenozoic Siwaliks molasse deposits exposed in the frontal Himalayan folds are characterized by such a radical grain size transition. Locally gravel deposits completely replace sands in the upward sequence within about a hundred meters, the median grain size (D50) displaying a sharp increase by a factor of ~100. Such a rapid gravel-sand transition is also observed in present-day river channels about 8-20 km downstream from the outlet of the frontal Himalaya. The passage from gravel-covered channel reaches (proximal alluvial fans) to sand-covered channel reaches (distal alluvial fans) occurs within a few kilometres on the Gangetic Plain in central Nepal, and the D50 ratio between the two types of channels equals ~100. We propose that the dramatic and remarkably similar decrease in grain size observed in the Siwaliks series and along modern rivers in the Gangetic foreland basin, results from a similar hydrological process, i.e. a grain sorting process during the selective deposition of the sediment load. Such behaviour is quite well reproduce by simple grain-size-dependent sediment transport models if we account for the initial grain size distribution of the eroded sediments. By analogy with modern rivers behaviour, the sudden grain size decrease observed in the Cenozoic Siwaliks molasse deposits is interpreted as the crossing of this sorting transition during progressive southward migration of the depositional facies in response to continuous Himalayan orogen construction. This study demonstrates that an abrupt change in grain size does not necessarily relate to a change in tectonic or climatic forcing, but can simply arise from internal adjustment of the piedmont rivers to the deposition of coarse bedload and grain segregation processes.

  7. Investigation of microorganisms involved in biosynthesis of the kefir grain.

    Science.gov (United States)

    Wang, Sheng-Yao; Chen, Kun-Nan; Lo, Yung-Ming; Chiang, Ming-Lun; Chen, Hsi-Chia; Liu, Je-Ruei; Chen, Ming-Ju

    2012-12-01

    The purpose of this study was to understand the significance of each microorganism in grain formation by evaluating their microbial aggregation and cell surface properties during co-aggregation of LAB and yeasts together with an investigation of biofilm formation. Non-grain forming strains from viili were also evaluated as a comparison. Results indicated that the kefir grain strains, Lactobacillus kefiranofaciens and Saccharomyces turicensis possess strong auto-aggregation ability and that Lactobacillus kefiri shows significant biofilm formation properties. Significant co-aggregation was noted when S. turicensis and kefir LAB strains (Lb. kefiranofaciens and Lb. kefiri) were co-cultured. Most of the tested LAB strains are hydrophilic and had a negative charge on their cell surface. Only the kefir LAB strains, Lb. kefiranofaciens HL1 and Lb. kefiri HL2, possessed very high hydrophobicity and had a positive cell surface charge at pH 4.2. In contrast, the LAB and yeasts in viili did not show any significant self-aggregation or biofilm formation. Based on the above results, we propose that grain formation begins with the self-aggregation of Lb. kefiranofaciens and S. turicensis to form small granules. At this point, the biofilm producer, Lb. kefiri, then begins to attach to the surface of granules and co-aggregates with other organisms and components in the milk to form the grains. On sub-culturing, more organisms attach to the grains resulting in grain growth. When investigated by scanning electron microscopy, it was found that short-chain lactobacilli such as Lb. kefiri occupy the surface, while long-chain lactobacilli such as Lb. kefiranofaciens have aggregated towards the center of the kefir grains. These findings agree with the above hypothesis on the formation of grains. Taken together, this study demonstrates the importance of cell surface properties together with fermentation conditions to the formation of grains in kefir. Copyright © 2012 Elsevier Ltd. All

  8. Grain charging in dusty plasmas (Invited)

    Science.gov (United States)

    Horanyi, M.

    2013-12-01

    Dusty plasmas represent the most general form of space, laboratory, and industrial plasmas. Interplanetary space, comets, planetary rings, asteroids, and aerosols in the atmosphere, are all examples where electrons, ions, and dust particles coexist. Dust particles immersed in plasmas and UV radiation collect electrostatic charges and respond to electromagnetic forces in addition to all the other forces acting on uncharged grains. Simultaneously, dust can alter its plasma environment. Dust particles in plasmas are unusual charge carriers. They are many orders of magnitude heavier than any other plasma particles, and they can have many orders of magnitude larger (negative or positive) time-dependent charges. The presence of dust can influence the collective plasma behavior, for example, by altering the traditional plasma wave modes and by triggering new types of waves and instabilities. This talk will focus on the charging processes, including the collection of electrons and ions in multi-species plasmas, and discuss the expected charge distribution on the dust particles as function of their size, and the dust density itself. Examples where these effects could result in novel plasma physics phenomena include Noctilucent clouds, and comets.

  9. On the progressive nature of grain crushing

    Science.gov (United States)

    Ciantia, Matteo O.; Piñero, Gema; Zhu, Jian; Shire, Tom

    2017-06-01

    In this work acoustic emission (AE) is used as experimental evidence of the progressive nature of grain crushing. Stress controlled high pressure oedometric compression test are carried out on 1.2 mm monodisperse samples of glass beads. It was observed that the granular assembly starts to experience particle breakage at a vertical stress of about 25MPa. When this yield pressure is exceeded the glass beads start to break emitting loud impulsive sound and the vertical displacement increases rapidly. The load was increased beyond the yield stress and at each increment while the vertical stress remained constant the sample continued to emit sound. The emission of sound at a constant vertical stress indicates that crushing is a progressive failure mechanism; once the first crushing event occurs, the structure starts to rearrange causing other crushing events to occur and additional settlement. In particular, two signal processing algorithms are used on the samples of the acoustic signal to obtain two additional metrics of the crushing evolution. The first is the cumulative energy versus time. The second is the number of crushing events versus time, which is based on the automatic detection of the peaks of the sound signal envelope. There is a clear correlation between the cumulative acoustic energy emitted and the observed sample displacement. Using laser scanning, the evolution of the particle size distribution and particle shape are measured in detail so that a link between the acoustic data and the crushing intensity is established. The crushing intensity was controlled using materials with different strengths.

  10. Fusariotoxins in Wheat Grain in Serbia

    Directory of Open Access Journals (Sweden)

    Ana Stepanić

    2011-01-01

    Full Text Available Samples of wheat grain (41, collected during the 2010 harvest from seven localities inSerbia, were analysed for the presence of zearalenone (ZEA, T-2 toxin, deoxynivalenol (DONand fumonisine B1 (FB1. Results of Enzyme-Linked Immunosorbent Assay (ELISA showedthat all analysed samples were positive for the presence of at least one of four observedfusariotoxins. The most distributed mycotoxins were ZEA (90.2%, with the average concentrationof 442.6μg kg–1 and T-2 (90.2%, with the average concentration of 24.2 μg kg–1.DON (73.2% and FB1 (84.4% were detected in a somewhat smaller number of samples, buttheir average concentrations were higher (1988.1 μg DON kg–1 and 882.7 μg FB1 kg–1. Theestablished correlations between concentrations of DON and FB1 (r = 0.32 or DON and ZEA(r = 0.22 were not statistically significant. A negative correlation was established betweenconcentrations of T-2 and FB1 (r= -0.24, as well as, between T-2 and DON (r = -0.36. Detectedconcentrations of ZEA and T-2 were bellow the level prescribed by the World Health Organisation(WHO, while concentrations of FB1 and DON detected in five that is, 17 samples,respectively, were above the permissible limit for human consumption

  11. On the Use of Laguerre Tessellations for Representations of 3D Grain Structures

    DEFF Research Database (Denmark)

    Lyckegaard, Allan; Lauridsen, Erik Mejdal; Ludwig, Wolfgang

    2011-01-01

    to correctly describe the local arrangements of grains (i.e., the grain neighbors and number of grain facets) for 31.8% of the investigated grains, the Laguerre tessellations were able to accurately describe statistical grain characteristics such as grain size distributions and grain neighbor distributions.......Accurate descriptions of 3D grain structures in polycrystalline materials are of key interest as the grain structure is closely correlated to the macroscopic properties of the material. In the present study, we investigate the accuracy of using Laguerre tessellations to represent 3D grain...... structures from only the spatial center of mass location and the volume of the grains. The ability of Laguerre tessellations to describe accurate grain shapes and topologies of real 3D grain structures are revealed by direct comparison to 3D reconstructions of an un-deformed meta-stable β -titanium alloy...

  12. Impacts of Grain-for-Green and Grain-for-Blue Policies on Valued Ecosystem Services in Shandong Province, China

    Directory of Open Access Journals (Sweden)

    Wei Song

    2015-01-01

    Full Text Available China launched a series of ecological restoration policies to mitigate its severe environmental challenges in the late 1990s. From the beginning, the effects and influences of the ecological restoration policies have been hotly debated. In the present study, we assessed the effects of two vital ecological restoration policies (Grain-for-Green and Grain-for-Blue on valued ecosystem services in Shandong province. A new method based on the net primary productivity and soil erosion was developed to assess the ecosystem service value. In the areas implementing the Grain-for-Green and Grain-for-Blue policies, the ecosystem service value increased by 24.01% and 43.10% during 2000–2008, respectively. However, comparing to the average increase of ecosystem service value (46.00% in the whole of Shandong province in the same period, Grain-for-Green and Grain-for-Blue did not significantly improve overall ecosystem services. The ecological restoration policy led to significant tradeoffs in ecosystem services. Grain-for-Green improved the ecosystem service function of nutrient cycling, organic material provision, and regulation of gases but decreased that of water conservation. Grain-for-Blue increased the water conservation function but led to a reduction in the function of soil conservation and nutrient cycling.

  13. Analysis of EBSD Grain Size Measurements Using Microstructure Simulations and a Customizable Pattern Matching Library for Grain Perimeter Estimation

    Science.gov (United States)

    Coutinho, Y. A.; Rooney, S. C. K.; Payton, E. J.

    2017-05-01

    Grain size data from electron backscatter diffraction (EBSD) maps are often reported as the mean of the circle equivalent diameters of the measured grain areas. Circle equivalent diameters are not directly comparable to the lineal intercept measurements more historically common for grain size characterization in analog optical microscopy. While the value of mean lineal intercept is the same in 2D and 3D for a given probe direction, the mean 2D circle equivalent section diameter is not directly related to any 3D property. Estimation of mean lineal intercept from circle equivalent diameter is usually carried out by again assuming feature circularity, despite the obvious corners that are inherent to grains from the requirements of space filling. A direct conversion between section areas and lineal intercepts can be performed if the grain perimeters are known. In the present work, a novel pattern matching library approach is investigated for measurement of grain perimeters using simulated 2D EBSD maps. The results are compared to alternative approaches for perimeter measurement and assessed with respect to spatial resolution, grain size distribution parameters, and relevant ASTM and ISO measurement standards. The benefits and drawbacks of each approach are discussed. Empirical estimators for conversion between lineal intercept, circle equivalent diameter, and ASTM grain size number are presented.

  14. Sedimentary controls on modern sand grain coat formation

    Science.gov (United States)

    Dowey, Patrick J.; Worden, Richard H.; Utley, James; Hodgson, David M.

    2017-05-01

    Coated sand grains can influence reservoir quality evolution during sandstone diagenesis. Porosity can be reduced and fluid flow restricted where grain coats encroach into pore space. Conversely pore-lining grain coats can restrict the growth of pore-filling quartz cement in deeply buried sandstones, and thus can result in unusually high porosity in deeply buried sandstones. Being able to predict the distribution of coated sand grains within petroleum reservoirs is thus important to help find good reservoir quality. Here we report a modern analogue study of 12 sediment cores from the Anllóns Estuary, Galicia, NW Spain, collected from a range of sub-environments, to help develop an understanding of the occurrence and distribution of coated grains. The cores were described for grain size, bioturbation and sedimentary structures, and then sub-sampled for electron and light microscopy, laser granulometry, and X-ray diffraction analysis. The Anllóns Estuary is sand-dominated with intertidal sand flats and saltmarsh environments at the margins; there is a shallowing/fining-upwards trend in the estuary-fill succession. Grain coats are present in nearly every sample analysed; they are between 1 μm and 100 μm thick and typically lack internal organisation. The extent of grain coat coverage can exceed 25% in some samples with coverage highest in the top 20 cm of cores. Samples from muddy intertidal flat and the muddy saltmarsh environments, close to the margins of the estuary, have the highest coat coverage (mean coat coverage of 20.2% and 21.3%, respectively). The lowest mean coat coverage occurs in the sandy saltmarsh (10.4%), beyond the upper tidal limit and sandy intertidal flat environments (8.4%), close to the main estuary channel. Mean coat coverage correlates with the concentration of clay fraction. The primary controls on the distribution of fine-grained sediment, and therefore grain coat distribution, are primary sediment transport and deposition processes that

  15. A statistical mixture model for estimating the proportion of unreduced pollen grains in perennial ryegrass (Lolium perenne L.) via the size of pollen grains

    NARCIS (Netherlands)

    Jansen, R.C.; Nijs, A.P.M. den

    1993-01-01

    The size of pollen grains is commonly used to indicate the ploidy level of pollen grains. In this paper observations of the diameter of pollen grains are evaluated from one diploid accession of perennial ryegrass (Lolium perenne L.), which was expected to produce diploid (unreduced) pollen grains in

  16. What influences the composition of fungi in wheat grains?

    Directory of Open Access Journals (Sweden)

    Biruta Bankina

    2017-12-01

    Full Text Available Wheat grains are inhabited by different fungi, including plant pathogens and fungi – mycotoxin producers. The composition of seed mycobiota can be influenced by different factors, including agronomic practices, but the results are still contradictory. The aim of this study was to evaluate the mycobiota of wheat grains depending on agroecological conditions. Wheat grains were obtained from a two-factorial field trial: A – tillage system (A1 – ploughing at a depth of 22–24 cm; A2 – harrowing at a depth of up to 10 cm; B – crop rotation (B1 – continuous wheat; B2 – oilseed rape and wheat; B3 – crop rotation. The mycobiota of grain were determined by mycological and molecular methods. The most abundant and widespread of the mycobiota were Pyrenophora tritici-repentis, Alternaria spp., Arthrinium spp., and Fusarium avenaceum. Higher amounts of precipitation increased the infection of grains with Fusarium fungi. Seven species of Fusarium were identified in the grain samples: F. avenaceum, F. poae, F. graminearum, F. culmorum, F. acuminatum, F. sporotrichioides, and F. tricinctum. The soil tillage method and crop rotation did not influence the total incidence of Fusarium spp., but the abundance of a particular species differed depending on agronomic practice. The research suggests that continuous wheat sowing under conditions of reduced soil tillage can increase the level of risk of grain infection with F. graminearum and, consequently, the accumulation of mycotoxins.

  17. 3D studies of coarserning kinetics of individual grains

    DEFF Research Database (Denmark)

    Poulsen, Stefan Othmar

    Techniques for fast, non-destructive characterization of the microstructure of materials using synchrotron X-ray radiation have in recent years become an important tool in materials science. The non-destructive nature of the techniques allows for time-resolved characterization of three-dimensiona...... to make general predictions of the coarsening kinetics of polycrystalline, dual-phase materials, specifically the coarsening mechanism, steady state distributions of grain size and topology, and interface morphology....... grains during recrystallization, where the recrystallization kinetics of individual grains and the temperature dependence of the recrystallization rate is examined, and for a study of grain structure and grain growth, where growth predictions are put forth in terms of the grain size and topology......-dimensional microstructures, i.e. direct probing of the evolution of specific microstructural features. Synchrotron X-ray radiation techniques have in the present work been employed for experimental characterization of microstructural evolution in individual grains during isothermal annealing: For a study of individual...

  18. Grain Growth in Nanocrystalline Mg-Al Thin Films

    Science.gov (United States)

    Kruska, Karen; Rohatgi, Aashish; Vemuri, Rama S.; Kovarik, Libor; Moser, Trevor H.; Evans, James E.; Browning, Nigel D.

    2017-10-01

    An improved understanding of grain growth kinetics in nanocrystalline materials, and in metals and alloys in general, is of continuing interest to the scientific community. In this study, Mg-Al thin films containing 10 wt pct Al and with 14.5 nm average grain size were produced by magnetron sputtering and subjected to heat treatments. The grain growth evolution in the early stages of heat treatment at 423 K, 473 K, and 573 K (150 °C, 200 °C, and 300 °C) was observed with transmission electron microscopy and analyzed based upon the classical equation developed by Burke and Turnbull. The grain growth exponent was found to be 7 ± 2 and the activation energy for grain growth was 31.1 ± 13.4 kJ/mol, the latter being significantly lower than in bulk Mg-Al alloys. The observed grain growth kinetics are explained by the Al supersaturation in the matrix and the pinning effects of the rapidly forming beta precipitates and possibly shallow grain boundary grooves. The low activation energy is attributed to the rapid surface diffusion which is dominant in thin film systems.

  19. Grain Growth in Nanocrystalline Mg-Al Thin Films

    Science.gov (United States)

    Kruska, Karen; Rohatgi, Aashish; Vemuri, Rama S.; Kovarik, Libor; Moser, Trevor H.; Evans, James E.; Browning, Nigel D.

    2017-12-01

    An improved understanding of grain growth kinetics in nanocrystalline materials, and in metals and alloys in general, is of continuing interest to the scientific community. In this study, Mg-Al thin films containing 10 wt pct Al and with 14.5 nm average grain size were produced by magnetron sputtering and subjected to heat treatments. The grain growth evolution in the early stages of heat treatment at 423 K, 473 K, and 573 K (150 °C, 200 °C, and 300 °C) was observed with transmission electron microscopy and analyzed based upon the classical equation developed by Burke and Turnbull. The grain growth exponent was found to be 7 ± 2 and the activation energy for grain growth was 31.1 ± 13.4 kJ/mol, the latter being significantly lower than in bulk Mg-Al alloys. The observed grain growth kinetics are explained by the Al supersaturation in the matrix and the pinning effects of the rapidly forming beta precipitates and possibly shallow grain boundary grooves. The low activation energy is attributed to the rapid surface diffusion which is dominant in thin film systems.

  20. GRAIN SIZE CONSTRAINTS ON HL TAU WITH POLARIZATION SIGNATURE

    Energy Technology Data Exchange (ETDEWEB)

    Kataoka, Akimasa; Dullemond, Cornelis P [Zentrum für Astronomie der Universität Heidelberg, Institut für Theoretische Astrophysik, Albert-Ueberle-Str. 2, D-69120 Heidelberg (Germany); Muto, Takayuki [Division of Liberal Arts, Kogakuin University, 1-24-2 Nishi-Shinjuku, Shinjuku-ku, Tokyo 163-8677 (Japan); Momose, Munetake; Tsukagoshi, Takashi, E-mail: kataoka@uni-heidelberg.de [College of Science, Ibaraki University, 2-1-1 Bunkyo, Mito, Ibaraki 310-8512 (Japan)

    2016-03-20

    The millimeter-wave polarization of the protoplanetary disk around HL Tau has been interpreted as the emission from elongated dust grains aligned with the magnetic field in the disk. However, the self-scattering of thermal dust emission may also explain the observed millimeter-wave polarization. In this paper, we report a modeling of the millimeter-wave polarization of the HL Tau disk with the self-polarization. Dust grains are assumed to be spherical and to have a power-law size distribution. We change the maximum grain size with a fixed dust composition in a fixed disk model to find the grain size to reproduce the observed signature. We find that the direction of the polarization vectors and the polarization degree can be explained with the self-scattering. Moreover, the polarization degree can be explained only if the maximum grain size is ∼150 μm. The obtained grain size from the polarization is different from that which has been previously expected from the spectral index of the dust opacity coefficient (a millimeter or larger) if the emission is optically thin. We discuss that porous dust aggregates may solve the inconsistency of the maximum grain size between the two constraints.

  1. Grain Growth in Nanocrystalline Mg-Al Thin Films

    Energy Technology Data Exchange (ETDEWEB)

    Kruska, Karen; Rohatgi, Aashish; Vemuri, Rama S.; Kovarik, Libor; Moser, Trevor H.; Evans, James E.; Browning, Nigel D.

    2017-10-05

    An improved understanding of grain growth kinetics in nanocrystalline materials, and in metals and alloys in general, is of continuing interest to the scientific community. In this study, Mg - Al thin films containing ~10 wt.% Al and with 14.5 nm average grain size were produced by magnetron-sputtering and subjected to heat-treatments. The grain growth evolution in the early stages of heat treatment at 423 K (150 °C), 473 K (200 °C) and 573K (300 °C) was observed with transmission electron microscopy and analyzed based upon the classical equation developed by Burke and Turnbull. The grain growth exponent was found to be 7±2 and the activation energy for grain growth was 31.1±13.4 kJ/mol, the latter being significantly lower than in bulk Mg-Al alloys. The observed grain growth kinetics are explained by the Al supersaturation in the matrix and the pinning effects of the rapidly forming beta precipitates and possibly shallow grain boundary grooves. The low activation energy is attributed to the rapid surface diffusion which is dominant in thin film systems.

  2. Mode-converted ultrasonic scattering in polycrystals with elongated grains.

    Science.gov (United States)

    Arguelles, Andrea P; Kube, Christopher M; Hu, Ping; Turner, Joseph A

    2016-09-01

    Elastic wave scattering is used to study polycrystalline media for a wide range of applications. Received signals, which include scattering from the randomly oriented grains comprising the polycrystal, contain information from which useful microstructural parameters may often be inferred. Recently, a mode-converted diffuse ultrasonic scattering model was developed for evaluating the scattered response of a transverse wave from an incident longitudinal wave in a polycrystalline medium containing equiaxed single-phase grains with cubic elastic symmetry. In this article, that theoretical mode-converted scattering model is modified to account for grain elongation within the sample. The model shows the dependence on scattering angle relative to the grain axis orientation. Experimental measurements were performed on a sample of 7475-T7351 aluminum using a pitch-catch transducer configuration. The results show that the mode-converted scattering can be used to determine the dimensions of the elongated grains. The average grain shape determined from the experimental measurements is compared with dimensions extracted from electron backscatter diffraction, an electron imaging technique. The results suggest that mode-converted diffuse ultrasonic scattering has the potential to quantify detailed information about grain microstructure.

  3. On the progressive nature of grain crushing

    Directory of Open Access Journals (Sweden)

    Ciantia Matteo O.

    2017-01-01

    Full Text Available In this work acoustic emission (AE is used as experimental evidence of the progressive nature of grain crushing. Stress controlled high pressure oedometric compression test are carried out on 1.2 mm monodisperse samples of glass beads. It was observed that the granular assembly starts to experience particle breakage at a vertical stress of about 25MPa. When this yield pressure is exceeded the glass beads start to break emitting loud impulsive sound and the vertical displacement increases rapidly. The load was increased beyond the yield stress and at each increment while the vertical stress remained constant the sample continued to emit sound. The emission of sound at a constant vertical stress indicates that crushing is a progressive failure mechanism; once the first crushing event occurs, the structure starts to rearrange causing other crushing events to occur and additional settlement. In particular, two signal processing algorithms are used on the samples of the acoustic signal to obtain two additional metrics of the crushing evolution. The first is the cumulative energy versus time. The second is the number of crushing events versus time, which is based on the automatic detection of the peaks of the sound signal envelope. There is a clear correlation between the cumulative acoustic energy emitted and the observed sample displacement. Using laser scanning, the evolution of the particle size distribution and particle shape are measured in detail so that a link between the acoustic data and the crushing intensity is established. The crushing intensity was controlled using materials with different strengths.

  4. Viability of pollen grains of tetraploid banana

    Directory of Open Access Journals (Sweden)

    Taliane Leila Soares

    2016-01-01

    Full Text Available ABSTRACT Obtaining banana tetraploid cultivars from triploid strains results in total or partial reestablishment of fertility, allowing the occurrence of some fruits with seeds, a feature that is undesirable from a marketing perspective. The objective of this study was to assess the viability of pollen of 12 banana tetraploid hybrids (AAAB by means of in vitro germination and two histochemical tests (acetocarmine and 2,3,5-triphenyltetrazolium chloride. The pollen tube growth was evaluated by germinating grains in three culture media — M1: 0.03% Ca(NO3∙4H2O, 0.02% Mg(SO4∙7H2O, 0.01% KNO3, 0.01% H3BO3 and 15% sucrose; M2: 0.03% Ca(NO3∙4H2O, 0.01% KNO3, 0.01% H3BO3 and 10% sucrose; and M3: 0.015% H3BO3, 0.045% Ca3(PO42 and 25% sucrose. The acetocarmine staining indicated high viability (above 80%, except for the genotypes YB42-17 and Caprichosa, which were 76 and 70%, respectively. However, the in vitro germination rate was lower than 50% for all the genotypes, except for the hybrids YB42-17 (M1 and YB42-47 (M1. The medium M1 provided the greatest germination percentage and pollen tube growth. Among the genotypes assessed, YB42-47 presented the highest germination rate (61.5% and tube length (5.0 mm. On the other hand, the Vitória cultivar had the lowest germination percentage (8.2% in medium M1. Studies of meiosis can shed more light on the differences observed in the evaluated tetraploids, since meiotic irregularities can affect pollen viability.

  5. Grain Boundary Sliding in Deforming Wehrlite: Rheology and Microstructure

    Science.gov (United States)

    Zhao, N.; Hirth, G.; Cooper, R. F.; Kruckenberg, S. C.

    2016-12-01

    Elastic anisotropy of Earth's upper mantle used to be attributed exclusively to dislocation creep. However, recent experimental results suggest that crystallographic preferred orientation (CPO) in olivine, which contributes to elastic anisotropy, could also form during grain boundary sliding [e.g., 1-3]. Nevertheless, the fundamental problem of how CPO forms during grain boundary sliding is not fully understood. Our current efforts examine the grain-size-sensitive flow of wehrlite, to characterize the influence of the second phase (clinopyroxene) both on olivine CPO formation as well as the propensity of grain boundary sliding and accumulated strain to effect solid-state phase separation (i.e., metamorphic layering). Creep tests on fine-grain-size (2-5 µm) olivine and clinopyroxene aggregates (T =1100-1200ºC; P = 1.5 GPa; γ=3-7) have been conducted. These reveal strong type-B fabric for olivine. Characterization of effects of grain size, temperature and applied strain rate reveal the grain size dependence, stress exponent and activation energy of the flow kinetics of wehrlite. The stress exponent, which is similar to stress exponent for harzburgite reported by Sundberg & Cooper [1], and grain-size dependence suggest that the dominant deformation mechanism in our experiments may be grain boundary sliding. A large stress drop in early segments of experiments suggest an evolution of microstructure. The Fourier transform of backscatter images demonstrates that there exists a direction of foliation, defined by Ol-Cpx heterophase boundaries, which may be the key to understand the development of CPO formation. [1] Sundberg, M. & Cooper, R. F., J. Geophys. Res., 2008. [2] Miyazaki, T., Sueyoshi, K., and Hiraga, T., Nature, 2013. [3] Tielke, J. A., L. N. Hansen, M. Tasaka, C. Meyers, M. E. Zimmerman, and D. L. Kohlstedt, J. Geophys. Res., 2016.

  6. Molecular structure and metabolic characteristics of the proteins and energy in triticale grains and dried distillers grains with solubles for dairy cattle.

    Science.gov (United States)

    Liu, Bo; McKinnon, John J; Thacker, Philip; Yu, Peiqiang

    2012-10-10

    To our knowledge, there is no research on the molecular structure of triticale grain in comparison with other types of cereal grains and metabolic characteristics of the protein and energy in this grain and its coproducts, called dried distillers grains with solubles (DDGS), for dairy cattle. The objective of this study was to identify differences in molecular structures of proteins among grains and their DDGS using a molecular spectroscopy technique, namely, DRIFT, and to determine the nutrient profile and supply to dairy cattle. The protein molecular structure studies showed a difference (P grains and their DDGS. The energy content was similar for triticale grain and DDGS. There were differences in the protein and carbohydrate subfractions (P grain and DDGS. Triticale grain and DDGS had similar intestinal digestibility of rumen undegraded CP. However, triticale DDGS had higher (P grain. Bioethanol processing induced changes in the protein molecular structure.

  7. Atomistic simulation of dislocation emission in nanosized grain boundaries

    Science.gov (United States)

    Derlet, P. M.; van Swygenhoven, H.; Hasnaoui, A.

    2003-11-01

    The present work deals with the atomic mechanism responsible for the emission of partial dislocations from grain boundaries (GB) in nanocrystalline metals. It is shown that, in a 12 nm grain-size sample, GBs containing grain-boundary dislocations (GBDs) can emit a partial dislocation during deformation by local atomic shuffling and stress-assisted free-volume migration. As in previous work, the nucleation occurs at a GBD, which, upon nucleation and propagation, is removed. In the present case, free-volume migration occurs away from the nucleation region both before and after the nucleation event.

  8. Modeling the process of compaction of plastic grains

    Directory of Open Access Journals (Sweden)

    A. Patejuk

    2008-03-01

    Full Text Available Thc aniclc prcscnts an experimental analysis of thc cffcct or plastic grain size on the deformation of the presscd moulding during thepmcess of punch thrust in a closcd containcr. Thc cffcct of configuration and grain diameter on !he flow of rorccs in rhc process ofmolding format ion in the scmi-liquid statc. Test werc performod by using specially prepared plasticine-based mdcl marcrial. Thc obtain4test resuIts arc technological guidelines Tor manufacturing products Tmm powdcrs of the requircd grain sizc

  9. From protein catalogues towards targeted proteomics approaches in cereal grains

    DEFF Research Database (Denmark)

    Finnie, Christine; Sultan, Abida; Grasser, Klaus D.

    2011-01-01

    Due to their importance for human nutrition, the protein content of cereal grains has been a subject of intense study for over a century and cereal grains were not surprisingly one of the earliest subjects for 2D-gel-based proteome analysis. Over the last two decades, countless cereal grain...... extraction, separation and identification of proteins and peptides is facilitating functional proteomics and analysis of sub-proteomes from small amounts of starting material, such as seed tissues. The combination of proteomics with structural and functional analysis is increasingly applied to target subsets...

  10. Brownian motion of grains and negative friction in dusty plasmas

    Directory of Open Access Journals (Sweden)

    S.A.Trigger

    2004-01-01

    Full Text Available Within the approximation of dominant charging collisions the explicit microscopic calculations of the Fokker-Planck kinetic coefficients for highly-charged grains moving in plasma are performed. It is shown that due to ion absorption by grain the friction coefficient can be negative and thus the appropriate threshold value of the grain charge is found. The stationary solutions of the Fokker-Planck equation with the velocity dependent kinetic coefficient are obtained and a considerable deviation of such solutions from the Maxwellian distribution is established.

  11. Self-compacting fine-grained concretes with compensated shrinkage

    Directory of Open Access Journals (Sweden)

    Alimov Lev

    2017-01-01

    Full Text Available This paper substantiates the efficiency of application of fine-grained concrete for erection of cast-in-place concrete and reinforced concrete structures of different purpose. On the basis of analysis of experimental research results it was established that the introduction of microfillers with expansion effect to composite binder allows not only improving the rheological properties of fine-grained concrete, but also decreasing of value of shrinkage strain and improving of concrete crack resistance and durability. The analysis of the results of industrial use of fine-grained concretes with compensated shrinkage is given.

  12. Transitional grain-size-sensitive flow of milky quartz aggregates

    Science.gov (United States)

    Fukuda, J. I.; Holyoke, C. W., III; Kronenberg, A. K.

    2014-12-01

    Fine-grained (~15 μm) milky quartz aggregates exhibit reversible flow strengths in triaxial compression experiments conducted at T = 800-900oC, Pc = 1.5 GPa when strain rates are sequentially decreased (typically from 10-3.5 to 10-4.5 and 10-5.5 s-1), and then returned to the original rate (10-3.5 s-1), while samples that experience grain growth at 1000oC (to 35 μm) over the same sequence of strain rates exhibit an irreversible increase in strength. Polycrystalline quartz aggregates have been synthesized from natural milky quartz powders (ground to 5 μm) by HIP methods at T = 1000oC, Pc = 1.5 GPa and t = 24 hours, resulting in dense, fine-grained aggregates of uniform water content of ~4000 ppm (H/106Si), as indicated by a broad OH absorption band at 3400 cm-1. In experiments performed at 800o and 900oC, grain sizes of the samples are essentially constant over the duration of each experiment, though grain shapes change significantly, and undulatory extinction and deformation lamellae indicate that much of the sample shortening (to 50%) is accomplished, over the four strain-rate steps, by dislocation creep. Differential stresses measured at T = 800oC decrease from 160 to 30 MPa as strain rate is reduced from 10-4.6 to 10-5.5 s-1, and a stress of 140 MPa is measured when strain rate is returned to 10-4.5 s-1. Samples deformed at 1000o and 1100oC experience normal grain growth, with grain boundary energy-driven grain-coarsening textures superposed by undulatory extinction and deformation lamellae. Differential stresses measured at 1000oC and strain rates of 10-3.6, 10-4.6, and 10-5.5 s-1 are 185, 80, and 80 MPa, respectively, while an increased flow stress of 260 MPa is measured (following ~28 hours of prior high temperature deformation and grain growth) when strain rate is returned to 10-3.6 s-1. While all samples exhibit lattice preferred orientations, the stress exponent n inferred for the fine-grained 800oC sample is 1.5 and the stress exponent of the coarse-grained

  13. Effects of Grain Refining Additions to Aluminum Alloys

    Science.gov (United States)

    Gennone, R. J.; Coyle, F. T.; Farrior, G. M.

    An efficient method of controlling the grain-size of commercial aluminum alloys is by continuous additions of grain-refining agents in the form of master-alloy rod which is fed automatically into the launder during casting. The simultaneous addition of titanium and boron in a single rod is more efficient and more economical than separate additions. Response of various alloys to grain refining may be determined using the laboratory test described. Effects of these additions on 6063 alloy are presented; preliminary results on other commercial alloys are included.

  14. Long time scale simulation of a grain boundary in copper

    DEFF Research Database (Denmark)

    Pedersen, A.; Henkelman, G.; Schiøtz, Jakob

    2009-01-01

    A general, twisted and tilted, grain boundary in copper has been simulated using the adaptive kinetic Monte Carlo method to study the atomistic structure of the non-crystalline region and the mechanism of annealing events that occur at low temperature. The simulated time interval spanned 67 mu s...... at 135 K. Similar final configurations were obtained starting from different initial structures: (i) by bringing the two grains into contact without any intermediate layer, and (ii) by inserting an amorphous region between the grains. The results obtained were analyzed with a radial distribution function...

  15. Grain boundaries: Progress report, June 15, 1988--June 14, 1989

    Energy Technology Data Exchange (ETDEWEB)

    Balluffi, R.W.; Bristowe, P.D.

    1989-02-01

    The present document is a progress report describing the work accomplished during the second year (June 15, 1988-June 14, 1989) of our three-year grant to study grain boundaries which started 15 June 1987. The research that was proposed initially for this period consisted of the following: (1) study of the atomistic structure of grain boundaries by means by combined x-ray diffraction and computer modeling; (2) study of grain boundary phase transitions by electron microscopy and computer modeling. 12 refs.

  16. Grain boundaries. Progress report, February 15, 1991--October 15, 1991

    Energy Technology Data Exchange (ETDEWEB)

    Balluffi, R.W.; Bristowe, P.D.

    1991-12-31

    The present document is a progress report describing the work accomplished to date during the second year of our four-year grant (February 15, 1990--February 14, 1994) to study grain boundaries. The research was focused on the following three major efforts: Study of the atomic structure of grain boundaries by means of x-ray diffraction, transmission electron microscopy and computer modeling; study of short-circuit diffusion along grain boundaries; and development of a Thin-film Deposition/Bonding Apparatus for the manufacture of high purity bicrystals.

  17. Outflow and clogging of shape-anisotropic grains in hoppers

    Science.gov (United States)

    Stannarius, Ralf; Ashour, Ahmed; Wegner, Sandra; BöRzsöNyi, Tamas

    Silos have been in use in human history for millennia, but still today, the discharge of grains from silos is a process with potential risks and imponderabilities. Models and quantitative predictions have been developed almost exclusively for spherical grains shapes. We study the discharge and clogging processes of shape-anisotropic grains in hoppers, and describe the peculiarities of these materials both in their dynamical properties and in the observed clogging structures. An attempt is made to adapt the well-known equations for spherical material to describe anisometric particles. Funding by DAAD and M\\x96B is acknowledged. A. A. acknowledges a scholarship from Future University, Egypt.

  18. 77 FR 66578 - Cancellation of Indianapolis Grain Inspection & Weighing Service, Inc. Designation; Selection of...

    Science.gov (United States)

    2012-11-06

    ...: Grain Inspection, Packers and Stockyards Administration, USDA. ACTION: Notice; correction. SUMMARY: The USDA, Grain Inspection, Packers and Stockyards Administration published a document in the Federal... Mitchell, Administrator, Grain Inspection, Packers and Stockyards Administration. BILLING CODE 3410-KD-P ...

  19. 76 FR 317 - Cancellation of Lewiston Grain Inspection Service, Inc. Designation; Opportunity for Designation...

    Science.gov (United States)

    2011-01-04

    ... Grain Inspection, Packers and Stockyards Administration Cancellation of Lewiston Grain Inspection..., Packers and Stockyards Administration, USDA. ACTION: Notice. SUMMARY: Lewiston Grain Inspection Service..., Packers and Stockyards Administration (GIPSA) that it would cease providing official inspection services...

  20. 76 FR 86 - Solicitation of Nominations for Members of the USDA Grain Inspection Advisory Committee

    Science.gov (United States)

    2011-01-03

    ... Grain Inspection, Packers and Stockyards Administration Solicitation of Nominations for Members of the USDA Grain Inspection Advisory Committee AGENCY: Grain Inspection, Packers and Stockyards... Inspection, Packers and Stockyards Administration (GIPSA) is seeking nominations for individuals to serve on...

  1. Food $ense Guide to Healthy Snacks for After School programs, Grains

    OpenAIRE

    Baxley, Heidi

    2012-01-01

    Eating grains, especially whole grains, provides our youth with many health benefits. People who eat whole grains as part of a healthy diet have a reduced risk of several chronic diseases including Heart Disease and Type II Diabetes.

  2. Grain growth of ε-iron: Implications to grain size and its evolution in the Earth's inner core

    Science.gov (United States)

    Yamazaki, Daisuke; Tsujino, Noriyoshi; Yoneda, Akira; Ito, Eiji; Yoshino, Takashi; Tange, Yoshinori; Higo, Yuji

    2017-02-01

    Knowledge of grain growth rate of ε-iron can put constraint on estimation of the grain size in the inner core. We determined grain growth rate of ε-iron at ∼55 GPa and 1200-1500 K by means of in-situ X-ray diffraction observation to be Gn - G0n = kt, where G (m) is the grain size at time t (s), G0 (m) is the initial grain size, n is growth exponent (fixed to 2) and k is the growth constant expressed as k =k0 exp ⁡ (-H* / RT) with log k0 (mn /s) = - 5.8 (± 2.4) and activation enthalpy H* = 221 (± 61) kJ /mol, and R is the gas constant and T is the absolute temperature. Extrapolation of the grain growth law of ε-iron to the inner core conditions suggests that the grain size in the inner core is in a range from several hundred meters to several kilometers, which is intermediate among the previous estimations, and hence the dominant deformation mechanism is considered to be Harper-Dorn creep rather than diffusion creep as pointed out by the previous work. This indicates the relatively uniform viscosity in the entire inner core.

  3. Identification of regulated proteins in naked barley grains (Hordeum vulgare nudum) after Fusarium graminearum infection at different grain ripening stages.

    Science.gov (United States)

    Trümper, Christina; Paffenholz, Katrin; Smit, Inga; Kössler, Philip; Karlovsky, Petr; Braun, Hans-Peter; Pawelzik, Elke

    2016-02-05

    We analyzed the effect of Fusarium graminearum infection on field-grown naked barley (Hordeum vulgare nudum). The ears were inoculated with F. graminearum spores during anthesis. In the course of ripening, grains in five phenological growth stages of naked barley from milk ripe to plant death were sampled. The albumin and globulin proteins of inoculated grains and untreated (control) grains were separated by two-dimensional gel electrophoresis. Forty-five spots composing of proteins that were changed in abundance due to F. graminearum infection were subsequently identified by mass spectrometry. Various proteins showing altered expression pattern after Fusarium infection were linked to stress response such as plant signal transduction pathways, fungal defense and oxidative burst. More proteins changed during early grain ripening stages than during later ripening stages. Protease inhibitors occurred at increased abundancy during milk ripe stage. A thaumatin-like protein accumulated at plant death stage. Proteins linked to nitrogen metabolism and protein biosynthesis were mainly reduced, whereas those linked to carbon metabolism were predominantly increased in infected grains. Fusarium graminearum infection can lead to significant contamination of grains with mycotoxins. With this 2D-based proteomics study we give an insight into plant–pathogen interactions between the non-model plant naked barley and the fungus F. graminearum during five stages of grain development. Over the multiple developmental stages we observed specific patterns of changes induced by the fungus: the primary plant metabolism and inhibition of fungal protease were predominantly affected during early grain development stages. During the entire grain development we found an induced accumulation of thaumatin-like proteins due to the fungal infection indicating their fundamental role for naked barley defense.

  4. Grain boundary dynamics in ceramics superplasticity

    Directory of Open Access Journals (Sweden)

    Wakai, E.

    2001-04-01

    Full Text Available Superplasticity refers to an ability of polycrystalline solids to exhibit exceptionally large elongation in tension. The application of superplasticity makes it possible to fabricate ceramic components by superplastic forming (SPF, concurrent with diffusion bonding, and superplastic sinter-forging just like superplastic metals. Furthermore the superplastic deformation plays an important role in stress-assisted densification processes such as hot isostatic pressing (HIP and hot pressing (HP. The ceramics superplasticity has been one of intensive research fields in the last decade. Although most of reports are still limited to those of zirconia[1], new developments have been achieved in superplasticity of Si3N4 and SiC in recent years. It is clearly demonstrated that the superplasticity is one of the common natures of fine-grained ceramics and nanocrystalline ceramics at elevated temperatures.

    La superplaticidad se refiere a la capacidad que posee un sólido policristalino de presentar alargamientos excepcionalmente elevados en tracción. La aplicación de la superplasticidad hace posible la fabricación de componentes cerámicos por conformado superplástico, soldadura por difusión y forja-sinterizado superplástica, igual que en metales superplásticos. Además, la deformación superplástica tiene un rol importante en los procesos de densificación asistidos por tensiones, tales como la compactación isostática en caliente y el prensado en caliente. Las cerámicas superplásticas han sido uno de los campos donde se ha realizado una investigación más intensa en la última década. Aunque, la mayoría de los informes se limitan a la circonia[1] se han alcanzado nuevos desarrollos en superplasticidad de Si3N4 y SiC. Está claramente demostrado que la superplasticidad es una propiedad intrínseca de las cerámicas de pequeño tamaño de grano y de las cer

  5. Coarse-grained Simulations of Viral Assembly

    Science.gov (United States)

    Elrad, Oren M.

    2011-12-01

    The formation of viral capsids is a marvel of natural engineering and design. A large number (from 60 to thousands) of protein subunits assemble into complete, reproducible structures under a variety of conditions while avoiding kinetic and thermodynamic traps. Small single-stranded RNA viruses not only assemble their coat proteins in this fashion but also package their genome during the self-assembly process. Recent experiments have shown that the coat proteins are competent to assemble not merely around their own genomes but heterologous RNA, synthetic polyanions and even functionalized gold nanoparticles. Remarkably these viruses can even assemble around cargo not commensurate with their native state by adopting different morphologies. Understanding the properties that confer such exquisite precision and flexibility to the assembly process could aid biomedical research in the search for novel antiviral remedies, drug-delivery vehicles and contrast agents used in bioimaging. At the same time, viral assembly provides an excellent model system for the development of a statistical mechanical understanding of biological self-assembly, in the hopes of that we will identify some universal principles that underly such processes. This work consists of computational studies using coarse-grained representations of viral coat proteins and their cargoes. We find the relative strength of protein-cargo and protein-protein interactions has a profound effect on the assembly pathway, in some cases leading to assembly mechanisms that are markedly different from those found in previous work on the assembly of empty capsids. In the case of polymeric cargo, we find the first evidence for a previously theorized mechanism in which the polymer actively participates in recruiting free subunits to the assembly process through cooperative polymer-protein motions. We find that successful assembly is non-monotonic in protein-cargo affinity, such affinity can be detrimental to assembly if it

  6. Brewing with 100 % unmalted grains: barley, wheat, oat and rye

    DEFF Research Database (Denmark)

    Zhuang, Shiwen; Shetty, Radhakrishna; Hansen, Mikkel

    2017-01-01

    Whilst beers have been produced using various levels of unmalted grains as adjuncts along with malt, brewing with 100 % unmalted grains in combination with added mashing enzymes remains mostly unknown. The aim of this study was to investigate the brewing potential of 100 % unmalted barley, wheat......, oat and rye in comparison with 100 % malt. To address this, identical brewing methods were adopted at 10-L scale for each grain type by applying a commercial mashing enzyme blend (Ondea® Pro), and selected quality attributes were assessed for respective worts and beers. Different compositions...... barley, oat, rye or wheat using exogenously added enzymes. It also helps to understand the process ability by revealing specific needs when manufacturing different type of beers from unmalted grains, potentially paving the way to process optimisation and development of future products....

  7. A madurella mycetomatis grain model in galleria mellonella larvae

    NARCIS (Netherlands)

    W. Kloezen (Wendy); M. van Helvert-van Poppel (Marilyn); A.H. Fahal (Ahmed); W.W.J. van de Sande (Wendy)

    2015-01-01

    textabstractEumycetoma is a chronic granulomatous subcutaneous infectious disease, endemic in tropical and subtropical regions and most commonly caused by the fungus Madurella mycetomatis. Interestingly, although grain formation is key in mycetoma, its formation process and its susceptibility

  8. Mathematic simulation of high-efficiency process of grain cleaning

    Science.gov (United States)

    Galyautdinova, Y. V.; Gaysin, I. A.; Samigullin, A. D.; Samigullina, A. R.; Galyautdinov, R. R.

    2017-09-01

    The article presents the results of field experiment and the results of computer simulation of the grain cleaning process pneumosorting machine PSM-0,5. The results of the comparison of two methods of research are presented.

  9. High-Resolution Single-Grain Diffraction of Polycrystalline Materials

    DEFF Research Database (Denmark)

    Lienert, Ulrich; Ribárik, Gábor; Ungar, Tamas

    2017-01-01

    . The microstructure usually influences the materials properties critically. It has been demonstrated that, by using high-energy synchrotron radiation, diffraction peaks off individual grains can be recorded in-situ during processing. Important information such as the orientation, average strain, and size...... of individual grains can be obtained, even if the peak shapes are commonly not analyzed. However, it is also well-known that the shape of diffraction peaks, if observed with sufficient resolution, contains significant information about the microstructure. While the intensity distribution in reciprocal space......). Conventional radial profile (line shape) analysis techniques average over many grains with possibly significantly different microstructure. Under conditions of single-grain diffraction, these limitations are overcome and the intensity distributions along all three directions of reciprocal space are accessible....

  10. Growth Inhibition of Grain Spoilage Fungi by Selected Herbs and ...

    African Journals Online (AJOL)

    ) and Thymus schimperi (thymus) were found to be the most effective. However piper nigrum (black pepper) had no effect on the test organisms. In MIC, spore germination inhibition and grain protection assay, cinnamon essential oil was found ...

  11. Identification of putative candidate gene markers for grain zinc ...

    African Journals Online (AJOL)

    Identification of putative candidate gene markers for grain zinc content using recombinant inbred lines (RIL) population of IRRI38 X Jeerigesanna. Naveen Kumar Gande, Pavan J Kundur, Rakhi Soman, Rajeswari Ambati, R Ashwathanarayana, Berhanu Dagnaw Bekele, HE Shashidhar ...

  12. Hydrolysis of Brewers' Spent Grain by Carbohydrate Degrading Enzymes

    NARCIS (Netherlands)

    Forssell, P.; Kontkanen, H.; Schols, H.A.; Hinz, S.W.A.; Eijsink, V.G.H.; Treimo, J.; Robertson, J.A.; Waldron, K.W.; Faulds, C.B.; Buchert, J.

    2008-01-01

    In this work four commercial cellulase-hemicellulase mixtures with different activity profiles were used for solubilization of carbohydrates from brewers' spent grain (BSG). After the enzyme treatment, both the solubilised fraction and the unhydrolysed residue were characterized. Treatment with

  13. Fungal Diversity of Maize (Zea Mays L. Grains

    Directory of Open Access Journals (Sweden)

    Gulbis Kaspars

    2016-06-01

    Full Text Available Maize is becoming more and more important crop for dairy farming as forage and as substrate for biogas production. The mycotoxin producing fungi can spoil feed, reduce cattle productivity and cause health problems. The aim of this research was to study the mycoflora of maize grains in order to clarify the fungal composition and verify the presence of potential mycotoxin producing fungi. The grain samples were collected from different maize hybrid performance trial in Research and Study farm “Vecauce” of Latvia University of Agriculture in 2014. The fungi from 14 genera were isolated from surface sterilized grains. The most abundant were Alternaria, Fusarium and Penicillium spp. Mycotoxin producing fungi are present in maize grain mycoflora, and there is a risk that maize production can contain mycotoxins.

  14. Crop production management: Organic wheat and small grains

    Science.gov (United States)

    Key management practices for organic wheat and small grain production are provided, including variety selection, planting date, seeding rate, drill calibration and operation, soil fertility, and management of weeds, insect pests, and diseases. ...

  15. Stardust from meteorites an introduction to presolar grains

    CERN Document Server

    Lugaro, Maria

    2005-01-01

    The study of presolar meteoritic grains is a new inter-disciplinary field that brings together topics from nuclear physics to astronomy and chemistry. Traditionally, most of the information about the cosmos has been gathered by observing light through telescopes. However, with the recent discovery that some dust grains extracted from primitive meteorites were produced in stellar environments, we now have the opportunity to gather information about stars and our Galaxy from the laboratory analysis of tiny pieces of stardust. Stellar grains represent a unique and fascinating subject of study. Their analysis is a breakthrough in research on stellar nucleosynthesis and the origin of the elements. While a number of specialized reviews exist on the topic, this book is the first work that brings together in a unified and accessible manner the background knowledge necessary for the study of presolar grains together with up-to-date discoveries in the field. The book includes exercise questions and answers, an extensiv...

  16. Intelligent classification methods of grain kernels using computer vision analysis

    Science.gov (United States)

    Lee, Choon Young; Yan, Lei; Wang, Tianfeng; Lee, Sang Ryong; Park, Cheol Woo

    2011-06-01

    In this paper, a digital image analysis method was developed to classify seven kinds of individual grain kernels (common rice, glutinous rice, rough rice, brown rice, buckwheat, common barley and glutinous barley) widely planted in Korea. A total of 2800 color images of individual grain kernels were acquired as a data set. Seven color and ten morphological features were extracted and processed by linear discriminant analysis to improve the efficiency of the identification process. The output features from linear discriminant analysis were used as input to the four-layer back-propagation network to classify different grain kernel varieties. The data set was divided into three groups: 70% for training, 20% for validation, and 10% for testing the network. The classification experimental results show that the proposed method is able to classify the grain kernel varieties efficiently.

  17. Effect of Phosphorus Fertilizer on Nitrogen Fixation by Some Grain ...

    African Journals Online (AJOL)

    acer

    5698. Effect of Phosphorus Fertilizer on Nitrogen Fixation by Some Grain Legume Varieties in Sudano – Sahelian Zone of North Eastern Nigeria. *H. Yakubu, J. D. Kwari and M.K. Sandabe. Department of Soil Science,. University of Maiduguri.

  18. Molecular investigations on grain filling rate under terminal heat ...

    African Journals Online (AJOL)

    Molecular investigations on grain filling rate under terminal heat stress in bread wheat (Triticum aestivum L.) Girish Chandra Pandey, Jagadish Rane, Sindhu Sareen, Priyanka Siwach, NK Singh, Ratan Tiwari ...

  19. Experimental Phase Functions of Millimeter-sized Cosmic Dust Grains

    Energy Technology Data Exchange (ETDEWEB)

    Muñoz, O.; Moreno, F.; Guirado, D.; Escobar-Cerezo, J. [Instituto de Astrofísica de Andalucía, CSIC, Glorieta de la Astronomía s/n, E-18008 Granada (Spain); Vargas-Martín, F. [Department of Electromagnetism and Electronics, University of Murcia, E-30100 Murcia (Spain); Min, M. [SRON Netherlands Institute for Space Research, Sobornnelaan 2, 3584 CA Utrecht (Netherlands); Hovenier, J. W. [Astronomical Institute “Anton Pannekoek,” University of Amsterdam, Science Park 904, 1098 XH, Amsterdam (Netherlands)

    2017-09-01

    We present the experimental phase functions of three types of millimeter-sized dust grains consisting of enstatite, quartz, and volcanic material from Mount Etna, respectively. The three grains present similar sizes but different absorbing properties. The measurements are performed at 527 nm covering the scattering angle range from 3° to 170°. The measured phase functions show two well-defined regions: (i) soft forward peaks and (ii) a continuous increase with the scattering angle at side- and back-scattering regions. This behavior at side- and back-scattering regions is in agreement with the observed phase functions of the Fomalhaut and HR 4796A dust rings. Further computations and measurements (including polarization) for millimeter-sized grains are needed to draw some conclusions about the fluffy or compact structure of the dust grains.

  20. Streaming of interstellar grains in the solar system

    Science.gov (United States)

    Gustafson, B. A. S.; Misconi, N. Y.

    1979-01-01

    Results of a theoretical study of the interactions between interstellar grains streaming through the solar system and the solar wind are presented. It is shown that although elongated core-mantle interstellar particles of a characteristic radius of about 0.12 microns are subject to a greater force due to radiation pressure than to gravitational attraction, they are still able to penetrate deep inside the solar system. Calculations of particle trajectories within the solar system indicate substantial effects of the solar activity cycle as reflected in the interplanetary magnetic field on the distribution of 0.12- and 0.0005-micron interstellar grains streaming through the solar system, leading to a 50-fold increase in interstellar grain densities 3 to 4 AU ahead of the sun during years 8 to 17 of the solar cycle. It is noted that during the Solar Polar Mission, concentrations are expected which will offer the opportunity of detecting interstellar grains in the solar system.