WorldWideScience

Sample records for boswellia carteri induces

  1. Frankincense oil derived from Boswellia carteri induces tumor cell specific cytotoxicity

    Directory of Open Access Journals (Sweden)

    Ashley Richard A

    2009-03-01

    Full Text Available Abstract Background Originating from Africa, India, and the Middle East, frankincense oil has been important both socially and economically as an ingredient in incense and perfumes for thousands of years. Frankincense oil is prepared from aromatic hardened gum resins obtained by tapping Boswellia trees. One of the main components of frankincense oil is boswellic acid, a component known to have anti-neoplastic properties. The goal of this study was to evaluate frankincense oil for its anti-tumor activity and signaling pathways in bladder cancer cells. Methods Frankincense oil-induced cell viability was investigated in human bladder cancer J82 cells and immortalized normal bladder urothelial UROtsa cells. Temporal regulation of frankincense oil-activated gene expression in bladder cancer cells was identified by microarray and bioinformatics analysis. Results Within a range of concentration, frankincense oil suppressed cell viability in bladder transitional carcinoma J82 cells but not in UROtsa cells. Comprehensive gene expression analysis confirmed that frankincense oil activates genes that are responsible for cell cycle arrest, cell growth suppression, and apoptosis in J82 cells. However, frankincense oil-induced cell death in J82 cells did not result in DNA fragmentation, a hallmark of apoptosis. Conclusion Frankincense oil appears to distinguish cancerous from normal bladder cells and suppress cancer cell viability. Microarray and bioinformatics analysis proposed multiple pathways that can be activated by frankincense oil to induce bladder cancer cell death. Frankincense oil might represent an alternative intravesical agent for bladder cancer treatment.

  2. Frankincense oil derived from Boswellia carteri induces tumor cell specific cytotoxicity

    OpenAIRE

    Ashley Richard A; Saban Ricardo; Saban Marcia R; Azzarello Joseph T; Osban Jeanette; Yang Qing; Frank Mark; Welter Jan C; Fung Kar-Ming; Lin Hsueh-Kung

    2009-01-01

    Abstract Background Originating from Africa, India, and the Middle East, frankincense oil has been important both socially and economically as an ingredient in incense and perfumes for thousands of years. Frankincense oil is prepared from aromatic hardened gum resins obtained by tapping Boswellia trees. One of the main components of frankincense oil is boswellic acid, a component known to have anti-neoplastic properties. The goal of this study was to evaluate frankincense oil for its anti-tum...

  3. Modifying effects of boswellia carteri on clarithromycine action: In vitro antibacterial study against common sensitive bacterial strains

    Directory of Open Access Journals (Sweden)

    Hayder M. Al-kuraishy

    2012-09-01

    Full Text Available Background:Plant-derived compounds have action alongside Gram-positive and Gram-negative bacteria and numerous compounds, inhibit efflux pumps and hence have become known as efflux pump inhibitors. Clarithromycin is a macrolide antibiotic used to treat pharyngitis, tonsillitis, acute maxillary sinusitis and acute bacterial exacerbation of chronic bronchitis the antibacterial range is the similar as erythromycin but it is active against Mycobacterium avium complex, M.leprae and atypical mycobacteria. The in vitro antibacterial activity results of different boswellic acid compounds discovered alpha keto-boswellic acid (AKBA to be the preponderance potent antibacterial compound alongside Grampositive pathogens, but it showed no significant antibacterial activity (MIC >128 μg/ml against the Gram negative bacteria . Aim: The aim of present study, is to illustrate the effectiveness of Boswellia carteri against Gram positive and negative bacteria alone and in combination with clarithromycine to elucidate the synergestic antibacterial effects and how Boswellia carteri modifying the antibacterial activity of clarithromycine. Material and methods: The bacteria strains used in this study included five Gram-positive bacteria (Staphylococcus aureus, Streptococcus faecalis, Bacillus cereus, Staphylococcus epidermidis, Staphylococcus saprophyticus and three Gramnegative bacteria (Klebsiella pneumoniae and Escherichia coli and Pseudomonas aeruginosa five for each strains. Antibacterial activities were evaluated by measuring inhibition zone diameters by Agar-well diffusion ,while Broth dilution method determine MIC .Then fractional inhibitory concentration determine the in vitro interaction of clarithromycine and boswellia carteri combination. Results :The result of present study showed that zone of inhibition of clarithromycine ranged from 4mg/ml for Pseudomonas aeruginosa and 19mm toward Klebsiella pneumonia while zone of inhibition of Boswellia carteri

  4. Proteoglycans from Boswellia serrata Roxb. and B. carteri Birdw. and identification of a proteolytic plant basic secretory protein

    DEFF Research Database (Denmark)

    Herrmann, Andreas; König, Simone; Lechtenberg, Matthias;

    2012-01-01

    Water-soluble high molecular weight compounds were isolated in yields of 21-22% from the oleogum of Boswellia serrata and B. carteri. Using anion exchange chromatography and gel permeation chromatography, different proteoglycans were purified and characterized, leading to four principally different...... groups: (i) Hyp-/Ser-rich extensins with O-glycosidic attached arabinan side chains; (ii) Modified extensins, with arabinogalactosylated side chains containing GlA and 4-O-Me-GlcA; (iii) Glycoproteins with N-glycosidic side chains containing higher amounts of Fuc, Man and GluNH(2,) featuring a 200 k...

  5. Potential ultrastructural changes in rat epididymal cell types induced by Boswellia papyrifera and Boswellia carterii incense.

    Science.gov (United States)

    Ahmed, Mukhtar; Al-Daghri, Nasser; Harrath, Abdul Halim; Alokail, Majed S; Aladakatti, Ravindranath H; Ghodesawar, Mukhtar Ahmed G; Alwasel, Saleh

    2013-08-01

    Boswellia papyrifera and Boswellia carterii, known as Arabian incense, diffuses smoke, contaminating the air, which adversely affects human health. Therefore, this study was designed to ascertain the effect of these plants on histopathological and ultrastructure changes in cauda epididymis of Albino rats. Animals were exposed to 4 g/kg body weight of B. papyrifera and B. carterii daily for 120 days along with suitable controls. Our study indicates a significant reduction in epithelial heights. Cells showed signs of degeneration. The ultrastructural study revealed that the cauda epididymis was affected, including its cell types. Furthermore, a decrease in the size of mitochondria, Golgi complex, and both ERs was observed. In all treated groups, plasma fructose decreased considerably, indicating the sign of reduced energy, vital for motility and other sperm functions. The results of this study suggest that these plants systematically affect cauda epididymal cell types and its lumen through its potential toxicity.

  6. Ultrastructural and hormonal changes in rat cauda epididymal spermatozoa induced by Boswellia papyrifera and Boswellia carterii.

    Science.gov (United States)

    Ahmed, Mukhtar; Ali, Daoud; Harrath, Abdel Halim; Hussain, Tajamul; Al-Daghri, Nasser; Alokail, Majed S; Aladakatti, Ravindranath H; Ghodesawar, Mukhtar Ahmed G

    2014-04-01

    Boswellia papyrifera and Boswellia carterii diffuses smoke polluting air that adversely affects indoor environment that certainly harm human health. Therefore, this study aims at ascertaining the effect of these plants on gonadal hormones and molecular changes in rat spermatozoa. The animals were exposed to 4 g/kg body weight of B. papyrifera and B. carterii daily for 120 days along with suitable controls. Significant decreases in FSH, LH and testosterone levels were evidenced, along with a reduction of protein, sialic acid, and carnitine levels. In sperm physiology, sperm count, motility, speed decrease, whereas sperm anomalies increase. TEM observation indicates morphological changes in plasma and acrosomal membranes, cytoplasmic droplet in the tail region, vacuolated, and disorganization of the mitochondrial sheath. These findings demonstrate that B. papyrifera and B. carterii smoke affects the process of sperm formation and maturation, which indicates the detrimental effects of these plants on the reproductive system.

  7. Evaluation of antiulcer activity of Boswellia serrata bark extracts using aspirin induced ulcer model in albino rats

    Directory of Open Access Journals (Sweden)

    Khaja Zeeyauddin

    2011-01-01

    Full Text Available The effect of bark extracts of Boswellia serrata (Family Bursera-ceae was evaluated in aspirin induced ulceration (200mg/kg in albino rats. Antiulcer activity was evaluated by measuring ulcer index and percentage of ulcer healing. The petroleum ether (250mg/kg and aqueous extracts (250mg/kg of bark of Boswellia serrata plant showed significant antiulcer activity as evidenced by the data obtained. Histopathological findings also confirm the anti-ulcer activity of Boswellia serrata bark extracts in albino rats.

  8. Boswellia sacra essential oil induces tumor cell-specific apoptosis and suppresses tumor aggressiveness in cultured human breast cancer cells

    Directory of Open Access Journals (Sweden)

    Suhail Mahmoud M

    2011-12-01

    Full Text Available Abstract Background Gum resins obtained from trees of the Burseraceae family (Boswellia sp. are important ingredients in incense and perfumes. Extracts prepared from Boswellia sp. gum resins have been shown to possess anti-inflammatory and anti-neoplastic effects. Essential oil prepared by distillation of the gum resin traditionally used for aromatic therapy has also been shown to have tumor cell-specific anti-proliferative and pro-apoptotic activities. The objective of this study was to optimize conditions for preparing Boswellea sacra essential oil with the highest biological activity in inducing tumor cell-specific cytotoxicity and suppressing aggressive tumor phenotypes in human breast cancer cells. Methods Boswellia sacra essential oil was prepared from Omani Hougari grade resins through hydrodistillation at 78 or 100 oC for 12 hours. Chemical compositions were identified by gas chromatography-mass spectrometry; and total boswellic acids contents were quantified by high-performance liquid chromatography. Boswellia sacra essential oil-mediated cell viability and death were studied in established human breast cancer cell lines (T47D, MCF7, MDA-MB-231 and an immortalized normal human breast cell line (MCF10-2A. Apoptosis was assayed by genomic DNA fragmentation. Anti-invasive and anti-multicellular tumor properties were evaluated by cellular network and spheroid formation models, respectively. Western blot analysis was performed to study Boswellia sacra essential oil-regulated proteins involved in apoptosis, signaling pathways, and cell cycle regulation. Results More abundant high molecular weight compounds, including boswellic acids, were present in Boswellia sacra essential oil prepared at 100 oC hydrodistillation. All three human breast cancer cell lines were sensitive to essential oil treatment with reduced cell viability and elevated cell death, whereas the immortalized normal human breast cell line was more resistant to essential oil

  9. Growth inhibition and differentiation of promyelocytic cells (HL-60) induced by BC-4, an active principle from Boswellia carterii Birdw.

    Science.gov (United States)

    Jing, Y; Xia, L; Han, R

    1992-03-01

    The induction of cell differentiation and growth inhibition of HL-60 cells by Bc-4, an active principle from Boswellia carterii, was studied in vitro and in vivo. The proliferation of HL-60 cells was found to be inhibited by Bc-4 at a concentration of 5-10 micrograms/ml. Under the action of Bc-4, the acid phosphatase and NBT reduction activities in HL-60 cells were increased, and phagocytosis of cells was also induced. All these activities were concentration dependent. The HL-60 cells were induced by Bc-4 to differentiate into more mature cells morphologically. The in vivo growth of HL-60 cells in mouse subrenal capsules (SRC) and in diffusion chambers inoculated into mice was inhibited by Bc-4 at a dose of 50 mg/kg. The morphology of HL-60 cells treated by Bc-4 in diffusion chambers exhibited characteristics of mature granulocytic cells.

  10. Boswellia sacra essential oil induces tumor cell-specific apoptosis and suppresses tumor aggressiveness in cultured human breast cancer cells

    OpenAIRE

    Suhail Mahmoud M; Wu Weijuan; Cao Amy; Mondalek Fadee G; Fung Kar-Ming; Shih Pin-Tsen; Fang Yu-Ting; Woolley Cole; Young Gary; Lin Hsueh-Kung

    2011-01-01

    Abstract Background Gum resins obtained from trees of the Burseraceae family (Boswellia sp.) are important ingredients in incense and perfumes. Extracts prepared from Boswellia sp. gum resins have been shown to possess anti-inflammatory and anti-neoplastic effects. Essential oil prepared by distillation of the gum resin traditionally used for aromatic therapy has also been shown to have tumor cell-specific anti-proliferative and pro-apoptotic activities. The objective of this study was to opt...

  11. Effects of an acetone extract of Boswellia carterii Birdw. (Burseraceae) gum resin on adjuvant-induced arthritis in lewis rats.

    Science.gov (United States)

    Fan, A Y; Lao, L; Zhang, R X; Zhou, A N; Wang, L B; Moudgil, K D; Lee, D Y W; Ma, Z Z; Zhang, W Y; Berman, B M

    2005-10-03

    Ruxiang (Gummi olibanum), the dried gum resin of Boswellia carterii (BC), has been used in traditional Chinese medicine to alleviate pain and inflammation for thousands of years. In this random, blinded study, the anti-arthritic effects of a BC extract were observed and compared to vehicle control in a Lewis rat adjuvant arthritis model (n=8/group). Arthritis was induced by injecting CFA subcutaneously into the base of the tail, and the extract was administered orally (i.g.) for 10 consecutive days beginning on day 16 after the injection. Arthritic scores, paw edema, and the local tissue pro-inflammatory cytokines tumor necrosis factor alpha (TNF-alpha) and interleukin-1 beta (IL-1beta) were assessed. Toxicity and adverse effects of the extract were evaluated. At 0.90 g/kg per day, BC significantly decreased arthritic scores between days 20 and 25 (p<0.05) and reduced paw edema on days 18, 20 and 22 compared to control (p<0.05). It also significantly suppressed local tissue TNF-alpha and IL-1beta (p<0.05). No major adverse effects were observed in animals during the repeated-dose treatment profile although mild fur discoloration was noted. The data show that BC extract has significant anti-arthritic and anti-inflammation effects and suggest that these effects may be mediated via the suppression of pro-inflammatory cytokines.

  12. Frankincense essential oil prepared from hydrodistillation of Boswellia sacra gum resins induces human pancreatic cancer cell death in cultures and in a xenograft murine model

    Directory of Open Access Journals (Sweden)

    Ni Xiao

    2012-12-01

    Full Text Available Abstract Background Regardless of the availability of therapeutic options, the overall 5-year survival for patients diagnosed with pancreatic cancer remains less than 5%. Gum resins from Boswellia species, also known as frankincense, have been used as a major ingredient in Ayurvedic and Chinese medicine to treat a variety of health-related conditions. Both frankincense chemical extracts and essential oil prepared from Boswellia species gum resins exhibit anti-neoplastic activity, and have been investigated as potential anti-cancer agents. The goals of this study are to identify optimal condition for preparing frankincense essential oil that possesses potent anti-tumor activity, and to evaluate the activity in both cultured human pancreatic cancer cells and a xenograft mouse cancer model. Methods Boswellia sacra gum resins were hydrodistilled at 78°C; and essential oil distillate fractions were collected at different durations (Fraction I at 0–2 h, Fraction II at 8–10 h, and Fraction III at 11–12 h. Hydrodistillation of the second half of gum resins was performed at 100°C; and distillate was collected at 11–12 h (Fraction IV. Chemical compositions were identified by gas chromatography–mass spectrometry (GC-MS; and total boswellic acids contents were quantified by high-performance liquid chromatography (HPLC. Frankincense essential oil-modulated pancreatic tumor cell viability and cytotoxicity were determined by colorimetric assays. Levels of apoptotic markers, signaling molecules, and cell cycle regulators expression were characterized by Western blot analysis. A heterotopic (subcutaneous human pancreatic cancer xenograft nude mouse model was used to evaluate anti-tumor capability of Fraction IV frankincense essential oil in vivo. Frankincense essential oil-induced tumor cytostatic and cytotoxic activities in animals were assessed by immunohistochemistry. Results Longer duration and higher temperature hydrodistillation produced more

  13. Evaluation of Hypoglycemic Activity of Boswellia carterii and Cissus rotundifolia in Streptozotocin/Nicotinamide-Induced Diabetic Rats

    Directory of Open Access Journals (Sweden)

    Ali A. Al-Mehdar

    2016-12-01

    Full Text Available Objective: To evaluate the hypoglycemic activity of Boswellia carterii and Cissus rotundifolia in rats compared to that of glibenclamide and metformin as common oral hypoglycemic drugs. Methods: Thirty-six male Wistar rats, divided into six groups of six rats each, were assigned into diabetic and non-diabetic groups. Diabetes was induced in rats by single intraperitoneal administration of streptozotocin (65 mg/kg b.w. and nicotinamide (110 mg/kg b.w.. The first two groups were normal and diabetic controls, whereas the other four diabetic groups were treated with water extracts of the medicinal plants; B. carterii (100 mg/kg b.w. and C. rotundifolia (100 mg/kg b.w., glibenclamide (5 mg/kg b.w. and metformin (150 mg/kg b.w.. Body weight and serum glucose were measured on days 1, 7, 14, 21 and 28. Serum cholesterol and triglyceride levels were also measured. Results: Treatment of diabetic rats with the water extracts of B. carterii and C. rotundifolia for four weeks resulted in a significant (p<0.05 increase in their body weights and a significant decrease in the levels of serum glucose, cholesterol and triglycerides. The effects of the two plant extracts were almost similar to those of glibenclamide and metformin. Conclusion: Water extracts of B. carterii or C. rotundifolia have a hypoglycemic effect resembling those of glibenclamide and metformin, and these findings provide a pharmacological evidence for their anti-diabetic claims in folk medicine.

  14. Clastogenic effects of dietary supplement--Spirulina alga, and some medicinal plant products from Boswellia serrata, Withania somnifera on mice.

    Science.gov (United States)

    Ghoshal, S; Mukhopadhyay, M J; Mukherjee, A

    2001-10-01

    Pretreatment of aqueous extracts of Zyrulina (Spirulina), Aswagandha (Withania) and Nopane (Boswellia) on colchicine induced chromosome damage showed weakness of clastogenic activity in Swiss albino mice. None of the treatments increased significantly the number of chromosome aberrations.

  15. Hepatoprotective triterpenes from the gum resin of Boswellia carterii.

    Science.gov (United States)

    Wang, Yan-Gai; Ma, Qin-Ge; Tian, Jin; Ren, Jin; Wang, Ai-Guo; Ji, Teng-Fei; Yang, Jian-Bo; Su, Ya-Lun

    2016-03-01

    Ten tirucallane-type triterpenes named boscartene A-J and a nor-tetracyclic triterpene boscartene K, together with ten known compounds were isolated from the gum resin of Boswellia carterii Birdw. Their structures and absolute configurations were elucidated by extensive spectroscopic analysis. In vitro assay, some of these compounds (10 μM) showed moderate hepatoprotective activities against d-galactosamine-induced HL-7702 cell damage.

  16. Population structure and morphology of the frankincense tree Boswellia papyrifera along an altitude gradient in Eritrea

    NARCIS (Netherlands)

    Ogbazghi, W.; Bongers, F.J.J.M.; Rijkers, A.J.M.; Wessel, M.

    2006-01-01

    In Eritrea, the frankincense tree Boswellia papyrifera is a multipurpose plant. Human induced factors such as land clearing for agriculture, overgrazing by livestock and overtapping of resin are threatening its distribution. Against this background, a study was carried out to investigate the species

  17. Acetyl-11-keto-beta-boswellic acid, a constituent of a herbal medicine from Boswellia serrata resin, attenuates experimental ileitis.

    Science.gov (United States)

    Krieglstein, C F; Anthoni, C; Rijcken, E J; Laukötter, M; Spiegel, H U; Boden, S E; Schweizer, S; Safayhi, H; Senninger, N; Schürmann, G

    2001-04-01

    The gum resin extract from Boswellia serrata (H15), an herbal product, was recently shown to have positive therapeutic effects in inflammatory bowel disease (IBD). However, the mechanisms and constituents responsible for these effects are poorly understood. This study examined the effect of the Boswellia extract and its single constituent acetyl-11-keto-beta-boswellic acid (AKBA) on leukocyte-endothelial cell interactions in an experimental model of IBD. Ileitis was induced by two subcutaneous injections of indomethacin (7.5 mg/kg) in Sprague-Dawley rats 24 h apart. Rats also received oral treatment with the Boswellia extract (H15) or AKBA at two different doses (low and high) equivalent to recommendations in human disease over 2 days. Controls received only the carriers NaHCO3 (subcutaneously) and tylose (orally). Effects of treatment were assessed by intravital microscopy in ileal submucosal venules for changes in the number of rolling and adherent leukocytes and by macroscopic and histological scoring. Increased leukocyte-endothelial cell adhesive interactions and severe tissue injury accompanied indomethacin-induced ileitis. Treatment with the Boswellia extract or AKBA resulted in a dose-dependent decrease in rolling (up to 90%) and adherent (up to 98%) leukocytes. High-dose Boswellia extract as well as both low- and high-dose AKBA significantly attenuated tissue injury scores. Oral therapy with the Boswellia extract or AKBA significantly reduces macroscopic and microcirculatory inflammatory features normally associated with indomethacin administration, indicating that the anti-inflammatory actions of the Boswellia extract in IBD may be due in part to boswellic acids such as AKBA.

  18. Chemistry and Biology of Essential Oils of Genus Boswellia

    Directory of Open Access Journals (Sweden)

    Hidayat Hussain

    2013-01-01

    Full Text Available The properties of Boswellia plants have been exploited for millennia in the traditional medicines of Africa, China, and especially in the Indian Ayurveda. In Western countries, the advent of synthetic drugs has obscured the pharmaceutical use of Boswellia, until it was reported that an ethanolic extract exerts anti-inflammatory and antiarthritic effects. Frankincense was commonly used for medicinal purposes. This paper aims to provide an overview of current knowledge of the volatile constituents of frankincense, with explicit consideration concerning the diverse Boswellia species. Altogether, more than 340 volatiles in Boswellia have been reported in the literature. In particular, a broad diversity has been found in the qualitative and quantitative composition of the volatiles with respect to different varieties of Boswellia. A detailed discussion of the various biological activities of Boswellia frankincense is also presented.

  19. Incensole acetate: a novel neuroprotective agent isolated from Boswellia carterii.

    Science.gov (United States)

    Moussaieff, Arieh; Shein, Na'ama A; Tsenter, Jeanna; Grigoriadis, Savvas; Simeonidou, Constantina; Alexandrovich, Alexander G; Trembovler, Victoria; Ben-Neriah, Yinon; Schmitz, Michael L; Fiebich, Bernd L; Munoz, Eduardo; Mechoulam, Raphael; Shohami, Esther

    2008-07-01

    Boswellia resin has been used as a major anti-inflammatory agent and for the healing of wounds for centuries. Incensole acetate (IA), isolated from this resin, was shown to inhibit the activation of nuclear factor-kappaB, a key transcription factor in the inflammatory response. We now show that IA inhibits the production of inflammatory mediators in an in vitro model system of C6 glioma and human peripheral monocytes. Given the involvement of postinjury inflammation in the pathophysiology and outcome of traumatic brain injury, we examined the effect of IA on the inflammatory process and on the recovery of neurobehavioral and cognitive functions in a mouse model of closed head injury (CHI). In the brains of post-CHI mice, IA reduced glial activation, inhibited the expression of interleukin-1beta, and tumor necrosis factor-alpha mRNAs, and induced cell death in macrophages at the area of trauma. A mild hypothermic effect was also noted. Subsequently, IA inhibited hippocampal neurodegeneration and exerted a beneficial effect on functional outcome after CHI, indicated by reduced neurological severity scores and improved cognitive ability in an object recognition test. This study attributes the anti-inflammatory activity of Boswellia resin to IA and related cembranoid diterpenes and suggests that they may serve as novel neuroprotective agents.

  20. Effect Of Boswellia Carterii Birdw On Carbohydrate Metabolism In Diabetic Male Albino Rats

    OpenAIRE

    Eman G. E. Helal*, Ashraf M. Mostafa**, Fawzy A. Ashour

    2005-01-01

    In the current study, thirty male adult albino rats were used to investigate the effect of Boswellia Carterii Birdw (BCB) on carbohydrate metabolism in alloxan-induced diabetes. Rats were divided into three equal groups, control, diabetic non treated and diabetic BCB treated groups. After thirty days of treatment five rats of each group were sacrificed and the others were left without any additional treatment for another 15 days (recovery period) then were sacrificed. The body weight of each ...

  1. Hepatoprotective prenylaromadendrane-type diterpenes from the gum resin of Boswellia carterii.

    Science.gov (United States)

    Wang, Yan-gai; Ren, Jin; Wang, Ai-guo; Yang, Jian-bo; Ji, Teng-fei; Ma, Qin-Ge; Tian, Jin; Su, Ya-lun

    2013-11-22

    Chemical examination of the exuded gum resin of Boswellia carterii resulted in the isolation of nine new prenylaromadendrane-type diterpenes, boscartols A-I (1-9). The structures of these compounds were established by extensive 1D and 2D NMR spectroscopic analyses, mass spectrometric data, and circular dichroism spectra. Compounds 1-3, 5, 6, 8, and 9 (10 μM) showed moderate hepatoprotective activity against d-galactosamine-induced HL-7702 cell damage.

  2. Chemical differentiation of Boswellia sacra and Boswellia carterii essential oils by gas chromatography and chiral gas chromatography-mass spectrometry

    NARCIS (Netherlands)

    Woolley, C.L.; Suhail, M.M.; Smith, B.L.; Boren, K.E.; Taylor, L.C.; Schreuder, M.F.; Chai, J.K.; Casabianca, H.; Haq, S.; Lin, H.K.; Al-Shahri, A.A.; Al-Hatmi, S.; Young, D.G.

    2012-01-01

    Major botanical and scientific references currently identify two species of frankincense, Boswellia carterii and Boswellia sacra, as being synonymous. We evaluated the Somalian (B. carterii) and Omani/Yemeni (B. sacra) species by chemical analyses to determine if there were any minor or major differ

  3. Potential Changes in Rat Spermatogenesis and Sperm Parameters after Inhalation of Boswellia papyrifera and Boswellia carterii Incense

    OpenAIRE

    Tajamul Hussain; Alokail, Majed S; Nasser Al-Daghri; Mukhtar Ahmed

    2013-01-01

    In this study the effect of Boswellia papyrifera (B. papyrifera) and Boswellia carterii (B. carterii) smoke exposure on spermatogenesis and sperm parameters in male albino rats was investigated. Rats (n = 11) were exposed daily in smoking chambers to smoke emanated by burning 4 g each of either B. papyrifera or B. carterii for 48 days. At the end of exposure duration rats were killed, and the testes were excised and analysed for histopathological and ultrastructural changes. Sperm analysis in...

  4. [Experimental study on induction of apoptosis of leukemic cells by Boswellia carterii Birdw extractive].

    Science.gov (United States)

    Qi, Z; Zhang, G; Zhu, W

    1999-01-01

    The purpose of the study was to investigate the apoptosis of leukemic cells induced by Boswellia Carterii Birdw(BCB). The target leukemia cell line HL60 and bone marrow leukemic cells from 30 acute non-lymphocytic leukemic(ANLL) patients (3 M1 11 M2a 10 M3 1 M4a 5 M5b) were studied. Apoptosis was detected by morphological observation, DNA electrophoresis, percentage of DNA fragmentation test and flow cytometric cell cycle analysis. It is concluded that BCB can induce apoptosis in ANLL cells and HL60 cells.

  5. Boswellia serrata , a potential antiinflammatory agent: An overview

    Directory of Open Access Journals (Sweden)

    M Z Siddiqui

    2011-01-01

    Full Text Available The resin of Boswellia species has been used as incense in religious and cultural ceremonies and in medicines since time immemorial. Boswellia serrata (Salai/Salai guggul, is a moderate to large sized branching tree of family Burseraceae (Genus Boswellia, grows in dry mountainous regions of India, Northern Africa and Middle East. Oleo gum-resin is tapped from the incision made on the trunk of the tree and is then stored in specially made bamboo basket for removal of oil content and getting the resin solidified. After processing, the gum-resin is then graded according to its flavour, colour, shape and size. In India, the States of Andhra Pradesh, Gujarat, Madhya Pradesh, Jharkhand and Chhattisgarh are the main source of Boswellia serrata. Regionally, it is also known by different names. The oleo gum-resins contain 30-60% resin, 5-10% essential oils, which are soluble in the organic solvents, and the rest is made up of polysaccharides. Gum-resin extracts of Boswellia serrata have been traditionally used in folk medicine for centuries to treat various chronic inflammatory diseases. The resinous part of Boswellia serrata possesses monoterpenes, diterpenes, triterpenes, tetracyclic triterpenic acids and four major pentacyclic triterpenic acids i.e. β-boswellic acid, acetyl-β-boswellic acid, 11-keto-β-boswellic acid and acetyl-11-keto-β-boswellic acid, responsible for inhibition of pro-inflammatory enzymes. Out of these four boswellic acids, acetyl-11-keto-β-boswellic acid is the most potent inhibitor of 5-lipoxygenase, an enzyme responsible for inflammation.

  6. Boswellia serrata Preserves Intestinal Epithelial Barrier from Oxidative and Inflammatory Damage.

    Directory of Open Access Journals (Sweden)

    Daniela Catanzaro

    Full Text Available Aminosalicylates, corticosteroids and immunosuppressants are currently the therapeutic choices in inflammatory bowel diseases (IBD, however, with limited remission and often serious side effects. Meanwhile complementary and alternative medicine (CAM use is increasing, particularly herbal medicine. Boswellia serrata is a traditional Ayurvedic remedy with anti-inflammatory properties, of interest for its usefulness in IBDs. The mechanism of this pharmacological potential of Boswellia serrata was investigated in colonic epithelial cell monolayers exposed to H2O2 or INF-γ+TNF-α, chosen as in vitro experimental model of intestinal inflammation. The barrier function was evaluated by the transepithelial electrical resistance (TEER and paracellular permeability assay, and by the tight junction proteins (zonula occludens-1, ZO-1 and occludin immunofluorescence. The expression of phosphorylated NF-κB and reactive oxygen species (ROS generation were determined by immunoblot and cytofluorimetric assay, respectively. Boswellia serrata oleo-gum extract (BSE and its pure derivative acetyl-11-keto-β-boswellic acid (AKBA, were tested at 0.1-10 μg/ml and 0.027 μg/ml, respectively. BSE and AKBA safety was demonstrated by no alteration of intestinal cell viability and barrier function and integrity biomarkers. H2O2 or INF-γ+TNF-α treatment of Caco-2 cell monolayers significantly reduced TEER, increased paracellular permeability and caused the disassembly of tight junction proteins occludin and ZO-1. BSE and AKBA pretreatment significantly prevented functional and morphological alterations and also the NF-κB phosphorylation induced by the inflammatory stimuli. At the same concentrations BSE and AKBA counteracted the increase of ROS caused by H2O2 exposure. Data showed the positive correlation of the antioxidant activity with the mechanism involved in the physiologic maintenance of the integrity and function of the intestinal epithelium. This study

  7. The effect of 60Co-gamma radio-sterilization on Boswellia carterii essential oil composition

    OpenAIRE

    P. Badr; S. Daneshamouz; A.A. Mohammadi; A.R. Akbarizadeh; Afsharypuor, S.

    2016-01-01

    Background and objectives:Gamma-irradiation is used vastly for both decontamination and sterilization of natural products; but these high-energy rays can affect heat-sensitive essential oils. Methods: The oleo-gum-resin of Boswellia carterii (Burseraceae) was sterilized by γ-irradiation at dose 30 KGy. The essential oils obtained by hydrodistillation of non-irradiated Boswellia (NIB) and irradiated Boswellia (IB) were analyzed by GC/MS and the changes were compared. The structure of octyl ace...

  8. The therapeutic effect of the aqueous extract of boswellia serrata on the learning deficit in kindled rats

    Directory of Open Access Journals (Sweden)

    Cyrus Jalili

    2014-01-01

    Conclusions: The results can be stated that the Boswellia extract is offset by harmful effects of seizures on cognitive function and consumption of Boswellia extract increases the learning ability in epileptic animals.

  9. Muusikamaailm : Uus hooaeg ooperiteatrites, kontserdimajades. Elliott Carteri esikooper. Birgit Cullberg surnud / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    1999-01-01

    Uue hooaja kavadest Los Angeles Operas, Kölni Opernhausis, New York City Operas, Inglise Rahvusooperis, San Francisco Operas; Detroidi Sümfooniaorkestri, Turu ja Helsingi Linnaorkestri ja San Francisco Symhony Orchestra hooaja avakontserditest. E.Carteri esikooperi "What Next" maailmaesiettekandest Berliini Riigiooperis. B.Cullbergi tegevusest

  10. Final Critical Habitat for Carter's Panicgrass (Panicum fauriei var. carteri) island of Mokoli'i (Chinaman's Hat), Oahu, HI

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — To provide the user with a general idea of areas where final critical habitat for Carter's Panicgrass (Panicum fauriei var. carteri) occur the based on the...

  11. Boswellia carterii Extract Inhibits TH1 Cytokines and Promotes TH2 Cytokines In Vitro

    OpenAIRE

    Chevrier, Marc R.; Ryan, Abigail E.; Lee, David Y.-W.; Zhongze, Ma; Wu-Yan, Zhang; Via, Charles S.

    2005-01-01

    Traditional herbal formulas used to treat inflammatory arthritis in China and India include Boswellia carterii or Boswellia serrata. They both contain boswellic acids (BAs) which have been shown to exhibit anti-inflammatory and antiarthritic properties. This study tests the hypothesis that mixtures of BAs derived from B. carterii have immunomodulatory properties. B. carterii plant resin obtained from China was prepared as an ethanol extract, and the presence of seven BAs was confirmed by colu...

  12. Potential Changes in Rat Spermatogenesis and Sperm Parameters after Inhalation of Boswellia papyrifera and Boswellia carterii Incense

    Directory of Open Access Journals (Sweden)

    Tajamul Hussain

    2013-02-01

    Full Text Available In this study the effect of Boswellia papyrifera (B. papyrifera and Boswellia carterii (B. carterii smoke exposure on spermatogenesis and sperm parameters in male albino rats was investigated. Rats (n = 11 were exposed daily in smoking chambers to smoke emanated by burning 4 g each of either B. papyrifera or B. carterii for 48 days. At the end of exposure duration rats were killed, and the testes were excised and analysed for histopathological and ultrastructural changes. Sperm analysis including total sperm count, motility, velocity and relative percentage of abnormal sperms were recorded. Rats exposed to B. papyrifera and B. carterii showed significant disturbances in spermatogenetic patterns and changes in sperm kinetics compared to unexposed rats. Atrophied seminiferous tubules with dynamic changes were also noticed. The boundaries of intercellular and intracellular vacuoles were seen in the Sertoli cells. Furthermore, in spermatids acrosomal vesicles were not fully formed. Degenerating spermatids were devoid of their nuclear membrane with electron dense matrix and vacuolization. Structural changes in Leydig cells were observed. Sperm analysis in exposed rats exhibited significant decrease in the sperm count, motility, speed and an increase in sperm anomalies when compare to controls. These findings demonstrate that the B. papyrifera and B. carterii smoke affects the process of spermatogenesis and sperm parameters and indicate the detrimental effects of these incense materials on human reproductive system.

  13. Potential changes in rat spermatogenesis and sperm parameters after inhalation of Boswellia papyrifera and Boswellia carterii incense.

    Science.gov (United States)

    Ahmed, Mukhtar; Al-Daghri, Nasser; Alokail, Majed S; Hussain, Tajamul

    2013-02-28

    In this study the effect of Boswellia papyrifera (B. papyrifera) and Boswellia carterii (B. carterii) smoke exposure on spermatogenesis and sperm parameters in male albino rats was investigated. Rats (n = 11) were exposed daily in smoking chambers to smoke emanated by burning 4 g each of either B. papyrifera or B. carterii for 48 days. At the end of exposure duration rats were killed, and the testes were excised and analysed for histopathological and ultrastructural changes. Sperm analysis including total sperm count, motility, velocity and relative percentage of abnormal sperms were recorded. Rats exposed to B. papyrifera and B. carterii showed significant disturbances in spermatogenetic patterns and changes in sperm kinetics compared to unexposed rats. Atrophied seminiferous tubules with dynamic changes were also noticed. The boundaries of intercellular and intracellular vacuoles were seen in the Sertoli cells. Furthermore, in spermatids acrosomal vesicles were not fully formed. Degenerating spermatids were devoid of their nuclear membrane with electron dense matrix and vacuolization. Structural changes in Leydig cells were observed. Sperm analysis in exposed rats exhibited significant decrease in the sperm count, motility, speed and an increase in sperm anomalies when compare to controls. These findings demonstrate that the B. papyrifera and B. carterii smoke affects the process of spermatogenesis and sperm parameters and indicate the detrimental effects of these incense materials on human reproductive system.

  14. Chemical differentiation of Boswellia sacra and Boswellia carterii essential oils by gas chromatography and chiral gas chromatography-mass spectrometry.

    Science.gov (United States)

    Woolley, Cole L; Suhail, Mahmoud M; Smith, Brett L; Boren, Karen E; Taylor, Lindsey C; Schreuder, Marc F; Chai, Jeremiah K; Casabianca, Hervé; Haq, Sadqa; Lin, Hsueh-Kung; Al-Shahri, Ahmed A; Al-Hatmi, Saif; Young, D Gary

    2012-10-26

    Major botanical and scientific references currently identify two species of frankincense, Boswellia carterii and Boswellia sacra, as being synonymous. We evaluated the Somalian (B. carterii) and Omani/Yemeni (B. sacra) species by chemical analyses to determine if there were any minor or major differences between the two species of frankincense. Components identified with their average percent for B. sacra are α-thujene (0.6%), α-pinene (68.2%), camphene (2.1%), sabinene (2.9%), β-pinene (2.0%), myrcene (0.7%), limonene+β-phellandrene (6.2%). Components identified with their average percent for B. carterii are α-thujene (7.9%), α-pinene (37.3%), camphene (0.8%), sabinene (4.9%), β-pinene (1.8%), myrcene (7.3%), limonene+β-phellandrene (14.4%). Initially, GC-MS analysis did not reveal major statistical differences. However, optical rotation values, B. Sacra (+30.1°) and B. carterii (-13.3°), demonstrated a greater significant difference. Enantiomeric ratio (+)/(-) values of α-pinene for B. sacra and B. carterii are 8.24 and 0.68, respectively, were also calculated aiding our conclusion that B. sacra and B. carterii are not synonymous but rather two distinct and individual frankincense species.

  15. The mitochondrial and plastid genomes of Volvox carteri: bloated molecules rich in repetitive DNA

    Directory of Open Access Journals (Sweden)

    Lee Robert W

    2009-03-01

    Full Text Available Abstract Background The magnitude of noncoding DNA in organelle genomes can vary significantly; it is argued that much of this variation is attributable to the dissemination of selfish DNA. The results of a previous study indicate that the mitochondrial DNA (mtDNA of the green alga Volvox carteri abounds with palindromic repeats, which appear to be selfish elements. We became interested in the evolution and distribution of these repeats when, during a cursory exploration of the V. carteri nuclear DNA (nucDNA and plastid DNA (ptDNA sequences, we found palindromic repeats with similar structural features to those of the mtDNA. Upon this discovery, we decided to investigate the diversity and evolutionary implications of these palindromic elements by sequencing and characterizing large portions of mtDNA and ptDNA and then comparing these data to the V. carteri draft nuclear genome sequence. Results We sequenced 30 and 420 kilobases (kb of the mitochondrial and plastid genomes of V. carteri, respectively – resulting in partial assemblies of these genomes. The mitochondrial genome is the most bloated green-algal mtDNA observed to date: ~61% of the sequence is noncoding, most of which is comprised of short palindromic repeats spread throughout the intergenic and intronic regions. The plastid genome is the largest (>420 kb and most expanded (>80% noncoding ptDNA sequence yet discovered, with a myriad of palindromic repeats in the noncoding regions, which have a similar size and secondary structure to those of the mtDNA. We found that 15 kb (~0.01% of the nuclear genome are homologous to the palindromic elements of the mtDNA, and 50 kb (~0.05% are homologous to those of the ptDNA. Conclusion Selfish elements in the form of short palindromic repeats have propagated in the V. carteri mtDNA and ptDNA, resulting in the distension of these genomes. Copies of these same repeats are also found in a small fraction of the nucDNA, but appear to be inert in this

  16. Immunomodulatory triterpenoids from the oleogum resin of Boswellia carterii Birdwood.

    Science.gov (United States)

    Badria, Farid A; Mikhaeil, Botros R; Maatooq, Galal T; Amer, Mohamed M A

    2003-01-01

    The immunomodulatory bioassay-guided fractionation of the oleogum resin of frankincense (Boswellia carterii Birdwood) resulted in the isolation and identification of 9 compounds; palmitic acid and eight triterpenoids belonging to lupane, ursane, oleanane, and tirucallane skeleta were isolated form the resin. These triterpenoids are lupeol, beta-boswellic acid, 11-keto-beta-boswellic acid, acetyl beta-boswellic acid, acetyl 11-keto-beta-boswellic acid, acetyl-alpha-boswellic acid, 3-oxo-tirucallic acid, and 3-hydroxy-tirucallic acid. The structures of the isolated compounds were deduced based on spectroscopic evidences. The lymphocyte transformation assay of the isolated compounds proved that the total extract retained more activity than that of any of the purified compounds.

  17. Two new triterpenoids from the resin of Boswellia carterii.

    Science.gov (United States)

    Wang, Feng; Li, Zhan-Lin; Cui, Hong-Hua; Hua, Hui-Ming; Jing, Yong-Kui; Liang, Sheng-Wang

    2011-03-01

    Two new triterpenoids, 3-oxotirucalla-7,9(11),24-trien-21-oic acid (1) and 18Hα,3β,20β-ursanediol (2), along with 15 known triterpenes, α-amyrin, α-boswellic acid, β-boswellic acid, acetyl α-boswellic acid, acetyl β-boswellic acid, 9,11-dehydro-β-boswellic acid, 9,11-dehydro-α-boswellic acid, acetyl 11α-methoxy-β-boswellic acid, 11-keto-β-boswellic acid, acetyl 11-keto-β-boswellic acid, acetyl α-elemolic acid, 3β-hydroxytirucalla-8,24-dien-21-oic acid, elemonic acid, 3α-hydroxytirucalla-7,24-dien-21-oic acid, and 3α-hydroxytirucall-24-en-21-oic acid, were isolated from the resin of Boswellia carterii Birdw.

  18. Genomic analysis of organismal complexity in the multicellular green alga Volvox carteri

    Energy Technology Data Exchange (ETDEWEB)

    Prochnik, Simon E.; Umen, James; Nedelcu, Aurora; Hallmann, Armin; Miller, Stephen M.; Nishii, Ichiro; Ferris, Patrick; Kuo, Alan; Mitros, Therese; Fritz-Laylin, Lillian K.; Hellsten, Uffe; Chapman, Jarrod; Simakov, Oleg; Rensing, Stefan A.; Terry, Astrid; Pangilinan, Jasmyn; Kapitonov, Vladimir; Jurka, Jerzy; Salamov, Asaf; Shapiro, Harris; Schmutz, Jeremy; Grimwood, Jane; Lindquist, Erika; Lucas, Susan; Grigoriev, Igor V.; Schmitt, Rudiger; Kirk, David; Rokhsar, Daniel S.

    2010-07-01

    Analysis of the Volvox carteri genome reveals that this green alga's increased organismal complexity and multicellularity are associated with modifications in protein families shared with its unicellular ancestor, and not with large-scale innovations in protein coding capacity. The multicellular green alga Volvox carteri and its morphologically diverse close relatives (the volvocine algae) are uniquely suited for investigating the evolution of multicellularity and development. We sequenced the 138 Mb genome of V. carteri and compared its {approx}14,500 predicted proteins to those of its unicellular relative, Chlamydomonas reinhardtii. Despite fundamental differences in organismal complexity and life history, the two species have similar protein-coding potentials, and few species-specific protein-coding gene predictions. Interestingly, volvocine algal-specific proteins are enriched in Volvox, including those associated with an expanded and highly compartmentalized extracellular matrix. Our analysis shows that increases in organismal complexity can be associated with modifications of lineage-specific proteins rather than large-scale invention of protein-coding capacity.

  19. Parasitic plant in natural Boswellia papyrifera stands at Humera, Northern Ethiopia

    Institute of Scientific and Technical Information of China (English)

    Abraham Yirgu; Alemu Gezahgne; Habtemariam Kassa; Minilik Tsega

    2014-01-01

    In Boswellia papyrifera (Del.) Hochst natural stands, we stud-ied the association of parasitic plants with B. papyrifera trees from which frankincense was tapped and marketed for domestic and export markets. Data on the rate of infection of parasitic plants on B. papyrifera was collected in three transects located at separate locations around Baha kar, northern Ethiopia. Each transect had ten circular sample plots of 400 m2 and separated by 100 m. Species composition, DBH, height, crown di-ameter, number of main, secondary and tertiary branches and number of parasitic plants on individual trees were recorded. Sixteen tree species were recorded in the combined sample plots. The parasitic plant associ-ated with B. papyrifera was identified as Tapinanthus globiferus. This parasite infected 38% of Boswellia trees in sample plots. The infection rate of the parasitic plant varied from 1 to 33 per Boswellia tree. The infection of T. globiferus on B. papyrifera was predominantly limited to tertiary small branchlets arising from secondary branches;parasitic plants were absent on thick main and secondary branches. In all plots, infection of T. globiferus was exclusively limited to Boswellia trees. The influence of T. globiferus parasitism on growth of Boswellia trees and its influence on yield of incense production needs further investigation. Management of natural stands for frankincense production should include measures to reduce infection by T. globiferus.

  20. In vitro antibacterial activity of three medicinal plants-Boswellia (Luban) species

    Institute of Scientific and Technical Information of China (English)

    Hasson SS; Al-Balushi MS; Sallam TA; Idris MA; Habbal O; Al-Jabri AA

    2011-01-01

    Objective:To study in vitro antibacterial and antifungal activity of hot water and methanolic extracts of the three medicinal plants-Boswellia (Luban) species. Methods:Three selected plants were collected from different localities of Soqotra (Republic of Yemen), Dohfar (Sultanate of Oman) and Republic of Somalia. The plants were dried and extracted with two different solvents (methanol and hot water) to yield six crude extracts. The obtained extracts were tested for their antibacterial activity against eleven different bacterial strains and two fungi using the standard well-diffusion and micro-dilution methods. The following microorganisms were used:methicillin-resistant Staphylococcus aureus (ATCC 6538), muti-drug resistant Pseudomonas aeruginosa (ATCC 27853), enterohemorrhagic Escherichia coli (0157 EHEC), Salmonella typhi, Proteus vulgaris, Klebsiella pneumoniae, Bacillus subtilus (ATCC 6059, reference strain), Streptococcus pneumoniae, Klebsella pneumonia, MRSA, Corynebacterium, Corynebacterium diphtheriae and two fungus:Candida maltosa and Candida albicans. Results: The different extracts possessed different inhibitory activity against different types of bacterial species. The patterns of inhibition varied with the plant extract, the solvent used for extraction and the organisms tested. The antimicrobial activity exhibited by the methanolic extracts of Boswellia sacra from the Suqotra and Dhofar regions was greater than that of Boswellia frereana collected from Somalia. The methanolic extract of the oleo-gum-resin showed higher efficacy to inhibit all the tested bacterial strains than the methanolic extract of frankincense-resin. The Boswellia frereana collected from Somalia showed lower activity compared with the two other Boswellia species. The plant extracts showed bacteriostatic activity at lower concentrations and bactericidal activity at higher concentrations. Neither water nor methanolic extracts showed any activity against the fungi Candida maltosa and

  1. Two New and Four Known Triterpenoids from Boswellia sacra Fluckiger

    Directory of Open Access Journals (Sweden)

    Liaqat Ali

    2014-07-01

    Full Text Available Two new O-acetyl derivatives of pentacyclic triterpenic acids, 3α-acetoxyurs -5:12-dien-24-oic acid ( 1 and 3α-acetoxylup -12:20 (29-dien-24-oic acid ( 2 were isolated from Omani frankincense of Boswellia sacra Flueckiger along with four known compounds: commic acid-D (3, 9,11-dehydro-β-boswellic acid (4, 3β-Hydroxy-11-oxours-12-ene (5, and 11β-Hydroxy-3-oxours-12-ene (6 . The structures of new compounds 1 and 2 were elucidated on the basis of detailed mass and NMR spectroscopic analysis using 1H NMR, 13C NMR, HMQC, HMBC, COSY, and HREIMS techniques. The relative configurations of 1 and 2 were assigned by comparative analysis of the NMR spectral data with the related known triterpenoids together with NOESY experiments. The structures of the known compounds 3-6 were confirmed by the comparative analysis of the reported mass and NMR data.

  2. Modelling the future of Boswellia papyrifera population and its frankincense production

    NARCIS (Netherlands)

    Lemenih, M.; Arts, B.J.M.; Wiersum, K.F.; Bongers, F.

    2014-01-01

    Sustainable production of the aromatic forest product frankincense is at stake due to rapid decline in its resource base. This affects livelihoods of thousands of citizens and several global industries. A system dynamic model approach is used to predict the future population of Boswellia papyrifera

  3. Arbuscular mycorrhizal associations in Boswellia papyrifera (frankincense-tree) dominated dry deciduous woodlands of Northern Ethiopia.

    NARCIS (Netherlands)

    Emiru Birhane, E.B.; Kuyper, T.W.; Sterck, F.J.; Bongers, F.

    2010-01-01

    This study assessed the arbuscular mycorrhizal (AM) status of Boswellia papyrifera (frankincense-tree) dominated dry deciduous woodlands in relation to season, management and soil depth in Ethiopia. We studied 43 woody species in 52 plots in three areas. All woody species were colonized by AM fungi,

  4. Resin secretory structures of Boswellia papyrifera and implications for frankincense yield

    NARCIS (Netherlands)

    Tolera, M.; Menger, D.; Sass, U.G.W.; Sterck, F.J.; Copini, P.; Bongers, F.

    2013-01-01

    Frankincense, a gum-resin, has been tapped from Boswellia papyrifera trees for centuries. Despite the intensive tapping and economic interest of B. papyrifera, information on the resin secretory structures, which are responsible for synthesis, storage and transport of frankincense, is virtually abse

  5. Frankincense tapping reduced photosynthetic carbon gain in Boswellia papyrifera (Burseraceae) trees

    NARCIS (Netherlands)

    Mengistu, T.; Sterck, F.J.; Anten, N.P.R.; Bongers, F.

    2012-01-01

    Whole-crown carbon gain depends on environmental variables and functional traits, and in turn sets limits to growth sinks of trees. We estimated the annual whole-crown carbon gain of trees of the species Boswellia papyrifera, which are tapped for frankincense, by integrating leaf photosynthetic rate

  6. The effect of tapping for frankincense on sexual reproduction in Boswellia papyrifera

    NARCIS (Netherlands)

    Rijkers, A.J.M.; Ogbazghi, W.; Wessel, M.; Bongers, F.J.J.M.

    2006-01-01

    1. In the Horn of Africa, frankincense (an aromatic hardened wood resin) is obtained by tapping Boswellia papyrifera. World-wide, frankincense is of great economic and social importance as an important element of incense and perfumes. The production is declining as a result of poor natural regenerat

  7. The distribution and regeneration of Boswellia papyrifera (Del.) Hochst. in Eritrea

    NARCIS (Netherlands)

    Ogbazghi Woldeselassie,

    2001-01-01

    Boswellia papyrifera (Del.) Hochst. is a deciduous gum-producing multipurpose perennial tree species growing in Sudanian and Sahelian regions. The tree is tapped on the stem for oleo-gum called olibanum (true frankincense). Land clearing for agriculture and un-regulated grazing are threatening the f

  8. The effect of 60Co-gamma radio-sterilization on Boswellia carterii essential oil composition

    Directory of Open Access Journals (Sweden)

    P. Badr

    2016-10-01

    Full Text Available Background and objectives:Gamma-irradiation is used vastly for both decontamination and sterilization of natural products; but these high-energy rays can affect heat-sensitive essential oils. Methods: The oleo-gum-resin of Boswellia carterii (Burseraceae was sterilized by γ-irradiation at dose 30 KGy. The essential oils obtained by hydrodistillation of non-irradiated Boswellia (NIB and irradiated Boswellia (IB were analyzed by GC/MS and the changes were compared. The structure of octyl acetate as the major component and marker of B. carterii was confirmed by MS/MS. Results: Twenty-five compounds comprising 99.55% of NIB oil and nineteen compounds comprising 98.61% of IB oil were identified. Major constituents which were common for both oils were octyl acetate (52.67 % in NIB, 76.51 % in IB, 1-octanol (6.37 % in NIB, 5.19 % in IB, duva-4, 8, 13-triene-1,3α diol (5.52 % in NIB, 3.94 % in IB, verticiol (13.63 % in NIB and verticillane type diterpene (5.4 % in IB they made up 78.19% and 91.04% of NIB and IB, respectively. Conclusion: Gamma irradiation was an efficient method for sterilization of Boswellia carterii oleo-gum resin, but it resulted in change in the essential oil composition particularly octyl acetate changed from 52.67% to 76.51%.

  9. Boswellia carterii liquisolid systems with promoted anti-inflammatory activity.

    Science.gov (United States)

    Mostafa, Dina Mahmoud; Ammar, Nagwa Mohammed; Abd El-Alim, Sameh Hosam; Kassem, Ahmed Alaa; Hussein, Rehab Ali; Awad, Gamal; El-Awdan, Sally Abdul-Wanees

    2015-01-01

    Boswellia carterii (BC) Birdwood oleogum resin is an ancient remedy of inflammation processes known since Ancient Egyptian time. Of boswellic acids, 3-acetyl-11-keto-β-boswellic acid (AKBA) is the most potent anti-inflammatory active principle. Liquisolid systems of the biologically active fraction of BC oleogum resin were prepared for improving dissolution properties using low dose oral delivery to achieve enhanced anti-inflammatory activity, in comparison with the standard oral anti-inflammatory; Indomethacin. AKBA was assayed, employing an accurate and sensitive HPLC method. Detection was carried out at 210 nm using UV/Vis detector. A solubility study for the bioactive fraction was conducted. Microcrystalline cellulose and Aeroperl®300 Pharma were used as carrier and coating materials. Angle of slide, liquid load factor and Carr's flow index were estimated. Six systems were prepared using polyethylene glycol 400, solvent and two drug loading concentrations; 20 and 40 %. For each concentration, three carrier: coat ratios were dispensed; 20:1, 10:1, and 5:1. Dissolution study was performed and two systems were selected for characterization and in vivo evaluation by investigating upper GIT ulcerogenic effect and anti-inflammatory efficacy in rats. Results indicate absence of ulcers and significantly higher and prolonged anti-inflammatory efficacy for formulations F1 and F2, with carrier: coat ratio, 5:1 and drug loads of 20 and 40 %, respectively, compared with standard oral indomethacin. We conclude higher efficacy of BC bioactive fraction liquisolids compared with Indomethacin with greater safety on GIT, longer duration of action and hence better patient compliance.

  10. miRNA Repertoires of Demosponges Stylissa carteri and Xestospongia testudinaria

    KAUST Repository

    Liew, Yi Jin

    2016-02-12

    MicroRNAs (miRNAs) are small regulatory RNAs that are involved in many biological process in eukaryotes. They play a crucial role in modulating genetic expression of their targets, which makes them integral components of transcriptional regulatory networks. As sponges (phylum Porifera) are commonly considered the most basal metazoan, the in-depth capture of miRNAs from these organisms provides additional clues to the evolution of miRNA families in metazoans. Here, we identified the core proteins involved in the biogenesis of miRNAs, and obtained evidence for bona fide miRNA sequences for two marine sponges Stylissa carteri and Xestospongia testudinaria (11 and 19 respectively). Our analysis identified several miRNAs that are conserved amongst demosponges, and revealed that all of the novel miRNAs identified in these two species are specific to the class Demospongiae.

  11. Characterisation of metachronal waves on the surface of the spherical colonial alga Volvox carteri

    Science.gov (United States)

    Brumley, Douglas; Polin, Marco; Morez, Constant; Goldstein, Raymond; Pedley, Timothy

    2012-02-01

    Volvox carteri is a spherical colonial alga, consisting of thousands of biflagellate cells. The somatic cells embedded on the surface of the colony beat their flagella in a coordinated fashion, producing a net fluid motion. Using high-speed imaging and particle image velocimetry (PIV) we have been able to accurately analyse the time-dependent flow fields around such colonies. The somatic cells on the colony surface may beat their flagella in a perfectly synchronised fashion, or may exhibit metachronal waves travelling on the surface. We analyse the dependence of this synchronisation on fundamental parameters in the system such as colony radius, characterise the speed and wavelength of the observed metachronal waves, and investigate possible models to account for the exhibited behaviour.

  12. Hydrodynamic Synchronization and Metachronal Waves on the Surface of the Colonial Alga Volvox carteri

    Science.gov (United States)

    Brumley, Douglas R.; Polin, Marco; Pedley, Timothy J.; Goldstein, Raymond E.

    2012-12-01

    From unicellular ciliates to the respiratory epithelium, carpets of cilia display metachronal waves, long-wavelength phase modulations of the beating cycles, which theory suggests may arise from hydrodynamic coupling. Experiments have been limited by a lack of organisms suitable for systematic study of flagella and the flows they create. Using time-resolved particle image velocimetry, we report the discovery of metachronal waves on the surface of the colonial alga Volvox carteri, whose large size and ease of visualization make it an ideal model organism for these studies. An elastohydrodynamic model of weakly coupled compliant oscillators, recast as interacting phase oscillators, reveals that orbit compliance can produce fast, robust synchronization in a manner essentially independent of boundary conditions, and offers an intuitive understanding of a possible mechanism leading to the emergence of metachronal waves.

  13. miRNA Repertoires of Demosponges Stylissa carteri and Xestospongia testudinaria.

    Directory of Open Access Journals (Sweden)

    Yi Jin Liew

    Full Text Available MicroRNAs (miRNAs are small regulatory RNAs that are involved in many biological process in eukaryotes. They play a crucial role in modulating genetic expression of their targets, which makes them integral components of transcriptional regulatory networks. As sponges (phylum Porifera are commonly considered the most basal metazoan, the in-depth capture of miRNAs from these organisms provides additional clues to the evolution of miRNA families in metazoans. Here, we identified the core proteins involved in the biogenesis of miRNAs, and obtained evidence for bona fide miRNA sequences for two marine sponges Stylissa carteri and Xestospongia testudinaria (11 and 19 respectively. Our analysis identified several miRNAs that are conserved amongst demosponges, and revealed that all of the novel miRNAs identified in these two species are specific to the class Demospongiae.

  14. Effect of Boswellia papyrifera on cognitive impairment in multiple sclerosis.

    Directory of Open Access Journals (Sweden)

    Behnaz Sedighi

    2014-09-01

    Full Text Available Cognitive impairment is one of the most crucial disorders among multiple sclerosis (MS patients. Since MS is an inflammatory disease and Boswellia papyrifera has anti-inflammatory effects, the influence of B. papyrifera on cognitive impairment in MS patients has been investigated in the present study.In this clinical trial, 80 MS patients who referred to the clinic of Shafa Hospital, Kerman, Iran were selected. Having completed a written consent form, patients with relapsing remitting MS, with no occurrence of a new attack throughout 1 month before the study, with no pregnancy or breastfeeding entered the study. The patients were randomly divided into two groups; then Brief International Cognitive Assessment for MS (BICAMS test was carried out. One group received B. papyrifera (capsule 300 mg, twice a day while the other group received placebo with the same dose for 2 months. After 2 months of treatment, BICAMS was redone and changes were analyzed. The significant change value on the before-after BICAMS points were considered to be 8, 13, and 7 points for the symbol digit modality test (SDMT, the California verbal learning test (CVLT, and the brief visual-spatial memory test revised (BVMT-R, respectively.The patients' mean age was 36.58 8.50 years. The mean duration of disease was 7.41 4.13 years. About 84.2% (n = 64 of the patients was female. In the BVMT-R, 13 patients (34.2%, who had already taken B. papyrifera, were shown to have significant improvement compared to the placebo group with no improvement (P < 0. 001. About 12 and 8 patients in the treatment and placebo groups in the SDMT, respectively (P = 0.200 and 17 and 12 patients in the treatment and placebo groups in the CVLT, respectively (P = 0.170 had significant change values.B. papyrifera showed significant improvement in visuospatial memory, but had no effect on verbal memory and information processing speed.

  15. Larvicidal activity of Annona senegalensis and Boswellia dalzielii leaf fractions against Aedes aegypti (Diptera: Culicidae)

    OpenAIRE

    Younoussa Lame; Elias Nchiwan Nukenine; Danga Yinyang Simon Pierre; Charles Okechukwu Esimone

    2014-01-01

    The purpose of the present study was to evaluate the larvicidal activity of leaf fractions of Annona senegalensis and Boswellia dalzielii against fourth instar larvae of Aedes aegypti. Fourth instar larvae of Ae. aegypti were exposed for 24 hours to various concentrations (312.5-2500 mg/L) of methanolic crude extract and its fractions obtained with n-hexane, chloroform, ethyl-acetate and methanol solvents, following WHO method. The mortalities recorded were subjected to ANOVA test for mean co...

  16. AN ASSESSMENT OF THE DISTRIBUTION OF NATURAL GROWING BOSWELLIA SPECIES IN WAJIR COUNTY, KENYA

    Directory of Open Access Journals (Sweden)

    Luvanda A.M

    2014-09-01

    Full Text Available Evidence has shown that Boswellia, Acacia, Commiphora and other dryland trees and shrubs positively contributes to the livelihoods of the local communities and the Kenyan economy through production of gums, resins, oils and other commercial extracts. A study to assess the distribution, inventory and frankincense yield of Boswellia species in Wajir County was undertaken. Random line transects were laid down across the major populations from which 165 plots were identified and assessed for GPS coordinates; tree counts and other individual tree parameters. The results revealed that Boswellia neglecta and B. microphylla were found in the County. Other gums and resins yielding species in the County were Acacia senegal, Commimpora holtziana and C. myrrha. Owing to the harsh climatic conditions, most of the mature gums and resins yielding trees were observed to attain a mean height of between 4 to 7 meters and diameters at breast heights (dbh of 9 to 15 cm. The yield records show that frankincense production varied widely across various sites, with a mean production estimated at 79.5 g/tree/year through natural exudes thus explaining the low yields of the frankincense production with a county annual production potential of 1,800 MT. Markets for the frankincense and mobilization of resources for collection were the two main drawbacks that warrant further investigation.

  17. Understanding Boswellia papyrifera tree secondary metabolites through bark spectral analysis

    Science.gov (United States)

    Girma, Atkilt; Skidmore, Andrew K.; de Bie, C. A. J. M.; Bongers, Frans

    2015-07-01

    Decision makers are concerned whether to tap or rest Boswellia Papyrifera trees. Tapping for the production of frankincense is known to deplete carbon reserves from the tree leading to production of less viable seeds, tree carbon starvation and ultimately tree mortality. Decision makers use traditional experience without considering the amount of metabolites stored or depleted from the stem-bark of the tree. This research was designed to come up with a non-destructive B. papyrifera tree metabolite estimation technique relevant for management using spectroscopy. The concentration of biochemicals (metabolites) found in the tree bark was estimated through spectral analysis. Initially, a random sample of 33 trees was selected, the spectra of bark measured with an Analytical Spectral Device (ASD) spectrometer. Bark samples were air dried and ground. Then, 10 g of sample was soaked in Petroleum ether to extract crude metabolites. Further chemical analysis was conducted to quantify and isolate pure metabolite compounds such as incensole acetate and boswellic acid. The crude metabolites, which relate to frankincense produce, were compared to plant properties (such as diameter and crown area) and reflectance spectra of the bark. Moreover, the extract was compared to the ASD spectra using partial least square regression technique (PLSR) and continuum removed spectral analysis. The continuum removed spectral analysis were performed, on two wavelength regions (1275-1663 and 1836-2217) identified through PLSR, using absorption features such as band depth, area, position, asymmetry and the width to characterize and find relationship with the bark extracts. The results show that tree properties such as diameter at breast height (DBH) and the crown area of untapped and healthy trees were strongly correlated to the amount of stored crude metabolites. In addition, the PLSR technique applied to the first derivative transformation of the reflectance spectrum was found to estimate the

  18. Alkaloids from the Sponge Stylissa carteri Present Prospective Scaffolds for the Inhibition of Human Immunodeficiency Virus 1 (HIV-1)

    Science.gov (United States)

    O’Rourke, Aubrie; Kremb, Stephan; Bader, Theresa Maria; Helfer, Markus; Schmitt-Kopplin, Philippe; Gerwick, William H.; Brack-Werner, Ruth; Voolstra, Christian R.

    2016-01-01

    The sponge Stylissa carteri is known to produce a number of secondary metabolites displaying anti-fouling, anti-inflammatory, and anti-cancer activity. However, the anti-viral potential of metabolites produced by S. carteri has not been extensively explored. In this study, an S. carteri extract was HPLC fractionated and a cell based assay was used to evaluate the effects of HPLC fractions on parameters of Human Immunodeficiency Virus (HIV-1) infection and cell viability. Candidate HIV-1 inhibitory fractions were then analyzed for the presence of potential HIV-1 inhibitory compounds by mass spectrometry, leading to the identification of three previously characterized compounds, i.e., debromohymenialdisine (DBH), hymenialdisine (HD), and oroidin. Commercially available purified versions of these molecules were re-tested to assess their antiviral potential in greater detail. Specifically, DBH and HD exhibit a 30%–40% inhibition of HIV-1 at 3.1 μM and 13 μM, respectively; however, both exhibited cytotoxicity. Conversely, oroidin displayed a 50% inhibition of viral replication at 50 μM with no associated toxicity. Additional experimentation using a biochemical assay revealed that oroidin inhibited the activity of the HIV-1 Reverse Transcriptase up to 90% at 25 μM. Taken together, the chemical search space was narrowed and previously isolated compounds with an unexplored anti-viral potential were found. Our results support exploration of marine natural products for anti-viral drug discovery. PMID:26861355

  19. Alkaloids from the Sponge Stylissa carteri Present Prospective Scaffolds for the Inhibition of Human Immunodeficiency Virus 1 (HIV-1)

    KAUST Repository

    O’Rourke, Aubrie

    2016-02-04

    The sponge Stylissa carteri is known to produce a number of secondary metabolites displaying anti-fouling, anti-inflammatory, and anti-cancer activity. However, the anti-viral potential of metabolites produced by S. carteri has not been extensively explored. In this study, an S. carteri extract was HPLC fractionated and a cell based assay was used to evaluate the effects of HPLC fractions on parameters of Human Immunodeficiency Virus (HIV-1) infection and cell viability. Candidate HIV-1 inhibitory fractions were then analyzed for the presence of potential HIV-1 inhibitory compounds by mass spectrometry, leading to the identification of three previously characterized compounds, i.e., debromohymenialdisine (DBH), hymenialdisine (HD), and oroidin. Commercially available purified versions of these molecules were re-tested to assess their antiviral potential in greater detail. Specifically, DBH and HD exhibit a 30%–40% inhibition of HIV-1 at 3.1 μM and 13 μM, respectively; however, both exhibited cytotoxicity. Conversely, oroidin displayed a 50% inhibition of viral replication at 50 μM with no associated toxicity. Additional experimentation using a biochemical assay revealed that oroidin inhibited the activity of the HIV-1 Reverse Transcriptase up to 90% at 25 μM. Taken together, the chemical search space was narrowed and previously isolated compounds with an unexplored anti-viral potential were found. Our results support exploration of marine natural products for anti-viral drug discovery.

  20. Alkaloids from the Sponge Stylissa carteri Present Prospective Scaffolds for the Inhibition of Human Immunodeficiency Virus 1 (HIV-1

    Directory of Open Access Journals (Sweden)

    Aubrie O’Rourke

    2016-02-01

    Full Text Available The sponge Stylissa carteri is known to produce a number of secondary metabolites displaying anti-fouling, anti-inflammatory, and anti-cancer activity. However, the anti-viral potential of metabolites produced by S. carteri has not been extensively explored. In this study, an S. carteri extract was HPLC fractionated and a cell based assay was used to evaluate the effects of HPLC fractions on parameters of Human Immunodeficiency Virus (HIV-1 infection and cell viability. Candidate HIV-1 inhibitory fractions were then analyzed for the presence of potential HIV-1 inhibitory compounds by mass spectrometry, leading to the identification of three previously characterized compounds, i.e., debromohymenialdisine (DBH, hymenialdisine (HD, and oroidin. Commercially available purified versions of these molecules were re-tested to assess their antiviral potential in greater detail. Specifically, DBH and HD exhibit a 30%–40% inhibition of HIV-1 at 3.1 μM and 13 μM, respectively; however, both exhibited cytotoxicity. Conversely, oroidin displayed a 50% inhibition of viral replication at 50 μM with no associated toxicity. Additional experimentation using a biochemical assay revealed that oroidin inhibited the activity of the HIV-1 Reverse Transcriptase up to 90% at 25 μM. Taken together, the chemical search space was narrowed and previously isolated compounds with an unexplored anti-viral potential were found. Our results support exploration of marine natural products for anti-viral drug discovery.

  1. Novel polymorphic microsatellite markers developed for a common reef sponge, Stylissa carteri

    KAUST Repository

    Giles, E.C.

    2013-04-04

    Despite the ubiquitous role sponges play in reef ecosystem dynamics, little is known about population-level connectivity in these organisms. The general field of population genetics in sponges remains in its infancy. To date, microsatellite markers have only been developed for few sponge species and no sponge population genetics studies using microsatellites have been conducted in the Red Sea. Here, with the use of next-generation sequencing, we characterize 12 novel polymorphic loci for the common reef sponge, Stylissa carteri. The number of alleles per loci ranged between three and eight. Observed heterozygosity frequencies (Ho) ranged from 0.125 to 0.870, whereas expected (He) heterozygosity frequencies ranged from 0.119 to 0.812. Only one locus showed consistent deviations from Hardy-Weinberg equilibrium (HWE) in both populations and two loci consistently showed the possible presence of null alleles. No significant linkage disequilibrium was detected for any pairs of loci. These microsatellites will be of use for numerous ecological studies focused on this common and abundant sponge. 2013 The Author(s).

  2. Time-dependent flow fields around the spherical colonial alga Volvox carteri

    Science.gov (United States)

    Brumley, Douglas; Polin, Marco; Morez, Constant; Goldstein, Raymond; Pedley, Timothy

    2011-11-01

    Volvox carteri is a spherical colonial alga, consisting of thousands of biflagellate cells. The somatic cells embedded on the surface of the colony beat their flagella approximately towards the south pole, producing a net fluid motion. Using high-speed imaging and particle image velocimetry (PIV) we have been able to accurately analyse the time-dependent flow fields around such colonies. The somatic cells on the colony surface may beat their flagella in a perfectly synchronised fashion, or may exhibit behaviour in which the coordination wanders periodically between forward and backward propagating metachronal waves. We analyse the dependence of this synchronisation on fundamental parameters in the system such as colony radius, characterise the speed and wavelength of metachronal waves propagating on the surface, and investigate the extent to which hydrodynamic interactions are responsible for the exhibited behaviour. The time-averaged flow fields agree with previous experiments involving freely swimming colonies (Phys. Rev. Lett. 105:168101, 2010) and Blake's squirmer model (J. Fluid Mech. 46, 199-208, 1971b).

  3. Hydrodynamic synchronization of flagella on the surface of the colonial alga Volvox carteri

    Science.gov (United States)

    Brumley, Douglas; Polin, Marco; Goldstein, Raymond; Pedley, Timothy

    2012-11-01

    Whether on the surface of unicellular ciliates or in the respiratory epithelium, groups of eukaryotic cilia and flagella are capable of coordinating their beating over large scales. The mechanism responsible for the emergence of these metachronal waves is still unclear, mostly because finding an experimental system in which the beating filaments can be followed individually is challenging. We propose the multicellular green alga Volvox carteri as an ideal model system to study metachronal coordination, and report the existence of robust metachronal waves on its surface. Inspired by flagellar tip trajectories of Volvox somatic cells, we model a flagellum using a sphere of radius a elastically bound to a circular orbit of radius r0, perpendicular to a no-slip plane. This elastohydrodynamic model of weakly-coupled self-sustained oscillators can be recast in terms of interacting phase oscillators, offering an intuitive understanding of the mechanism driving the emergence of coordination. Our results confirm that elasticity is fundamental to guarantee fast and robust synchronization, and that sufficiently compliant trajectories lead to the emergence of metachronal waves in a manner essentially independent of boundary conditions.

  4. Exploring seascape genetics and kinship in the reef sponge Stylissa carteri in the Red Sea

    KAUST Repository

    Giles, Emily C.

    2015-06-01

    A main goal of population geneticists is to study patterns of gene flow to gain a better understanding of the population structure in a given organism. To date most efforts have been focused on studying gene flow at either broad scales to identify barriers to gene flow and isolation by distance or at fine spatial scales in order to gain inferences regarding reproduction and local dispersal. Few studies have measured connectivity at multiple spatial scales and have utilized novel tools to test the influence of both environment and geography on shaping gene flow in an organism. Here a seascape genetics approach was used to gain insight regarding geographic and ecological barriers to gene flow of a common reef sponge, Stylissa carteri in the Red Sea. Furthermore, a small-scale (<1 km) analysis was also conducted to infer reproductive potential in this organism. At the broad scale, we found that sponge connectivity is not structured by geography alone, but rather, genetic isolation in the southern Red Sea correlates strongly with environmental heterogeneity. At the scale of a 50-m transect, spatial autocorrelation analyses and estimates of full-siblings revealed that there is no deviation from random mating. However, at slightly larger scales (100–200 m) encompassing multiple transects at a given site, a greater proportion of full-siblings was found within sites versus among sites in a given location suggesting that mating and/or dispersal are constrained to some extent at this spatial scale. This study adds to the growing body of literature suggesting that environmental and ecological variables play a major role in the genetic structure of marine invertebrate populations.

  5. Exploring seascape genetics and kinship in the reef sponge Stylissa carteri in the Red Sea.

    Science.gov (United States)

    Giles, Emily C; Saenz-Agudelo, Pablo; Hussey, Nigel E; Ravasi, Timothy; Berumen, Michael L

    2015-07-01

    A main goal of population geneticists is to study patterns of gene flow to gain a better understanding of the population structure in a given organism. To date most efforts have been focused on studying gene flow at either broad scales to identify barriers to gene flow and isolation by distance or at fine spatial scales in order to gain inferences regarding reproduction and local dispersal. Few studies have measured connectivity at multiple spatial scales and have utilized novel tools to test the influence of both environment and geography on shaping gene flow in an organism. Here a seascape genetics approach was used to gain insight regarding geographic and ecological barriers to gene flow of a common reef sponge, Stylissa carteri in the Red Sea. Furthermore, a small-scale (<1 km) analysis was also conducted to infer reproductive potential in this organism. At the broad scale, we found that sponge connectivity is not structured by geography alone, but rather, genetic isolation in the southern Red Sea correlates strongly with environmental heterogeneity. At the scale of a 50-m transect, spatial autocorrelation analyses and estimates of full-siblings revealed that there is no deviation from random mating. However, at slightly larger scales (100-200 m) encompassing multiple transects at a given site, a greater proportion of full-siblings was found within sites versus among sites in a given location suggesting that mating and/or dispersal are constrained to some extent at this spatial scale. This study adds to the growing body of literature suggesting that environmental and ecological variables play a major role in the genetic structure of marine invertebrate populations.

  6. Time of collection and cutting sizes affect vegetative propagation of Boswellia papyrifera (Del.) Hochst through leafless branch cuttings

    NARCIS (Netherlands)

    Haile, G.; Gebrehiwot, K.; Lemenih, M.; Bongers, F.

    2011-01-01

    Boswellia papyrifera (Del) Hochst is a key dry land plant species in the Horn of Africa with high socio-economic significance in Ethiopia, Eritrea and Sudan. In recent decades, populations of this species are declining due to lack of recruitment through natural regeneration. This study investigated

  7. Genomic sequencing and microsatellite marker development for Boswellia papyrifera, an economically important but threatened tree native to dry tropical forests

    NARCIS (Netherlands)

    Addisalem, A.B.; Esselink, G.; Bongers, F.; Smulders, M.J.M.

    2015-01-01

    Microsatellite (or simple sequence repeat, SSR) markers are highly informative DNA markers often used in conservation genetic research. Next-generation sequencing enables efficient development of large numbers of SSR markers at lower costs. Boswellia papyrifera is an economically important tree spec

  8. Boswellia gum resin/chitosan polymer composites: Controlled delivery vehicles for aceclofenac.

    Science.gov (United States)

    Jana, Sougata; Laha, Bibek; Maiti, Sabyasachi

    2015-01-01

    This study was undertaken to evaluate the effect of Boswellia gum resin on the properties of glutaraldehyde (GA) crosslinked chitosan polymer composites and their potential as oral delivery vehicles for a non-steroidal anti-inflammatory drug, aceclofenac. The incorporation of resinous material caused a significant improvement in drug entrapment efficiency (∼40%) of the polymer composites. Fourier transform infrared (FTIR) spectroscopic analysis confirmed the formation of chitosan-gum resin composites and did not show any evidence of drug-polymer chemical interaction. Field emission scanning electron microscopy (FE-SEM) suggested the formation of particulate polymer composites up to chitosan:gum resin mass ratio of 1:3. Only 8-17% drug was released into HCl solution (pH 1.2) in 2h. The drug release rate of polymer composites was faster in phosphate buffer solution (pH 6.8). The composites released ∼60-68% drug load in 7h. In same duration, the drug release rate suddenly boosted up to 92% as the concentration of gum resin in the composites was raised to 80%. The drug release mechanism deviated from non-Fickian to case-II type with increasing resin concentration in the composites. Hence, GA-treated Boswellia resin-chitosan composites could be considered as alternative vehicles for oral delivery of aceclofenac.

  9. Boswellia carterii extract inhibits TH1 cytokines and promotes TH2 cytokines in vitro.

    Science.gov (United States)

    Chevrier, Marc R; Ryan, Abigail E; Lee, David Y-W; Zhongze, Ma; Wu-Yan, Zhang; Via, Charles S

    2005-05-01

    Traditional herbal formulas used to treat inflammatory arthritis in China and India include Boswellia carterii or Boswellia serrata. They both contain boswellic acids (BAs) which have been shown to exhibit anti-inflammatory and antiarthritic properties. This study tests the hypothesis that mixtures of BAs derived from B. carterii have immunomodulatory properties. B. carterii plant resin obtained from China was prepared as an ethanol extract, and the presence of seven BAs was confirmed by column chromatography, high-performance liquid chromatography, and UV laser desorption/ionization tandem mass spectroscopy. The extract was then tested for its ability to alter in vitro production of TH1 cytokines (interleukin-2 [IL-2] and gamma interferon) and TH2 cytokines (IL-4 and IL-10) by murine splenocytes. Delivery of the resin extract using ethanol as a solvent resulted in significant cellular toxicity not seen with the addition of ethanol alone. By contrast, delivery of the resin extract using a sesame oil solvent resulted in a dose-dependent inhibition of TH1 cytokines coupled with a dose-dependent potentiation of TH2 cytokines. These results indicate that a purified mixture of BAs from B. carterii plant resin exhibits carrier-dependent immunomodulatory properties in vitro.

  10. Validation of reference genes for quantitative gene expression studies in Volvox carteri using real-time RT-PCR.

    Science.gov (United States)

    Kianianmomeni, Arash; Hallmann, Armin

    2013-12-01

    Quantitative real-time reverse transcription polymerase chain reaction (qRT-PCR) is a sensitive technique for analysis of gene expression under a wide diversity of biological conditions. However, the identification of suitable reference genes is a critical factor for analysis of gene expression data. To determine potential reference genes for normalization of qRT-PCR data in the green alga Volvox carteri, the transcript levels of ten candidate reference genes were measured by qRT-PCR in three experimental sample pools containing different developmental stages, cell types and stress treatments. The expression stability of the candidate reference genes was then calculated using the algorithms geNorm, NormFinder and BestKeeper. The genes for 18S ribosomal RNA (18S) and eukaryotic translation elongation factor 1α2 (eef1) turned out to have the most stable expression levels among the samples both from different developmental stages and different stress treatments. The genes for the ribosomal protein L23 (rpl23) and the TATA-box binding protein (tbpA) showed equivalent transcript levels in the comparison of different cell types, and therefore, can be used as reference genes for cell-type specific gene expression analysis. Our results indicate that more than one reference gene is required for accurate normalization of qRT-PCRs in V. carteri. The reference genes in our study show a much better performance than the housekeeping genes used as a reference in previous studies.

  11. Cembranoids from the Gum Resin of Boswellia carterii as Potential Antiulcerative Colitis Agents.

    Science.gov (United States)

    Ren, Jin; Wang, Yan-Gai; Wang, Ai-Guo; Wu, Lian-Qiu; Zhang, Hai-Jing; Wang, Wen-Jie; Su, Ya-Lun; Qin, Hai-Lin

    2015-10-23

    Eight new cembranoids, boscartins A-H (1, 2, and 4-9), and the known incensole oxide were isolated from the gum resin of Boswellia carterii. The absolute configurations of 1, 2, 4, and incensole oxide were unequivocally resolved using single-crystal X-ray diffraction analysis with Cu Kα radiation, and the absolute configuration of 5 was resolved via electronic circular dichroism data. The antiulcerative colitis activities of the compounds were evaluated in an in vitro x-box-binding protein 1 (XBP 1) transcriptional activity assay using dual luciferase reporter detection. At 10 μM, compounds 1, 5, 6, and 7 significantly activated XBP 1 transcription with EC50 values of 0.34, 1.14, 0.88, and 0.42 μM, respectively, compared with the pGL3-basic vector control.

  12. Cooperation and conflict in the evolution of individuality. IV. Conflict mediation and evolvability in Volvox carteri.

    Science.gov (United States)

    Michod, Richard E; Nedelcu, Aurora M; Roze, Denis

    2003-05-01

    its role in mediating conflict between the two levels of selection, the cell and the cell group. We apply our theoretical framework to the evolution of germ/soma differentiation in the green algal group Volvocales. In the most complex member of the group, Volvox carteri, the potential conflicts among lower-level cells as to the "right" to reproduce the higher-level individual (i.e. the colony) have been mediated by restricting immortality and totipotency to the germ-line. However, this mediation, and the evolution of an early segregated germ-line, was achieved by suppressing mitotic and differentiation capabilities in all post-embryonic cells. By handicapping the soma in this way, individuality is ensured, but the solution has affected the long-term evolvability of this lineage. We think that although conflict mediation is pivotal to the emergence of individuality at the higher-level, the way in which the mediation is achieved can greatly affect the longer-term evolvability of the lineage.

  13. New terpenoids, olibanumols D-G, from traditional Egyptian medicine olibanum, the gum-resin of Boswellia carterii.

    Science.gov (United States)

    Morikawa, Toshio; Oominami, Hideo; Matsuda, Hisashi; Yoshikawa, Masayuki

    2011-01-01

    A new prenylaromadendrane-type diterpene, olibanumol D (1), and three new oleanane- and lupane-type triterpenes, olibanumols E (2), F (3), and G (4), were isolated from the traditional Egyptian medicine olibanum, the exuded gum-resin from Boswellia carterii Birdw. Their structures were established mainly on the basis of 1D and 2D NMR spectral data. Compounds 1 and 2 exhibited nitric oxide production inhibitory activity in lipopolysaccharide-activated mouse peritoneal macrophages.

  14. Research advances intriterpenoids constituents and pharmacological action of Boswellia carterii%乳香中三萜类化合物和药理活性的研究进展

    Institute of Scientific and Technical Information of China (English)

    孙妍; 商庆辉

    2016-01-01

    In this study, the recent progress in the research of triterpenoids and pharmacological activities of frankincense, the gum resin of Boswellia carterii or the other plants to the same species mainly consisting of chemical constituents, such as pentacyclic triterpenoid and tetracyclic triterpenoid, was reviewed. Investigations demonstrated that resin had the following pharmacological effects: anti-inflammatory, antitumor, inducing differentiation and apoptosis, anti-ulcer, hypoglycemic action, improvement on learning and memory, etc. The results also indicated that fewer adverse reactions and potential medicinal value of this material. The research will provide reference for further research of Boswellia carterii.%乳香为橄榄科植物乳香树或同属植物的胶状树脂,主要活性成分为五环三萜、四环三萜等三萜类化合物。现代药理研究表明乳香有抗炎、抗肿瘤、诱导分化凋亡、抗溃疡、降糖、改善学习记忆等药理活性,在抗炎、抗肿瘤方面药理研究较为深入,不良反应少,有潜在的药用价值。通过查阅文献,对近五年来乳香三萜类成分及其药理作用研究进展进行综述,为乳香的进一步研究提供参考。

  15. Curcumin and Boswellia serrata gum resin extract inhibit chikungunya and vesicular stomatitis virus infections in vitro.

    Science.gov (United States)

    von Rhein, Christine; Weidner, Tatjana; Henß, Lisa; Martin, Judith; Weber, Christopher; Sliva, Katja; Schnierle, Barbara S

    2016-01-01

    Chikungunya virus (CHIKV) is a mosquito-transmitted alphavirus that causes chikungunya fever and has infected millions of people mainly in developing countries. The associated disease is characterized by rash, high fever, and severe arthritis that can persist for years. CHIKV has adapted to Aedes albopictus, which also inhabits temperate regions including Europe and the United States of America. CHIKV has recently caused large outbreaks in Latin America. No treatment or licensed CHIKV vaccine exists. Traditional medicines are known to have anti-viral effects; therefore, we examined whether curcumin or Boswellia serrata gum resin extract have antiviral activity against CHIKV. Both compounds blocked entry of CHIKV Env-pseudotyped lentiviral vectors and inhibited CHIKV infection in vitro. In addition, vesicular stomatitis virus vector particles and viral infections were also inhibited to the same extent, indicating a broad antiviral activity. Although the bioavailability of these compounds is rather poor, they might be used as a lead structure to develop more effective antiviral drugs or might be used topically to prevent CHIKV spread in the skin after mosquito bites.

  16. The First Chloroplast Genome Sequence of Boswellia sacra, a Resin-Producing Plant in Oman

    Science.gov (United States)

    Khan, Abdul Latif; Al-Harrasi, Ahmed; Asaf, Sajjad; Park, Chang Eon; Park, Gun-Seok; Khan, Abdur Rahim; Lee, In-Jung; Al-Rawahi, Ahmed; Shin, Jae-Ho

    2017-01-01

    Boswellia sacra (Burseraceae), a keystone endemic species, is famous for the production of fragrant oleo-gum resin. However, the genetic make-up especially the genomic information about chloroplast is still unknown. Here, we described for the first time the chloroplast (cp) genome of B. sacra. The complete cp sequence revealed a circular genome of 160,543 bp size with 37.61% GC content. The cp genome is a typical quadripartite chloroplast structure with inverted repeats (IRs 26,763 bp) separated by small single copy (SSC; 18,962 bp) and large single copy (LSC; 88,055 bp) regions. De novo assembly and annotation showed the presence of 114 unique genes with 83 protein-coding regions. The phylogenetic analysis revealed that the B. sacra cp genome is closely related to the cp genome of Azadirachta indica and Citrus sinensis, while most of the syntenic differences were found in the non-coding regions. The pairwise distance among 76 shared genes of B. sacra and A. indica was highest for atpA, rpl2, rps12 and ycf1. The cp genome of B. sacra reveals a novel genome, which could be used for further studied to understand its diversity, taxonomy and phylogeny. PMID:28085925

  17. Effects of resin tapping and tree size on the purity, germination and storage behavior of Boswellia papyrifera (Del.) Hochst. seeds from Metema District, northwestern Ethiopia.

    NARCIS (Netherlands)

    Eshete, A.; Teketay, D.; Lemenih, M.; Bongers, F.

    2012-01-01

    Boswellia papyrifera (Del.) Hochst. is one of the tree species in dry woodlands of Ethiopia that provides several goods and services. Despite its wide economic and ecological importance, its area coverage is dwindling from time to time, and its natural regeneration is hampered. Hence, long-term pros

  18. Four new ursane-type triterpenes, olibanumols K, L, M, and N, from traditional egyptian medicine olibanum, the gum-resin of Boswellia carterii.

    Science.gov (United States)

    Morikawa, Toshio; Oominami, Hideo; Matsuda, Hisashi; Yoshikawa, Masayuki

    2010-11-01

    Four new ursane-type triterpenes, olibanumols K (1), L (2), M (3), and N (4), were isolated from traditional Egyptian medicine olibanum, the exuded gum-resin from Boswellia carterii BIRDW. Their structures were elucidated on the basis of chemical and physicochemical evidence.

  19. Larvicidal activity of Annona senegalensis and Boswellia dalzielii leaf fractions against Aedes aegypti (Diptera: Culicidae

    Directory of Open Access Journals (Sweden)

    Younoussa Lame

    2014-12-01

    Full Text Available The purpose of the present study was to evaluate the larvicidal activity of leaf fractions of Annona senegalensis and Boswellia dalzielii against fourth instar larvae of Aedes aegypti. Fourth instar larvae of Ae. aegypti were exposed for 24 hours to various concentrations (312.5-2500 mg/L of methanolic crude extract and its fractions obtained with n-hexane, chloroform, ethyl-acetate and methanol solvents, following WHO method. The mortalities recorded were subjected to ANOVA test for mean comparison and Probit analysis to determine LC50. Preliminary phytochemical screening test for some components of the plants assessed were also evaluated. The phytochemical screening of the two plants revealed the presence of alkaloids, steroids, phenolic compounds, terpenoids, fats and oils in the crude extracts which, after splitting were most distributed in n-hexane and chloroform fractions. Apart from methanol fraction, all products used showed a significant (P<0.001 concentration-dependent toxicity against Ae. aegypti larvae. The LC50 recorded with crude extract were 759.6 and 830.4 mg/L for A. senegalensis and B. dalzielli respectively. After fractionation, n-hexane and chloroform fractions of A. senegalensis revealed more effective activity than others with CL50 values of 379.3 and 595.2 mg/L respectively. As for B. dalzielli, n-hexane (LC50=537.1 mg/L and chloroform (LC50=585.5 mg/L fractions were also the most effective. These results suggest that the n-hexane and chloroform fractions of these plants as a promising larvicide against Ae. aegypti and can constitute the best basic and vital step in the development of a botanical insecticide source.

  20. Antistaphylococcal and biofilm inhibitory activities of acetyl-11-keto-β-boswellic acid from Boswellia serrata

    Directory of Open Access Journals (Sweden)

    Arora Daljit S

    2011-03-01

    Full Text Available Abstract Background Boswellic acids are pentacyclic triterpenes, which are produced in plants belonging to the genus Boswellia. Boswellic acids appear in the resin exudates of the plant and it makes up 25-35% of the resin. β-boswellic acid, 11-keto-β-boswellic acid and acetyl-11-keto-β-boswellic acid have been implicated in apoptosis of cancer cells, particularly that of brain tumors and cells affected by leukemia or colon cancer. These molecules are also associated with potent antimicrobial activities. The present study describes the antimicrobial activities of boswellic acid molecules against 112 pathogenic bacterial isolates including ATCC strains. Acetyl-11-keto-β-boswellic acid (AKBA, which exhibited the most potent antibacterial activity, was further evaluated in time kill studies, postantibiotic effect (PAE and biofilm susceptibility assay. The mechanism of action of AKBA was investigated by propidium iodide uptake, leakage of 260 and 280 nm absorbing material assays. Results AKBA was found to be the most active compound showing an MIC range of 2-8 μg/ml against the entire gram positive bacterial pathogens tested. It exhibited concentration dependent killing of Staphylococcus aureus ATCC 29213 up to 8 × MIC and also demonstrated postantibiotic effect (PAE of 4.8 h at 2 × MIC. Furthermore, AKBA inhibited the formation of biofilms generated by S. aureus and Staphylococcus epidermidis and also reduced the preformed biofilms by these bacteria. Increased uptake of propidium iodide and leakage of 260 and 280 nm absorbing material by AKBA treated cells of S aureus indicating that the antibacterial mode of action of AKBA probably occurred via disruption of microbial membrane structure. Conclusions This study supported the potential use of AKBA in treating S. aureus infections. AKBA can be further exploited to evolve potential lead compounds in the discovery of new anti-Gram-positive and anti-biofilm agents.

  1. Effects of Boswellia Papyrifera Gum Extract on Learning and Memory in

    Directory of Open Access Journals (Sweden)

    Amir Farshchi

    2010-04-01

    Full Text Available Objective(sLearning is defined as the acquisition of information and skills, while subsequent retention of that information is called memory. The objective of the present study was to investigate the effect of aqueous extract of Boswellia papyrifera on learning and memory paradigms in mice and rats.Materials and MethodsThis study was held at the Department of Pharmacology, Faculty of Pharmacy, Kermanshah University of Medical Science, Kermanshah, Iran from September 2006 to March 2008. Male Wistar rats and male NMRI mice were randomly divided into control, B. papyrifera treated (50, 100, 150 mg/kg, p.o., and piracetam (150 mg/kg groups. Radial arm maze (RAM and Morris water maze (MWM were the screening tests used to assess the activity of B. papyrifera extract.ResultsThe mice treated with B. papyrifera (50, 100 and 150 mg/kg or piracetam (150 mg/kg showed a decrease in number of days required to learned (P< 0.05 and time taken to find food by the learned mice in radial arm maze (P< 0.01. In Morris water maze, rats treated with the above mentioned doses showed dose dependent improvement in spatial learning. Escape latency during swimming in water maze in piracetam and B. papyrifera treated animals was significantly lower (P< 0.01 than control. Swimming distance was also significantly lower (P< 0.05 in the treated groups.Conclusion The results show facilitation of spatial learning and memory processes and thereby validate B. papyrifera traditional use of intelligence improving. The presence of alkaloids, flavonoids and saponins might be responsible for this activity of B. papyrifera.

  2. A randomized, double blind, placebo controlled, cross over study to evaluate the analgesic activity of Boswellia serrata in healthy volunteers using mechanical pain model

    Directory of Open Access Journals (Sweden)

    K Prabhavathi

    2014-01-01

    Full Text Available Objective: Experimental pain models in human healthy volunteers are advantageous for early evaluation of analgesics. All efforts to develop nonsteroidal anti-inflammatory drugs (NSAIDs which are devoid of gastrointestinal and cardiovascular system effects are still far from achieving a breakthrough. Hence we evaluated the analgesic activity of an ayurvedic drug, Boswellia serrata by using validated human pain models which has shown its analgesic activity both in-vitro and preclinical studies to evaluate the analgesic activity of single oral dose (125 mg, 2 capsules of Boswellia serrata compared to placebo using mechanical pain model in healthy human subjects. Materials and Methods: After taking written informed consent, twelve healthy subjects were randomized (1:1 to receive single oral dose of Boswellia serrata (Shallaki® 125 mg, 2 capsules or identical placebo in a crossover design. Mechanical pain was assessed using Ugo basile analgesymeter (by Randall Selitto test at baseline and at 1 hr, 2 hrs and 3 hrs after test drug administration. Pain Threshold force and time and Pain Tolerance force and time were evaluated. Statistical analysis was done by paired t-test. Results : Twelve healthy volunteers have completed the study. Mean percentage change from baseline in Pain Threshold force and time with Boswellia serrata when compared to placebo had significantly increased [Force: 9.7 ± 11.0 vs 2.9 ± 3.4 (P = 0.05 and time: 9.7 ± 10.7 vs 2.8 ± 3.4 (P = 0.04] at third hr. Mean Percentage change from baseline in Pain Tolerance force and time with Boswellia serrata when compared to placebo had significantly (P ≤ 0.01 increased at 1 hr, 2 hrs and 3 hrs. Conclusion : In the present study, Boswellia serrata significantly increased the Pain Threshold and Pain Tolerance force and time compared to placebo. Both study medications were well tolerated. Further multiple dose studies may be needed to establish the analgesic efficacy of the drug.

  3. Phytochemical Analysis and Anti-cancer Investigation of Boswellia serrata Bioactive Constituents In Vitro.

    Science.gov (United States)

    Ahmed, Hanaa H; Abd-Rabou, Ahmed A; Hassan, Amal Z; Kotob, Soheir E

    2015-01-01

    Cancer is a major health obstacle around the world, with hepatocellular carcinoma (HCC) and colorectal cancer (CRC) as major causes of morbidity and mortality. Nowadays, there isgrowing interest in the therapeutic use of natural products for HCC and CRC, owing to the anticancer activity of their bioactive constituents. Boswellia serrata oleo gum resin has long been used in Ayurvedic and traditional Chinese medicine to alleviate a variety of health problems such as inflammatory and arthritic diseases. The current study aimed to identify and explore the in vitro anticancer effect of B. Serrata bioactive constituents on HepG2 and HCT 116 cell lines. Phytochemical analysis of volatile oils of B. Serrata oleo gum resin was carried out using gas chromatography- mass spectrometry (GC/MS). Oleo-gum-resin of B. Serrata was then successively extracted with petroleum ether (extract 1) and methanol (extract 2). Gas-liquid chromatography (GLC) analysis of the lipoidal matter was also performed. In addition, a methanol extract of B. Serrata oleo gum resin was phytochemically studied using column chromatography (CC) and thin layer chromatography (TLC) to obtain four fractions (I, II, III and IV). Sephadex columns were used to isolate β-boswellic acid and identification of the pure compound was done using UV, mass spectra, 1H NMR and 13C NMR analysis. Total extracts, fractions and volatile oils of B. Serrata oleo-gum resin were subsequently applied to HCC cells (HepG2 cell line) and CRC cells (HCT 116 cell line) to assess their cytotoxic effects. GLC analysis of the lipoidal matter resulted in identification of tricosane (75.32%) as a major compound with the presence of cholesterol, stigmasterol and β-sitosterol. Twenty two fatty acids were identified of which saturated fatty acids represented 25.6% and unsaturated fatty acids 74.4% of the total saponifiable fraction. GC/MS analysis of three chromatographic fractions (I,II and III) of B. Serrata oleo gum resin revealed the

  4. Synthesis, characterization, and evaluation of the antimicrobial efficacy of Boswellia ovalifoliolata stem bark-extract-mediated zinc oxide nanoparticles

    Science.gov (United States)

    Supraja, N.; Prasad, T. N. V. K. V.; Krishna, T. Giridhara; David, E.

    2016-04-01

    Synthesis of metal nanoparticles using biological systems is an expanding research area in nanotechnology. Moreover, search for new nanoscale antimicrobials is been always attractive as they find numerous avenues for application in medicine. Biosynthesis of metallic nanoparticles is cost effective and eco-friendly compared to those of conventional methods of nanoparticles synthesis. Herein, we present the synthesis of zinc oxide nanoparticles using the stem bark extract of Boswellia ovalifoliolata, and evaluation of their antimicrobial efficacy. Stable ZnO nanoparticles were formed by treating 90 ml of 1 mM zinc nitrate aqueous solution with 10 ml of 10 % bark extract. The formation of B. ovalifoliolata bark-extract-mediated zinc oxide nanoparticles (BZnNPs) was confirmed by UV-visible spectroscopic analysis and recorded the localized surface plasmon resonance (LSPR) at 230 nm. Fourier transform infrared spectroscopic (FT-IR) analysis revealed that primary and secondary amine groups in combination with the proteins present in the bark extract are responsible for the reduction and stabilization of the BZnNPs. The morphology and crystalline phase of the nanocrystals were determined by Transmission electron microscopy (TEM). The hydrodynamic diameter (20.3 nm) and a positive zeta potential (4.8 mV) were measured using the dynamic light scattering technique. The antimicrobial activity of BZnNPs was evaluated (in vitro) against fungi, Gram-negative, and Gram-positive bacteria using disk diffusion method which were isolated from the scales formed in drinking water PVC pipelines.

  5. Macronutrient uptake and carotenoid/chlorophyll a ratio in the dinoflagellate Amphidinium carteri Hulburt, cultured under different nutrient and light conditions Consumo de macronutrientes y proporción de carotenoides/clorofila a en el dinoflagelado Amphidinium carteri Hulburt, cultivado bajo diferentes condiciones de luz y nutrientes

    Directory of Open Access Journals (Sweden)

    Enrique Valenzuela-Espinoza

    2011-04-01

    Full Text Available Population growth, macronutrient (, uptake and carotenoids/chlorophyll a ratio we determined in Amphidinium carteri Hulburt, cultured under conditions of continuous light (50, 150, 300 and 750 μmol quanta m-2 s-1 and three nutrient concentrations NaNO3/NaH2PO4 at 441.5/18.1 μM (low 883/36.3 μM (medium and 1766/72.6 μM (high. Both nutrient and irradiance had a significant effect (p 0.05. In cultures under low nutrient condition, NO- and PO4- were almost depleted by the fifth day and in cultures with medium nutrient this condition occurred in the sixth day; whereas, at high nutrient condition the nutrients were not depleted. We concluded that A. carteri had higher growth rates and nutrient consumption at 300 μmol quanta m-2 s-1 during the first five days and in general the effect of nutrients on the pigment ratios was not significant (p > 0.05. However, the average peridinin/Chla ratio decreased up to 72% from the lowest and the highest irradiance. The opposite was observed for the average of diadinoxanthin/Chla ratio that increased almost two-fold, and the averages dinoxanthin and diatoxanthin to Chla ratios that increased from low to high irradiances. The average diatoxanthin/Chla ratio at 750 μmol quanta m-2 s-1 increased up to 2.7-fold from the exponential to the stationary phase only in the low and medium nutrient concentration. Likewise, the average peridinin, dinoxanthin and diatoxanthin to Chla ratios were not significantly different at 50 and 150 μmol quanta m-2 s-1. These results indicate important changes in average carotenoids/Chla ratios in A. carteri cultured under different irradiances.Se evaluaron el crecimiento poblacional, consumo de macronutrientes (, y proporción de carotenoides/clorofila a en Amphidinium carteri Hulburt, cultivado durante 7 días, bajo condiciones de luz continua: 50, 150, 300 y 750 μmol quanta m-2 s-1 y tres concentraciones de nutrientes NaNO3/NaH2PO4 (441.5/18.1 μM (bajo; 883/36.3 μM (medio y 1766

  6. Caspase Mediated Synergistic Effect of Boswellia serrata Extract in Combination with Doxorubicin against Human Hepatocellular Carcinoma

    Directory of Open Access Journals (Sweden)

    Mohammad Ahmed Khan

    2014-01-01

    Full Text Available The study investigated the growth-inhibiting and apoptosis mediating effects of B. serrata extract as monotherapy and combination therapy with DOX against hepatocellular carcinoma cell lines. Boswellic acid rich fraction of B. serrata extract was prepared. MTT assay on HepG2 and Hep3B cells was carried out using B. serrata alone and in combination with DOX. Further, caspase-3 activity, TNF-α level, and IL-6 level were estimated. Isobolographic analysis was carried out to evaluate the effect of combination therapy. Additionally, protective effect of B. serrata extract on DOX induced hepatic toxicity was also evaluated in Wistar rats. B. serrata extract inhibited growth of HepG2 (IC50 value of 21.21±0.92 μg/mL as well as HepG2 (IC50 value of 18.65±0.71 μg/mL. DOX inhibited growth in HepG2 and Hep3B cells with an IC50 of 1.06±0.04 μg/mL and 1.92±0.09 μg/mL. Isobolographic analysis showed combination index (CI of DOX and B. serrata extract of 0.53±0.03 to 0.79±0.02 suggesting synergistic behavior against the two cell lines. B. serrata extract also caused dose dependent increase in caspase-3 activity, TNF-α level, and IL-6 level which was higher (P<0.001 with DOX (1 μM and B. serrata extract (20 μg/mL combination. B. serrata extract also protected Wistar rats against DOX induced hepatic toxicity.

  7. Caspase Mediated Synergistic Effect of Boswellia serrata Extract in Combination with Doxorubicin against Human Hepatocellular Carcinoma

    Science.gov (United States)

    Khan, Mohammad Ahmed; Singh, Mhaveer; Khan, Masood Shah; Najmi, Abul Kalam

    2014-01-01

    The study investigated the growth-inhibiting and apoptosis mediating effects of B. serrata extract as monotherapy and combination therapy with DOX against hepatocellular carcinoma cell lines. Boswellic acid rich fraction of B. serrata extract was prepared. MTT assay on HepG2 and Hep3B cells was carried out using B. serrata alone and in combination with DOX. Further, caspase-3 activity, TNF-α level, and IL-6 level were estimated. Isobolographic analysis was carried out to evaluate the effect of combination therapy. Additionally, protective effect of B. serrata extract on DOX induced hepatic toxicity was also evaluated in Wistar rats. B. serrata extract inhibited growth of HepG2 (IC50 value of 21.21 ± 0.92 μg/mL) as well as HepG2 (IC50 value of 18.65 ± 0.71 μg/mL). DOX inhibited growth in HepG2 and Hep3B cells with an IC50 of 1.06 ± 0.04 μg/mL and 1.92 ± 0.09 μg/mL. Isobolographic analysis showed combination index (CI) of DOX and B. serrata extract of 0.53 ± 0.03 to 0.79 ± 0.02 suggesting synergistic behavior against the two cell lines. B. serrata extract also caused dose dependent increase in caspase-3 activity, TNF-α level, and IL-6 level which was higher (P < 0.001) with DOX (1 μM) and B. serrata extract (20 μg/mL) combination. B. serrata extract also protected Wistar rats against DOX induced hepatic toxicity. PMID:25177685

  8. Absolute stereostructures of olibanumols A, B, C, H, I, and J from olibanum, gum-resin of Boswellia carterii, and inhibitors of nitric oxide production in lipopolysaccharide-activated mouse peritoneal macrophages.

    Science.gov (United States)

    Yoshikawa, Masayuki; Morikawa, Toshio; Oominami, Hideo; Matsuda, Hisashi

    2009-09-01

    Three new monoterpenes, olibanumols A (1), B (2), and C (3), and three new triterpenes, olibanumols H (4), I (5), and J (6), were isolated from olibanum, the exuded gum-resin from Boswellia carterii BIRDW. Their structures including the absolute configuration were determined by chemical and physicochemical evidence. Among the constituents, olibanumols A (1), H (4), and I (5), and isofouquierol (12) exhibited nitric oxide production inhibitory activity in lipopolysaccharide-activated mouse peritoneal macrophages.

  9. Characterization of 3alpha-acetyl-11-keto-alpha-boswellic acid, a pentacyclic triterpenoid inducing apoptosis in vitro and in vivo.

    Science.gov (United States)

    Büchele, Berthold; Zugmaier, Waltraud; Estrada, Aidee; Genze, Felicitas; Syrovets, Tatiana; Paetz, Christian; Schneider, Bernd; Simmet, Thomas

    2006-11-01

    3Alpha-acetyl-11-keto-alpha-boswellic acid (3alpha-acetoxy-11-oxo-olean-12-en-24-oic acid, 1) was synthesized by a radical-type reaction using bromine and 3alpha-acetyl-alpha-boswellic acid isolated from the oleo-gum-resin of Boswellia carterii. 1D and 2D NMR (COSY, HMBC, ROESY) at 500 MHz were used for shift assignments and structure verification. The compound investigated is present in a herbal preparation extracted from Boswellia serrata oleo-gum-resin, it inhibits the growth of chemotherapy-resistant human PC-3 prostate cancer cells in vitro and induces apoptosis as shown by activation of caspase 3 and the induction of DNA fragmentation. In addition, compound 1 is active IN VIVO as shown by inhibition of proliferation and induction of apoptosis in PC-3 prostate cancer cells xenotransplanted onto the chick chorioallantoic membrane.

  10. Entomophily, ornithophily and anemochory in the self-incompatible Boswellia ovalifoliolata Bal. & Henry (Burseraceae, an endemic and endangered medicinally important tree species

    Directory of Open Access Journals (Sweden)

    A.J.S. Raju

    2012-07-01

    Full Text Available Boswellia ovalifoliolata (Burseraceae is a narrow endemic and endangered deciduous tree species. Its flowering, fruiting and seed dispersal events occur in a leafless state during the dry season. The flowers are small, bisexual, mildly odoriferous and actinomorphic; weakly protandrous but strictly self-incompatible. While insects and sunbirds pollinate the flowers, floral characteristics suggest that entomophily is the principal mode. Both bud and flower feeding by a weevil and flower and fruit feeding by the Palm Squirrel have been found to affect the success of sexual reproduction. The Garden Lizard serves as a predator of pollinating insects, especially bees and wasps, thus influencing pollination of this tree species. Fruit set in open pollination is below 10%, rising to 34% in manual cross-pollination. Limitation of cross-pollination, space constraints for seed production from all flower ovules and availability of limited resources in rocky, dry litter of the forest floor appear to constrain higher fruit set. Mature fruits dehisce and disseminate their lightweight, papery winged seeds with the aid of wind. The study site being windy provides the necessary driving force for effective dispersal of seeds away from parent trees. Seed germination occurs following rainfall but further growth depends on soil water and nutritional status. The success rate of seedling recruitment is highly limited, and it could be due to nutrient-poor soil and water stress resulting from dry spells during the rainy season.

  11. Composition and antibacterial activity of the essential oils of four commercial grades of Omani luban, the oleo-gum resin of Boswellia sacra FLUECK.

    Science.gov (United States)

    Al-Saidi, Salim; Rameshkumar, K B; Hisham, Abdulkhader; Sivakumar, Nallusamy; Al-Kindy, Salma

    2012-03-01

    The essential oil compositions of four botanically certified and commercially available samples of Omani lubans (oleo-gum resins of Boswellia sacra Flueck.), locally known as Hoojri, Najdi, Shathari, and Shaabi in Jibali Arabic, obtained from plants growing in four different geographic locations of the Dhofar region of Oman, were analyzed by GC-FID, GC/MS, and (13) C-NMR spectroscopy. The market price of these four grades of lubans differed considerably, according to their color, clump size, and texture. However, this study revealed that Hoojri, the first grade luban, and Shaabi, the fourth grade luban, which greatly differed in their price, closely resembled each other in their essential oil composition, yield, and physicochemical characteristics, except the color and texture. The composition, yield, and specific rotation of the oils of Najdi and Shathari, the second and the third grade lubans, respectively, were different from those of Hoojri and Shaabi, but they both had high limonene contents. Najdi oil was different from the other three oils in terms of its high myrcene content. α-Pinene was the principal component in all the oils and can be considered as a chemotaxonomical marker that confirms the botanical and geographical source of the resins. All the oils showed pronounced activity against a panel of bacteria, and the trend in their bioactivity and their mode of action are discussed.

  12. Micropropagation and non-steroidal anti-inflammatory and anti-arthritic agent boswellic acid production in callus cultures of Boswellia serrata Roxb.

    Science.gov (United States)

    Nikam, Tukaram D; Ghorpade, Ravi P; Nitnaware, Kirti M; Ahire, Mahendra L; Lokhande, Vinayak H; Chopra, Arvind

    2013-01-01

    Micropropagation through cotyledonary and leaf node and boswellic acid production in stem callus of a woody medicinal endangered tree species Boswellia serrata Roxb. is reported. The response for shoots, roots and callus formation were varied in cotyledonary and leafy nodal explants from in vitro germinated seeds, if inoculated on Murshige and Skoog's (MS) medium fortified with cytokinins and auxins alone or together. A maximum of 8.0 ± 0.1 shoots/cotyledonary node explant and 6.9 ± 0.1 shoots/leafy node explants were produced in 91 and 88 % cultures respectively on medium with 2.5 μM 6-benzyladenine (BA) and 200 mg l(-1) polyvinylpyrrolidone (PVP). Shoots treated with 2.5 μM IBA showed the highest average root number (4.5) and the highest percentage of rooting (89 %). Well rooted plantlets were acclimatized and 76.5 % of the plantlets showed survival upon transfer to field conditions. Randomly amplified polymorphic DNA (RAPD) analysis of the micropropagated plants compared with mother plant revealed true-to-type nature. The four major boswellic acid components in calluses raised from root, stem, cotyledon and leaf explants were analyzed using HPLC. The total content of four boswellic acid components was higher in stem callus obtained on MS with 15.0 μM IAA, 5.0 μM BA and 200 mg l(-1) PVP. The protocol reported can be used for conservation and exploitation of in vitro production of medicinally important non-steroidal anti-inflammatory metabolites of B. serrata.

  13. Non-timber forest product (NTFP) extraction in arid environments: Land-use change, frankincense production and the sustainability of Boswellia sacra in Dhofar (Oman)

    Science.gov (United States)

    Farah, Mohamud Haji

    Frankincense, a much revered non-timber forest product (NTFP) known as luban in Oman, is a gum-resin extracted from Boswellia sacra (meqerot). In Oman, B. sacra is endemic to ecological zones in and around Dhofar's southern mountain ranges of Jabal Samhan, Jabal Qamar and Jabal Qara. Hojar (Samhan Nejd), Nejd (Qara Nejd), Shazr (Qamar Nejd) and Sha'b are the four B. sacra ecological zones. A suffix (i) after the name (i.e. Hojari or Samhan Nejdi) is indicative of the luban produced in or associated with the respective zone. Traditional Omani B. sacra ownership, management, organization, and frankincense extraction are based on a land parcel system known as menzela. The 1970's oil boom attracted rural labor to urban and oil operation centers in Dhofar and other provinces, thus creating a labor shortage that had a profound transformative impact on frankincense production. This transformation caused frankincense extraction to evolve from an Omani-controlled system to a Somali-dominated hybrid system. Migrant Somali harvesters predominantly control the production and processing of frankincense in the field. Similarly, wholesalers occupy the next rung up the production ladder are the most powerful players in the frankincense industry. Dhofar has a long history of non-timber forest product (NTFP) extraction. From April to mid-June 1999, luban production in the Hojari/Nejdi zone of the study area was estimated at 8,710 kg with a seasonal projection of 24,840kg-30,360kg. B. sacra, a single or multiple stem shrub restricted to wadis in arid environments in or around the Dhofar Mountains, can be found at elevations from 60m above sea level in Wadi Adonib on the coastal plains to 1,770m above sea level in Wadi Kharish (a branch of Wadi Qobyr) in jabal Samhan). Land-use and landcover changes in Dhofar are threatening the fragile stability of B. sacra habitats. Frankincense trees on easily accessible flat or gently sloping terrain are susceptible to stress and mortality from

  14. Effects of the Four-Herb Compound ANBP on Wound Healing Promotion in Diabetic Mice.

    Science.gov (United States)

    Hou, Qian; He, Wen-Jun; Chen, Li; Hao, Hao-Jie; Liu, Jie-Jie; Dong, Liang; Tong, Chuan; Li, Mei-Rong; Zhou, Zhong-Zhi; Han, Wei-Dong; Fu, Xiao-Bing

    2015-12-01

    Wound healing is a troublesome problem in diabetic patients. Besides, there is also an increased risk of postsurgical wound complications for diabetic patient. It has been revealed that traditional Chinese medicine may promote healing and inhibit scar formation, while the changes of morphology and physiology of wounds on such medicine treatment still remain elusive. In this study, we first used the ultralow temperature preparation method to produce mixed superfine powder from Agrimonia pilosa (A), Nelumbo nucifera (N), Boswellia carteri (B), and Pollen typhae (P), named as ANBP. Applying ANBP on 40 streptozotocin (STZ)-induced diabetic C57BL/6 mice (4-6 weeks, 20 ± 2 g), we observed that the wound healing process was accelerated and the wound healing time was shortened (14 days, P wound healing, promote vascularization, and inhibit inflammation, suggesting the potential clinic application of ANBP for diabetes mellitus and refractory wounds.

  15. 乳香提取物固体纳米脂质微粒的制备与性能研究%Preparation and performance of solid lipid nanoparticles from Boswellia carterii Birdw extract

    Institute of Scientific and Technical Information of China (English)

    闫广义; 李玢洁; 白林凤; 许菁; 王雪梅

    2015-01-01

    Solid lipid nanoparticles from Boswellia carterii Birdw extract (BCBE -SLN )were prepared via high shear ultrasonic emulsification. Suitable conditions for the preparation were obtained via experiments investigating the changes of shear rate,emulsifying temperature and composition of the ingredient mixture. The particle size,Zeta potential and the morphological characteristics of the BCBE-SLN product were characterized, and the centrifugal stability,storage stability,dilution stability were examined. The percutaneous absorption in vitro test was conducted. Results showed that the average particle size of BCBE-SLN achieves 70.6 nm,PDI is 0.388 ,and Zeta potential is -20.0 mV under the condition as:emulsion temperature is 60 ℃;mass fractions of emulsifiers A-25 and BC -20 are both 0.5%;and those of BCBE and lipid material are both 1.0%;the shear rate is 13 000 r/min for 3 min. The skin permeability of the BCBE-SLN product is good;moreover,the centrifugal,storage and dilution stability of the BCBE-SLN product are also good.%采用高剪切超声乳化法制备乳香提取物固体纳米脂质微粒(BCBE-SLN),通过改变剪切速率、乳化温度和配方组成,得出适宜的制备条件;对所得产品的粒径、Zeta电位及形貌进行了表征;研究了其离心、储存及稀释稳定性;并对其进行体外经皮试验。结果表明:在乳化温度为60℃,乳化剂鲸蜡醇聚醚-20(BC-20)和硬脂醇聚氧乙烯醚-25(A-25)的质量分数均为0.5%,脂质原料和乳香提取物的质量分数均为1.0%,剪切速率为13000 r/min,剪切时间为3 min时,制备的BCBE-SLN的平均粒径为70.6 nm,多分散指数(PDI)为0.388,Zeta电位为-20.0 mV,产品有很好的皮肤渗透性,并具备良好的离心、储存及稀释稳定性。

  16. Boswellic acid acetate induces differentiation and apoptosis in leukemia cell lines.

    Science.gov (United States)

    Jing, Y; Nakajo, S; Xia, L; Nakaya, K; Fang, Q; Waxman, S; Han, R

    1999-01-01

    Boswellic acid acetate (BC-4), a compound isolated from the herb Boswellia carterii Birdw., can induce differentiation and apoptosis of leukemia cells. Based on cell morphology and NBT reduction, BC-4 induced monocytic differentiation of myeloid leukemia HL-60, U937 and ML-1 cells at a dose under 12.5 microg/ml (24.2 microM). BC-4 was a potent inducer, with 90% of the cells showing morphologic changes and 80-90% of the cells showing NBT reduction. Specific and non-specific esterase were also increased by BC-4. Based on benzidine staining assay, BC-4 failed to induce erythroid leukemia DS-19 and K562 cells differentiation. In contrast to its selective differentiation effect, BC-4 strongly inhibited growth of all cell lines tested. The growth inhibition effect was dose- and time-dependent. In HL-60 cells, 20 microg/ml (38.8 microM) of BC-4 decreased viable cell number by 60% at 24 h, whereas at 3 days there was virtually no viable cells. Morphologic and DNA fragmentation analysis proved that BC-4 induced cell apoptosis. The dual apoptotic and differentiation effects of BC-4 suggest that it may be a powerful agent in the treatment of leukemia.

  17. Chemotaxonomic investigations on resins of the frankincense species Boswellia papyrifera, Boswellia serrata and Boswellia sacra, respectively, Boswellia carterii : a qualitative and quantitative approach by chromatographic and spectroscopic methodology

    OpenAIRE

    Paul, Michael

    2012-01-01

    Extracts from the resin exudates of the frankincense tree again returned into the focus of pharmacological research within the last 20 years. So far, several research groups reported on promising anti-inflammatory, anti-microbial and even anti-tumour effects (in vitro and in vivo). The Boswellic acids are regarded as one of the most potent active agents thereof. However, the resins still contain innumerable amounts of terpenoid compounds. Their interactions, when administered as an extract, a...

  18. Stilbene glycosides are natural product inhibitors of FGF-2-induced angiogenesis

    Directory of Open Access Journals (Sweden)

    Naz Humera

    2009-04-01

    Full Text Available Abstract Background Angiogenesis, the growth of new blood vessels from the pre-existing vasculature is associated with pathological processes, in particular tumour development, and is a target for the development of new therapies. We have investigated the anti-angiogenic potential of two naturally occurring stilbene glycosides (compounds 1 and 2 isolated from the medicinal plant Boswellia papyriferai using large and smallvessel-derived endothelial cells. Compound 1 (trans-4',5'-dihydroxy-3-methoxystilbene-5-O-{α-L-rhamnopyranosyl-(1→2-[α-L-rhamnopyranosyl-(1→6}-β-D-glucopyranoside was the more hydrophilic and inhibited FGF-2-induced proliferation, wound healing, invasion in Matrigel, tube formation and angiogenesis in large and small vessel-derived endothelial cells and also in the chick chorioallantoic membrane assay. Using a binding assay we were able to show compound 1 reduced binding of FGF-2 to fibroblast growth factor receptors-1 and -2. In all cases the concentration of compound 1 which caused 50% inhibition (IC50 was determined. The effect of compound 1 on EGF and VEGF-induced proliferation was also investigated. Results Compound 1 inhibited all stages of FGF-2 induced angiogenesis with IC50 values in the range 5.8 ± 0.18 – 48.90 ± 0.40 μM but did not inhibit EGF or VEGF-induced angiogenesis. It also inhibited FGF-2 binding to FGF receptor-1 and -2 with IC50 values of 5.37 ± 1.04 and 9.32 ± 0.082 μM respectively and with concommotant down-regulation of phosphorylated-ERK-1/-2 expression. Compound 2 was an ineffective inhibitor of angiogenesis despite its structural homology to compound 1. Conclusion Compound 1 inhibited FGF-2 induced angiogenesis by binding to its cognate receptors and is an addition to the small number of natural product inhibitors of angiogenesis

  19. Inhibition of LPS-induced TNF-α and NO production in mouse macrophage and inflammatory response in rat animal models by a novel Ayurvedic formulation, BV-9238.

    Science.gov (United States)

    Dey, Debendranath; Chaskar, Sunetra; Athavale, Nitin; Chitre, Deepa

    2014-10-01

    Rheumatoid arthritis is a chronic crippling disease, where protein-based tumor necrosis factor-alpha (TNF-α) inhibitors show significant relief, but with potentially fatal side effects. A need for a safe, oral, cost-effective small molecule or phyto-pharmaceutical is warranted. BV-9238 is an Ayurvedic poly-herbal formulation containing specialized standardized extracts of Withania somnifera, Boswellia serrata, Zingiber officinale and Curcuma longa. The anti-inflammatory and anti-arthritic effects of BV-9238 were evaluated for inhibition of TNF-α and nitric oxide (NO) production, in lipopolysaccharide-stimulated, RAW 264.7, mouse macrophage cell line. BV-9238 reduced TNF-α and NO production, without any cytotoxic effects. Subsequently, the formulation was tested in adjuvant-induced arthritis (AIA) and carrageenan-induced paw edema (CPE) rat animal models. AIA was induced in rats by injecting Freund's complete adjuvant intra-dermally in the paw, and BV-9238 and controls were administered orally for 21 days. Arthritic scores in AIA study and inflamed paw volume in CPE study were significantly reduced upon treatment with BV-9238. These results suggest that the anti-inflammatory and anti-arthritic effects of BV-9238 are due to its inhibition of TNF-α, and NO, and this formulation shows promise as an alternate therapy for inflammatory disorders where TNF-α and NO play important roles.

  20. Frankincense tapping reduces the carbohydrate storage of Boswellia trees

    NARCIS (Netherlands)

    Mengistu, T.; Sterck, F.J.; Fetene, M.; Bongers, F.

    2013-01-01

    Carbohydrates fixed by photosynthesis are stored in plant organs in the form of starch or sugars. Starch and sugars sum to the total non-structural carbohydrate pool (TNC) and may serve as intermediate pools between assimilation and utilization. We examined the impact of tapping on TNC concentration

  1. Manage or convert Boswellia woodlands? Can frankincense production payoff?

    NARCIS (Netherlands)

    Dejene, T.; Lemenih, M.; Bongers, F.

    2013-01-01

    African dry forests provide non-timber forest products (NTFPs) of high commercial value, such as frankincense and gum arabic. Nonetheless, their deforestation and conversion to croplands is intensifying. Expected higher financial return from crop production is a main driver of conversion, but resear

  2. The effect of Frankincense in the treatment of moderate plaque-induced gingivitis: a double blinded randomized clinical trial

    Directory of Open Access Journals (Sweden)

    M Chitsazan

    2011-10-01

    Full Text Available "n  Background and the purpose of the Study: Extract of Boswellia Serrata species has been used in the Indian traditional medicine in the treatment of various inflammatory diseases. The present study was designed to evaluate anti-inflammatory effects of Frankincense in the treatment of gingivitis, which is a periodontal tissue inflammatory disease. "n  Methods: This double blind randomized placebo controlled trial was carried out among high school female students with moderate plaque-induced gingivitis. Based on either administration of 0.1 gram of Frankincense extract or 0.2 gram of its powder or placebo and whether the patients undergone scaling and root planning (SRP or not, they were randomly assigned to 6 groups. The primary efficacy outcome was changes in Gingival Index (Loe & Sillness and the secondary outcomes were alteration in plaque index (Sillness & Loe, bleeding index (Cowell and probing pocket depth (WHO probe. All indices were measured in the 0, 7th and 14th days of the study. "n  Results: Seventy five patients ranged of 15-18 years old were enrolled. At the end of the study, the indices in all groups showed significant decreases in comparison to the first day (p< 0.05, except for the bleeding index in the group without SRP and drug therapy (p=0.111. More precise analysis of data revealed that SRP in association with Frankincense application (either extract or powder can lead to remarkable decrease in inflammatory indices in comparison to the groups without SRP and drug therapy (p<0.001. In addition, no significant difference was observed between powder or extract therapy (p >0.05 and between patients received either SRP or treatment alone (p=0.169. "n  Conclusion: Frankincense, a safe and low-cost herbal medicine, may be feasibly applied to improve inflammation based disease of gingival as an adjunct to the conventional mechanical therapy.

  3. Tirucallic acids are novel pleckstrin homology domain-dependent Akt inhibitors inducing apoptosis in prostate cancer cells.

    Science.gov (United States)

    Estrada, Aydee C; Syrovets, Tatiana; Pitterle, Kai; Lunov, Oleg; Büchele, Berthold; Schimana-Pfeifer, Judith; Schmidt, Thomas; Morad, Samy A F; Simmet, Thomas

    2010-03-01

    Activation of the serine/threonine kinase Akt is associated with aggressive clinical behavior of prostate cancer. We found that the human prostate cancer cell lines LNCaP and PC-3 express predominantly Akt1 and Akt2. Selective down-regulation of Akt1, but not Akt2, by short-hairpin RNA reduced the viability of prostate cancer cells. In addition, structurally different Akt inhibitors were cytotoxic for the prostate cancer cells, confirming that the Akt pathway is indispensable for their viability. We have purified the tetracyclic triterpenoids 3-oxo-tirucallic acid, 3-alpha-acetoxy-tirucallic acid, and 3-beta-acetoxy-tirucallic acid from the oleogum resin of Boswellia carterii to chemical homogeneity. The acetoxy-derivatives in particular potently inhibited the activities of human recombinant Akt1 and Akt2 and of constitutively active Akt immunoprecipitated from PC-3 cells, whereas inhibitor of nuclear factor-kappaB kinases remained unaffected. Docking data indicated that these tetracyclic triterpenoids form hydrogen bonds within the phosphatidylinositol binding pocket of the Akt pleckstrin homology domain. Accordingly, 3-beta-acetoxy-tirucallic acid did not inhibit the activity of Akt1 lacking the pleckstrin homology domain. In the prostate cancer cell lines investigated, these compounds inhibited the phosphorylation of cellular Akt and the Akt signaling pathways, including glycogen synthase kinase-3beta and BAD phosphorylation, nuclear accumulation of p65, the androgen receptor, beta-catenin, and c-Myc. These events culminated in the induction of apoptosis in prostate cancer, but not in nontumorigenic cells. The tirucallic acid derivatives inhibited proliferation and induced apoptosis in tumors xenografted onto chick chorioallantoic membranes and decreased the growth of pre-established prostate tumors in nude mice without overt systemic toxicity. Thus, tirucallic acid derivatives represent a new class of Akt inhibitors with antitumor properties.

  4. Effect of Boswellia Carterii Birdw Extractive on Quality of Ulcer Healing in Rats with Gastric Ulcer Induced by Acetic Acid%乳香提取物对大鼠乙酸胃溃疡愈合质量的影响

    Institute of Scientific and Technical Information of China (English)

    梅武轩; 曾常春

    2004-01-01

    目的:研究乳香提取物对大鼠乙酸胃溃疡愈合质量的影响.方法:用冰醋酸制备大鼠慢性胃溃疡模型,随机分为6组,分别灌服0.85%氯化钠溶液、乳香提取物、雷尼替丁等.用苏木精-伊红染色、粘液组织化学染色和苦味酸-酸性品红染色对大鼠愈合性胃溃疡再生粘膜厚度、再生粘膜粘液含量、囊状扩张腺体数量、炎症细胞浸润数量等进行定量观察.结果:乳香提取物组再生粘膜厚度增加、囊状扩张腺体数量减少和粘液高碘酸无色品红(PAS)含量增加;肉芽组织胶原含量增加,炎症细胞浸润数量减少.结论:乳香提取物能提高溃疡再生粘膜结构和功能成熟度,提高溃疡愈合质量.

  5. 乳香诱导急性非淋巴细胞白血病细胞凋亡中对Bcl-2基因调节%Boswellia Carterii Birdw Extractive Induces Apoptosis of Acute Non-lymphocytic Cells with Regulation of Expressions of Bcl-2 gene Protein

    Institute of Scientific and Technical Information of China (English)

    齐振华; 张国平; 柳昕; 赵谢兰

    2001-01-01

    研究乳香诱导急性非淋巴细胞白血病细胞凋亡中对 Bcl- 2 基因蛋白的影响.采用 DNA 片段百分率及免疫组化法检测30 例急性非淋巴细胞白血病细胞及白血病细胞株 HL60 细胞经 100 μg/ml乳香处理前、后 Bcl-2 基因蛋白表达水平 .结果:乳香具有诱导急性非淋巴细胞白血病细胞及 HL60 细胞凋亡[1]及下调 Bc l-2 基因蛋白表达水平.结论:乳香具有诱导急性非淋巴细胞白血病细胞及 HL60 细胞凋亡作用及下调 Bcl-2 基因蛋白.Bcl-2 基因蛋白表达水平下调可能是乳香提取物诱导急性非淋巴细胞白血病细胞凋亡重要机制之一.

  6. 乳香诱导急性早幼粒细胞白血病细胞凋亡与细胞周期改变%Inducing effect of Boswellia Carterii Birdw on apoptosis of leukemic cells and its action on cell cycle

    Institute of Scientific and Technical Information of China (English)

    齐振华; 张国平; 赵谢兰; 柳昕; 李卫红

    2000-01-01

    目的:为探讨乳香抗白血病的作用机制,研究乳香诱导急性早幼粒细胞白血病细胞凋亡与细胞周期关系.方法:应用形态学观察,DNA凝胶电泳、DNA片段百分率,流式细胞仪分析检测白血病细胞凋亡及细胞周期.结果:乳香提取物与全反式维甲酸相似,具有诱导急性早幼粒细胞白血病细胞凋亡及作用细胞周期G1及S期(G1期细胞减少,S期细胞增多).结论:乳香提出物是一有前途的诱导分化剂.

  7. Morphological alteration, lysosomal membrane fragility and apoptosis of the cells of Indian freshwater sponge exposed to washing soda (sodium carbonate).

    Science.gov (United States)

    Mukherjee, Soumalya; Ray, Mitali; Dutta, Manab Kumar; Acharya, Avanti; Mukhopadhyay, Sandip Kumar; Ray, Sajal

    2015-12-01

    Washing soda is chemically known as sodium carbonate and is a component of laundry detergent. Domestic effluent, drain water and various anthropogenic activities have been identified as major routes of sodium carbonate contamination of the freshwater ecosystem. The freshwater sponge, Eunapius carteri, bears ecological and evolutionary significance and is considered as a bioresource in aquatic ecosystems. The present study involves estimation of morphological damage, lysosomal membrane integrity, activity of phosphatases and apoptosis in the cells of E. carteri under the environmentally realistic concentrations of washing soda. Exposure to washing soda resulted in severe morphological alterations and damages in cells of E. carteri. Fragility and destabilization of lysosomal membranes of E. carteri under the sublethal exposure was indicative to toxin induced physiological stress in sponge. Prolonged exposure to sodium carbonate resulted a reduction in the activity of acid and alkaline phosphatases in the cells of E. carteri. Experimental concentration of 8 mg/l of washing soda for 192 h yielded an increase in the physiological level of cellular apoptosis among the semigranulocytes and granulocytes of E. carteri, which was suggestive to possible shift in apoptosis mediated immunoprotection. The results were indicative of an undesirable shift in the immune status of sponge. Contamination of the freshwater aquifers by washing soda thus poses an alarming ecotoxicological threat to sponges.

  8. Use of an alpha lipoic, methylsulfonylmethane and bromelain dietary supplement (Opera(®)) for chemotherapy-induced peripheral neuropathy management, a prospective study.

    Science.gov (United States)

    Desideri, Isacco; Francolini, Giulio; Becherini, Carlotta; Terziani, Francesca; Delli Paoli, Camilla; Olmetto, Emanuela; Loi, Mauro; Perna, Marco; Meattini, Icro; Scotti, Vieri; Greto, Daniela; Bonomo, Pierluigi; Sulprizio, Susanna; Livi, Lorenzo

    2017-03-01

    Chemotherapy-induced peripheral neuropathy (CIPN) is a major clinical problem associated with a number of cytotoxic agents. OPERA(®) (GAMFARMA srl, Milan, Italy) is a new dietary supplement where α-lipoic acid, Boswellia Serrata, methylsulfonylmethane and bromelain are combined in a single capsule. The aim of this prospective study was to determine the efficacy and safety of OPERA(®) supplementation in a series of patients affected by CIPN. We selected 25 subjects with CIPN evolving during or after chemotherapy with potentially neurotoxic agents. Patients were enrolled at the first clinical manifestation of neuropathy. CIPN was assessed at the enrollment visit and subsequently repeated every 3 weeks until 12 weeks. Primary endpoint was the evaluation of changes of measured scores after 12 weeks of therapy compared to baseline evaluation. Secondary endpoints were the evaluation of neuropathy reduction at 12 weeks after beginning of therapy with OPERA(®). Analysis of VAS data showed reduction in pain perceived by patients. According to NCI-CTC sensor and motor score, mISS scale and TNSc scale, both pain and both sensor and motor neuropathic impairment decreased after 12 weeks of treatments. Treatment with OPERA supplement was well tolerated; no increase in the toxicity profile of any of the therapeutic regimen that the patients were undergoing was reported. OPERA(®) was able to improve CIPN symptoms in a prospective series of patients treated with neurotoxic chemotherapy, with no significant toxicity or interaction. Prospective RCT in a selected patients' population is warranted to confirm its promising activity.

  9. Revealing microbial functional activities in the Red Sea sponge S tylissa carteri by metatranscriptomics

    KAUST Repository

    Moitinho-Silva, Lucas

    2014-07-09

    The persistence of coral reef ecosystems relies on the symbiotic relationship between scleractinian corals and intracellular, photosynthetic dinoflagellates in the genus Symbiodinium. Genetic evidence indicates that these symbionts are biologically diverse and exhibit discrete patterns of environmental and host distribution. This makes the assessment of Symbiodinium diversity critical to understanding the symbiosis ecology of corals. Here, we applied pyrosequencing to the elucidation of Symbiodinium diversity via analysis of the internal transcribed spacer 2 (ITS2) region, a multicopy genetic marker commonly used to analyse Symbiodinium diversity. Replicated data generated from isoclonal Symbiodinium cultures showed that all genomes contained numerous, yet mostly rare, ITS2 sequence variants. Pyrosequencing data were consistent with more traditional denaturing gradient gel electrophoresis (DGGE) approaches to the screening of ITS2 PCR amplifications, where the most common sequences appeared as the most intense bands. Further, we developed an operational taxonomic unit (OTU)-based pipeline for Symbiodinium ITS2 diversity typing to provisionally resolve ecologically discrete entities from intragenomic variation. A genetic distance cut-off of 0.03 collapsed intragenomic ITS2 variants of isoclonal cultures into single OTUs. When applied to the analysis of field-collected coral samples, our analyses confirm that much of the commonly observed Symbiodinium ITS2 diversity can be attributed to intragenomic variation. We conclude that by analysing Symbiodinium populations in an OTU-based framework, we can improve objectivity, comparability and simplicity when assessing ITS2 diversity in field-based studies.

  10. Effect of a Herbal-Leucine mix on the IL-1β-induced cartilage degradation and inflammatory gene expression in human chondrocytes

    Directory of Open Access Journals (Sweden)

    Haqqi Tariq M

    2011-08-01

    Full Text Available Abstract Background Conventional treatments for the articular diseases are often effective for symptom relief, but can also cause significant side effects and do not slow the progression of the disease. Several natural substances have been shown to be effective at relieving the symptoms of osteoarthritis (OA, and preliminary evidence suggests that some of these compounds may exert a favorable influence on the course of the disease. The objective of this study was to investigate the anti-inflammatory/chondroprotective potential of a Herbal and amino acid mixture containing extract of the Uncaria tomentosa, Boswellia spp., Lepidium meyenii and L-Leucine on the IL-1β-induced production of nitric oxide (NO, glycosaminoglycan (GAG, matrix metalloproteinases (MMPs, aggrecan (ACAN and type II collagen (COL2A1 in human OA chondrocytes and OA cartilage explants. Methods Primary OA chondrocytes or OA cartilage explants were pretreated with Herbal-Leucine mixture (HLM, 1-10 μg/ml and then stimulated with IL-1β (5 ng/ml. Effect of HLM on IL-1β-induced gene expression of iNOS, MMP-9, MMP-13, ACAN and COL2A1 was verified by real time-PCR. Estimation of NO and GAG release in culture supernatant was done using commercially available kits. Results HLM tested in these in vitro studies was found to be an effective anti-inflammatory agent, as evidenced by strong inhibition of iNOS, MMP-9 and MMP-13 expression and NO production in IL-1β-stimulated OA chondrocytes (p Leucine mixture (HLM up-regulation of ACAN and COL2A1 expression in IL-1β-stimulated OA chondrocytes was also noted (p Conclusion Our data suggests that HLM could be chondroprotective and anti-inflammatory agent in arthritis, switching chondrocyte gene expression from catabolic direction towards anabolic and regenerative, and consequently this approach may be potentially useful as a new adjunct therapeutic/preventive agent for OA or injury recovery.

  11. Environ: E00343 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available E00343 Boswellia gum substance Crude drug alpha-Boswellic acid, beta-Boswellic acid...11391], beta-Phellandrene [CPD:C09877 C11392] Boswellia carterii, Boswellia bhaw-dajiana, Boswellia neglecta [TAX:246345], Boswell...ia [TAX:80276] Burseraceae (frankincense family) Boswellia ...oil-bearing gum Alpha,beta-Boswellic acid in the component might exist as condensed type. Crude drugs [BR:br...08305] Dicot plants: rosids Burseraceae (frankincense family) E00343 Boswellia gum substance ...

  12. The effects of diet- and diet plus exercise-induced weight loss on basal metabolic rate and acylated ghrelin in grade 1 obese subjects

    Directory of Open Access Journals (Sweden)

    Lopes AL

    2013-11-01

    Full Text Available André L Lopes,1 Ana Paula T Fayh,2,3 Luisa G de Souza Campos,4 Bruno C Teixeira,1 Randhall B Kreismann Carteri,1 Jerri L Ribeiro,4 Rogério Friedman,2 Álvaro Reischak-Oliveira1 1Exercise Research Laboratory, School of Physical Education, Universidade Federal do Rio Grande do Sul, Porto Alegre, RS, Brazil; 2Endocrine Unit, Hospital de Clínicas de Porto Alegre, Universidade Federal do Rio Grande do Sul, Porto Alegre, RS, Brazil; 3Health Sciences College of Trairi, Universidade Federal do Rio Grande do Norte, Santa Cruz, RN, Brazil; 4Centro Universitário Metodista – IPA, Porto Alegre, RS, Brazil Background: Diet and exercise are often prescribed as primary intervention regarding obesity-related disorders. Additionally, recent studies have shown beneficial effects of weight loss through diet and exercise in ghrelin concentrations in obese subjects. The aim of this study was to evaluate the effects of a 5% weight loss on lipid profile, resting metabolic rate (RMR, and acylated ghrelin (AG using two different methods of intervention (diet or diet plus exercise. Materials and methods: Eighteen subjects (twelve women and six men aged 20–40 years with a body mass index of 30–34.9 kg/m2 (grade 1 obesity were randomized into two intervention groups: diet (n=9 or diet plus exercise (n=9. Both groups underwent treatment until 5% of the initial body weight was lost. At baseline and upon completion, RMR and AG were analyzed. Results: Both groups showed a significant decrease in body fat percentage and fat mass. The diet-plus-exercise group showed a decrease in AG (pre: 54.4±25.3 pg/mL and post: 33.2±19.1 pg/mL and an increase in RMR (pre: 1,363±379 kcal/day, post: 1,633±223 kcal/day. Conclusion: These data suggest that diet plus exercise induced weight loss and had beneficial effects on AG concentration and RMR, essential factors to ensure the benefits of a weight-loss program. Keywords: exercise therapy, diet, energy regulation, obesity

  13. Inducing autophagy

    DEFF Research Database (Denmark)

    Harder, Lea M; Bunkenborg, Jakob; Andersen, Jens S.

    2014-01-01

    catabolism, which has recently been found to induce autophagy in an MTOR independent way and support cancer cell survival. In this study, quantitative phosphoproteomics was applied to investigate the initial signaling events linking ammonia to the induction of autophagy. The MTOR inhibitor rapamycin was used...

  14. CHEMICAL COMPONENTS OF BOSWELLIA CARTERII%乳香的化学成分

    Institute of Scientific and Technical Information of China (English)

    周金云; 崔锐

    2002-01-01

    目的研究乳香的化学成分.方法应用色谱技术进行分离和纯化,IR,NMR,MS等波谱解析化学结构.结果从乳香中分离出6个化合物,分别鉴定为α-乙酰乳香酸(1),β-乙酰乳香酸(2),羽扇-20(29)-烯-3α-乙酰氧基-24-酸(3),α-乳香酸(4),β-乳香酸(5),11-羰基-β-乙酰乳香酸(6).结论化合物3为新成分.

  15. 乳香的化学成分%Chemical Constituents of Boswellia carterii (Frankincense)

    Institute of Scientific and Technical Information of China (English)

    李福双; 颜冬兰; 刘让如; 徐康平; 谭桂山

    2010-01-01

    目的:研究乳香提取物的化学成分.方法:超临界萃取乳香有效部位,采用硅胶柱层析,制备薄层层析等色谱方法,分离乳香提取物的化学成分.采用四甲基偶氮唑蓝(MTT)法观察化合物3、4对肿瘤细胞的抑制增殖作用.结果:分离得到9个化合物,经波谱方法鉴定为西松烯A(1),verticilla-4(20),7,11-triene(2),11-羰基-β-乙酰乳香酸(3),3-羰基-甘遂烷-8,24-二烯-21-酸(4),花生酸(5),棕榈酸(6),硬脂酸(7),1,2-二羟基十九酮-3(8),单棕榈酸甘油酯(9).结论:化合物7~9为首次从该属植物中分离得到.化合物3对Bel-7402细胞有抑制增值作用,化合物4对MCF-7,SMMC-7721,K562,Hela细胞有抑制增殖作用.

  16. Exercise-Induced Asthma

    Science.gov (United States)

    ... Your 1- to 2-Year-Old Exercise-Induced Asthma KidsHealth > For Parents > Exercise-Induced Asthma A A ... previous continue Tips for Kids With Exercise-Induced Asthma For the most part, kids with exercise-induced ...

  17. Exercise-Induced Asthma

    Science.gov (United States)

    ... management of exercise-induced bronchoconstriction: A practice parameter. Annals of Allergy, Asthma & Immunology. 2010;105:S1. Krafczyk ... up exercise on exercise-induced bronchoconstriction. Medicine and Science in Sports and Exercise. 2012;44:383. Asthma ...

  18. Extrachromosomal inducible expression

    NARCIS (Netherlands)

    Veltman, Douwe M; Van Haastert, Peter J M

    2013-01-01

    Inducible expression systems are very convenient for proteins that induce strong side effects such as retardation of growth or development and are essential for the expression of toxic proteins. In this chapter we describe the doxycycline-inducible expression system, optimized for the controlled exp

  19. Protein (Viridiplantae): 302855776 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 5 hypothetical protein VOLCADRAFT_70813, partial Volvox carteri f. nagariensis HLAPDGHVTPDGHLTPDGHLTPDGHLTPD...GHLTPDGHLTPDGHLTPDGHLTPDGHLTPDGHLTPDGHLTPDGHLTPDGHLTPDGHLTPDGPCSQARPPRYHHHRHLAPDGHVTPDGHLTPDGHLTPDGHLTPDGHLT

  20. Protein (Viridiplantae): 302837446 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3068:4777 hypothetical protein VOLCADRAFT_74585 Volvox carteri f. nagariensis MSAGVEARALFRAFLREGRRFPNYNIREYIQRRAKEGFQEAASITDITAVDALLQSGRQELEVVKRQSLVYRLYGRKVKNVLELDLAFKPGVKPGDMSA ...

  1. Protein (Viridiplantae): 302852767 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 5 hypothetical protein VOLCADRAFT_43342, partial Volvox carteri f. nagariensis GEMWPRGEMWPRGEMWPRGEMRPRGEMWPRGEMRPRGEMWPRGEMWPRGEMW...PRGEMRPRGEMWPRGEMWPRGEMRPRGEMWPRGEMWPRGEMWPRGEMWPRGEMWPRGEMWPRGEMWPRGEMRPRGEMWPRG ...

  2. Protein (Viridiplantae): 302838522 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available :31 hypothetical protein VOLCADRAFT_60851, partial Volvox carteri f. nagariensis LYRPRLQERLYRPRLQERLYRSRLQERLYRPRLQEKLYRPRLQEKLYRPR...LQERLYRPRLQERLYRPRLQERLYRPRLQERLYRPRLQERLYRPRLQERLYRPRLQEKLYRPRLQEKLYRPRLQERLYRPRLQERLY ...

  3. Protein (Viridiplantae): 302857194 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3068:658 hypothetical protein VOLCADRAFT_108754 Volvox carteri f. nagariensis MNDLRTLINKCARETFGGARGMEKSVKRDWWNEDCAAAWNDMMSFRKVVRDPVSGKLPDLHRTTWKAKHRAFKKARKAAIQEFEMEDMRRRIKDARFNPR ...

  4. Bromazepam-induced dystonia.

    Science.gov (United States)

    Pérez Trullen, J M; Modrego Pardo, P J; Vázquez André, M; López Lozano, J J

    1992-01-01

    Benzodiazepines are drugs with a good tolerance that are widely used for the treatment of anxiety. Extrapyramidal side-effects are unusual. Diazepam is effective for the treatment of drug-induced dystonias, nevertheless there are some reports of Diazepam-induced dystonia. We report a case history of a patient who developed oromandibular dystonia after taking Bromazepam. The possible mechanisms that cause drug-induced dystonia are described.

  5. A Case of Metastatic Bladder Cancer in Both Lungs Treated with Korean Medicine Therapy Alone

    Directory of Open Access Journals (Sweden)

    Dong-Hyun Lee

    2014-07-01

    Full Text Available This case report is aimed to investigate the effects of Korean medicine therapy (KMT including oral herbal medicine and herb nebulizer therapy in treating metastatic bladder cancer in the lungs. A 74-year-old man was diagnosed with metastatic bladder cancer in both lungs in August 2013. He refused any chemotherapy and was admitted to our hospital in a much progressed state on January 11, 2014. Since then, he was treated with KMT until May 17, 2014. The main oral herbal medicines were Hyunamdan made of heat-processed ginseng, Hangamdan S made of Cordyceps militaris, Panax ginseng radix, Commiphora myrrha, calculus bovis, margarita, Boswellia carteri, Panax notoginseng radix and Cremastra appendiculata tuber, and nebulizer therapy with Soram nebulizer solution made of wild ginseng and Cordyceps sinensis distillate. Their effect was evaluated considering the change of the main symptoms and using serial chest X-ray. The size and number of multiple metastatic nodules in both lungs were markedly decreased and the symptoms had disappeared. These results suggest that KMT can be an effective method to treat metastatic bladder cancer in the lungs.

  6. The four-herb Chinese medicine ANBP enhances wound healing and inhibits scar formation via bidirectional regulation of transformation growth factor pathway.

    Science.gov (United States)

    Hou, Qian; He, Wen-Jun; Hao, Hao-Jie; Han, Qing-Wang; Chen, Li; Dong, Liang; Liu, Jie-Jie; Li, Xiang; Zhang, Ya-Jing; Ma, Ying-Zhi; Han, Wei-Dong; Fu, Xiao-Bing

    2014-01-01

    The four-herb Chinese medicine ANBP is a pulverized mixture of four herbs including Agrimonia Eupatoria (A), Nelumbo Nucifera Gaertn (N), Boswellia Carteri (B) and Pollen Typhae Angustifoliae (P). The combination of the four herbs was first described in Chinese canonical medicine about 2000 years ago for treatment of various trauma disorders, such as hemostasis, antiinflammatory, analgesia, and wound healing, etc. However, the precise mechanisms of ANBP are still unclear. In our study, using rabbit ear hypertrophic scar models of full-thickness skin defect, we showed that local ANBP treatment not only significantly enhanced wound healing by relieving inflammation, increasing formation of granulation tissue and accelerating re-epithelialization, but also reduced scar formation by decreasing collagen production, protuberant height and volume of scars, and increasing collagen maturity. We demonstrated that these effects of ANBP are associated with transforming growth factor (TGF)-β1-mediated signalling pathways through Smad-dependent pathways. ANBP treatment significantly increased expression of TGF-β1 and Smad2/3 mRNA at the early stage of wound healing, and led to markedly decrease expression of TGF-β1 and Smad2/3 compared with the control group after 14 days post-wounding. Taken together, our results defined a bidirectional regulation role of ANBP for TGF-β1/Smad pathway in promoting wound healing and alleviating scar formation, which may be an effective therapy for human wounds at the earliest stage.

  7. The four-herb Chinese medicine ANBP enhances wound healing and inhibits scar formation via bidirectional regulation of transformation growth factor pathway.

    Directory of Open Access Journals (Sweden)

    Qian Hou

    Full Text Available The four-herb Chinese medicine ANBP is a pulverized mixture of four herbs including Agrimonia Eupatoria (A, Nelumbo Nucifera Gaertn (N, Boswellia Carteri (B and Pollen Typhae Angustifoliae (P. The combination of the four herbs was first described in Chinese canonical medicine about 2000 years ago for treatment of various trauma disorders, such as hemostasis, antiinflammatory, analgesia, and wound healing, etc. However, the precise mechanisms of ANBP are still unclear. In our study, using rabbit ear hypertrophic scar models of full-thickness skin defect, we showed that local ANBP treatment not only significantly enhanced wound healing by relieving inflammation, increasing formation of granulation tissue and accelerating re-epithelialization, but also reduced scar formation by decreasing collagen production, protuberant height and volume of scars, and increasing collagen maturity. We demonstrated that these effects of ANBP are associated with transforming growth factor (TGF-β1-mediated signalling pathways through Smad-dependent pathways. ANBP treatment significantly increased expression of TGF-β1 and Smad2/3 mRNA at the early stage of wound healing, and led to markedly decrease expression of TGF-β1 and Smad2/3 compared with the control group after 14 days post-wounding. Taken together, our results defined a bidirectional regulation role of ANBP for TGF-β1/Smad pathway in promoting wound healing and alleviating scar formation, which may be an effective therapy for human wounds at the earliest stage.

  8. Induced radioactivity at CERN

    CERN Multimedia

    1970-01-01

    A description of some of the problems and some of the advantages associated with the phenomenon of induced radioactivity at accelerator centres such as CERN. The author has worked in this field for several years and has recently written a book 'Induced Radioactivity' published by North-Holland.

  9. Diet induced thermogenesis

    NARCIS (Netherlands)

    Westerterp, K.R.

    2004-01-01

    OBJECTIVE: Daily energy expenditure consists of three components: basal metabolic rate, diet-induced thermogenesis and the energy cost of physical activity. Here, data on diet-induced thermogenesis are reviewed in relation to measuring conditions and characteristics of the diet. METHODS: Measuring c

  10. Mesalamine-Induced Myocarditis

    OpenAIRE

    Pierre-Louis Michel; Richard Dorent; Nadjib Hammoudi; Florence Pontnau; Antoine Khalil; Clement Bailly; Olivier Merceron

    2010-01-01

    Nowadays mesalamine is a common treatment for Crohn's disease and hypersensitive reactions to this product have been reported. Yet there is limited information concerning mesalamine-induced myocarditis and its mechanism is not known. We described a case of mesalamine-induced myocarditis in Crohn's disease of the colon.

  11. Mesalamine-Induced Myocarditis

    Directory of Open Access Journals (Sweden)

    Olivier Merceron

    2010-01-01

    Full Text Available Nowadays mesalamine is a common treatment for Crohn's disease and hypersensitive reactions to this product have been reported. Yet there is limited information concerning mesalamine-induced myocarditis and its mechanism is not known. We described a case of mesalamine-induced myocarditis in Crohn's disease of the colon.

  12. Diet induced thermogenesis

    Directory of Open Access Journals (Sweden)

    Westerterp KR

    2004-08-01

    Full Text Available Objective Daily energy expenditure consists of three components: basal metabolic rate, diet-induced thermogenesis and the energy cost of physical activity. Here, data on diet-induced thermogenesis are reviewed in relation to measuring conditions and characteristics of the diet. Methods Measuring conditions include nutritional status of the subject, physical activity and duration of the observation. Diet characteristics are energy content and macronutrient composition. Results Most studies measure diet-induced thermogenesis as the increase in energy expenditure above basal metabolic rate. Generally, the hierarchy in macronutrient oxidation in the postprandial state is reflected similarly in diet-induced thermogenesis, with the sequence alcohol, protein, carbohydrate, and fat. A mixed diet consumed at energy balance results in a diet induced energy expenditure of 5 to 15 % of daily energy expenditure. Values are higher at a relatively high protein and alcohol consumption and lower at a high fat consumption. Protein induced thermogenesis has an important effect on satiety. In conclusion, the main determinants of diet-induced thermogenesis are the energy content and the protein- and alcohol fraction of the diet. Protein plays a key role in body weight regulation through satiety related to diet-induced thermogenesis.

  13. Mania induced by opipramol

    Directory of Open Access Journals (Sweden)

    Kazhungil Firoz

    2015-01-01

    Full Text Available Antidepressants have propensity to induce manic switch in patients with bipolar disorder. Opipramol is an atypical anxiolytic and antidepressant drug which predominantly acts on sigma receptors. Although structurally resembles tricyclic antidepressant imipramine it does not have inhibitory action on the reuptake of norepinephrine/serotonin and hence it is not presumed to cause manic switch in bipolar depression. Here, we describe a case of mania induced by opipramol, in a patient with bipolar affective disorder who was treated for moderate depressive episode with lithium and opipramol and we discuss neurochemical hypothesis of opipramol-induced mania.

  14. Vitiligo, drug induced (image)

    Science.gov (United States)

    ... this person's face have resulted from drug-induced vitiligo. Loss of melanin, the primary skin pigment, occasionally ... is the case with this individual. The typical vitiligo lesion is flat and depigmented, but maintains the ...

  15. Drug-induced hepatitis

    Science.gov (United States)

    Toxic hepatitis ... to get liver damage. Some drugs can cause hepatitis with small doses, even if the liver breakdown ... liver. Many different drugs can cause drug-induced hepatitis. Painkillers and fever reducers that contain acetaminophen are ...

  16. Drug-induced catatonia.

    Science.gov (United States)

    Duggal, Harpreet S; Singh, Ira

    2005-09-01

    Catatonia is a heterogeneous syndrome that varies in etiology, presentation, course and sequelae. Initially conceptualized as a subtype of schizophrenia, catatonia is now recognized to occur not only with other psychiatric conditions but also with medical conditions and drug-induced and toxic states. While drug-induced catatonia is now a recognized entity, most studies club it with catatonia due to general medical conditions or organic catatonia, thus precluding any meaningful interpretation of such cases. The literature on drug-induced catatonia mostly draws from scattered case reports. This article attempts to review the available literature in this realm and integrate the information in an attempt to explore the epidemiology, etiology, mechanism and treatment of drug-induced catatonia.

  17. Topological Induced Gravity

    CERN Document Server

    Oda, Ichiro

    2016-01-01

    We propose a topological model of induced gravity (pregeometry) where both Newton's coupling constant and the cosmological constant appear as integration constants in solving field equations. The matter sector of a scalar field is also considered, and by solving field equations it is shown that various types of cosmological solutions in the FRW universe can be obtained. A detailed analysis is given of the meaning of the BRST transformations, which make the induced gravity be a topological field theory, by means of the canonical quantization analysis, and the physical reason why such BRST transformations are needed in the present formalism is clarified. Finally, we propose a dynamical mechanism for fixing the Lagrange multiplier fields by following the Higgs mechanism. The present study clearly indicates that the induced gravity can be constructed at the classical level without recourse to quantum fluctuations of matter and suggests an interesting relationship between the induced gravity and the topological qu...

  18. Cold-induced metabolism

    NARCIS (Netherlands)

    van Marken Lichtenbelt, W.D.; Daanen, A.M.

    2003-01-01

    Cold-induced metabolism. van Marken Lichtenbelt WD, Daanen HA. Department of Human Biology, Maastricht University, Maastricht, The Netherlands. PURPOSE OF REVIEW: Cold response can be insulative (drop in peripheral temperature) or metabolic (increase in energy expenditure). Nonshivering thermogenesi

  19. Exercise-induced asthma

    Science.gov (United States)

    ... medlineplus.gov/ency/patientinstructions/000036.htm Exercise-induced asthma To use the sharing features on this page, ... such as running, basketball, or soccer. Use Your Asthma Medicine Before you Exercise Take your short-acting, ...

  20. Optomechanically induced transparency

    CERN Document Server

    Weis, S; Deleglise, S; Gavartin, E; Arcizet, O; Schliesser, A; Kippenberg, T J

    2010-01-01

    Coherent interaction of laser radiation with multilevel atoms and molecules can lead to quantum interference in the electronic excitation pathways. A prominent example observed in atomic three-level-systems is the phenomenon of electromagnetically induced transparency (EIT), in which a control laser induces a narrow spectral transparency window for a weak probe laser beam. The concomitant rapid variation of the refractive index in this spectral window can give rise to dramatic reduction of the group velocity of a propagating pulse of probe light. Dynamic control of EIT via the control laser enables even a complete stop, that is, storage, of probe light pulses in the atomic medium. Here, we demonstrate optomechanically induced transparency (OMIT)--formally equivalent to EIT--in a cavity optomechanical system operating in the resolved sideband regime. A control laser tuned to the lower motional sideband of the cavity resonance induces a dipole-like interaction of optical and mechanical degrees of freedom. Under...

  1. Trauma-induced coagulopathy.

    Science.gov (United States)

    Katrancha, Elizabeth D; Gonzalez, Luis S

    2014-08-01

    Coagulopathy is the inability of blood to coagulate normally; in trauma patients, it is a multifactorial and complex process. Seriously injured trauma patients experience coagulopathies during the acute injury phase. Risk factors for trauma-induced coagulopathy include hypothermia, metabolic acidosis, hypoperfusion, hemodilution, and fluid replacement. In addition to the coagulopathy induced by trauma, many patients may also be taking medications that interfere with hemostasis. Therefore, medication-induced coagulopathy also is a concern. Traditional laboratory-based methods of assessing coagulation are being supported or even replaced by point-of-care tests. The evidence-based management of trauma-induced coagulopathy should address hypothermia, fluid resuscitation, blood components administration, and, if needed, medications to reverse identified coagulation disorders.

  2. Carbamazepine-Induced Diarrhea

    OpenAIRE

    J Gordon Millichap

    1992-01-01

    Intractable diarrhea induced by carbamazepine (CBZ) in 3 patients and necessitating discontinuation of the drug is reported from the Departments of Neurology and Medicine, University of Louisville School of Medicine, Kentucky.

  3. Lorazepam-induced diplopia

    Directory of Open Access Journals (Sweden)

    Jisha M Lucca

    2014-01-01

    Full Text Available Diplopia - seeing double - is a symptom with many potential causes, both neurological and ophthalmological. Benzodiazepine induced ocular side-effects are rarely reported. Lorazepam is one of the commonly used benzodiazepine in psychiatric practice. Visual problems associated with administration of lorazepam are rarely reported and the frequency of occurrence is not established. We report a rare case of lorazepam-induced diplopia in a newly diagnosed case of obsessive compulsive disorder.

  4. Terahertz field induced electromigration

    DEFF Research Database (Denmark)

    Strikwerda, Andrew; Zalkovskij, Maksim; Iwaszczuk, Krzysztof;

    We report the first observation of THz-field-induced electromigration in sub-wavelength metallic gap structures after exposure to intense single-cycle, sub-picosecond electric field transients of amplitude up to 400 kV/cm.......We report the first observation of THz-field-induced electromigration in sub-wavelength metallic gap structures after exposure to intense single-cycle, sub-picosecond electric field transients of amplitude up to 400 kV/cm....

  5. Lorazepam-induced diplopia.

    Science.gov (United States)

    Lucca, Jisha M; Ramesh, Madhan; Parthasarathi, Gurumurthy; Ram, Dushad

    2014-01-01

    Diplopia - seeing double - is a symptom with many potential causes, both neurological and ophthalmological. Benzodiazepine induced ocular side-effects are rarely reported. Lorazepam is one of the commonly used benzodiazepine in psychiatric practice. Visual problems associated with administration of lorazepam are rarely reported and the frequency of occurrence is not established. We report a rare case of lorazepam-induced diplopia in a newly diagnosed case of obsessive compulsive disorder.

  6. Contrast-induced nephropathy

    Directory of Open Access Journals (Sweden)

    Ricardo A. García Hernández

    2016-06-01

    Full Text Available Contrast-induced nephropathy is an important complication associated with the use of contrast media. Favoring factors for the development of contrast-induced nephronpathy have been widely described, being diabetes mellitus and previous renal disease the greatest risk. The pathophysiology is a complex process where the medullary hypoxia represents the trigger element. Previous hydration and the use of low osmolality contrast are the most recommended measures to prevent its development.

  7. Paroxetine-induced galactorrhea.

    Science.gov (United States)

    Gulati, Prannay; Chavan, B S; Das, Subhash

    2014-10-01

    Drug-induced galactorrhea has been reported with agents such as antidopaminergic antiemetics, antipsychotics, etc., with few case reports of galactorrhea with selective serotonin reuptake inhibitors, including paroxetine, being reported in last few decades. Prolactin levels have been found to be either raised or normal in these cases. We here report a case of paroxetine induced galactorrhea in a 48-year-old female patient of obsessive compulsive disorder, having hyperprolactinemic and euprolactinemic galactorrhea at different time with a pituitary incidentaloma.

  8. Paroxetine-induced galactorrhea

    OpenAIRE

    Gulati, Prannay; Chavan, B.S.; Das, Subhash

    2014-01-01

    Drug-induced galactorrhea has been reported with agents such as antidopaminergic antiemetics, antipsychotics, etc., with few case reports of galactorrhea with selective serotonin reuptake inhibitors, including paroxetine, being reported in last few decades. Prolactin levels have been found to be either raised or normal in these cases. We here report a case of paroxetine induced galactorrhea in a 48-year-old female patient of obsessive compulsive disorder, having hyperprolactinemic and euprola...

  9. Fine-scale spatial genetic structure in the frankincense tree Boswellia papyrifera (Del.) Hochst. and implications for conservation

    NARCIS (Netherlands)

    Bekele, Addisalem; Duminil, J.; Wouters, D.; Bongers, F.; Smulders, M.J.M.

    2016-01-01

    The fine-scale genetic structure and how it varies between generations depends on the spatial scale of gene dispersal and other fundamental aspects of species’ biology, such as the mating system. Such knowledge is crucial for the design of genetic conservation strategies. This is particularly rel

  10. Crystalglobulin-induced nephropathy.

    Science.gov (United States)

    Gupta, Vinay; El Ters, Mireille; Kashani, Kianoush; Leung, Nelson; Nasr, Samih H

    2015-03-01

    Crystalline nephropathy refers to renal parenchymal deposition of crystals leading to kidney damage. The most common forms of crystalline nephropathy encountered in renal pathology are nephrocalcinosis and oxalate nephropathy. Less frequent types include urate nephropathy, cystinosis, dihydroxyadeninuria, and drug-induced crystalline nephropathy (e.g., caused by indinavir or triamterene). Monoclonal proteins can also deposit in the kidney as crystals and cause tissue damage. This occurs in conditions such as light chain proximal tubulopathy, crystal-storing histiocytosis, and crystalglobulinemia. The latter is a rare complication of multiple myeloma that results from crystallization of monoclonal proteins in the systemic vasculature, leading to vascular injury, thrombosis, and occlusion. In this report, we describe a case of crystalglobulin-induced nephropathy and discuss its pathophysiology and the differential diagnosis of paraprotein-induced crystalline nephropathy.

  11. Gravitationally induced quantum transitions

    Science.gov (United States)

    Landry, A.; Paranjape, M. B.

    2016-06-01

    In this paper, we calculate the probability for resonantly inducing transitions in quantum states due to time-dependent gravitational perturbations. Contrary to common wisdom, the probability of inducing transitions is not infinitesimally small. We consider a system of ultracold neutrons, which are organized according to the energy levels of the Schrödinger equation in the presence of the Earth's gravitational field. Transitions between energy levels are induced by an oscillating driving force of frequency ω . The driving force is created by oscillating a macroscopic mass in the neighborhood of the system of neutrons. The neutron lifetime is approximately 880 sec while the probability of transitions increases as t2. Hence, the optimal strategy is to drive the system for two lifetimes. The transition amplitude then is of the order of 1.06 ×10-5, and hence with a million ultracold neutrons, one should be able to observe transitions.

  12. Gravitationally induced quantum transitions

    CERN Document Server

    Landry, A

    2016-01-01

    In this letter, we calculate the probability for resonantly induced transitions in quantum states due to time dependent gravitational perturbations. Contrary to common wisdom, the probability of inducing transitions is not infinitesimally small. We consider a system of ultra cold neutrons (UCN), which are organized according to the energy levels of the Schr\\"odinger equation in the presence of the earth's gravitational field. Transitions between energy levels are induced by an oscillating driving force of frequency $\\omega$. The driving force is created by oscillating a macroscopic mass in the neighbourhood of the system of neutrons. The neutrons decay in 880 seconds while the probability of transitions increase as $t^2$. Hence the optimal strategy is to drive the system for 2 lifetimes. The transition amplitude then is of the order of $1.06\\times 10^{-5}$ hence with a million ultra cold neutrons, one should be able to observe transitions.

  13. Time Domain Induced Polarization

    DEFF Research Database (Denmark)

    Fiandaca, Gianluca; Auken, Esben; Christiansen, Anders Vest

    2012-01-01

    Time-domain-induced polarization has significantly broadened its field of reference during the last decade, from mineral exploration to environmental geophysics, e.g., for clay and peat identification and landfill characterization. Though, insufficient modeling tools have hitherto limited the use...... of time-domaininduced polarization for wider purposes. For these reasons, a new forward code and inversion algorithm have been developed using the full-time decay of the induced polarization response, together with an accurate description of the transmitter waveform and of the receiver transfer function......%. Furthermore, the presence of low-pass filters in time-domain-induced polarization instruments affects the early times of the acquired decays (typically up to 100 ms) and has to be modeled in the forward response to avoid significant loss of resolution. The developed forward code has been implemented in a 1D...

  14. [Radiation induced tumors].

    Science.gov (United States)

    Gutiérrez Bayard, L; Delgado López, L; Tirado Bejarano, C; Gómez Puerto, A; García Fernández, J L

    1998-04-01

    Radiations at cellular level produce different effects, depending on type of radiation and irradiated tissue. The radiation-induced cancers are associated to non-letals genetics mutations, and to classify like radiation induced tumors is necessary that appear in the treatment volume, a long latency period (years), histolo-different to the primary lesion, enough doses quantitatively and that exists a greater incidence in the irradiated populations. The genetics mutations affect at tumoral suppressors gen(Gen RB I, p53, BRCA I, BRCA 2) and repressors gen (hMSH 2, hMLH I,...), they could be longer and multifocals mutations, and produce lack of cellular control and a greater predisposition to develop tumors and a probable risk of increment of radiosensitivity. We present some of the more representatives studies about radiation-induced tumors.

  15. Wheat induced urticaria

    Directory of Open Access Journals (Sweden)

    Uppal Monica

    2004-09-01

    Full Text Available Wheat is widely consumed all over India in various forms - flour, daliya, maida, suji and wheat bran. Very few cases of wheat induced urticaria have been reported. This may be due to unusual features of wheat related hypersensitivity. A 35 year old female presented to us with history of chronic urticaria and angioedema. History revealed correlation between wheat intake and urticaria episodes. Prick testing was done with wheat antigen in the standard series and derivatives of raw wheat. Normal saline and histamine were used as controls. Prick testing was positive. Oral challenge induced urticaria within half an hour. This report discusses clinical features of wheat related hypersensitivity.

  16. Induced Norm Control Toolbox

    DEFF Research Database (Denmark)

    Beran, Eric Bengt

    1996-01-01

    This paper describes the basic nature of the InducedNorm Control Toolbox (INCT). The toolbox is a set of Matlab-filesusing LMITOOL and the Semidefinite Programming package(SP). Thetoolbox is public domain. The INCT provides a series of analysisand synthesis tools for continuous time-invariant lin......This paper describes the basic nature of the InducedNorm Control Toolbox (INCT). The toolbox is a set of Matlab-filesusing LMITOOL and the Semidefinite Programming package(SP). Thetoolbox is public domain. The INCT provides a series of analysisand synthesis tools for continuous time...

  17. Rosuvastatin-induced pemphigoid.

    LENUS (Irish Health Repository)

    Murad, Aizuri A

    2012-01-01

    Statins are widely prescribed medications and very well tolerated. Rosuvastatin is another member of this drug used to treat dyslipidaemia. It is a competitive inhibitor of the enzyme 3-hydroxy-3-methylglutaryl coenzyme A reductase. Immunobullous disease is usually idiopathic but can be drug-induced. Both idiopathic and iatrogenic forms share common clinical and immunohistological features. The authors report a case of pemphigoid induced by rosuvastatin, a commonly prescribed medication. To our knowledge, there is limited report on rosuvastatin associated with pemphigoid in the literature.

  18. Geomagnetism and Induced Voltage

    Science.gov (United States)

    Abdul-Razzaq, W.; Biller, R. D.

    2010-01-01

    Introductory physics laboratories have seen an influx of "conceptual integrated science" over time in their classrooms with elements of other sciences such as chemistry, biology, Earth science, and astronomy. We describe a laboratory to introduce this development, as it attracts attention to the voltage induced in the human brain as it…

  19. Injection-induced earthquakes.

    Science.gov (United States)

    Ellsworth, William L

    2013-07-12

    Earthquakes in unusual locations have become an important topic of discussion in both North America and Europe, owing to the concern that industrial activity could cause damaging earthquakes. It has long been understood that earthquakes can be induced by impoundment of reservoirs, surface and underground mining, withdrawal of fluids and gas from the subsurface, and injection of fluids into underground formations. Injection-induced earthquakes have, in particular, become a focus of discussion as the application of hydraulic fracturing to tight shale formations is enabling the production of oil and gas from previously unproductive formations. Earthquakes can be induced as part of the process to stimulate the production from tight shale formations, or by disposal of wastewater associated with stimulation and production. Here, I review recent seismic activity that may be associated with industrial activity, with a focus on the disposal of wastewater by injection in deep wells; assess the scientific understanding of induced earthquakes; and discuss the key scientific challenges to be met for assessing this hazard.

  20. Understanding induced seismicity

    NARCIS (Netherlands)

    Elsworth, Derek; Spiers, Christopher J.; Niemeijer, Andre R.

    2016-01-01

    Fluid injection–induced seismicity has become increasingly widespread in oil- and gas-producing areas of the United States (1–3) and western Canada. It has shelved deep geothermal energy projects in Switzerland and the United States (4), and its effects are especially acute in Oklahoma, where seismi

  1. Amlodipine induced gingival enlargement

    Directory of Open Access Journals (Sweden)

    Shankar Gittaboyina

    2016-01-01

    Full Text Available Drug-induced gingival overgrowth or enlargement is an abnormal growth of the gingiva due to an adverse drug reaction in patients treated with anticonvulsants, immunosuppressants, and calcium channel blockers (CCBs. CCBs are considered as one of the etiologic factors among patients seeking dental care for drug-induced gingival enlargement or overgrowth. This enlargement can be localized or generalized and can range from mild to extremely severe, affecting patient's appearance, and function. CCBs are one of the most commonly used drugs for the management of cardiovascular disorders and are known for causing gingival over growth. Amlodipine is a new CCB and has been used with increasing frequency in the management of hypertension and angina. Although amlodipine is considered as a safe drug, very rarely it may induce gingival overgrowth. A rare case of amlodipine-induced gingival overgrowth has been reported herein a 45-year-old female patient. The treatment aspect included scaling and root planing, substitution of the drug, the surgical excision, and the maintenance and supportive therapy resulting in an excellent clinical outcome.

  2. Pyrazinamide induced thrombocytopenia

    Directory of Open Access Journals (Sweden)

    Kant Surya

    2010-01-01

    Full Text Available Thrombocytopenia is an uncommon but potentially life-threatening complication of certain antitubercular drugs and is characterized by rapid destruction of platelets whenever offending drug is taken by a susceptible person. We report a case of pyrazinamide-induced thrombocytopenia in a patient receiving anti tubercular drugs.

  3. Cold-induced metabolism

    NARCIS (Netherlands)

    Lichtenbelt, W. van Marken; Daanen, H.A.M.

    2003-01-01

    Purpose of review Cold response can be insulative (drop in peripheral temperature) or metabolic (increase in energy expenditure). Nonshivering thermogenesis by sympathetic, norepinephrine-induced mitochondrial heat production in brown adipose tissue is a well known component of this metabolic respon

  4. Bacteriocin Inducer Peptides

    Science.gov (United States)

    Novel peptides produced by bacteriocin-producing bacteria stimulate the production of bacteriocins in vitro. The producer bacteria are cultured in the presence of a novel inducer bacteria and a peptide having a carboxy terminal sequence of VKGLT in order to achieve an increase in bacteriocin produc...

  5. Induced Angular Momentum

    Science.gov (United States)

    Parker, G. W.

    1978-01-01

    Discusses, classically and quantum mechanically, the angular momentum induced in the bound motion of an electron by an external magnetic field. Calculates the current density and its magnetic moment, and then uses two methods to solve the first-order perturbation theory equation for the required eigenfunction. (Author/GA)

  6. Mild induced hypothermia

    DEFF Research Database (Denmark)

    Johansen, Maria E; Jensen, Jens-Ulrik; Bestle, Morten H

    2014-01-01

    INTRODUCTION: Coagulopathy associates with poor outcome in sepsis. Mild induced hypothermia has been proposed as treatment in sepsis but it is not known whether this intervention worsens functional coagulopathy. MATERIALS AND METHODS: Interim analysis data from an ongoing randomized controlled tr...

  7. Ergotamine-induced colitis.

    Science.gov (United States)

    Wörmann, B; Höchter, W; Seib, H J; Ottenjann, R

    1985-07-01

    We report on a 45-year-old woman with ulcerative colitis of the rectum that arose after the use of up to 6 suppositories of a preparation containing ergotamine daily over a period of 6 years. On the basis of a review of the literature the clinical, endoscopic and histological features of the ergotamine-induced colitis are characterized.

  8. Drug-induced hyperkalemia.

    Science.gov (United States)

    Ben Salem, Chaker; Badreddine, Atef; Fathallah, Neila; Slim, Raoudha; Hmouda, Houssem

    2014-09-01

    Hyperkalemia is a common clinical condition that can be defined as a serum potassium concentration exceeding 5.0 mmol/L. Drug-induced hyperkalemia is the most important cause of increased potassium levels in everyday clinical practice. Drug-induced hyperkalemia may be asymptomatic. However, it may be dramatic and life threatening, posing diagnostic and management problems. A wide range of drugs can cause hyperkalemia by a variety of mechanisms. Drugs can interfere with potassium homoeostasis either by promoting transcellular potassium shift or by impairing renal potassium excretion. Drugs may also increase potassium supply. The reduction in renal potassium excretion due to inhibition of the renin-angiotensin-aldosterone system represents the most important mechanism by which drugs are known to cause hyperkalemia. Medications that alter transmembrane potassium movement include amino acids, beta-blockers, calcium channel blockers, suxamethonium, and mannitol. Drugs that impair renal potassium excretion are mainly represented by angiotensin-converting enzyme inhibitors, angiotensin-II receptor blockers, direct renin inhibitors, nonsteroidal anti-inflammatory drugs, calcineurin inhibitors, heparin and derivatives, aldosterone antagonists, potassium-sparing diuretics, trimethoprim, and pentamidine. Potassium-containing agents represent another group of medications causing hyperkalemia. Increased awareness of drugs that can induce hyperkalemia, and monitoring and prevention are key elements for reducing the number of hospital admissions, morbidity, and mortality related to drug-induced hyperkalemia.

  9. Advertising-Induced Embarrassment

    NARCIS (Netherlands)

    Puntoni, S.; Hooge, de I.E.; Verbeke, W.J.M.I.

    2015-01-01

    Abstract Consumer embarrassment is a concern for many advertisers. Yet little is known about ad-induced embarrassment. The authors investigate when and why consumers experience embarrassment as a result of exposure to socially sensitive advertisements. The theory distinguishes between viewing potent

  10. Injection-induced earthquakes

    Science.gov (United States)

    Ellsworth, William L.

    2013-01-01

    Earthquakes in unusual locations have become an important topic of discussion in both North America and Europe, owing to the concern that industrial activity could cause damaging earthquakes. It has long been understood that earthquakes can be induced by impoundment of reservoirs, surface and underground mining, withdrawal of fluids and gas from the subsurface, and injection of fluids into underground formations. Injection-induced earthquakes have, in particular, become a focus of discussion as the application of hydraulic fracturing to tight shale formations is enabling the production of oil and gas from previously unproductive formations. Earthquakes can be induced as part of the process to stimulate the production from tight shale formations, or by disposal of wastewater associated with stimulation and production. Here, I review recent seismic activity that may be associated with industrial activity, with a focus on the disposal of wastewater by injection in deep wells; assess the scientific understanding of induced earthquakes; and discuss the key scientific challenges to be met for assessing this hazard.

  11. Uterine contraction induced by Tanzanian plants used to induce abortion

    DEFF Research Database (Denmark)

    Nikolajsen, Tine; Nielsen, Frank; Rasch, Vibeke

    2011-01-01

    Women in Tanzania use plants to induce abortion. It is not known whether the plants have an effect.......Women in Tanzania use plants to induce abortion. It is not known whether the plants have an effect....

  12. Viral induced demyelination.

    Science.gov (United States)

    Stohlman, S A; Hinton, D R

    2001-01-01

    Viral induced demyelination, in both humans and rodent models, has provided unique insights into the cell biology of oligodendroglia, their complex cell-cell interactions and mechanisms of myelin destruction. They illustrate mechanisms of viral persistence, including latent infections in which no infectious virus is readily evident, virus reactivation and viral-induced tissue damage. These studies have also provided excellent paradigms to study the interactions between the immune system and the central nervous system (CNS). Although of interest in their own right, an understanding of the diverse mechanisms used by viruses to induce demyelination may shed light into the etiology and pathogenesis of the common demyelinating disorder multiple sclerosis (MS). This notion is supported by the persistent view that a viral infection acquired during adolescence might initiate MS after a long period of quiescence. Demyelination in both humans and rodents can be initiated by infection with a diverse group of enveloped and non-enveloped RNA and DNA viruses (Table 1). The mechanisms that ultimately result in the loss of CNS myelin appear to be equally diverse as the etiological agents capable of causing diseases which result in demyelination. Although demyelination can be a secondary result of axonal loss, in many examples of viral induced demyelination, myelin loss is primary and associated with axonal sparing. This suggests that demyelination induced by viral infections can result from: 1) a direct viral infection of oligodendroglia resulting in cell death with degeneration of myelin and its subsequent removal; 2) a persistent viral infection, in the presence or absence of infectious virus, resulting in the loss of normal cellular homeostasis and subsequent oligodendroglial death; 3) a vigorous virus-specific inflammatory response wherein the virus replicates in a cell type other than oligodendroglia, but cytokines and other immune mediators directly damage the

  13. Induced Charge Capacitive Deionization

    CERN Document Server

    Rubin, S; Biesheuvel, P M; Bercovici, M

    2016-01-01

    We demonstrate the phenomenon of induced-charge capacitive deionization (ICCDI) that occurs around a porous and conducting particle immersed in an electrolyte, under the action of an external electrostatic field. The external electric field induces an electric dipole in the porous particle, leading to capacitive charging of its volume by both cations and anions at opposite poles. This regime is characterized both by a large RC charging time and a small electrochemical charge relaxation time, which leads to rapid and significant deionization of ionic species from a volume which is on the scale of the particle. We show by theory and experiment that the transient response around a cylindrical particle results in spatially non-uniform charging and non-steady growth of depletion regions which emerge around the particle's poles. Potentially, ICCDI can be useful in applications where fast concentration changes of ionic species are required over large volumes.

  14. Curvature-induced dissipation

    CERN Document Server

    Debus, J -D; Succi, S; Herrmann, H J

    2015-01-01

    By inspecting the effect of curvature on a moving fluid, we find that local sources of curvature not only exert inertial forces on the flow, but also generate viscous stresses as a result of the departure of streamlines from the idealized geodesic motion. The curvature-induced viscous forces are shown to cause an indirect and yet appreciable energy dissipation. As a consequence, the flow converges to a stationary equilibrium state solely by virtue of curvature-induced dissipation. In addition, we show that flow through randomly-curved media satisfies a non-linear transport law, resembling Darcy-Forchheimer's law, due to the viscous forces generated by the spatial curvature. It is further shown that the permeability can be characterized in terms of the average metric perturbation.

  15. Tulipalin A induced phytotoxicity.

    Science.gov (United States)

    McCluskey, James; Bourgeois, Marie; Harbison, Raymond

    2014-04-01

    Tulipalin A induced phytotoxicity is a persistent allergic contact dermatitides documented in floral workers exposed to Alstroemeria and its cultivars.[1] The causative allergen is tulipalin A, a toxic glycoside named for the tulip bulbs from which it was first isolated.[2] The condition is characterized by fissured acropulpitis, often accompanied by hyperpigmentation, onychorrhexis, and paronychia. More of the volar surface may be affected in sensitized florists. Dermatitis and paronychia are extremely common conditions and diagnostic errors may occur. A thorough patient history, in conjunction with confirmatory patch testing with a bulb sliver and tuliposide A exposure, can prevent misdiagnosis. We report a case of Tulipalin A induced phytotoxicity misdiagnosed as an unresolved tinea manuum infection in a patient evaluated for occupational exposure.

  16. Induced pluripotent stem cells

    Institute of Scientific and Technical Information of China (English)

    Siddhartha Bhowmik; LI Yong

    2011-01-01

    Induced pluripotent stem (iPS) cells are a recent development which has brought a promise of great therapeutic values. The previous technique of somatic cell nuclear transfer (SCNT) has been ineffective in humans. Recent discoveries show that human fibroblasts can be reprogrammed by a transient over expression of a small number of genes; they can undergo induced pluripotency. iPS were first produced in 2006. By 2008, work was underway to remove the potential oncogenes from their structure. In 2009, protein iPS (piPS) cells were discovered. Surface markers and reporter genes play an important role in stem cell research. Clinical applications include generation of self renewing stem cells, tissue replacement and many more. Stem cell therapy has the ability to dramatically change the treatment of human diseases.

  17. Ofloxacin induced hypersensitivity reaction

    Directory of Open Access Journals (Sweden)

    Hari Babu Ramineni

    2015-01-01

    Full Text Available Ofloxacin is a commonly used antimicrobial agent to combat various infections. The adverse profile of quinolones includes gastrointestinal symptoms, which are the most frequent, neuropsychiatric symptoms, hematologic abnormalities are less common. We report a rare case of ofloxacin induced hypersensitivity reaction in a 57 year old female patient with complaints of rashes over the axilla, upper limb and back, abdomen, thorax associated with exfoliation of skin all over the axilla associated with severe itching. Based on history and clinical examination patient was diagnosed as ofloxacin induced hypersensitivity reaction and was successfully treated with antihistamines and corticosteroids. Pharmacovigilance should be a part of patient care in order to reduce occurrence of adverse drug reaction and also encourage practitioners in reporting so as to gather more and more data regarding adverse drug reactions. [Int J Res Med Sci 2015; 3(1.000: 349-351

  18. Cyanamide-induced granulocytopenia.

    Science.gov (United States)

    Ajima, M; Usuki, K; Igarashi, A; Okazaki, R; Hamano, K; Urabe, A; Totsuka, Y

    1997-09-01

    We report a 64-year-old male with granulocytopenia and dermatitis due to cyanamide treatment. We administered cyanamide for alcoholism. After about one month he suffered from scaly erythema over his whole body and granulocytopenia (granulocyte; 140/microliter) with maturation arrest in bone marrow. After cessation of cyanamide and the start of granulocyte colony-stimulating factor administration, the skin eruption ameliorated gradually, and the peripheral blood granulocyte counts increased. Cyanamide showed positive results in the drug lymphocyte stimulation test (198%) and the patch test led to the diagnosis of granulocytopenia and dermatitis induced by cyanamide. After restarting glibenclamide and diazepam administration, his granulocytopenia did not reoccur. To our knowledge, this is the first report of a case with granulocytopenia induced by cyanamide.

  19. Sepsis-induced Cardiomyopathy

    Science.gov (United States)

    Romero-Bermejo, Francisco J; Ruiz-Bailen, Manuel; Gil-Cebrian, Julián; Huertos-Ranchal, María J

    2011-01-01

    Myocardial dysfunction is one of the main predictors of poor outcome in septic patients, with mortality rates next to 70%. During the sepsis-induced myocardial dysfunction, both ventricles can dilate and diminish its ejection fraction, having less response to fluid resuscitation and catecholamines, but typically is assumed to be reversible within 7-10 days. In the last 30 years, It´s being subject of substantial research; however no explanation of its etiopathogenesis or effective treatment have been proved yet. The aim of this manuscript is to review on the most relevant aspects of the sepsis-induced myocardial dysfunction, discuss its clinical presentation, pathophysiology, etiopathogenesis, diagnostic tools and therapeutic strategies proposed in recent years. PMID:22758615

  20. OXYTOCIN INDUCED NEONATAL HYPERBILIRUBINEMIA

    Directory of Open Access Journals (Sweden)

    Smita S.

    2015-05-01

    Full Text Available INTRODUCTION: Hyperbilirubinemia is one of the most common causes of health problems, observed in 60% of term and 80% of preterm infants in the first week of life . Hyperbilirubinemia leads to neurotoxicity in severe condition. Some studies suggests that liberal use of oxytocin for inducing labour is one of the factor which lead to neonatal hyperbilirubinemia. OBJECTIVE: To compare the effect of oxytocin and neonatal bilirubin levels with spontaneous vaginal delivery . MATERIALS AND METHOD S : 100 full term parturients were selected for this study. The subjects were divided into two groups. 50 healthy babies of women who had oxytocin induced labour and 50 healthy babies of women with normal vaginal delivery following spontaneous onset of labour formed the control group. Neon atal serum bilirubin was measured on day 1, 3 and 5 after delivery. Bilirubin was measured by spectrophotometry. Data was analysed in ms excel sheet using spss 19.0v. Statistical analysis was done by using unpaired‘t’ test. RESULTS: There was significant i ncrease in bilirubin level in oxytocin induced group compared to control group on day 1 and 3. There was insignificant increase in bilirubin level in oxytocin induced group on day 5. However the level of serum bilirubin is within normal limits as bilirubin level normally rises on till 4 th day and decreases thereafter. CONCLUSION: Neonatal hyperbilirubinemia may be due to oxytocin administration by continues IV infusion which results in erythrocyte swell and rupture. Increase in bilirubin level in oxytocin i nduced group is within physiological limits

  1. Polarization induced doped transistor

    Energy Technology Data Exchange (ETDEWEB)

    Xing, Huili (Grace); Jena, Debdeep; Nomoto, Kazuki; Song, Bo; Zhu, Mingda; Hu, Zongyang

    2016-06-07

    A nitride-based field effect transistor (FET) comprises a compositionally graded and polarization induced doped p-layer underlying at least one gate contact and a compositionally graded and doped n-channel underlying a source contact. The n-channel is converted from the p-layer to the n-channel by ion implantation, a buffer underlies the doped p-layer and the n-channel, and a drain underlies the buffer.

  2. Drug-induced diarrhoea.

    Science.gov (United States)

    Chassany, O; Michaux, A; Bergmann, J F

    2000-01-01

    Diarrhoea is a relatively frequent adverse event, accounting for about 7% of all drug adverse effects. More than 700 drugs have been implicated in causing diarrhoea; those most frequently involved are antimicrobials, laxatives, magnesium-containing antacids, lactose- or sorbitol-containing products, nonsteroidal anti-inflammatory drugs, prostaglandins, colchicine, antineoplastics, antiarrhythmic drugs and cholinergic agents. Certain new drugs are likely to induce diarrhoea because of their pharmacodynamic properties; examples include anthraquinone-related agents, alpha-glucosidase inhibitors, lipase inhibitors and cholinesterase inhibitors. Antimicrobials are responsible for 25% of drug-induced diarrhoea. The disease spectrum of antimicrobial-associated diarrhoea ranges from benign diarrhoea to pseudomembranous colitis. Several pathophysiological mechanisms are involved in drug-induced diarrhoea: osmotic diarrhoea, secretory diarrhoea, shortened transit time, exudative diarrhoea and protein-losing enteropathy, and malabsorption or maldigestion of fat and carbohydrates. Often 2 or more mechanisms are present simultaneously. In clinical practice, 2 major types of diarrhoea are seen: acute diarrhoea, which usually appears during the first few days of treatment, and chronic diarrhoea, lasting more than 3 or 4 weeks and which can appear a long time after the start of drug therapy. Both can be severe and poorly tolerated. In a patient presenting with diarrhoea, the medical history is very important, especially the drug history, as it can suggest a diagnosis of drug-induced diarrhoea and thereby avoid multiple diagnostic tests. The clinical examination should cover severity criteria such as fever, rectal emission of blood and mucus, dehydration and bodyweight loss. Establishing a relationship between drug consumption and diarrhoea or colitis can be difficult when the time elapsed between the start of the drug and the onset of symptoms is long, sometimes up to several

  3. Inducement Prizes and Innovation.

    OpenAIRE

    Brunt, Liam; Lerner, Josh; Nicholas, Tom

    2011-01-01

    We examine prizes as an inducement for innovation using a novel dataset of awards for inventiveness offered by the Royal Agricultural Society of England from 1839 to 1939. At annual shows the RASE held competitive trials and awarded medals and monetary prizes (exceeding one million pounds in current prices) to spur technological development. We find large effects of the prizes on contest entries, especially for the Society’s gold medal. Matching award and patent data, we also detect large eff...

  4. Inducement prizes and innovation

    OpenAIRE

    Brunt, Liam; Lerner, Josh; Nicholas, Tom

    2011-01-01

    We examine prizes as an inducement for innovation using a novel dataset of awards for inventiveness offered by the Royal Agricultural Society of England from 1839 to 1939. At annual shows the RASE held competitive trials and awarded medals and monetary prizes (exceeding one million pounds in current prices) to spur technological development. We find large effects of the prizes on contest entries, especially for the Society’s gold medal. Matching award and patent data, we also detect large eff...

  5. Cisplatin Induced Nephrotoxicity

    Directory of Open Access Journals (Sweden)

    Seyed Seifollah Beladi Mousavi

    2014-02-01

    The standard approach to prevent cisplatin-induced nephrotoxicity is the administration of lower doses of cisplatin in combination with the administration of full intravenous isotonic saline before and after cisplatin administration. Although a number of pharmacologic agents including sodium thiosulfate, N-acetylcysteine, theophylline and glycine have been evaluated for prevention of nephrotoxicity, none have proved to have an established role, thus, additional clinical studies will be required to confirm their probable effects.

  6. Environment induced incoherent controllability

    OpenAIRE

    Romano, Raffaele; D'Alessandro, Domenico

    2005-01-01

    We prove that the environment induced entanglement between two non interacting, two-dimensional quantum systems S and P can be used to control the dynamics of S by means of the initial state of P. Using a simple, exactly solvable model, we show that both accessibility and controllability of S can be achieved under suitable conditions on the interaction of S and P with the environment.

  7. Immunotoxicity of washing soda in a freshwater sponge of India.

    Science.gov (United States)

    Mukherjee, Soumalya; Ray, Mitali; Ray, Sajal

    2015-03-01

    The natural habitat of sponge, Eunapius carteri faces an ecotoxicological threat of contamination by washing soda, a common household cleaning agent of India. Washing soda is chemically known as sodium carbonate and is reported to be toxic to aquatic organisms. Domestic effluent, drain water and various human activities in ponds and lakes have been identified as the major routes of washing soda contamination of water. Phagocytosis and generation of cytotoxic molecules are important immunological responses offered by the cells of sponges against environmental toxins and pathogens. Present study involves estimation of phagocytic response and generation of cytotoxic molecules like superoxide anion, nitric oxide and phenoloxidase in E. carteri under the environmentally realistic concentrations of washing soda. Sodium carbonate exposure resulted in a significant decrease in the phagocytic response of sponge cells under 4, 8, 16 mg/l of the toxin for 96h and all experimental concentrations of the toxin for 192h. Washing soda exposure yielded an initial increase in the generation of the superoxide anion and nitric oxide followed by a significant decrease in generation of these cytotoxic agents. Sponge cell generated a high degree of phenoloxidase activity under the experimental exposure of 2, 4, 8, 16 mg/l of sodium carbonate for 96 and 192 h. Washing soda induced alteration of phagocytic and cytotoxic responses of E. carteri was indicative to an undesirable shift in their immune status leading to the possible crises of survival and propagation of sponges in their natural habitat.

  8. Ethanol-induced analgesia

    Energy Technology Data Exchange (ETDEWEB)

    Pohorecky, L.A.; Shah, P.

    1987-09-07

    The effect of ethanol (ET) on nociceptive sensitivity was evaluated using a new tail deflection response (TDR) method. The IP injection of ET (0.5 - 1.5 g/kg) produced raid dose-dependent analgesia. Near maximal effect (97% decrease in TDR) was produced with the 1.5 g/kg dose of ET ten minutes after injection. At ninety minutes post-injection there was still significant analgesia. Depression of ET-induced nociceptive sensitivity was partially reversed by a 1 mg/kg dose of naloxone. On the other hand, morphine (0.5 or 5.0 mg/kg IP) did not modify ET-induced analgesia, while 3.0 minutes of cold water swim (known to produce non-opioid mediated analgesia) potentiated ET-induced analgesic effect. The 0.5 g/kg dose of ET by itself did not depress motor activity in an open field test, but prevented partially the depression in motor activity produced by cold water swim (CWS). Thus, the potentiation by ET of the depression of the TDR produced by CWS cannot be ascribed to the depressant effects of ET on motor activity. 21 references, 4 figures, 1 table.

  9. Induced QCD I: Theory

    CERN Document Server

    Brandt, Bastian B; Wettig, Tilo

    2016-01-01

    We explore an alternative discretization of continuum SU(N_c) Yang-Mills theory on a Euclidean spacetime lattice, originally introduced by Budzcies and Zirnbauer. In this discretization the self-interactions of the gauge field are induced by a path integral over N_b auxiliary boson fields, which are coupled linearly to the gauge field. The main progress compared to earlier approaches is that N_b can be as small as N_c. In the present paper we (i) extend the proof that the continuum limit of the new discretization reproduces Yang-Mills theory in two dimensions from gauge group U(N_c) to SU(N_c), (ii) derive refined bounds on N_b for non-integer values, and (iii) perform a perturbative calculation to match the bare parameter of the induced gauge theory to the standard lattice coupling. In follow-up papers we will present numerical evidence in support of the conjecture that the induced gauge theory reproduces Yang-Mills theory also in three and four dimensions, and explore the possibility to integrate out the ga...

  10. Induced abortion and psychosexuality.

    Science.gov (United States)

    Bianchi-Demicheli, F; Kulier, R; Perrin, E; Campana, A

    2000-12-01

    Little information exists on the impact of induced abortion on psychosexuality. Negative psychological effects and psychiatric complications due to termination of pregnancy seem to be rare. The objective of this study was to review the impact of induced abortion on sexuality and couple relationships. A systematic search of the literature was performed. Studies had to report a quantitative or qualitative evaluation of sexuality after pregnancy termination. Four studies were included. In the one prospective study using a control group, no difference in sexual functioning between groups after 1 year was reported. In the remaining observational studies, sexual dysfunction was reported in up to 30% of women after termination. Women undergoing abortion had significantly more conflicts in their partnerships. This was similar in all studies. Separation occurred in about one-quarter of all couples. Some studies report sexual dysfunction after termination of pregnancy. In about half of the couples separated after termination, abortion seemed not to have led to the separation. Psychological factors, together with relationship problems, might have played a role in failed contraception. The impact of induced abortion on sexuality needs to be studied in greater detail with rigorous methodology to draw firm conclusions.

  11. Duxorubicin-induced cardiotoxicity

    Directory of Open Access Journals (Sweden)

    Mukund Joshi

    2015-02-01

    Full Text Available The survival rate of cancer patients has greatly increased over the last 20 years. However, to achieve this result, a considerable price has been paid in terms of the side-effects associated with the intensive anticancer treatment. Cardiotoxicity of anticancer drugs is a serious problem. It is defined, by the National Cancer Institute, as the and ldquo;toxicity that affects the heart. and rdquo; This definition not only includes a direct effect of the drug on the heart, but also an indirect effect due to enhancement of hemodynamic flow alterations or due to thrombotic events. Cardiotoxicity can develop in a subacute, acute, or chronic manner. The risk for such effects depends upon: cumulative dose, rate of drug administration, mediastinal radiation, advanced age, younger age, female gender, pre-existing heart disease and hypertension. Anthracyclines, such as doxorubicin (DOX, cause serious cardiac side-effects. Acute tachyarrhythmias and acute heart failure (HF may occur after high doses, but these reactions are now rare due to changed dosage schemes (e.g. slower infusion with the aim to prevent this. However, the sub-acute or chronic cardiac effects of anthracyclines remain a clinical problem. Clinically, anthracycline induced cardiotoxicity manifests itself as left ventricular failure, which develops insidiously over months to years after completion of the anthracycline based chemotherapy and may result in congestive HF. The mechanism of anthracyclin induced cardiotoxicity is not totally unraveled. It is likely that the decline in myocardial function is related to apoptosis of cardiac myocytes that occurs apparently at random in the myocardium. Anthracyclin induced formation of reactive oxygen species (ROS in the presence of intracellular iron, impaired homeostasis of intracellular iron and calcium (that may facilitate the apoptosis induced by the ROS have been put forward as mechanisms. Cardiac protection can be achieved by limitation of the

  12. Comparative anti-inflammatory effects of anti-arthritic herbal medicines and ibuprofen.

    Science.gov (United States)

    Kang, Joshua J; Samad, Mohammed A; Kim, Kye S; Bae, Soochan

    2014-09-01

    Non-steroidal anti-inflammatory drugs (NSAIDS), such as ibuprofen, are widely used over-the-counter drugs to treat arthritis, but they are often associated with side effects. Herbal medicines have been used to treat various diseases such as arthritis, but the scientific profiles are not well understood. In this study, we examined, in comparison with ibuprofen, the inhibitory effects on various inflammatory markers of the most commonly used herbal medicines to treat arthritis, boswellia (Boswellia sapindales), licorice (Glycyrrhiza glabra), guggul (Commiphora wightii), and neem (Azadirachta indica). To elicit inflammatory response, we exposed mouse myoblast C2C12 cells to lipopolysaccharide (LPS). Tumor necrosis factor-alpha (TNF-α) and monocyte chemotactic protein-1 (MCP-1), which are cytokines activated during an inflammatory response, were determined. The optimal non-toxic concentration was determined by exposing different concentrations of drugs (from 0.01 to 10 mg/mL). Cell death measurement revealed that the drug concentrations lower than 0.05 mg/mL were non-toxic concentrations for each drug, and these doses were used for the main experiments. We found that neem and licorice showed robust anti-inflammatory responses compared with ibuprofen. However, boswellia and guggul did not demonstrate significant anti-inflammatory responses. We concluded that neem and licorice are more effective than ibuprofen in suppressing LPS-induced inflammation in C2C12 cells.

  13. Radiation Induced Genomic Instability

    Energy Technology Data Exchange (ETDEWEB)

    Morgan, William F.

    2011-03-01

    Radiation induced genomic instability can be observed in the progeny of irradiated cells multiple generations after irradiation of parental cells. The phenotype is well established both in vivo (Morgan 2003) and in vitro (Morgan 2003), and may be critical in radiation carcinogenesis (Little 2000, Huang et al. 2003). Instability can be induced by both the deposition of energy in irradiated cells as well as by signals transmitted by irradiated (targeted) cells to non-irradiated (non-targeted) cells (Kadhim et al. 1992, Lorimore et al. 1998). Thus both targeted and non-targeted cells can pass on the legacy of radiation to their progeny. However the radiation induced events and cellular processes that respond to both targeted and non-targeted radiation effects that lead to the unstable phenotype remain elusive. The cell system we have used to study radiation induced genomic instability utilizes human hamster GM10115 cells. These cells have a single copy of human chromosome 4 in a background of hamster chromosomes. Instability is evaluated in the clonal progeny of irradiated cells and a clone is considered unstable if it contains three or more metaphase sub-populations involving unique rearrangements of the human chromosome (Marder and Morgan 1993). Many of these unstable clones have been maintained in culture for many years and have been extensively characterized. As initially described by Clutton et al., (Clutton et al. 1996) many of our unstable clones exhibit persistently elevated levels of reactive oxygen species (Limoli et al. 2003), which appear to be due dysfunctional mitochondria (Kim et al. 2006, Kim et al. 2006). Interestingly, but perhaps not surprisingly, our unstable clones do not demonstrate a “mutator phenotype” (Limoli et al. 1997), but they do continue to rearrange their genomes for many years. The limiting factor with this system is the target – the human chromosome. While some clones demonstrate amplification of this chromosome and thus lend

  14. Catatonia induced by disulfiram

    Directory of Open Access Journals (Sweden)

    HK Goswami

    2015-07-01

    Full Text Available Catatonia is a clinical syndrome with varieties of psychomotor abnormalities of retardation and excitement. It can occur both in psychiatric and medical conditions. The aetiology of catatonia has not been fully described. Many researchers suggest that catatonia can occur due to deficiency of cortical gamma-aminobutyric acid (GABA which is an inhibitory neurotransmitter. Disulfiram is an agent that is being used in the treatment of alcohol dependence by its aversive effect. It has been seen that disulfiram is one of the causes of catatonia. This paper aimed to report a case of catatonia induced by disulfiram with no past history of any psychiatric or medical illness.

  15. Contrast induced nephropathy

    DEFF Research Database (Denmark)

    Stacul, Fulvio; van der Molen, Aart J; Reimer, Peter

    2011-01-01

    measures used to reduce the incidence of CIN, and the management of patients receiving metformin. Key Points • Definition, risk factors and prevention of contrast medium induced nephropathy are reviewed. • CIN risk is lower with intravenous than intra-arterial iodinated contrast medium. • eGFR of 45 ml....../min/1.73 m (2) is CIN risk threshold for intravenous contrast medium. • Hydration with either saline or sodium bicarbonate reduces CIN incidence. • Patients with eGFR ≥ 60 ml/min/1.73 m (2) receiving contrast medium can continue metformin normally....

  16. Contrast induced nephropathy

    DEFF Research Database (Denmark)

    Stacul, Fulvio; van der Molen, Aart J; Reimer, Peter

    2011-01-01

    measures used to reduce the incidence of CIN, and the management of patients receiving metformin. Key Points • Definition, risk factors and prevention of contrast medium induced nephropathy are reviewed. • CIN risk is lower with intravenous than intra-arterial iodinated contrast medium. • eGFR of 45 ml....../min/1.73 m (2) is CIN risk threshold for intravenous contrast medium. • Hydration with either saline or sodium bicarbonate reduces CIN incidence. • Patients with eGFR = 60 ml/min/1.73 m (2) receiving contrast medium can continue metformin normally....

  17. Antioxidant-Induced Stress

    Directory of Open Access Journals (Sweden)

    Robert D. Kross

    2012-02-01

    Full Text Available Antioxidants are among the most popular health-protecting products, sold worldwide without prescription. Indeed, there are many reports showing the benefits of antioxidants but only a few questioning the possible harmful effects of these “drugs”. The normal balance between antioxidants and free radicals in the body is offset when either of these forces prevails. The available evidence on the harmful effects of antioxidants is analyzed in this review. In summary, a hypothesis is presented that “antioxidant-induced stress” results when antioxidants overwhelm the body’s free radicals.

  18. Ofloxacin-induced hallucinations

    Directory of Open Access Journals (Sweden)

    Urmila Chauhan

    2013-01-01

    Full Text Available Drug-induced hallucinations are not uncommon, and may be misdiagnosed as psychiatric illness leading to unnecessary treatment with antipsychotics. If a temporal association of use of a drug having the potential to cause hallucinations is present, mere withdrawal of the drug causes complete improvement in the symptoms. There are reports of various untoward central nervous system adverse events following administration of fluoroquinolones, including delirium, hallucinations and psychosis, even after a single dose. We describe a 5-year-old girl who suffered visual hallucinations following ofloxacin use.

  19. Sitagliptin-induced hemolysis

    Directory of Open Access Journals (Sweden)

    Bekur Ragini

    2010-01-01

    Full Text Available Sitagliptin is a newer oral hypoglycemic drug of the dipeptidyl peptidase-IV inhibitor class. It appears to be a promising newer oral hypoglycemic agent. The advantages are the absence of hypoglycemia when used as monotherapy and they cause less gain weight. We report a case of sitagliptin-induced hemolysis, a rare side effect, not reported in the literature. As sitagliptin is widely used in type 2 diabetes mellitus physicians should be aware of the possibility of this rare but potentially serious adverse drug reaction.

  20. Cannabis induced asystole.

    Science.gov (United States)

    Brancheau, Daniel; Blanco, Jessica; Gholkar, Gunjan; Patel, Brijesh; Machado, Christian

    2016-01-01

    Cannabis or marijuana is the most used recreational, and until recently illegal, drug in the United States. Although cannabis has medicinal use, its consumption has been linked to motor vehicle accidents in dose dependent fashion. Marijuana and other cannabinoids produce a multitude of effects on the human body that may result in these motor vehicle accidents. Some of the effects that marijuana has been known to cause include altered sensorium, diminished reflexes, and increased vagal tone. We present a case of cannabis induced asystole from hypervagotonia.

  1. Drug-induced gynecomastia.

    Science.gov (United States)

    Eckman, Ari; Dobs, Adrian

    2008-11-01

    Gynecomastia is caused by drugs in 10 - 25% of all cases. The pathophysiologic mechanism for some drugs includes exogenous estrogens exposure, medications that cause hypogonadism, anti-androgenic effects and hyperprolactinemia. This manuscript reviews common examples of drug-induced gynecomastia, discussing the mechanisms and possible treatments. Discontinuing the medication is always the best choice; however, if this is not possible, then testosterone replacement therapy may be needed for hypogonadism. When a man is euogonadal, a trial of the anti-estrogen, tamoxifen or an aromatase inhibitor may be an option.

  2. Man-Induced Vibrations

    DEFF Research Database (Denmark)

    Jönsson, Jeppe; Hansen, Lars Pilegaard

    1994-01-01

    Human motion can cause various types of periodic or transient dynamic loads. The periodic loads are mainly due to jumping, running, dancing, walking and body rocking. Transient loads primarily result from single impulse loads, such as jumping and falling from elevated positions. The response...... concerned with spectator-induced vertical vibrations on grandstands. The idea is to use impulse response analysis and base the load description on the load impulse. If the method is feasable, it could be used in connection with the formulation of requirements in building codes. During the last two decades...

  3. Xerostomia induced by radiotherapy

    Directory of Open Access Journals (Sweden)

    Alimi D

    2015-08-01

    Full Text Available David Alimi Department of Anesthesiology, University of Pittsburgh Medical Center, Pittsburgh, PA, USAWe read with great interest the excellent review on xerostomia induced by radiotherapy, by Pinna et al.1 The authors should be congratulated for a very detailed review of the physiopathology, clinical symptoms, and therapeutic management of an extremely difficult condition. Although we agree that the use of anticholinergic medication represents treatment, it requires the patient to have residual salivary gland function. Unfortunately, it is well established that in most cases radiotherapy destroys most of the salivary gland and associated salivary secretions.     

  4. Trauma Induced Coagulopathy

    DEFF Research Database (Denmark)

    Genét, Gustav Folmer; Johansson, Per; Meyer, Martin Abild Stengaard

    2013-01-01

    It remains debated whether traumatic brain injury (TBI) induces a different coagulopathy compared to non-TBI. This study investigated traditional coagulation tests, biomarkers of coagulopathy and endothelial damage in trauma patients with and without TBI. Blood from 80 adult trauma patients were...... sampled (median of 68 min (IQR 48-88) post-injury) upon admission to our trauma centre. Plasma/serum were retrospectively analysed for biomarkers reflecting sympathoadrenal activation (adrenaline, noradrenaline), coagulation activation/inhibition and fibrinolysis (protein C, activated protein C, tissue...

  5. Electromagnetically Induced Entanglement.

    Science.gov (United States)

    Yang, Xihua; Xiao, Min

    2015-08-28

    Quantum entanglement provides an essential resource for quantum computation, quantum communication, and quantum network. How to conveniently and efficiently produce entanglement between bright light beams presents a challenging task to build realistic quantum information processing networks. Here, we present an efficient and convenient way to realize a novel quantum phenomenon, named electromagnetically induced entanglement, in the conventional Λ-type three-level atomic system driven by a strong pump field and a relatively weak probe field. Nearly perfect entanglement between the two fields can be achieved with a low coherence decay rate between the two lower levels, high pump-field intensity, and large optical depth of the atomic ensemble. The physical origin is quantum coherence between the lower doublet produced by the pump and probe fields, similar to the well-known electromagnetically induced transparency. This method would greatly facilitate the generation of nondegenerate narrow-band continuous-variable entanglement between bright light beams by using only coherent laser fields, and may find potential and broad applications in realistic quantum information processing.

  6. Antipsychotic-induced hyperprolactinemia.

    Science.gov (United States)

    Bostwick, Jolene R; Guthrie, Sally K; Ellingrod, Vicki L

    2009-01-01

    Use of antipsychotic agents has been associated with hyperprolactinemia, or elevated prolactin levels; this hormonal abnormality can interfere with the functioning of reproductive, endocrine, and metabolic systems. As antipsychotic agents are increasingly used for both United States Food and Drug Administration-approved and nonapproved indications, many individuals are at risk for developing antipsychotic-induced hyperprolactinemia. First-generation antipsychotics pose the greatest risk of causing this adverse effect; however, second-generation antipsychotics, particularly risperidone and paliperidone, also often increase prolactin secretion. Hyperprolactinemia has short- and long-term consequences that can seriously affect quality of life: menstrual disturbances, galactorrhea, sexual dysfunction, gynecomastia, infertility, decreased bone mineral density, and breast cancer. Although many of these are definitively connected to elevated prolactin levels, some, such as breast cancer, require further study. Both clinicians and patients should be aware of hyperprolactinemia-associated effects. To prevent or alleviate the condition, tailoring an antipsychotic drug regimen to each individual patient is essential. In addition, the risk of hyperprolactinemia can be minimized by using the lowest effective dose of the antipsychotic agent. If the effects of prolactin are evident, the drug can be changed to another agent that is less likely to affect prolactin levels; alternatively, a dopamine agonist may be added, although this may compromise antipsychotic efficacy. Additional research is needed to clarify the appropriate level of monitoring, the long-term effects, and the optimal treatment of antipsychotic-induced hyperprolactinemia.

  7. [Gluten induced diseases].

    Science.gov (United States)

    Frič, P; Zavoral, M; Dvořáková, T

    2013-05-01

    The introduction of cereals in human nutrition 10 000 years ago caused the occurrence of gluten induced diseases. This protein complex is involved in pathogenesis of wheat allergy, celiac disease, and gluten sensitivity. Wheat allergy and celiac disease are mediated by the system of adaptive immunity. Gluten sensitivity is a recently defined entity induced by innate immune mechanisms. These subjects present various intestinal and particularly extraintestinal symptoms. The differences between celiac disease and gluten intolerance include permeability of the intestinal mucosal barrier, histology of duodenal biopsy, and mucosal gene expression. The symptoms of gluten sensitivity may also have another genetic background of food intolerance independent of the HLADQ2, - DQ8 system and tissue transglutaminase (eg. in some psychiatric disorders). At present, there is no specific bio-marker of gluten sensitivity. The diagnosis is possible only by exclusion of other causes of symptoms and improvement on a glutenfree diet applied in a doubleblind placebo controlled manner with optional sequence of both stages to exclude the placebo effect due to nutritional intervention.

  8. Interferon induced thyroiditis.

    Science.gov (United States)

    Tomer, Yaron; Menconi, Francesca

    2009-12-01

    Interferon-alpha (IFNalpha) is used for the treatment of various disorders, most notable chronic hepatitis C virus (HCV) infection. One of the commonest side effects of IFNalpha therapy is thyroiditis, with up to 40% of HCV patients on IFNalpha developing clinical or subclinical disease. In some cases interferon induced thyroiditis (IIT) may result in severe symptomatology necessitating discontinuation of therapy. IIT can manifest as clinical autoimmune thyroiditis, presenting with symptoms of classical Hashimoto's thyroiditis or Graves' disease, or as non-autoimmune thyroiditis. Non-autoimmune thyroiditis can manifest as destructive thyroiditis, with early thyrotoxicosis and later hypothyroidism, or as non-autoimmune hypothyroidism. While the epidemiology and clinical presentation of IIT have been well characterized the mechanisms causing IIT are still poorly understood. It is likely that the hepatitis C virus (HCV) itself plays a role in the disease, as the association between HCV infection and thyroiditis is well established. It is believed that IFNalpha induces thyroiditis by both immune stimulatory effects and by direct effects on the thyroid. Early detection and therapy of this condition are important in order to avoid complications of thyroid disease such as cardiac arrhythmias.

  9. Drug-induced lupus.

    Science.gov (United States)

    Rubin, Robert L

    2005-04-15

    Autoantibodies and, less commonly, systemic rheumatic symptoms are associated with treatment with numerous medications and other types of ingested compounds. Distinct syndromes can be distinguished, based on clinical and laboratory features, as well as exposure history. Drug-induced lupus has been reported as a side-effect of long-term therapy with over 40 medications. Its clinical and laboratory features are similar to systemic lupus erythematosus, except that patients fully recover after the offending medication is discontinued. This syndrome differs from typical drug hypersensitivity reactions in that drug-specific T-cells or antibodies are not involved in induction of autoimmunity, it usually requires many months to years of drug exposure, is drug dose-dependent and generally does not result in immune sensitization to the drug. Circumstantial evidence strongly suggests that oxidative metabolites of the parent compound trigger autoimmunity. Several mechanisms for induction of autoimmunity will be discussed, including bystander activation of autoreactive lymphocytes due to drug-specific immunity or to non-specific activation of lymphocytes, direct cytotoxicity with release of autoantigens and disruption of central T-cell tolerance. The latter hypothesis will be supported by a mouse model in which a reactive metabolite of procainamide introduced into the thymus results in lupus-like autoantibody induction. These findings, as well as evidence for thymic function in drug-induced lupus patients, support the concept that abnormalities during T-cell selection in the thymus initiate autoimmunity.

  10. Induced Seismicity Monitoring System

    Science.gov (United States)

    Taylor, S. R.; Jarpe, S.; Harben, P.

    2014-12-01

    There are many seismological aspects associated with monitoring of permanent storage of carbon dioxide (CO2) in geologic formations. Many of these include monitoring underground gas migration through detailed tomographic studies of rock properties, integrity of the cap rock and micro seismicity with time. These types of studies require expensive deployments of surface and borehole sensors in the vicinity of the CO2 injection wells. Another problem that may exist in CO2 sequestration fields is the potential for damaging induced seismicity associated with fluid injection into the geologic reservoir. Seismic hazard monitoring in CO2 sequestration fields requires a seismic network over a spatially larger region possibly having stations in remote settings. Expensive observatory-grade seismic systems are not necessary for seismic hazard deployments or small-scale tomographic studies. Hazard monitoring requires accurate location of induced seismicity to magnitude levels only slightly less than that which can be felt at the surface (e.g. magnitude 1), and the frequencies of interest for tomographic analysis are ~1 Hz and greater. We have developed a seismo/acoustic smart sensor system that can achieve the goals necessary for induced seismicity monitoring in CO2 sequestration fields. The unit is inexpensive, lightweight, easy to deploy, can operate remotely under harsh conditions and features 9 channels of recording (currently 3C 4.5 Hz geophone, MEMS accelerometer and microphone). An on-board processor allows for satellite transmission of parameter data to a processing center. Continuous or event-detected data is kept on two removable flash SD cards of up to 64+ Gbytes each. If available, data can be transmitted via cell phone modem or picked up via site visits. Low-power consumption allows for autonomous operation using only a 10 watt solar panel and a gel-cell battery. The system has been successfully tested for long-term (> 6 months) remote operations over a wide range

  11. Diet-Induced Thermogenesis

    Institute of Scientific and Technical Information of China (English)

    GE Chang-rong; GAO Si-zheng; JIA Jun-jing; Mark Jois

    2008-01-01

    An immense amount of information has now accrued about the factors that influence the increment of heat and the efficiency with which the energy of food is used by different animal species.Heat increment is one of the major factors that decrease the efficiency of energy utilization.In growing animals,the free energy content of the basal ATP requirement is typically about one-third of dietary basal heat production (thermogenesis).Thermogenesis is an evolutionary and biologically significant mechanism for adaptive,homeostatic heat production in animals,including shivering thermogenesis (ST),nonshivefing thermogenesis (NST),diet-induced thermogenesis (DIT),febrile response (fever),and so on.The main focus of this review is on the effect of DIT on energy metabolism.

  12. Catatonia induced by levetiracetam.

    Science.gov (United States)

    Chouinard, Marie-Josée; Nguyen, Dang-Khoa; Clément, Jean-François; Bruneau, Marie-Andrée

    2006-02-01

    Levetiracetam (Keppra) is a novel antiepileptic drug approved as adjunctive treatment for adults with partial onset seizures. Although the drug is generally well tolerated, behavioral side effects have been reported in variable frequency. Most behavioral problems are mild in nature (agitation, hostility, anxiety, emotional lability, apathy, depression) and quickly resolve with discontinuation of medication. However, serious psychiatric adverse events may also occur with rare cases of psychosis and suicidal behavior. We report here the case of a 43-year-old woman who developed symptoms compatible with catatonia after being exposed to levetiracetam for the treatment of epilepsy. To our knowledge, it is the first reported case of catatonia induced by levetiracetam. We review the difficulties that may be encountered in the differential diagnosis of medical catatonia.

  13. Aripiprazole-induced priapism

    Directory of Open Access Journals (Sweden)

    Satya K Trivedi

    2016-01-01

    Full Text Available Priapism is a urologic emergency representing a true disorder of penile erection that persists beyond or is unrelated to sexual interest or stimulation. A variety of psychotropic drugs are known to produce priapism, albeit rarely, through their antagonistic action on alpha-1 adrenergic receptors. We report such a case of priapism induced by a single oral dose of 10 mg aripiprazole, a drug with the least affinity to adrenergic receptors among all atypical antipsychotics. Polymorphism of alpha-2A adrenergic receptor gene in schizophrenia patients is known to be associated with sialorrhea while on clozapine treatment. Probably, similar polymorphism of alpha-1 adrenergic receptor gene could contribute to its altered sensitivity and resultant priapism. In future, pharmacogenomics-based approach may help in personalizing the treatment and effectively prevent the emergence of such side effects.

  14. Migraine induced by hypoxia

    DEFF Research Database (Denmark)

    Arngrim, Nanna; Schytz, Henrik Winther; Britze, Josefine

    2016-01-01

    Migraine with aura is prevalent in high-altitude populations suggesting an association between migraine aura and hypoxia. We investigated whether experimental hypoxia triggers migraine and aura attacks in patients suffering from migraine with aura. We also investigated the metabolic and vascular...... response to hypoxia. In a randomized double-blind crossover study design, 15 migraine with aura patients were exposed to 180 min of normobaric hypoxia (capillary oxygen saturation 70-75%) or sham on two separate days and 14 healthy controls were exposed to hypoxia. Glutamate and lactate concentrations...... in the visual cortex were measured by proton magnetic resonance spectroscopy. The circumference of cranial arteries was measured by 3 T high-resolution magnetic resonance angiography. Hypoxia induced migraine-like attacks in eight patients compared to one patient after sham (P = 0.039), aura in three...

  15. Radiation induced pesticidal microbes

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Ki Yup; Lee, Y. K.; Kim, J. S.; Kim, J. K.; Lee, S. J.; Lim, D. S

    2001-01-01

    To isolate pesticidal microbes against plant pathogenic fungi, 4 strains of bacteria(K1. K3, K4, YS1) were isolated from mushroom compost and hot spring. K4, K1, K3, YS1 strain showed wide antifungal spectrum and high antifungal activities against 12 kinds of fungi. Specific proteins and the specific transcribed genes were found from the YS1 and its radiation-induced mutants. And knock-out mutants of antifungal activity were derived by transposon mutagenesis. From these knock-out mutants, the antifungal activity related genes and its modification by gamma-ray radiation are going to be studied. These results suggested that radiation could be an useful tool for the induction of functional mutants.

  16. Gadolinium-Induced Fibrosis.

    Science.gov (United States)

    Todd, Derrick J; Kay, Jonathan

    2016-01-01

    Gadolinium-based contrast agents (GBCAs), once believed to be safe for patients with renal disease, have been strongly associated with nephrogenic systemic fibrosis (NSF), a severe systemic fibrosing disorder that predominantly afflicts individuals with advanced renal dysfunction. We provide a historical perspective on the appearance and disappearance of NSF, including its initial recognition as a discrete clinical entity, its association with GBCA exposure, and the data supporting a causative relationship between GBCA exposure and NSF. On the basis of this body of evidence, we propose that the name gadolinium-induced fibrosis (GIF) more accurately reflects the totality of knowledge regarding this disease. Use of high-risk GBCAs, such as formulated gadodiamide, should be avoided in patients with renal disease. Restriction of GBCA use in this population has almost completely eradicated new cases of this debilitating condition. Emerging antifibrotic therapies may be useful for patients who suffer from GIF.

  17. [Cannabis-induced disorders].

    Science.gov (United States)

    Soyka, M; Preuss, U; Hoch, E

    2017-03-01

    Use and misuse of cannabis and marihuana are frequent. About 5% of the adult population are current users but only 1.2% are dependent. The medical use of cannabis is controversial but there is some evidence for improvement of chronic pain and spasticity. The somatic toxicity of cannabis is well proven but limited and psychiatric disorders induced by cannabis are of more relevance, e.g. cognitive disorders, amotivational syndrome, psychoses and delusional disorders as well as physical and psychological dependence. The withdrawal symptoms are usually mild and do not require pharmacological interventions. To date there is no established pharmacotherapy for relapse prevention. Psychosocial interventions include psychoeducation, behavioral therapy and motivational enhancement. The CANDIS protocol is the best established German intervention among abstinence-oriented therapies.

  18. Tibolone induced Bullous pemphigoid.

    Directory of Open Access Journals (Sweden)

    Vishal. R. Tandon, Annil Mahajan* & Sudhaa Sharma**

    2008-01-01

    Full Text Available We present first ever report of Bullous pemphigoid induced by Tibolone, a STEAR (Selective tissueestrogenic activity regulator that has progestogenic, some androgenic as well as estrogenic effects prescribedas an alternative to estrogen replacement therapy for treatment of climacteric symptoms in one ofthe 51 year old postmenopausal women with one and half year duration since menopause with previoushistory of use of estrogen progesterone pills during her active sexual life. The mechanism for this ADR isnot well understood. But possible explanation could be progesterone activity of the drug leading to autoimmunityas reported previously. The present patient was managed by dechallenge of drug, local, oral corticosteroidsand injectable, methotrexate, along with folic acid and antibiotic coverage fearing anemia andsecondary infections.

  19. Radiation induced microbial pesticide

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Ki Yup; Lee, Young Keun; Kim, Jae Sung; Kim, Jin Kyu; Lee, Sang Jae

    2000-01-01

    To control plant pathogenic fungi, 4 strains of bacteria (K1, K3, K4, YS1) were isolated from mushroom compost and hot spring. K4, K1, K3, YS1 strain showed wide antifungal spectrum and high antifungal activities against 13 kinds of fungi. Mutants of K1 and YS1 strains were induced by gamma-ray radiation and showed promising antifungal activities. These wild type and mutants showed resistant against more than 27 kinds of commercial pesticides among 30 kinds of commercial pesticides test particularly, YS1-1006 mutant strain showed resistant against hydrogen oxide. And mutants had increased antifungal activity against Botryoshaeria dothidea. These results suggested that radiation could be an useful method for the induction of functional mutants. (author)

  20. Radiation induced oral mucositis

    Directory of Open Access Journals (Sweden)

    P S Satheesh Kumar

    2009-01-01

    Full Text Available Patients receiving radiotherapy or chemotherapy will receive some degree of oral mucositis The incidence of oral mucositis was especially high in patients: (i With primary tumors in the oral cavity, oropharynx, or nasopharynx; (ii who also received concomitant chemotherapy; (iii who received a total dose over 5,000 cGy; and (iv who were treated with altered fractionation radiation schedules. Radiation-induced oral mucositis affects the quality of life of the patients and the family concerned. The present day management of oral mucositis is mostly palliative and or supportive care. The newer guidelines are suggesting Palifermin, which is the first active mucositis drug as well as Amifostine, for radiation protection and cryotherapy. The current management should focus more on palliative measures, such as pain management, nutritional support, and maintenance, of good oral hygiene

  1. Vincristine induced cranial polyneuropathy.

    Science.gov (United States)

    Bay, Ali; Yilmaz, Cahide; Yilmaz, Nebi; Oner, Ahmet Faik

    2006-06-01

    We describe a 5-year-old girl showed recovery of vincristine induced cranial polyneuropathy with pyridoxine and pyridostigmine treatment. A 5-year-old girl was diagnosed preB cell Acute Lymphoblastic Leukemia (ALL). She received chemotherapy according to the previously described modified St. Jude total therapy studies XIII. Five days after the fourth dose of vincristine, she presented with bilateral ptosis. Neurological examination revealed bilateral ptosis, and complete external opthalmoplegia with normal pupillary and corneal reflexes. She received 3.8 mg cumulative dose of vincristin before development of ptosis. A neuroprotective and neuroregenerative treatment attempt with pyridoxine and pyridostigmine was initiated. The bilateral ptosis markedly improved after 7 days of pyridoxine and pyridostigmine treatment and completely resolved after two weeks. The both agents were given for 3 weeks and were well tolerated without any side effects. During the follow up period we did not observe residue or recurrence of the ptosis.

  2. Paliperidone palmitate-induced sialorrhoea

    Directory of Open Access Journals (Sweden)

    Cengiz Cengisiz

    2016-03-01

    Full Text Available Extrapyramidal, metabolic, and cardiac side effects were reported for atypical antipsychotics; although a few resources show paliperidone-induced sialorrhea, there are no resources that show paliperidone palmitate-induced sialorrhea. In this paper, we present the paliperidone palmitate-induced sialorrhea side effects of a patient who applied on our clinic [Cukurova Med J 2016; 41(0.100: 8-13

  3. Alcohol-Induced Blackout

    Directory of Open Access Journals (Sweden)

    Dai Jin Kim

    2009-11-01

    Full Text Available For a long time, alcohol was thought to exert a general depressant effect on the central nervous system (CNS. However, currently the consensus is that specific regions of the brain are selectively vulnerable to the acute effects of alcohol. An alcohol-induced blackout is the classic example; the subject is temporarily unable to form new long-term memories while relatively maintaining other skills such as talking or even driving. A recent study showed that alcohol can cause retrograde memory impairment, that is, blackouts due to retrieval impairments as well as those due to deficits in encoding. Alcoholic blackouts may be complete (en bloc or partial (fragmentary depending on severity of memory impairment. In fragmentary blackouts, cueing often aids recall. Memory impairment during acute intoxication involves dysfunction of episodic memory, a type of memory encoded with spatial and social context. Recent studies have shown that there are multiple memory systems supported by discrete brain regions, and the acute effects of alcohol on learning and memory may result from alteration of the hippocampus and related structures on a cellular level. A rapid increase in blood alcohol concentration (BAC is most consistently associated with the likelihood of a blackout. However, not all subjects experience blackouts, implying that genetic factors play a role in determining CNS vulnerability to the effects of alcohol. This factor may predispose an individual to alcoholism, as altered memory function during intoxication may affect an individual‟s alcohol expectancy; one may perceive positive aspects of intoxication while unintentionally ignoring the negative aspects. Extensive research on memory and learning as well as findings related to the acute effects of alcohol on the brain may elucidate the mechanisms and impact associated with the alcohol- induced blackout.

  4. Radio-induced brain lesions

    Directory of Open Access Journals (Sweden)

    Gorgan Mircea Radu

    2014-03-01

    Full Text Available Introduction : Radiotherapy, an important tool in multimodal oncologic treatment, can cause radio-induced brain lesion development after a long period of time following irradiation.

  5. Ühendriikide endise presidendi juudikriitika vihastab ameeriklasi / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2007-01-01

    USA endise presidendi Jimmy Carteri raamatus "Palestiina: rahu, mitte apartheid" kirjutab autor Lähis-Ida rahosobitamisest ja peab rahukõneluste takerdumises süüdlaseks Iisraeli. Lisa: Katke Jimmy Carteri raamatust; Arvustus

  6. Orlistat-induced acute pancreatitis

    OpenAIRE

    2012-01-01

    Drug-induced pancreatitis is a rare but important cause of pancreatic injury. Orlistat is a pancreatic lipase inhibitor licensed for the treatment of obesity. We present a case of orlistat- induced mild acute pancreatitis that developed 8 days after starting treatment.

  7. Sparfloxacin induced toxic epidermal necrolysis

    Directory of Open Access Journals (Sweden)

    Ramesh M

    2003-05-01

    Full Text Available Toxic epidermal necrolysis (TEN is a life-threatening cutaneous adverse drug reaction. TEN is known to occur with the fluoroquinolone class of antibiotics, but only four cases of sparfloxacin induced TEN have been reported to the WHO database. This is another case report of sparfloxacin induced TEN.

  8. Chlorpromazine induced ocular myasthenia gravis

    Directory of Open Access Journals (Sweden)

    Nitya S

    2013-10-01

    Full Text Available Drug induced bilateral ptosis is a very rare adverse drug reaction. Here we report a case of ten year old male child with chlorpromazine induced bilateral ptosis due to ocular myasthenia. [Int J Basic Clin Pharmacol 2013; 2(5.000: 653-654

  9. Congruence properties of induced representations

    DEFF Research Database (Denmark)

    Mayer, Dieter; Momeni, Arash; Venkov, Alexei

    In this paper we study representations of the projective modular group induced from the Hecke congruence group of level 4 with Selberg's character. We show that the well known congruence properties of Selberg's character are equivalent to the congruence properties of the induced representations. ...

  10. Chloroquine-induced pruritus

    Directory of Open Access Journals (Sweden)

    Aghahowa S

    2010-01-01

    Full Text Available Chloroquine-induced pruritus remains one of the most common side-effects in the use of chloroquine in the prophylaxis and treatment of uncomplicated malaria before the advent of artemisinin-based combination therapies. It has been reported to vary from a tolerable to intolerable intensity among susceptible individuals resulting in disruption of treatment and development of resistance to the drug thus leading to therapeutic failures as reported. This scourge is quite challenging due to the complex physiologic mechanism that has not been fully elucidated. Factors observed to be responsible in the induction of pruritus such as age, race, heredity, density of parasitaemia; impurities in formulations, plasmodial specie, dosage form and metabolites have been discussed in this review. Efforts to ameliorate this burden have necessitated the use of drugs of diverse pharmacological classes such as antihistamines, corticosteroids and multivitamins either alone or as a combination. This review is to look into the use of chloroquine retrospectively, and consider its re-introduction due to its safety. Efficacy can be attained if the pruritic effect is resolved.

  11. Methaemoglobinemia Induced by MDMA?

    Directory of Open Access Journals (Sweden)

    L. L. W. Verhaert

    2011-01-01

    Full Text Available Case. A 45-year-old man with a blank medical history presented at the emergency room with dizziness and cyanosis. Physical examination showed cyanosis with a peripheral saturation (SpO2 of 85%, he did not respond to supplemental oxygen. Arterial blood gas analysis showed a striking chocolate brown colour. Based on these data, we determined the arterial methaemoglobin concentration. This was 32%. We gave 100% oxygen and observed the patient in a medium care unit. The next day, patient could be discharged in good condition. Further inquiry about exhibitions and extensive history revealed that the patient used MDMA (3,4- methylenedioxymethamphetamine, the active ingredient of ecstasy. Conclusion. Acquired methaemoglobinemia is a condition that occurs infrequently, but is potentially life threatening. Different nutrients, medications, and chemicals can induce methaemoglobinemia by oxidation of haemoglobin. The clinical presentation of a patient with methaemoglobinemia is due to the impossibility of O2 binding and transport, resulting in tissue hypoxia. Important is to think about methaemoglobin in a patient who presents with cyanosis, a peripheral saturation of 85% that fails to respond properly to the administration of O2. Because methaemoglobin can be reduced physiologically, it is usually sufficient to remove the causative agent, to give O2, and to observe the patient.

  12. Temozolomide-Induced Myelodysplasia

    Directory of Open Access Journals (Sweden)

    Ethan A. Natelson

    2010-01-01

    Full Text Available A patient who had received temozolomide (TMZ as a single agent in treatment of malignant glioma developed therapy-induced myelodysplasia (T-MDS. TMZ is an orally active imidazotetrazine which methylates guanine residues in DNA, ultimately causing single and double-strand DNA breaks leading to apoptotic cell death. TMZ does not chemically cross-link DNA and is considered a nonclassical alkylating agent, similar in structure and activity to dacarbazine. Observations on this patient, and on similarly treated others, suggest that the cumulative dose threshold (CDT for TMZ that predisposes to T-MDS and which may potentially lead to acute myeloid leukemia (T-AML is around 18000 to 20000 mg/sq m. Although the incidence of T-MDS and the predisposing CDT of TMZ may differ from that of other potentially leukemogenic compounds currently and formerly used as chemotherapeutic agents, all alkylating agents, including TMZ, should be considered potentially leukemogenic when administered long term.

  13. Methaemoglobinemia Induced by MDMA?

    Science.gov (United States)

    Verhaert, L L W

    2011-01-01

    Case. A 45-year-old man with a blank medical history presented at the emergency room with dizziness and cyanosis. Physical examination showed cyanosis with a peripheral saturation (SpO(2)) of 85%, he did not respond to supplemental oxygen. Arterial blood gas analysis showed a striking chocolate brown colour. Based on these data, we determined the arterial methaemoglobin concentration. This was 32%. We gave 100% oxygen and observed the patient in a medium care unit. The next day, patient could be discharged in good condition. Further inquiry about exhibitions and extensive history revealed that the patient used MDMA (3,4- methylenedioxymethamphetamine, the active ingredient of ecstasy). Conclusion. Acquired methaemoglobinemia is a condition that occurs infrequently, but is potentially life threatening. Different nutrients, medications, and chemicals can induce methaemoglobinemia by oxidation of haemoglobin. The clinical presentation of a patient with methaemoglobinemia is due to the impossibility of O(2) binding and transport, resulting in tissue hypoxia. Important is to think about methaemoglobin in a patient who presents with cyanosis, a peripheral saturation of 85% that fails to respond properly to the administration of O(2). Because methaemoglobin can be reduced physiologically, it is usually sufficient to remove the causative agent, to give O(2), and to observe the patient.

  14. Carbimazole-induced agranulocytosis

    Directory of Open Access Journals (Sweden)

    Anisha Mohan

    2015-01-01

    Full Text Available A 47 year old lady with hyperthyroidism for past 1½ years was initially on Carbimazole 20 mg orally then changed to 30 mg (during Hysterectomy but was taking 10 mg for last 1 year. She had intermittent fever with severe B/L bifrontal headache since 3 weeks. Routine investigations showed anaemia, neutropenia, leucopenia and CRP elevation. Peripheral smear showed normocytic normochromic anaemia with Rouleaux formation, leucopenia with 2% atypical cells and mild thrombocytosis. Widal test, RA factor (Rheumatoid factor test, Ig M (Immunoglobulin M dengue, Ig M Lepto, TORCH infections (Toxoplasmosis, Other (Syphilis, varicella-zoster, parvovirus B19, Cytomegalovirus and Herpes infections, ANA (Antinuclear antibody screen cANCA (Cytoplasmic antineutrophil cytoplasmic antibodies and pANCA (Perinuclear Anti-Neutrophil Cytoplasmic Antibodies tests were negative. Bone marrow aspiration showed normo to hypercellular marrow with 15% atypical cells and plasma cells. Multiple myeloma workup was done. Carbimazole was withheld. Conclusion: Drug induced agranulocytosis occurs with in 1-2 months of taking the antithyroid medication but onset delayed by 1½ year. De-challenge resulted normalization of blood parameters.

  15. Environ: E00682 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available resin Obtained by steam distillation Major component: alpha-Pinene [CPD:C09880] Essential oils [BR:br08321] ...Boswellia carterii [TAX:80276] Burseraceae Boswellia carterii a natural oleo gum

  16. Inducible HSP70 Protects Radiation-Induced Salivary Gland Damage

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Hae-June; Lee, Yoon-Jin; Kwon, Hee-Choong; Lee, Su-Jae; Bae, Sang-Woo; Lee, Yun-Sil [Korea Institute of Radiological Medical Sciences, Seoul (Korea, Republic of); Kim, Sung-Ho [Chonnam National University, Gwangju (Korea, Republic of)

    2006-07-01

    Irradiation (IR) delivered to the head and neck is a common treatment for malignancies. Salivary glands in the irradiation field are severely damaged, and consequently this resulted in marked salivary hypofunction. While the exact mechanism of salivary gland damage remains enigmatic, fluid secreting acinar cells are lost, and saliva output is dramatically reduced. Previously we have reported that inducible heat shock protein 70 (HSP70i) induced radioresistance in vitro. Moreover, HSP70i localized to salivary glands by gene transfer has great potential for the treatment of salivary gland. Herein, we investigated whether HSP70 can use as radio protective molecules for radiation-induced salivary gland damage in vivo.

  17. Protein (Viridiplantae): 302855728 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3068:1908 hypothetical protein VOLCADRAFT_100778 Volvox carteri f. nagariensis MEAREMEAREMEAREMEAREMEAREMEAREREAREMEAREREAREMEARE...MEAREMEAREMEAREMEAREMEAREMEAREREVREREAREMEAREMEAKEMEAREMEARERECPCDRRLYSYFGQCSGPPKTCSVPR ...

  18. Protein (Viridiplantae): 302830920 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 058 3068:3058 hypothetical protein VOLCADRAFT_87241 Volvox carteri f. nagariensis MPNPLAEMELLGFWGLKLVATVTDCHMSDSGRVMTAFVFKVVSYRNEAAST...LAEMELLGFWGLKLVATVTDCHMSDSGRVMTAFVFKVVSYRNEAASTMLTPEPLPESLEYLQAQVERALDERRELERVMWA...AREGRGGPSMLSCKQLETIELSTMGEAAELEVKRALEAITVVQYSMPNPLAEMELLGFWGLKLVATVTDCHMSDSGRVMTAFVFKVVSYRNEAASTMLTPEPLPESLEYLQAQVERALDERRELERVMWAAREGRGGPSMLSCKQLETIELSTMGEAAELEVKRALEEMFH ...

  19. Protein (Viridiplantae): 302857788 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 5109 3068:5109 hypothetical protein VOLCADRAFT_39472, partial Volvox carteri f. nagariensis PSGNPFGEPPSGNPLRGTPSGNPFGNPPPSG...NPLREPPPPLRGTPSGTPPFGEPPSGNPFREPLRGTLFGNPFGEPLRGTPSGNLFGEPFREPLRGTPSGNPFGEPLRGTPSGNPFGEPLRGTP ...

  20. Protein (Viridiplantae): 302857651 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available :8553 3068:8553 hypothetical protein VOLCADRAFT_39527, partial Volvox carteri f. nagariensis PLGTLWEPFGNPLGTLWEPFGNPLGTLWEPFGNPLGTL...WEPFGNPLGTLWEPFGNPLGTLWEPFGNPLGTLWEPFGNPLGTLWEPFGNPLGTLWEPFGNPLGTLWEPFGNPLGTLWEPFGNPLGTLWEPFGNPLGTLWEPFGNPLGTLWEPFGNPLGTLWEPFGNP ...

  1. Protein (Viridiplantae): 302836858 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 68:159 hypothetical protein VOLCADRAFT_90367 Volvox carteri f. nagariensis MPGSQSSKGLGLRLAPYWLSVWCCSNFPECSRRSAADRRHRPSQLRHLAP...SGPSNRAPGAAVEPVASLGHLRWSPHRGLPHLAPVAASTTSHSSGPSDSASSTSRSISKMEVATVGGGCFWCVEACYNMLQ

  2. Protein (Viridiplantae): 302856240 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 904 3068:2904 hypothetical protein VOLCADRAFT_37223, partial Volvox carteri f. nagariensis HPSMGPPGPFQSHPRHPSMGPPGPFESHARHPSM...GPPGPFQSHPRHPSMGPPGPIQSHPRHPSMGPPGPFQSHARHPSMGPPGPFQSHPRHPSMGPPGPFQSHPRHP ...

  3. Protein (Viridiplantae): 302854046 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 904 3068:2904 hypothetical protein VOLCADRAFT_69561, partial Volvox carteri f. nagariensis MGPPGPFESHARHPSMGPPGPFQSHPRHPSM...GPPGPFESHARHPSMGPPGPFQSHPRHPSMGPPGPIQSHPRHPSMGPPGPFQSHARHPSMGPPGPFQSHPRHPSKGPPGPFQSHPRHP ...

  4. Protein (Viridiplantae): 302855471 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3068:275 hypothetical protein VOLCADRAFT_70544 Volvox carteri f. nagariensis MRSASICHYTICKHMPYAICKHMRSASICHY...AICKHMPYAICKHIPYAICEHMPYATCKHMRSASICDLQAYAICKHMRSHMPYAICKHMRSASICHYAICKHMPYAICKHIPYAICEHMPYATCKHMRSASICDLQAY...AICKHIRSASICDLQAYAICKHMPSVICKHMRSASICDLQAYAICDLQACAICKHMRSTSICHYAICKHMPSCHLQAYAIMRSASISHYAICKHMPSCDLQAYAIMRSASICHYAICKHMPL ...

  5. Protein (Viridiplantae): 302856498 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3068:275 hypothetical protein VOLCADRAFT_71475 Volvox carteri f. nagariensis MRSAGICHMLAYAICKHMPYAICKHMPLCDL...QAYAIMRSSSICHYAICKHMQSASICHMFAYAICKHMPYAICKHMPCAICKHMPYAICGHMRSASICHMLAYAICKHMPYAICKHMPLTICKHMPLCDQQAYAICKHMPYVCICDLQAYAIMRSAGICDLQAYAIMLSAGICDLQAYVICLHMRSASICHMRSASICH ...

  6. Protein (Viridiplantae): 302855851 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3068:275 hypothetical protein VOLCADRAFT_70901, partial Volvox carteri f. nagariensis MQSASICNLQAYAICDLQAYAICKHMPYAICKHHMPYAICKHMRSA...SICDLQAYAICKHMLSASICDLQAYAVCKHMRSASICCLQAYAICKHLRSASICDLQAYVICKHMRSASICHMRSASICDLQAYAVCKHMRSASICSLQAYAVCKHMQSASICDLQAYAICKHMRFASMC ...

  7. Protein (Viridiplantae): 302855547 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3068:275 hypothetical protein VOLCADRAFT_70645, partial Volvox carteri f. nagariensis MRSASICHIRCASICDLQAYAT...SDVQAYAICKHMPDAICKHMPHSMCKHMRSASICDLQAYAICKHMRSASICDLQAYAICKHLPDTICKHMPHSMCKHMRSASICDLQAYAICKHMPSASICQMRSASICHIRCASICDLQAYARCDLQAYATFDVQTYAICKHLRSASICDLQAYAICKHMPHSMCKH ...

  8. Protein (Viridiplantae): 302842271 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3068:275 hypothetical protein VOLCADRAFT_81968 Volvox carteri f. nagariensis MRSARICDLQAYAICDLQAYAKCKHLPNASICDLQAYAICKHMRSA...SICDLQAYAICKHMRYAICKHMHYAHMRSASICHLQAYAICDLQAYAICDLQAYAICELQAYAICAIYAICKHMRSASICNMQVYAICKHMRSASRCTYAICDLQAYAICKHMRSASICDLQAYAICKHMCCILLNHNWMVASEDTDLEEFHPLK ...

  9. Protein (Viridiplantae): 302841701 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3068:275 hypothetical protein VOLCADRAFT_62437, partial Volvox carteri f. nagariensis MRSASICHIRCASICELQAYAI...CKHVRSASICDRQAYAICKHMPDTICKHMPHSMCKHMRSASICQIRPASICHIRCASICDLQAYATCKHMRAASICDRQAYAICKHMPDAICKHMPHSMCKHMRSASICQMRSASICHIRCASICDLQAYARCDLQAYAICKHMRSASICQIRCASICDL ...

  10. Protein (Viridiplantae): 302856118 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3068:275 hypothetical protein VOLCADRAFT_71227 Volvox carteri f. nagariensis MRCANICDLQAYAICKHMGCASICDLQPYAICNHMRSA...SICDLQAYAMCKHMRCASICDLQAYAICKHMRCASICDLQAYAICKHMRSASICDLQAYAMCKHMRSASICDLQAYALCKHMGCASICDVQAYAMCKHMRCASICDVQAYAMCKHMRSA...SICALQAYALCKHMRFASIWDVQAYEICKHMRCASICDLQAYALCKHMRSASICDVQAYAMCKHMRSA...SICDLQAYALCKHMGCASICDVQAYAMCKHMRCASICDVQAYAMCKHMRSASICALQAYALCKHMRFASIWDVQAYEICKHMRCASICDMQTYALCKHMRSASICDVQAYVLCKYM ...

  11. Protein (Viridiplantae): 302855974 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3068:275 hypothetical protein VOLCADRAFT_70990, partial Volvox carteri f. nagariensis MRSASICDLQAYAICKHLGCASICDAQAYAIWKHMRSA...SICDLQVYALCKHIGCASVCDLQAYAIICDLQAYAICKHMRCASICALQAYAICKHMRYYMRSASICDLQAYATCKHMPYAICKHMPYAICKHMPYAICKHMPYAICKHMRSASICHMRSASICDLQAYAICDLQAYAMLCLLCLL ...

  12. Protein (Viridiplantae): 302855864 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3068:275 hypothetical protein VOLCADRAFT_70912 Volvox carteri f. nagariensis MRSASICDLQAYVICKHIPYAICKHTPYAICKHMPYAICKHIPLCDLQAYAIMRSA...SICNYAIGKHMPLCDLQAYAICDLQAYTICDLQAYAICDLQAYAICKHMRSASICDLQAYMICKHIICDLQAYAICKHMRSASICDLQAYAICDLQAYAICKHMPYAICKHMPYAICKHMRSASICNLQAYAICDLQAYVICKHT ...

  13. Protein (Viridiplantae): 302856745 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3068:275 hypothetical protein VOLCADRAFT_71629 Volvox carteri f. nagariensis MRSASVCDLQAYAICKHMPDAICKHMPHSMCKHMRSASICDLQAYAICKHMRSA...SICDLQAYAICKHMPDAICKHMPHPMCKHMRSASICQMRSASICHIRCASICDLQAYATSDVQAYAICKHMPDAICKHMPHSMCKHMRSASICDLQAYAICKHMRSA...SICDLQAYAICKHLPDTICKHMPHSMCKHMRSASICDLQAYAICKHMPSASICQMRSAS

  14. Protein (Viridiplantae): 302852975 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3068:275 hypothetical protein VOLCADRAFT_68841 Volvox carteri f. nagariensis MPYAICKHMQYALCNHMQYAICKHMRSASICHMRPASMCNMRSA...SICDLQAYDKCDLQAYAICKNMPYAICKHMPYAICKHMPYAICKHMHLQAYAVCKHMPYAICKHMPYAICKHMPYAICKHMPYAICKDYNLQAYAICKHMRSA...SICDLQAYAICDLQACAICDLQAYAICKHMTNAICKHMPSARICHMRSASICHMRSASICHMRYAICDLQAYAVCKHTQSASICSL ...

  15. Protein (Viridiplantae): 302842712 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 4547 3068:4547 hypothetical protein VOLCADRAFT_63044 Volvox carteri f. nagariensis MRVQEKGRGGSKPEEKSRSGGRGGK...CTAKSRSGGRGGKCTAKRSRWQQAQRRRAAAAAGEGNAPQKGRGGSKPEEKSRSGGRGGKCTAKRRRSGGREGKCTAKRSRWQQAQRRRAAAAAREGNAPQKGRGGSKPEEK...SRSGGRGGKCTAKSRSGGRGGKCTAKRSRWQQAQRRRAAAAAGEGNARQKGRGGSKPEEKSRSGGRGGKCTAKRSRWQQAQRRRAAAAAGEGNAPQKGRGGSKPRGEEPQRRPGREMHDKN ...

  16. Protein (Viridiplantae): 302846807 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 6811 3068:6811 hypothetical protein VOLCADRAFT_37529, partial Volvox carteri f. nagariensis PGPPHIYLRRTAPPGPPHIYLRRTAPPGPPHIYLRRTAPP...GPPHIYLRRTAPPGPPHIYLRRTAPPGPPHIYLRRTAPPGPPHIYLRRTAPPGPPHIYLRRTAPPGPPHIHLRRTAPPGPCPP ...

  17. Protein (Viridiplantae): 302857690 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 56 3068:8556 hypothetical protein VOLCADRAFT_72041 Volvox carteri f. nagariensis MCSPRSLLTCMCSPRSLLTCMCSPRSLLARMCSPRSLLACMCSPRS...LLARMCSPRSLLARMCSPRSLLARMCSPRSLLTCMCSPRSLLARMCSPRSLLARMCSPRSLLARMCSPRSLLARMCSPRSLLARMCSPRSLLARMCSPRSLLACMCSPRS...LLACMCSPRSLLARMCSPRSLLARMCSPRSLLARMCSPRSLLACMCSPRSLLARMCSPRSLLARMCSPRSLLARMCSPRSLLARMCSPRSLLARMCSPRSLLARMCSPRPVRFFTQRNTDCDNTCVSVENVAL ...

  18. Protein (Viridiplantae): 302840846 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3068:1999 hypothetical protein VOLCADRAFT_92503 Volvox carteri f. nagariensis MWGVDGMWGVDGMWGVDGMWGVDGMWGVDGIWGVDGMWGVDGMWGVDGMW...GVDGMWGVDGIWGVDGMWGVDGMWGVDGMWGVDGMWGVDGIWGVDGMWGVDGMWGVDGIWGVDGMWGVDGMWGVDGMRV ...

  19. Protein (Viridiplantae): 302841890 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 777 3068:5777 hypothetical protein VOLCADRAFT_47984, partial Volvox carteri f. nagariensis TCCNTEAGAATCCNTEAGAATCCNTEAGAATCCNT...EAGAATCCNTEAGAATCCNTEAGAATCCNTEAGAATCCNTEAGAATCCNTEAGAATCCNTEAGAATCCNTEAGAATCC ...

  20. Protein (Viridiplantae): 302840219 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 5423 3068:5423 hypothetical protein VOLCADRAFT_117895, partial Volvox carteri f. nagariensis MARRGSAPSTAAVGPRVASGPR...PDAALVRREAEEAAAAPPSRHGLAAGSVNARAAQPFSGLFNTFGSGGGAAGGGGGGRPNGGSGTAAAASGPRRITSGRPGSGRGPQLLPPGGDHSSTSTAGGGPPS ...

  1. Protein (Viridiplantae): 302846750 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3068:1228 hypothetical protein VOLCADRAFT_95759 Volvox carteri f. nagariensis MRHGEDTSRHRGNEQKAPPSLPPSLPPSLPPSLPPSLPPSLPPSLPPSLPPS...LPPSLPPSLPPSLPPSLPPSLPPSLPPSLPPSLPPFLPPSLPPSLPPSLPPSLPPSLPPSLPPSLPPSLPPSLPPFLPPSLPPSLPPSLPPSLPPSLPPSLPPSLPPSPPPSLPPSLPACP ...

  2. Protein (Viridiplantae): 302841996 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3068:1909 hypothetical protein VOLCADRAFT_62572, partial Volvox carteri f. nagariensis PPSSVTHTRIPPSSVTHTRIPPSSGTHTRIPPSSGTHTRIPPS...SGTHTRIPPSSGTHSRIPPSSGTHSRIPPPSGTHTRIPPPSGTHTRIPPSSVTHTRIPPSSGTHTRIPPSSGTHTRIPPSSGTHTRIPPSSGTHTRIPPSSGTHTRIPPSSGTHTRIPPSSGTHTRIPPLGRLLLTAAKQHT ...

  3. Protein (Viridiplantae): 302853557 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 0 3068:1430 hypothetical protein VOLCADRAFT_69247, partial Volvox carteri f. nagariensis DPPSDWEADPPGDWEVDPPSDWEADPPSDWEADPPGDWEADPPS...DWEADPPGDWEADPPGDWEADPPSDWEADPPSDWEADPPGDWEADPPSDWEADPPGDWEADPPGDWEADPPSDWEADPPSDWEADPPSDWEADPPGDWEADPPSDWEGRHP ...

  4. Protein (Viridiplantae): 302846527 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 0 3068:1430 hypothetical protein VOLCADRAFT_65149, partial Volvox carteri f. nagariensis DPPSDWEADPPSDWEADPPTIGRLIPPSDWEADPPSDWEADPPS...DWKADPPSDWEGDPPSDWEADPPSDWEADPPSDWEADPPSDWEADPPSDWEADPP ...

  5. Protein (Viridiplantae): 302836407 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available VSAQDVESRNSNKPRPPKAPEAPQPPSPQPPSPKPPRQPKAPKPPSPKPPSPKPPSPKPPSRPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPS...PKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPKHPKAPEQPTAPKQP...8:155 hypothetical protein VOLCADRAFT_90121 Volvox carteri f. nagariensis MTRLAASSSPHRAMTSRLVLLAVVAVLCLMAPQG

  6. Protein (Viridiplantae): 302847044 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 0 3068:1430 hypothetical protein VOLCADRAFT_37371, partial Volvox carteri f. nagariensis PSELEADPPSEWEADPPSELEADPPSELEADPPSELGADPPS...ELEADPPSELEADPPSELEADPPSELEADPPSGLEADPPSELEADPPSELEADPPSESEADPP ...

  7. Protein (Viridiplantae): 302836401 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 8:155 hypothetical protein VOLCADRAFT_90115 Volvox carteri f. nagariensis MTRLAASSSPHRAMTSRLVLLAVVAVLCLMASQGVNAQIIIVEGTAEKSPPPKAPQPPS...PQPPSPQPPSPQPPSPQPPSPQPPSPQPPSPQPPSPQPPSPQPPSPQPPSPQPPSPKPPSPKPPSPPSPKPPSPKPPSPKAPY

  8. Protein (Viridiplantae): 302836413 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 8:154 hypothetical protein VOLCADRAFT_90125 Volvox carteri f. nagariensis MTSRLVLLAVVAVLCLMAPQGATAAGQTTGIEER...FTWNATWDSWDKALASILKKKSPPPSPQPPSPRPPRPSRPPPSPRPPPSPPPPSLPAPPPPSPSPPPPSPPPPSPLPPSPPPPSPFPPSPPPPSPLPPSPPPPSPPKS...SRLISKPNKWKSSATSSQQDPLHQSLLSRDSVPGTDLKAQENDIELEAKLSPASHAATITIRNSDDGKEPSPPSPPTSPSPPSPPNSPPQPNPPSPPNPPSPPS...PPNPPSPPSPPNPPSPPSPPKAPKSPFAPNAPGKEYEQFKKKKWMYIISNSKYSYEGADYFCQSKGYILVPYYGKYKKDHQDAAYSACYMSGKGCWLWDSEEGSCPYVDPKGDGEAYEGDCNDKNYAFCYRGWGEKKKQP ...

  9. Protein (Viridiplantae): 302831395 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 0 3068:1430 hypothetical protein VOLCADRAFT_56839, partial Volvox carteri f. nagariensis DPPSDWEADPPSDWEADPPSDWEADPPSDWEADPPSDWEADPPS...DWEADPPSDWEADPPSDWEADPPSDWEADPPSDWEADPPSDWEADPPSDWEADPPSDWGADPPSDWEADPPSDWEADPPSDWEADPPSDWKADLPSDWKADPPSD ...

  10. Protein (Viridiplantae): 302856447 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 068:309 hypothetical protein VOLCADRAFT_71439, partial Volvox carteri f. nagariensis MLADRICSQIAYGTCLQTVYACIMQMHAHMYNISH...ISYIAYRILHIAYRILHIAYRISHIAYCILHIAYCISHIPYRCIWHIAYCILHIAYCISHIAYCISHIAYCILHIAYCISHIAY ...

  11. Protein (Viridiplantae): 302842451 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 068:309 hypothetical protein VOLCADRAFT_93481 Volvox carteri f. nagariensis MRICITYRISYIAYRILHIAYRILHIAYRILHIAYCISHIAYCISH...IAYCILHIAYCILHIAYRILHIAYCISHIAAYGISHITYRISHIANCMHIAAYRISLHIAAYCISHIHICIYAHI ...

  12. Protein (Viridiplantae): 302842580 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 068:309 hypothetical protein VOLCADRAFT_62920, partial Volvox carteri f. nagariensis CILHIAYCILHIAYCILHIAYCILHIAYRILHIAYRISHIAYCISH...IAYCISHIACRISHIAYCISHIAYRILHIPYRCIWHIAYHIPHIAYRKLHAYRCISHIAAYRCILHIAYTYMHICTYTKHKT ...

  13. Protein (Viridiplantae): 302857466 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 068:309 hypothetical protein VOLCADRAFT_71945 Volvox carteri f. nagariensis MRICLHIAYVCISHIAYRICACLHIAISHIIHIAYRILPIAYCISHIAYCISH...IAYCILHIAYCISHIAYRISHIAYCISHIAYCISHIAYCILHIAYCILHIAYCILHIAYCILHIAYCILHIAYCILHIAYCILHIAAYGILHIAYAYRSQHSIA ...

  14. Protein (Viridiplantae): 302837846 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 068:309 hypothetical protein VOLCADRAFT_90903 Volvox carteri f. nagariensis MQMHIVYCISHIAYCILHIAYRILHIAYCISHIAYRILHIAYCILHIAYCISH...VAYCISHIPYRCIWHIARISHTAYRIPQITYRCISHIAAYRCILHITYTYMYIYAHI ...

  15. Protein (Viridiplantae): 302855806 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 068:309 hypothetical protein VOLCADRAFT_35996, partial Volvox carteri f. nagariensis HIAYCISHIAYCISHIAYCISHIAYCILHIAYCISH...IAYCVSHIAYRILHIAYRILHIAYRILHIAYCILHIAYCILHIAYRISHIAYCISHPYRCIWHIAY ...

  16. Protein (Viridiplantae): 302837844 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 068:309 hypothetical protein VOLCADRAFT_60268, partial Volvox carteri f. nagariensis CILHIAYCILHIAYCILHIAYCILHIAYCILHIAYCISHIAYRISH...ITYRILHIAYCISHIAYCISHIAYRISHIPYPISHIPYHCIWHIAYHIPHIAYRKLHIAAYRISLHIAAYCISHIHICIYAHNET ...

  17. Protein (Viridiplantae): 302848645 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 068:309 hypothetical protein VOLCADRAFT_96833 Volvox carteri f. nagariensis MRICITYRTYRILHIAYCILHIAYCILHIAYRISHIAYCISHIAYRISHIAAYGISH...IAYCISHIAYRISHIAYRILHIAYCILHIAYRISHIPYRCIWHIAYHIPHIAHRKLHIAAYRISLHIAPYCISHIHICIYAHI ...

  18. Protein (Viridiplantae): 302855635 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 068:309 hypothetical protein VOLCADRAFT_100737 Volvox carteri f. nagariensis MYNISHIVYCISHIAYCISHIAYRISHIAYRILHIAYCISHIAYCISHIAYCISH...IAYRISHIPYRCTISLHMAYRISHTARISHIANCISLHIAYCILHIAYCISHIAYPISLHHIAAYGISHITYRTHIAYRKLHIAAYRISLHIAAYCISHIHICIYAHI ...

  19. Protein (Viridiplantae): 302853005 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 068:309 hypothetical protein VOLCADRAFT_99209 Volvox carteri f. nagariensis MQMHAHTYNISHIVYCISHIAYCISHIAYRISHIAYRISH...IVYRVSHIAYRILHIAYCILHIAYCILHIAYCILHIAYCILHIAYCILHIAYRISHIAAYMAYRISHTAYRISQIAYRCISHIAAYRCILHITYMHIIYAHI ...

  20. Protein (Viridiplantae): 302830706 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 98 3068:2998 hypothetical protein VOLCADRAFT_103166 Volvox carteri f. nagariensis MSHHQSLAAGHARVLANSSLTCSRFVRGRRVCHQTQPTSLRCRHQLDRFAL...LASANEPITSASNGAVLDKRSGRMTYKPLSYGEMVNDAVDSVVSAIGDNLKWLEVEFPALPTNVDGYKGSSDLFIDSNTQLAL

  1. Protein (Viridiplantae): 302831251 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3162 3068:3162 hypothetical protein VOLCADRAFT_87297 Volvox carteri f. nagariensis MNSSWMYRWYDDRWPDATSNASLNSAAGQQLLRALQEAQAQQAQTIAQ...QAQTIAQQAQIIAQLQATIAQRAQIIAQLQATIAQLQRDIKALQVAQQAPRWRGLLRLFSCC ...

  2. Protein (Viridiplantae): 302834010 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 883 3068:1883 hypothetical protein VOLCADRAFT_58297, partial Volvox carteri f. nagariensis PALPRTALPSAAPPSPAPPSAAPPSPAPPSAAPPSPAPPS...AAPPSPAPPSAAPPSPKPPSTADSGPPSCPYTRPPDQPAPPRFPPFPPRFATPGPGPPTSLHAPSHHPPFPFHLPSLLPSCAFPS

  3. Protein (Viridiplantae): 302839916 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3068:1666 hypothetical protein VOLCADRAFT_92089 Volvox carteri f. nagariensis MAASTWGEYLGKTGWEKIPCIPAYPQTCIPAYLHTCIPAYLHTCIPAYLHTCI...PAYLHTCIPAYLHTCIPAYLHIPAHTCIQVAKRVLILLAEALSKAKDYASHSKTPPRAGRTYLGTQQLYQVM ...

  4. Protein (Viridiplantae): 302847488 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 6958 3068:6958 hypothetical protein VOLCADRAFT_36625, partial Volvox carteri f. nagariensis HLLGSTHPVQYLRSSTHPVQHLLGSTYFVQHLLGS...TYFVQHMLGSTYFVQHLLGSTYFVQHLLGSTYFVQHLLGSVYFAQHLLGSPRPIRRLLG ...

  5. Protein (Viridiplantae): 302830610 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3068:915 hypothetical protein VOLCADRAFT_79257 Volvox carteri f. nagariensis MEDHTRPVLSLSVANGKLFSGSYDYTIKVWD...LQTLQKIRTLTGHNDAVRALALADGKLFSGSYDSTVRVWDENTLQCLEVLKGHTGPVRTLVHCRNNMFSGSYDRTVKVWDAETLQCLKTLEGHDDNVRVLAVGDRHMY...SGSWDKTIRVWSLSTLECVRMLEGHTEAVLALAVGNNVLVSGSYDTTVRFWDANSNYRCVRKCDGHDDAVRVLAAADGRVFSGSYDGTIGIW ...

  6. Protein (Viridiplantae): 302854914 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 68:852 hypothetical protein VOLCADRAFT_32673, partial Volvox carteri f. nagariensis CAFNCASKCMSNCALSCTLKRASNRGLSCALDSMDRCASNCTLQCASNC...VHCTLQCASNCVVRCTLNCALNCMFNCMSSCVVGCASKCASRRMSNCAVRCRKCFAICP ...

  7. Protein (Viridiplantae): 302837842 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 68:591 hypothetical protein VOLCADRAFT_60384 Volvox carteri f. nagariensis MNKTASQNAVQPTRTTLDKHCTVQCASNCVVWC...TLNCALNCMFNCTSSCVVGCALKCASRRMSNCAVRCSQCFAICALNPCCVTPAAVQCGTHCTLQCASNCVVQCTLNCTLNCTSNCMSSCVMGCALNRASQRMSNCAHCTLQCASNCVVQCTLNCTLNCTSNC...MSSCVMGCALNRASQRMSNCAVLCGQCLSICAFNRGAVRCAAVRCGAVRGPK ...

  8. Protein (Viridiplantae): 302852125 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 68:591 hypothetical protein VOLCADRAFT_68365, partial Volvox carteri f. nagariensis ASICAFNCAVRCAFNCALNCASNCASNC...AFNCMLRCALNCALNCTFNCMSSRVVGCPLKRASRRMSNCAVRCSAHCTLQCASNCVVRCTLNCALNCMFNCMSSCVVGCASKCASRRMSNCAVRCRKCFAICPLNPYQNETALRALSTRS ...

  9. Protein (Viridiplantae): 302846405 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 8:397 hypothetical protein VOLCADRAFT_95610 Volvox carteri f. nagariensis MRDEIASTKRSAWHSTCWTSSSTNEHVTELDAKF...SMLPADKVEAMRAATDFQNYPEFARAFPKCENAWHSTCWTSSSTNEHVTELDAKFSMLPADKVEAMRAATDFQNYPEFARAFPKCENGRIAPYGCNRDPQQSRFRLDP

  10. Heparin-induced thrombocytopenia

    Directory of Open Access Journals (Sweden)

    Shaikh Nissar

    2011-01-01

    Full Text Available In the last 7 decades heparin has remained the most commonly used anticoagulant. Its use is increasing, mainly due to the increase in the number of vascular interventions and aging population. The most feared complication of heparin use is heparin-induced thrombocytopenia (HIT. HIT is a clinicopathologic hypercoagulable, procoagulant prothrombotic condition in patients on heparin therapy, and decrease in platelet count by 50% or to less than 100,000, from 5 to 14 days of therapy. This prothrombotic hypercoagulable state in HIT patient is due to the combined effect of various factors, such as platelet activation, mainly the formation of PF4/heparin/IgG complex, stimulation of the intrinsic factor, and loss of anticoagulant effect of heparin. Diagnosis of HIT is done by clinical condition, heparin use, and timing of thrombocytopenia, and it is confirmed by either serotonin release assay or ELISA assay. Complications of HIT are venous/arterial thrombosis, skin gangrene, and acute platelet activation syndrome. Stopping heparin is the basic initial treatment, and Direct Thrombin Inhibitors (DTI are medication of choice in these patients. A few routine but essential procedures performed by using heparin are hemodialysis, Percutaneous Coronary Intervention, and Cardiopulmonary Bypass; but it cannot be used if a patient develops HIT. HIT patients with unstable angina, thromboembolism, or indwelling devices, such as valve replacement or intraaortic balloon pump, will require alternative anticoagulation therapy. HIT can be prevented significantly by keeping heparin therapy shorter, avoiding bovine heparin, using low-molecular weight heparin, and stopping heparin use for flush and heparin lock.

  11. Extreme geomagnetically induced currents

    Science.gov (United States)

    Kataoka, Ryuho; Ngwira, Chigomezyo

    2016-12-01

    We propose an emergency alert framework for geomagnetically induced currents (GICs), based on the empirically extreme values and theoretical upper limits of the solar wind parameters and of d B/d t, the time derivative of magnetic field variations at ground. We expect this framework to be useful for preparing against extreme events. Our analysis is based on a review of various papers, including those presented during Extreme Space Weather Workshops held in Japan in 2011, 2012, 2013, and 2014. Large-amplitude d B/d t values are the major cause of hazards associated with three different types of GICs: (1) slow d B/d t with ring current evolution (RC-type), (2) fast d B/d t associated with auroral electrojet activity (AE-type), and (3) transient d B/d t of sudden commencements (SC-type). We set "caution," "warning," and "emergency" alert levels during the main phase of superstorms with the peak Dst index of less than -300 nT (once per 10 years), -600 nT (once per 60 years), or -900 nT (once per 100 years), respectively. The extreme d B/d t values of the AE-type GICs are 2000, 4000, and 6000 nT/min at caution, warning, and emergency levels, respectively. For the SC-type GICs, a "transient alert" is also proposed for d B/d t values of 40 nT/s at low latitudes and 110 nT/s at high latitudes, especially when the solar energetic particle flux is unusually high.

  12. Immune Vasculitis Induced Atherosclerosis

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    The relationship between immune vasculitis and atherosclerosis was studied. The experimental model of weanling rabbits for immune vasculitis was reproduced by intravenous injection of 10 % bovine serum albumin. There were 6 groups: group A, 25 weanling rabbits with immune vasculitis subject to coronary arteriography; group B, 10 normal mature rabbits subject to coronary arteriography; group C, 10 weanling rabbits subject to coronary arteriography; group D, 8 weanling rabbits with vasculitis and cholesterol diet; group E, 8 weanling rabbits receiving single cholesterol diet; group F: 8 weanling rabbits receiving basic diet. Four weeks later, coronary arteriography was performed in groups A, B and C. The rabbits in groups D, E and F were sacrificed for the study of pathological changes in the coronary artery after 12 weeks. The results showed that the dilatation of coronary artery occurred in 6 rabbits of group A, but in groups B and C, no dilatation of coronary artery appeared. In comparison with group E, more severe atherosclerosis occurred in group D, showing the thickened plaque, fibrous sclerosis and atherosclerotic lesion. Percentage of plaques covering aortic intima, incidence of atherosclerosis of small coronary arteries and degree of stenosis of coronary arteries were significantly higher in group D than in group E (P<0.01). No atherosclerosis changes were found in group F. It was concluded that in the acute phase, the serum immune vasculitis can induce the dilatation of coronary artery of some weanling rabbits, and aggravate the formation of atherosclerosis in rabbits fed with cholesterol diet. Immune vasculitis is a new risk factor of atherosclerosis and ischemic heart disease.

  13. Does stress induce bowel dysfunction?

    Science.gov (United States)

    Chang, Yu-Ming; El-Zaatari, Mohamad; Kao, John Y

    2014-08-01

    Psychological stress is known to induce somatic symptoms. Classically, many gut physiological responses to stress are mediated by the hypothalamus-pituitary-adrenal axis. There is, however, a growing body of evidence of stress-induced corticotrophin-releasing factor (CRF) release causing bowel dysfunction through multiple pathways, either through the HPA axis, the autonomic nervous systems, or directly on the bowel itself. In addition, recent findings of CRF influencing the composition of gut microbiota lend support for the use of probiotics, antibiotics, and other microbiota-altering agents as potential therapeutic measures in stress-induced bowel dysfunction.

  14. Cisplatin-Induced Eosinophilic Pneumonia

    Directory of Open Access Journals (Sweden)

    Hideharu Ideguchi

    2014-01-01

    Full Text Available A 67-year-old man suffering from esophageal cancer was admitted to our hospital complaining of dyspnea and hypoxemia. He had been treated with cisplatin, docetaxel, and fluorouracil combined with radiotherapy. Chest computed tomography revealed bilateral ground-glass opacity, and bronchoalveolar lavage fluid showed increased eosinophils. Two episodes of transient eosinophilia in peripheral blood were observed after serial administration of anticancer drugs before the admission, and drug-induced lymphocyte stimulation test to cisplatin was positive. Thus cisplatin-induced eosinophilic pneumonia was suspected, and corticosteroid was effectively administered. To our knowledge, this is the first reported case of cisplatin-induced eosinophilic pneumonia.

  15. Noise-induced coherent switch

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Taking the famous genetic toggle switch as an example,we numerically investigated the effect of noise on bistability.We found that extrinsic noise resulting from stochastic fluctuations in synthesis and degradation rates and from the environmental fluctuation in gene regulatory processes can induce coherent switch,and that there is an optimal noise intensity such that the noise not only can induce this switch,but also can amplify a weak input signal.In addition,we found that the intrinsic noise introduced through the Poisson τ-leap algorithm cannot induce such a switch.

  16. Drug-Induced Metabolic Acidosis.

    Science.gov (United States)

    Pham, Amy Quynh Trang; Xu, Li Hao Richie; Moe, Orson W

    2015-01-01

    Metabolic acidosis could emerge from diseases disrupting acid-base equilibrium or from drugs that induce similar derangements. Occurrences are usually accompanied by comorbid conditions of drug-induced metabolic acidosis, and clinical outcomes may range from mild to fatal. It is imperative that clinicians not only are fully aware of the list of drugs that may lead to metabolic acidosis but also understand the underlying pathogenic mechanisms. In this review, we categorized drug-induced metabolic acidosis in terms of pathophysiological mechanisms, as well as individual drugs' characteristics.

  17. Systemic resistance induced by rhizosphere bacteria

    NARCIS (Netherlands)

    Loon, L.C. van; Bakker, P.A.H.M.; Pieterse, C.M.J.

    1998-01-01

    Nonpathogenic rhizobacteria can induce a systemic resistance in plants that is phenotypically similar to pathogen-induced systemic acquired resistance (SAR). Rhizobacteria-mediated induced systemic resistance (ISR) has been demonstrated against fungi, bacteria, and viruses in Arabidopsis, bean, carn

  18. Reading-Induced Absence Seizures

    OpenAIRE

    J Gordon Millichap

    1995-01-01

    A 12-year-old girl with a 2-year history of absence seizures induced by reading and diagnosed by video EEG is reported from The University of Texas Southwestern Medical Center, Dallas, and Riyadh Armed Forces Hospital, Saudi Arabia.

  19. Eigenvalue Conditions for Induced Subgraphs

    Directory of Open Access Journals (Sweden)

    Harant Jochen

    2015-05-01

    Full Text Available Necessary conditions for an undirected graph G to contain a graph H as induced subgraph involving the smallest ordinary or the largest normalized Laplacian eigenvalue of G are presented.

  20. Induced-charge Electrokinetic Phenomena

    CERN Document Server

    Bazant, M Z; Bazant, Martin Z.; Squires, Todd M.

    2003-01-01

    Motivated by the recent discovery of AC electro-osmosis near micro-electrodes, we predict a broad class of nonlinear electrokinetic phenomena involving induced interfacial charge. By considering various polarizable objects (metals or dielectrics) in DC and AC applied fields, we develop a simple physical picture of `induced-charge electro-osmosis' (ICEO), the fluid slip at a surface due to an electric field acting on the diffuse charge it induces. We also discuss `induced-charge electrophoresis' (ICEP), the analogous motion of a freely-suspended polarizable particle. Both differ significantly from their classical linear counterparts. We present a mathematical theory of ICEO flows in the weakly nonlinear limit of thin double layers. As an example, we calculate the time-dependent ICEO slip around a metallic sphere with a thin dielectric coating in a suddenly-applied DC field. We briefly discuss possible applications of ICEO to microfluidics and of ICEP to colloidal manipulation.

  1. Methadone Induced Sensorineural Hearing Loss

    OpenAIRE

    Chadi Saifan; Daniel Glass; Iskandar Barakat; Suzanne El-Sayegh

    2013-01-01

    Background. Sudden sensorineural hearing loss (SSHL) caused by opiate abuse or overuse has been well documented in the medical literature. Most documented case reports have involved either heroin or hydrocodone/acetaminophen. Recently, case reposts of methadone induced SSHL have been published. Case Report. We present the case of a 31-year-old man who developed SSHL after a methadone overdose induced stupor. He was subsequently restarted on methadone at his regular dose. On follow-up audiomet...

  2. Mutations induced in plant breeding

    Energy Technology Data Exchange (ETDEWEB)

    Barriga B, P. (Universidad Austral de Chile, Valdivia. Inst. de Produccion y Sanidad Vegetal)

    1984-10-01

    The most significant aspects of the use of ionizing radiations in plant breeding are reviewed. Aspects such as basic principles of mutation, expression and selection in obtention of mutants, methods for using induced mutations and sucess achieved with this methodology in plant breeding are reviewed. Results obtained in a program of induced mutation on wheat for high content of protein and lysine at the Universidad Austral de Chile are presented.

  3. Holographic Two-Photon Induced Photopolymerization

    Data.gov (United States)

    Federal Laboratory Consortium — Holographic two-photon-induced photopolymerization (HTPIP) offers distinct advantages over conventional one-photon-induced photopolymerization and current techniques...

  4. Victim-induced criminality.

    Science.gov (United States)

    Fooner, M

    1966-09-02

    about the probable effects on the administration of criminal justice. These are pragmatic problems; there is a third problem which may at this time seem speculative, but is, nevertheless, quite important. 3) To what extent will a particular proposal for victim compensation contribute to a temptation-opportunity pattern in victim behavior? In previous studies it has been pointed out that large numbers of our fellow Americans have tended to acquire casual money-handling habits-generically designated "carelessness"-which contribute to the national growth of criminality. How the victim helps the criminal was sketched in reports of those studies (10). It was made abundantly clear that human beings in our affluent society cannot be assumed to be prudent or self-protective against the hazards of crime. Even when the "victim" is not overtly acting to commit a crime-as in the case of the property owner who hires an arsonist-he often tempts the offender. Among the victims of burglary-statistically the most prevalent crime in the United States-are a substantial number of Americans who keep cash, jewelry, and other valuables carelessly at home or in hotel rooms to which the burglar has easy access through door or window. Victims of automobile theft-one of the fastest growing classes of crime-include drivers who leave the vehicle or its contents invitingly accessible to thieves. And so on with other classes of crime. As pointed out in previous studies, when victim behavior follows a temptation-opportunity pattern, it (i) contributes to a "climate of criminal inducements," (ii) adds to the economic resources available to criminal societies, and (iii) detracts from the ability of lawenforcement agencies to suppress the growth of crime.

  5. Induced airflow in flying insects II. Measurement of induced flow.

    Science.gov (United States)

    Sane, Sanjay P; Jacobson, Nathaniel P

    2006-01-01

    The flapping wings of insects and birds induce a strong flow over their body during flight. Although this flow influences the sensory biology and physiology of a flying animal, there are very little data on the characteristics of this self-generated flow field or its biological consequences. A model proposed in the companion paper estimated the induced flow over flying insects. In this study, we used a pair of hot wire anemometers to measure this flow at two locations near the body of a tethered flapping hawk moth, Manduca sexta. The axial inflow anemometer measured the airflow prior to its entry into the stroke plane, whereas the radial outflow anemometer measured the airflow after it crossed the stroke plane. The high temporal resolution of the hot wire anemometers allowed us to measure not only the mean induced flow but also subtle higher frequency disturbances occurring at 1-4 times the wing beat frequency. These data provide evidence for the predictions of a mathematical model proposed in the companion paper. Specifically, the absolute value of the measured induced flow matches the estimate of the model. Also, as predicted by the model, the induced flow varies linearly with wing beat frequency. Our experiments also show that wing flexion contributes significantly to the observed higher frequency disturbances. Thus, the hot wire anemometry technique provides a useful means to quantify the aerodynamic signature of wing flexion. The phasic and tonic components of induced flow influence several physiological processes such as convective heat loss and gas exchange in endothermic insects, as well as alter the nature of mechanosensory and olfactory stimuli to the sensory organs of a flying insect.

  6. Uterine contraction induced by Ghanaian plants used to induce abortion

    DEFF Research Database (Denmark)

    Larsen, Birgitte HV; Soelberg, Jens; Kristiansen, Uffe

    2016-01-01

    Ethnomedicinal observations from the time of the Atlantic slave trade show women in Ghana historically used plants as emmenagogues (menstruation stimulants) and to induce abortion. This study investigates the effect of four of these plants on uterine contraction. The historically used plants were...... response obtained with acetylcholine. Erythrina senegalensis, Ficus sur and Physalis angulata did not show activity. M. cecropioides can thus be used to induce contractions, which coincides well with the historical and extant use of M. cecropioides as emmenagogue/birth stimulant...

  7. Drug-induced cutaneous vasculitides.

    Science.gov (United States)

    Antiga, E; Verdelli, A; Bonciani, D; Bonciolini, V; Quintarelli, L; Volpi, W; Fabbri, P; Caproni, M

    2015-04-01

    Cutaneous vasculitides (CV) can be idiopathic or secondary to several triggers, including drugs, which account for up to 30% of all the cases of CV. Several drugs can induce CV, including some medications commonly used in dermatology, including minocycline, and several new drugs, such as anti-TNF agents. Different pathomecanisms are involved in the development of drug-induced CV, including the formation and deposition of immune complexes, the induction of neutrophil apoptosis, the formation of neoantigens between the drugs and proteins from the host, the shift of the immune response, and others. Although the diagnosis is difficult, because the clinical picture of drug-induced CV is in general indistinguishable from that of other forms of CV, it is important to recognize such entities in order to correctly manage the patient. Anamnesis, diagnostic algorithms to assess the likelihood of the association between a drug and a cutaneous reaction, skin biopsy and laboratory testing (including the search for antineutrophil cytoplasmic antibodies) are useful tools to make a diagnosis of drug-induced CV. About the therapy, while in idiopathic vasculitides the treatment is usually more aggressive and long-lasting, very often requiring a maintenance therapy with immunosuppressive drugs, in drug-induced CV the discontinuation of the suspected drug alone is usually enough to achieve complete remission, making the prognosis usually very good.

  8. Drug-induced lupus erythematosus

    Directory of Open Access Journals (Sweden)

    M. Carrabba

    2011-09-01

    Full Text Available Drug-induced lupus is a syndrome which share symptoms and laboratory characteristics with the idiopathic systemic lupus erythematosus (SLE. The list of medications implicated as etiologic agents in drug-induced lupus continues to grow. The terms used for this condition are lupus-like syndrome, drug-induced lupus erythematosus (DILE and drug related lupus. More than 80 drugs have been associated with DILE. The first case of DILE was reported in 1945 and associated with sulfadiazin. In 1953 it was reported that DILE was related to the use of hydralazine. Drugs responsible for the development of DILE can divided into three groups, but the list of these drugs is quite long because new drugs are included yearly in the list. The syndrome is characterised by arthralgia, myalgia, pleurisy, rash and fever in association with antinuclear antibodies in the serum. Recognition of DILE is important because it usually reverts within a few weeks after stopping the drug.

  9. Static behaviour of induced seismicity

    CERN Document Server

    Mignan, Arnaud

    2015-01-01

    The standard paradigm to describe seismicity induced by fluid injection is to apply nonlinear diffusion dynamics in a poroelastic medium. I show that the spatiotemporal behaviour and rate evolution of induced seismicity can, instead, be expressed by geometric operations on a static stress field produced by volume change at depth. I obtain laws similar in form to the ones derived from poroelasticity while requiring a lower description length. Although fluid flow is known to occur in the ground, it is not pertinent to the behaviour of induced seismicity. The proposed model is equivalent to the static stress model for tectonic foreshocks generated by the Non- Critical Precursory Accelerating Seismicity Theory. This study hence verifies the explanatory power of this theory outside of its original scope.

  10. Late onset clozapine induced agranulocytosis

    Directory of Open Access Journals (Sweden)

    Rajmohan Velayudhan

    2014-01-01

    Full Text Available Agranulocytosis is defined as an absolute neutrophil count less than 100/mm 3 in association with infectious disease. The risk of agranulocytosis is 0.38% of all clozapine treated cases and there is a relatively lesser incidence in Indian population. The risk of clozapine-induced agranulocytosis and neutropenia is highest in the first 6 months and higher in the initial 18 months after the onset of treatment. There have been very few reports of neutropenia and agranulocytosis after this period. There have so far been no reports of late onset clozapine induced agranulocytosis has been reported from India. A case of late onset clozapine induced agranulocytosis with possible mechanism of the same is reported.

  11. Surface-induced evaporative cooling

    Institute of Scientific and Technical Information of China (English)

    Ke Min; Yan Bo; Cheng Feng; Wang Yu-Zhu

    2009-01-01

    The effects of surface-induced evaporative cooling on an atom chip are investigated. The evolutions of temperature, number and phase-space density of the atom cloud are measured when the atom cloud is brought close to the surface. Rapid decrease of the temperature and number of the atoms is found when the atom-surface distance is < 100 μm. A gain of about a factor of five on the phase-space density is obtained. It is found that the efficiency of the surface-induced evaporative cooling depends on the atom-surface distance and the shape of the evaporative trap. When the atoms are moved very close to the surface, severe heating is observed, which dominates when the holding time is > 8 ms. It is important that the surface-induced evaporative cooling offers novel possibilities for the realization of a continuous condensation, where a spatially varying evaporative cooling is required.

  12. Validating induced seismicity forecast models - Induced Seismicity Test Bench

    CERN Document Server

    Kiraly-Proag, Eszter; Gischig, Valentin; Wiemer, Stefan; Karvounis, Dimitrios; Doetsch, Joseph

    2016-01-01

    Induced earthquakes often accompany fluid injection, and the seismic hazard they pose threatens various underground engineering projects. Models to monitor and control induced seismic hazard with traffic light systems should be probabilistic, forward-looking, and updated as new data arrive. In this study, we propose an Induced Seismicity Test Bench to test and rank such models; this test bench can be used for model development, model selection, and ensemble model building. We apply the test bench to data from the Basel 2006 and Soultz-sous-For\\^ets 2004 geothermal stimulation projects, and we assess forecasts from two models: Shapiro and Smoothed Seismicity (SaSS) and Hydraulics and Seismics (HySei). These models incorporate a different mix of physics-based elements and stochastic representation of the induced sequences. Our results show that neither model is fully superior to the other. Generally, HySei forecasts the seismicity rate better after shut-in, but is only mediocre at forecasting the spatial distri...

  13. Metal-induced crystallization fundamentals and applications

    CERN Document Server

    Wang, Zumin; Mittemeijer, Eric J

    2014-01-01

    Introduction to Metal-Induced CrystallizationAtomic Mechanisms and Interface Thermodynamics of Metal-Induced Crystallization of Amorphous Semiconductors at Low TemperaturesThermodynamics and Kinetics of Layer Exchange upon Low-Temperature Annealing Amorphous Si/Polycrystalline Al Layered StructuresMetal-Induced Crystallization by Homogeneous Insertion of Metallic Species in Amorphous SemiconductorsAluminum-Induced Crystallization: Applications in Photovoltaic TechnologiesApplications of Metal-Induced Crystallization for Advanced Flat-Panel DisplaysLaser-Assisted Meta

  14. Snowfall induced by corona discharge

    CERN Document Server

    Ju, Jingjing; Li, Ruxin; Du, Shengzhe; Sun, Haiyi; Liu, Yonghong; Tian, Ye; Bai, Yafeng; Liu, Yaoxiang; Chen, Na; Wang, Jingwei; Wang, Cheng; Liu, Jiansheng; Chin, S L; Xu, Zhizhan

    2016-01-01

    We demonstrated for the first time the condensation and precipitation (or snowfall) induced by a corona discharge inside a cloud chamber. Ionic wind was found to have played a more significant role than ions as extra Cloud Condensation Nuclei (CCN). 2.25 g of net snow enhancement was measured after applying a 30 kV corona discharge for 25 min. In comparison with another newly emerging femtosecond laser filamentation method, the snow precipitation induced by the corona discharge has about 4 orders of magnitude higher wall-plug efficiency under similar conditions.

  15. Induced radioactivity in LDEF components

    Science.gov (United States)

    Harmon, B. A.; Fishman, G. J.; Parnell, T. A.; Laird, C. E.

    1992-01-01

    A systematic study of the induced radioactivity of the Long Duration Exposure Facility (LDEF) is being carried out in order to gather information about the low earth orbit radiation environment and its effects on materials. The large mass of the LDEF spacecraft, its stabilized configuration, and long mission duration have presented an opportunity to determine space radiation-induced radioactivities with a precision not possible before. Data presented include preliminary activities for steel and aluminum structural samples, and activation subexperiment foils. Effects seen in the data show a clear indication of the trapped proton anisotropy in the South Atlantic Anomaly and suggest contributions from different sources of external radiation fluxes.

  16. Drug-induced hepatic injury

    DEFF Research Database (Denmark)

    Friis, Henrik; Andreasen, P B

    1992-01-01

    The Danish Committee on Adverse Drug Reactions received 1100 reports of suspected drug-induced hepatic injury during the decade 1978-1987. The causal relationship between drug and hepatic injury was classified as definite in 57 (5.2%) reports, probable in 989 (89.9%) reports, possible in 50 (4...... during the last 2 years of the decade. Based on consumption data, the incidence of hepatic injury due to sulindac was estimated to be 18-fold higher than that due to ibuprofen. Paracetamol was reported to induce acute cytotoxic as well as cholestatic reactions in non-alcoholic subjects taking therapeutic...

  17. Drug-induced hair loss.

    Science.gov (United States)

    2016-05-01

    Hair loss can have major psychological consequences. It can be due to a wide variety of causes, including hormonal disorders, dietary factors, infections, inflammation, trauma, emotional factors, and cancer. Drugs can also induce hair loss, by interacting with the hair growth cycle. Drug-induced hair loss may be immediate or delayed, sudden or gradual, and diffuse or localised. It is usually reversible after drug discontinuation. The drugs most often implicated in hair loss are anticancer agents, interferon, azole antifungals, lithium, immunosuppressants, and many other drugs belonging to a variety of pharmacological classes.

  18. Ceftriaxone-induced toxic hepatitis

    Institute of Scientific and Technical Information of China (English)

    Erdal Peker; Eren Cagan; Murat Dogan

    2009-01-01

    Toxic hepatitis or drug-induced liver injury encompasses a spectrum of clinical disease ranging from mild biochemical abnormalities to acute liver failure. The advantages of a long half-life, wide spectrum, high tissue penetration rate, and a good safety profile,make ceftriaxone, a third-generation cephalosporin,a frequent choice in the treatment of childhood infections. Previous studies have reported a few cases of high aspartate aminotransferase and alanine aminotransferase levels, along with three cases ofhepatitis caused by ceftriaxone. Here, we report a case of drug-induced toxic hepatitis in a patient who was treated with ceftriaxone for acute tonsillitis.

  19. An induced junction photovoltaic cell

    Science.gov (United States)

    Call, R. L.

    1974-01-01

    Silicon solar cells operating with induced junctions rather than diffused junctions have been fabricated and tested. Induced junctions were created by forming an inversion layer near the surface of the silicon by supplying a sheet of positive charge above the surface. Measurements of the response of the inversion layer cell to light of different wavelengths indicated it to be more sensitive to the shorter wavelengths of the sun's spectrum than conventional cells. The greater sensitivity occurs because of the shallow junction and the strong electric field at the surface.

  20. Anesthetic-Induced Developmental Neurotoxicity

    Institute of Scientific and Technical Information of China (English)

    Jia-RenLiu; Qian Liu; Jing Li; Sulpicio G. Soriano

    2011-01-01

    1 IntroductionMillions of newborn and infants receive anesthetic,sedative and analgesic drugs for surgery and painful procedures on a daily basis.Recent laboratory reports clearly demonstrate that anesthetic and sedative drugs induced both neuroapoptosis and neurocognitive deficits in laboratory models.This issue is of paramount interest to pediatric anesthesiologists and intensivists because it questions the safety of anesthetics used for fetal and neonatal anesthesia[1-2].In an attempt to summarize the rapidly expanding laboratorybased literature on anesthetic-induced developmental neurotoxicity (AIDN),this review will examine published reports on the characterization,mechanisms and alleviation of this phenomenon.

  1. Traffic forecasts ignoring induced demand

    DEFF Research Database (Denmark)

    Næss, Petter; Nicolaisen, Morten Skou; Strand, Arvid

    2012-01-01

    Although the phenomenon of induced traffic has been theorized for more than 60 years and is now widely accepted among transport researchers, the traffic-generating effects of road capacity expansion are still often neglected in transport modelling. Such omission can lead to serious bias in the as......Although the phenomenon of induced traffic has been theorized for more than 60 years and is now widely accepted among transport researchers, the traffic-generating effects of road capacity expansion are still often neglected in transport modelling. Such omission can lead to serious bias...

  2. Radiation-induced intestinal inflammation

    Institute of Scientific and Technical Information of China (English)

    Meritxell Mollà; Julián Panés

    2007-01-01

    Radiation induces an important inflammatory response in the irradiated organs, characterized by leukocyte infiltration and vascular changes that are the main limiting factor in the application of this therapeutic modality for the treatment of cancer. Recently, a considerable investigative effort has been directed at determining the molecular mechanisms by which radiation induces leukocyte recruitment, in order to create strategies to prevent intestinal inflammatory damage. In these review, we consider current available evidence on the factors governing the process of leukocyte recruitment in irradiated organs, mainly derived from experimental studies, with special attention to adhesion molecules, and their value as therapeutic targets.

  3. Bathtub suction-induced purpura.

    Science.gov (United States)

    Landers, Maeran C; Schroeder, Theresa L

    2004-01-01

    We report two cases of bathtub suction-induced purpura. Two girls, ages 9 and 14 years, developed recurring purpura "spontaneously" in the same lower back location and in the same U-shaped distribution. The patients had similar histopathologic findings, with extravasated erythrocytes and a sparse superficial inflammatory infiltrate. After extensive evaluation, one patient eventually admitted to self-inducing her lesions by creating suction against a bathtub. The second patient denied self-inflicting her lesions; however, her purpura improved when she stopped taking baths.

  4. Demand inducement as cheap talk.

    Science.gov (United States)

    Calcott, P

    1999-12-01

    The doctor-patient interaction is analysed in a game of cheap talk. Causes and consequences of imperfect agency are examined. One form of imperfect agency, supplier-induced demand, is a feature of neologism proof equilibria with some parameter values but not with others. The model is used to evaluate two tests that have been used to test for the existence of supplier-induced demand. The analysis suggests that the two tests, which compare the medical utilization of informed and uninformed consumers, are not valid.

  5. Conflict-Induced Perceptual Filtering

    Science.gov (United States)

    Wendt, Mike; Luna-Rodriguez, Aquiles; Jacobsen, Thomas

    2012-01-01

    In a variety of conflict paradigms, target and distractor stimuli are defined in terms of perceptual features. Interference evoked by distractor stimuli tends to be reduced when the ratio of congruent to incongruent trials is decreased, suggesting conflict-induced perceptual filtering (i.e., adjusting the processing weights assigned to stimuli…

  6. Photobiomodulation on alcohol induced dysfunction

    Science.gov (United States)

    Yang, Zheng-Ping; Liu, Timon C.; Zhang, Yan; Wang, Yan-Fang

    2007-05-01

    Alcohol, which is ubiquitous today, is a major health concern. Its use was already relatively high among the youngest respondents, peaked among young adults, and declined in older age groups. Alcohol is causally related to more than 60 different medical conditions. Overall, 4% of the global burden of disease is attributable to alcohol, which accounts for about as much death and disability globally as tobacco and hypertension. Alcohol also promotes the generation of reactive oxygen species (ROS) and/or interferes with the body's normal defense mechanisms against these compounds through numerous processes, particularly in the liver. Photobiomodulation (PBM) is a cell-specific effect of low intensity monochromatic light or low intensity laser irradiation (LIL) on biological systems. The cellular effects of both alcohol and LIL are ligand-independent so that PBM might rehabilitate alcohol induced dysfunction. The PBM on alcohol induced human neutrophil dysfunction and rat chronic atrophic gastritis, the laser acupuncture on alcohol addiction, and intravascular PBM on alcoholic coma of patients and rats have been observed. The endonasal PBM (EPBM) mediated by Yangming channel, autonomic nervous systems and blood cells is suggested to treat alcohol induced dysfunction in terms of EPBM phenomena, the mechanism of alcohol induced dysfunction and our biological information model of PBM. In our opinion, the therapeutic effects of PBM might also be achieved on alcoholic myopathy.

  7. Plasma generation induced by triboelectrification

    DEFF Research Database (Denmark)

    Kusano, Yukihiro; Singh, Shailendra Vikram; Michelsen, Poul

    2009-01-01

    A gas discharge plasma can be induced by triboelectrification around a sliding contact. The detailed physical mechanism of triboelectrification is unknown, but an empirical classification scheme can be referred to in practice. It is reported that intense ultra-violet emission from a plasma...

  8. Constraint-induced movement therapy

    DEFF Research Database (Denmark)

    Castellini, Greta; Gianola, Silvia; Banzi, Rita;

    2014-01-01

    on randomized controlled trials (RCTs) included in a Cochrane systematic review on the effectiveness of constraint-induced movement therapy (CIMT) for stroke patients. METHODS: We extracted data on the functional independence measure (FIM) and the action research arm test (ARAT) from RCTs that compared CIMT...

  9. Ventilator and viral induced inflammation

    NARCIS (Netherlands)

    Hennus, M.P.

    2013-01-01

    This thesis expands current knowledge on ventilator induced lung injury and provides insights on the immunological effects of mechanical ventilation during viral respiratory infections. The experimental studies in the first part of this thesis improve our understanding of how mechanical ventilation

  10. Toxic encephalopathy induced by capecitabine.

    Science.gov (United States)

    Niemann, B; Rochlitz, C; Herrmann, R; Pless, M

    2004-01-01

    Toxic encephalopathy is a rarely described side effect of 5-fluorouracil which usually presents with cerebellar, neuropsychiatric, and focal neurological symptoms. Magnetic resonance imaging findings are described as patchy white matter alterations. We report the 1st case of capecitabine-induced toxic encephalopathy with epilepsy-like symptoms and diffuse white matter alterations on magnetic resonance imaging.

  11. Transdermal hyoscine induced unilateral mydriasis.

    LENUS (Irish Health Repository)

    Hannon, Breffni

    2012-03-20

    The authors present a case of unilateral mydriasis in a teenager prescribed transdermal hyoscine hydrobromide (scopolamine) for chemotherapy induced nausea and vomiting. The authors discuss the ocular side-effects associated with this particular drug and delivery system and the potential use of transdermal hyoscine as an antiemetic agent in this group.

  12. Late onset startle induced tics

    NARCIS (Netherlands)

    Tijssen, MAJ; Brown, P; Morris, HR; Lees, A

    1999-01-01

    Three cases of late onset Gilles de la Tourette's syndrome are presented. The motor ties were mainly induced by an unexpected startling stimulus, but the startle reflex was not exaggerated. The ties developed after physical trauma or a period of undue emotional stress. Reflex ties may occur in Gille

  13. Hydralazine-induced constrictive pericarditis

    NARCIS (Netherlands)

    Franssen, CFC; ElGamal, MIH; Gans, ROB; Hoorntje, SJ

    1996-01-01

    A 59-year-old man was diagnosed as having constrictive pericarditis 17 months after a typical hydralazine-induced autoimmune syndrome, This late complication of hydralazine has been reported only once. Ten years later the patient was found to have anti-neutrophil cytoplasmic antibodies directed agai

  14. SPS Ion Induced Desorption Experiment

    CERN Multimedia

    Maximilien Brice

    2003-01-01

    This experiment will give a study about the induced desorption from heavy ion (Indium ion run from week 45 in SPS T4-H8 area) impacting LHC type graphite collimator. 4 different samples are located in the 4 chambers 90° one to each other: pure graphite, graphite with copper coating, graphite with NEG coating, 316LN stainless steal (reference).

  15. Adolescents and Exercise Induced Asthma

    Science.gov (United States)

    Hansen, Pamela; Bickanse, Shanna; Bogenreif, Mike; VanSickle, Kyle

    2008-01-01

    This article defines asthma and exercise induced asthma, and provides information on the triggers, signs, and symptoms of an attack. It also gives treatments for these conditions, along with prevention guidelines on how to handle an attack in the classroom or on the practice field. (Contains 2 tables and 1 figure.)

  16. Nodal bradycardia induced by tocainide.

    OpenAIRE

    Mandal, S. K.; Datta, S.K.

    1983-01-01

    A case of tocainide-induced nodal bradycardia in standard recommended dose is reported. There was no recurrence when the drug was subsequently reintroduced in a reduced dosage. It is suggested that in the elderly, tocainide should be used in a lower dosage than normally recommended.

  17. Drug-induced renal disease.

    Science.gov (United States)

    Curtis, J R

    1979-11-01

    The clinical manifestations of drug-induced renal disease may include all the manifestations attributed to natural or spontaneous renal diseases such as acute renal failure, chronic renal failure, acute nephritic syndrome, renal colic, haematuria, selective tubular defects, obstructive nephropathy, etc. It is therefore vital in any patient with renal disease whatever the clinical manifestations might be, to obtain a meticulous drug and toxin inventory. Withdrawal of the offending drug may result in amelioration or cure of the renal disorder although in the case of severe renal failure it may be necessary to utilise haemodialysis or peritoneal dialysis to tide the patient over the period of acute renal failure. Analgesic nephropathy is an important cause of terminal chronic renal failure and it is therefore vital to make the diagnosis as early as possible. The pathogenesis of some drug-induced renal disorders appears to be immunologically mediated. There are many other pathogenetic mechanisms involved in drug-induced renal disorders and some drugs may under appropriate circumstances be responsible for a variety of different nephrotoxic effects. For example, the sulphonamides have been incriminated in examples of crystalluria, acute interstitial nephritis, acute tubular necrosis, generalised hypersensitivity reactions, polyarteritis nodosa and drug-induced lupus erythematosus.

  18. 'Popper'-induced vision loss.

    Science.gov (United States)

    Krilis, Matthew; Thompson, Julia; Atik, Alp; Lusthaus, Jed; Jankelowitz, Stacey

    2013-05-01

    Amyl nitrite 'poppers' are recreational drugs, which are a potent source of nitric oxide. The use of 'poppers' can cause psychoactive stimulation, reduced blood pressure, tachycardia and involuntary muscle relaxation. Their use is becoming increasingly common around the world, including approximately 60% of Australia's male homosexual community. We report the first case of 'popper'-induced vision loss in Australasia.

  19. Microcracks and Overpressure- Induced Fractures

    Institute of Scientific and Technical Information of China (English)

    Ahmed M. Al - QAHTANI

    2001-01-01

    The microfractures and natural fractures studies have a great significance in the hydrocarbon accumulation exploration and can be a good supporter for wide geophysical study on the major structures. This paper is a brief review on microcracks and overpressure- induced fracture. It is to discuss different views on the mechanism of fractures in the subsurface of the earth.

  20. [Readers' position against induced abortion].

    Science.gov (United States)

    1981-08-25

    Replies to the request by the Journal of Nursing on readers' positions against induced abortion indicate there is a definite personal position against induced abortion and the assistance in this procedure. Some writers expressed an emotional "no" against induced abortion. Many quoted arguments from the literature, such as a medical dictionary definition as "a premeditated criminally induced abortion." The largest group of writers quoted from the Bible, the tenor always being: "God made man, he made us with his hands; we have no right to make the decision." People with other philosophies also objected. Theosophical viewpoint considers reincarnation and the law of cause and effect (karma). This philosophy holds that induced abortion impedes the appearance of a reincarnated being. The fundamental question in the abortion problem is, "can the fetus be considered a human life?" The German anatomist Professor E. Bleckschmidt points out that from conception there is human life, hence the fertilized cell can only develop into a human being and is not merely a piece of tissue. Professional nursing interpretation is that nursing action directed towards killing of a human being (unborn child) is against the nature and the essence of the nursing profession. A different opinion states that a nurse cares for patients who have decided for the operation. The nurse doesn't judge but respects the individual's decision. Some proabortion viewpoints considered the endangering of the mother's life by the unborn child, and the case of rape. With the arguments against abortion the question arises how to help the woman with unwanted pregnancy. Psychological counseling is emphasized as well as responsible and careful assistance. Referral to the Society for Protection of the Unborn Child (VBOK) is considered as well as other agencies. Further reader comments on this subject are solicited.

  1. Hypolipidimic effect of some medicinal plants on diabetic rats

    OpenAIRE

    Eman G.E.Helal * and Mohamed M. A. Shahat

    2006-01-01

    Our aim was to evaluate the hypolipidimic effect of aqueous extract of a famous mixture used in Saudi Arabia folk medicine that consists of Nigella sativa, Commiphora myrrha, Boswellia carterii Birdw, Ferule assa-foetida and Aloe vera and also the extract of each plant alone on alloxan induced diabetic rats. Material and Methods :-The present study was carried out on 80 adult male albino rats (120 ± 20 g.b.wt. ), the rats were divided randomly into 8 groups, the first group served as control ...

  2. Distinguishing warming-induced drought from drought-induced warming

    Science.gov (United States)

    Roderick, M. L.; Yin, D.

    2015-12-01

    It is usually observed that temperatures, especially maximum temperatures are higher during drought. A very widely held public perception is that the increase in temperature is a cause of drought. This represents the warming-induced drought scenario. However, the agricultural and hydrologic scientific communities have a very different interpretation with drought being the cause of increasing temperature. In essence, those communities assume the warming is a surface feedback and their interpretation is for drought-induced warming. This is a classic cause-effect problem that has resisted definitive explanation due to the lack of radiative observations at suitable spatial and temporal scales. In this presentation we first summarise the observations and then use theory to untangle the cause-effect relationships that underlie the competing interpretations. We then show how satellite data (CERES, NASA) can be used to disentangle the cause-effect relations.

  3. Does a parthenogenesis-inducing Wolbachia induce vestigial cytoplasmic incompatibility?

    Science.gov (United States)

    Kraaijeveld, Ken; Reumer, Barbara M.; Mouton, Laurence; Kremer, Natacha; Vavre, Fabrice; van Alphen, Jacques J. M.

    2011-03-01

    Wolbachia is a maternally inherited bacterium that manipulates the reproduction of its host. Recent studies have shown that male-killing strains can induce cytoplasmic incompatibility (CI) when introgressed into a resistant host. Phylogenetic studies suggest that transitions between CI and other Wolbachia phenotypes have also occurred frequently, raising the possibility that latent CI may be widespread among Wolbachia. Here, we investigate whether a parthenogenesis-inducing Wolbachia strain can also induce CI. Parthenogenetic females of the parasitoid wasp Asobara japonica regularly produce a small number of males that may be either infected or not. Uninfected males were further obtained through removal of the Wolbachia using antibiotics and from a naturally uninfected strain. Uninfected females that had mated with infected males produced a slightly, but significantly more male-biased sex ratio than uninfected females that had mated with uninfected males. This effect was strongest in females that mated with males that had a relatively high Wolbachia titer. Quantitative PCR indicated that infected males did not show higher ratios of nuclear versus mitochondrial DNA content. Wolbachia therefore does not cause diploidization of cells in infected males. While these results are consistent with CI, other alternatives such as production of abnormal sperm by infected males cannot be completely ruled out. Overall, the effect was very small (9%), suggesting that if CI is involved it may have degenerated through the accumulation of mutations.

  4. Effectiveness of Cyperus scariosus and Boswellia serrata on quality of life in women with stress urinary incontinence assessed with ICIQ-SF

    Directory of Open Access Journals (Sweden)

    Arkalgud Rangaswamy Padmaja

    2014-09-01

    Methods: A parallel, randomized placebo-controlled, single-blind, pre- and post-test trial was conducted in the National Institute of Unani Medicine Hospital. The patients (n = 60 were randomly allocated to either test (n = 30 or control group (n = 30. In the test and placebo group, equal quantity of C.scariosus and B.serrata (4 g powder in two divided doses plus pelvic floor muscle training (PFMT and placebo plus PFMT, respectively, was given for 8 weeks. The outcome was to assess HRQOL by International Consultation on Incontinence Questionnaire-Short Form (ICIQ-SF. Mann-Whitney, Wilcoxon Matched paired, Chi-square or Fisher Exact tests were used to analyze the results. Results: The mean ICIQ-SF score in the test and control group at baseline was 10.2 +/- 0.96 and 10.13 +/- 0.89 respectively. At post-intervention, statistically significant improvement was recorded in the ICIQ-SF scores between groups. In addition, within the group comparison was statistically significant in both groups at each follow up. The percentage improvement from baseline at 12 weeks was 70% and 53% in the test and control groups, respectively. No adverse effects were noted. Conclusion: The test group yielded a more positive effect with regards to improvement in HRQOL than control group in women with stress urinary incontinence. Hence, test drugs plus PFMT appear to be a better alternative than PFMT alone. [J Exp Integr Med 2014; 4(3.000: 212-219

  5. Formulation and quality evaluation of Boswellia carterii Birdwood volatile oil liposomes%乳香挥发油脂质体的制备及质量评价

    Institute of Scientific and Technical Information of China (English)

    刘让如; 谭桂山; 贺凌云; 徐康平

    2009-01-01

    目的 研制乳香挥发油脂质体并进行质量评价.方法 采用正交设计法进行试验,以包封率为指标筛选处方,并对脂质体形态、粒径大小与分布、Zeta电位及包封率等质量指标进行评价.结果 最佳处方为A3B3C2,即:胆固醇与磷脂的重量比为1:6、药脂重量比为1:6、制备温度为60 ℃.质量评价结果表明脂质体圆整均匀,平均粒径、Zeta电位和包封率分别为150 nm、-39.5 mV和(87.7%±1.23%).结论 乳香挥发油脂质体的制备工艺方便、科学,各项质量指标良好.

  6. 乳香抗哮喘有效部位化学成分的研究%Chemical constituents of antiasthmatic fraction in gelatinous resin of Boswellia carterii

    Institute of Scientific and Technical Information of China (English)

    郭辉; 张玲; 尚立霞

    2007-01-01

    目的 研究乳香抗哮喘活性部位的化学成分.方法 以抗哮喘活性为追踪,采用硅胶柱色谱对乳香抗哮喘有效部位进行分离,运用IR、MS、NMR等方法进行结构鉴定.结果 从乳香的抗哮喘活性部位分离并鉴定了8个化合物,分别为β-乙酰乳香酸(acetyl β-boswellic acid,Ⅰ)、β-乳香酸(β-boswellic acid,Ⅱ)、pinnicolic acid A(3-ox-olanosta-8,24-dien-21-oic acid,Ⅲ)、栓菌酸B(3β-hydroxylanosta-8,24-dien-21-oic acid,Ⅳ)、α-乳香酸(α-boswellic acid,Ⅴ)、11-羰基-β-乙酰乳香酸(11-keto-β-boswellic acid,Ⅵ)、脱氢松香酸(Ⅶ)、山达海松酸(Ⅷ).结论 化合物Ⅶ、Ⅷ均为首次从该植物中分离得到.

  7. Research advance on chemical constituents and pharmacological action of Boswellia carterii%乳香的化学成分和药理活性研究进展

    Institute of Scientific and Technical Information of China (English)

    常允平; 韩英梅; 张俊艳

    2012-01-01

    乳香为橄榄科植物乳香树或同属植物的胶状树脂,主要含有五环三萜、四环三萜、大环二萜等萜类和多种挥发油类成分.研究表明药用乳香具有抗炎、抗肿瘤、抗哮喘、抗氧化等药理活性,有潜在的药用价值.综述了乳香化学成分和药理作用研究进展,为乳香的进一步研究提供参考.

  8. 乳香药材鉴别和含量测定方法研究%Study on Identification and Determination Methods of Boswellia carterii Birdw.

    Institute of Scientific and Technical Information of China (English)

    尚立霞; 刘燕; 耿丽波; 袁振海; 张清华; 况成裕; 王妮; 刘玲玲; 王虹艳

    2014-01-01

    目的 制定乳香药材的鉴别和含量测定方法,为药用植物资源的开发利用提供科学依据.方法 采用薄层色谱法(TLC)鉴别乳香药材中主要有效成分11-羰基-β-乙酰乳香酸;采用高效液相色谱法(HPLC)测定其含量并制定含量限度,色谱柱为XTerra@MS C18(3.9 mm×150 mm,5μm),流动相为乙腈-0.1%冰醋酸溶液(80∶20),检测波长250 nm.结果 乳香药材中11-羰基-β-乙酰乳香酸的TLC鉴别特征明显,专属性强;乳香药材中11-羰基-β-乙酰乳香酸的含量测定线性范围为0.256~5.12 μg (r=1.000),平均回收率(n=6)为99.43%(RSD=1.21%),规定乳香药材中11-羰基-β-乙酰乳香酸的含量不得低于2.0%.结论 本方法能快速、简单、准确地对乳香药材中有效成分11-羰基-β-乙酰乳香酸进行定性定量测定.

  9. 乳香大环二萜类化学成分研究%Macrocyclic Diterpenes from Boswellia carterii Birdwood (Frankincense)

    Institute of Scientific and Technical Information of China (English)

    李福双; 徐康平; 袁寿洪; 颜冬兰; 刘让如; 谭健兵; 曾光尧; 周应军; 谭桂山

    2010-01-01

    采用硅胶柱层析,制各薄层层析等色谱方法,从乳香CO2超临界提取物中分得7个大环二萜类化合物,经波谱方法鉴定为incensole acetate(1),incensole(2),incensole oxide acetate(3),isoincensole acetate(4),incensole oxide(5),isoincensole oxide(6),isoincensolol(7),其中,化合物7为新化合物,化合物4为首次从该属植物中分离得到.采用四甲基偶氮唑蓝(MTT)法观察化合物对肿瘤细胞的抑制增殖作用.

  10. Electrochemical Oscillations Induced by Surfactants

    Institute of Scientific and Technical Information of China (English)

    翟俊红; 贺占博

    2003-01-01

    A new type of electrochemical oscillation induced by surfactant was observed in experiments. The electrochemical system is a Daniell cell with a copper rod in CuSO4 aqueous and an aluminum rod in Al(NO3)3 aqueous as electrodes. The surfactants are CTAB, TX-100, SLS. The addition of trace surfactant solution by a micro-syringe made the original monotonously changing electrochemical system produce obvious periodic phenomena. At the mean time, the copper ion selective electrode and Hg2SO4 reference electrode were used to monitor the copper electrode reaction and determine its rate constant k of first order reaction. According to the experimental results of electrode reaction kinetics, the possible mechanism was found to be the polarization induced from the directional adsorption of trace surfactant on the electrode surface. That is the electrochemical oscillations.

  11. Methadone Induced Sensorineural Hearing Loss

    Directory of Open Access Journals (Sweden)

    Chadi Saifan

    2013-01-01

    Full Text Available Background. Sudden sensorineural hearing loss (SSHL caused by opiate abuse or overuse has been well documented in the medical literature. Most documented case reports have involved either heroin or hydrocodone/acetaminophen. Recently, case reposts of methadone induced SSHL have been published. Case Report. We present the case of a 31-year-old man who developed SSHL after a methadone overdose induced stupor. He was subsequently restarted on methadone at his regular dose. On follow-up audiometry exams, he displayed persistent moderately severe sensorineural hearing loss bilaterally. Discussion. This case is notable because unlike all but one previously reported case, the patient—who was restated on methadone—did not make a complete recovery. Conclusion. Methadone overuse in rare cases causes SSHL.

  12. Color-induced graph colorings

    CERN Document Server

    Zhang, Ping

    2015-01-01

    A comprehensive treatment of color-induced graph colorings is presented in this book, emphasizing vertex colorings induced by edge colorings. The coloring concepts described in this book depend not only on the property required of the initial edge coloring and the kind of objects serving as colors, but also on the property demanded of the vertex coloring produced. For each edge coloring introduced, background for the concept is provided, followed by a presentation of results and open questions dealing with this topic. While the edge colorings discussed can be either proper or unrestricted, the resulting vertex colorings are either proper colorings or rainbow colorings. This gives rise to a discussion of irregular colorings, strong colorings, modular colorings, edge-graceful colorings, twin edge colorings and binomial colorings. Since many of the concepts described in this book are relatively recent, the audience for this book is primarily mathematicians interested in learning some new areas of graph colorings...

  13. Methadone induced sensorineural hearing loss.

    Science.gov (United States)

    Saifan, Chadi; Glass, Daniel; Barakat, Iskandar; El-Sayegh, Suzanne

    2013-01-01

    Background. Sudden sensorineural hearing loss (SSHL) caused by opiate abuse or overuse has been well documented in the medical literature. Most documented case reports have involved either heroin or hydrocodone/acetaminophen. Recently, case reposts of methadone induced SSHL have been published. Case Report. We present the case of a 31-year-old man who developed SSHL after a methadone overdose induced stupor. He was subsequently restarted on methadone at his regular dose. On follow-up audiometry exams, he displayed persistent moderately severe sensorineural hearing loss bilaterally. Discussion. This case is notable because unlike all but one previously reported case, the patient-who was restated on methadone-did not make a complete recovery. Conclusion. Methadone overuse in rare cases causes SSHL.

  14. Drug-induced sexual dysfunction.

    Science.gov (United States)

    Aldridge, S A

    1982-01-01

    Commonly used drugs that may cause sexual dysfunction are reviewed. The anatomy and physiology of the normal sexual response are reviewed. The influence of drugs on neurogenic, hormonal, and vascular mechanisms may result in diminished libido, impotence, ejaculatory and orgasmic difficulties, inhibited vaginal lubrication, menstrual irregularities, and gynecomastia in men or painful breast enlargement in women. Parasympatholytic agents, which interfere with cholinergic transmission, may affect erectile potency, while adrenergic inhibiting agents may interfere with ejaculatory control. Central nervous system depressants or sedating drugs, drugs producing hyperprolactinemia, and antiandrogenic drugs also may affect the normal sexual response. Drugs such as antihypertensive and antipsychotic agents may induce sexual dysfunction that can result in patient noncompliance. Usually, drug-induced side effects are reversible with discontinuation of the offending agent.

  15. Esomeprazole-induced photoallergic dermatitis

    Directory of Open Access Journals (Sweden)

    Shukla A

    2010-01-01

    Full Text Available There are no published case reports of esomeprazole-induced photoallergic dermatitis. We report here a 58-year-old lady with prior history of propylthiouracil and carbimazole-induced photoallergy, who presented with heartburn and dysphagia. She was diagnosed to have erosive esophagitis and was treated with esomeprazole, following which she developed photoallergic dermatitis. It improved on cessation of the drug and did not recur on subsequent treatment with ranitidine. Naranjo score for this adverse drug event was 8, thereby making it a probable adverse drug reaction. This reaction may be due to sulphur moiety, which is common to all these drugs. Physicians must be aware of this possible side-effect, especially in patients with prior history of photoallergy to other drugs.

  16. Prediction of pilot induced oscillations

    Directory of Open Access Journals (Sweden)

    Valentin PANĂ

    2011-03-01

    Full Text Available An important problem in the design of flight-control systems for aircraft under pilotedcontrol is the determination of handling qualities and pilot-induced oscillations (PIO tendencieswhen significant nonlinearities exist in the vehicle description. The paper presents a method to detectpossible pilot-induced oscillations of Category II (with rate and position limiting, a phenomenonusually due to a misadaptation between the pilot and the aircraft response during some tasks in whichtight closed loop control of the aircraft is required from the pilot. For the analysis of Pilot in the LoopOscillations an approach, based on robust stability analysis of a system subject to uncertainparameters, is proposed. In this analysis the nonlinear elements are substituted by linear uncertainparameters. This approach assumes that PIO are characterized by a limit cycle behavior.

  17. Lead- induced genotoxicity in wheat

    Directory of Open Access Journals (Sweden)

    Elena Truta

    2010-02-01

    Full Text Available The changes induced in cytogenetic parameters from root meristems of Triticum aestivum cv. Maruca seedlings have been studied after treatment with lead acetate and lead nitrate solutions, at four concentrations (10, 25, 50, 100 μM containing 2.07, 5.18, 10.36, respectively 20.72 μg ml-1 Pb2+. Lead induced mitosis disturbances in root meristematic cells of wheat seedlings, expressed mainly in decrease of mitotic index and changes in preponderance of division phases. This heavy metal has genotoxic effects, expressed in the occurrence of many chromosomal aberrations in all Pb2+ treated variants. Pb2+ nitrate shows a more pronounced genotoxic potential than lead acetate trihydrate.

  18. Electromagnetically Induced Quantum Holographic Imaging

    Science.gov (United States)

    Qiu, Tian-Hui; Xie, Min; Ma, Hong-Yang; Zheng, Chun-Hong; Chen, Li-Bo

    2016-05-01

    We study the quantum holographic imaging of one-dimensional electromagnetically induced grating created by a strong standing wave in an atomic medium. Entangled photon pairs, generated in a spontaneous parametric down-conversion process, are employed as the imaging light to realize coincidence recording. By theoretical analysis and numerical simulation, we find that both the amplitude and phase information of the object can be imaged with the characteristic of imaging nonlocally and of arbitrarily controllable image variation in size.

  19. Drug-Induced Sleep Endoscopy.

    Science.gov (United States)

    Charakorn, Natamon; Kezirian, Eric J

    2016-12-01

    Drug-induced sleep endoscopy (DISE) is an upper airway evaluation technique in which fiberoptic examination is performed under conditions of unconscious sedation. Unique information obtained from this 3-dimensional examination of the airway potentially provides additive benefits to other evaluation methods to guide treatment selection. This article presents recommendations regarding DISE technique and the VOTE Classification system for reporting DISE findings and reviews the evidence concerning DISE test characteristics and the association between DISE findings and treatment outcomes.

  20. Acyclovir-induced thrombotic microangiopathy

    Science.gov (United States)

    Goli, R.; Mukku, K. K.; Devaraju, S. B. R.; Uppin, M. S.

    2017-01-01

    Acyclovir is a commonly used antiviral drug. Acute kidney injury (AKI) due to intratubular crystal precipitation and interstitial nephritis is well known. Here we present a case of acyclovir induced AKI in a 61 year old male with herpes zoster, which presented like thrombotic microangiopathy with acute interstitial nephritis. This is the first case report on acyclovir causing thrombotic microaniopathy with partial improvement in renal function after plasmapharesis. PMID:28356666

  1. Induced, endogenous and exogenous centrality

    OpenAIRE

    Everett, Martin G.; Stephen P. Borgatti

    2010-01-01

    Centrality measures are based upon the structural position an actor has within the network. Induced centrality, sometimes called vitality measures, take graph invariants as an overall measure and derive vertex level measures by deleting individual nodes or edges and examining the overall change. By taking the sum of standard centrality measures as the graph invariant we can obtain measures which examine how much centrality an individual node contributes to the centrality of the other nodes in...

  2. Noise-induced quantum transport

    OpenAIRE

    Ghosh, Pulak Kumar; Barik, Debashis; Ray, Deb Shankar

    2004-01-01

    We analyze the problem of directed quantum transport induced by external exponentially correlated telegraphic noise. In addition to quantum nature of the heat bath, nonlinearity of the periodic system potential brings in quantum contribution. We observe that quantization, in general, enhances classical current at low temperature, while the differences become insignificant at higher temperature. Interplay of quantum diffusion and quantum correction to system potential is analyzed for various r...

  3. Current-Induced Membrane Discharge

    OpenAIRE

    Andersen, MB; Soestbergen, van, M Michiel; A Mani; Bruus, H.; Biesheuvel, PM; Bazant, MZ

    2012-01-01

    Possible mechanisms for overlimiting current (OLC) through aqueous ion-exchange membranes (exceeding diffusion limitation) have been debated for half a century. Flows consistent with electro-osmotic instability have recently been observed in microfluidic experiments, but the existing theory neglects chemical effects and remains to be quantitatively tested. Here, we show that charge regulation and water self-ionization can lead to OLC by “current-induced membrane discharge” (CIMD), even in the...

  4. Abacavir-induced liver toxicity

    Directory of Open Access Journals (Sweden)

    Maria Diletta Pezzani

    Full Text Available Abstract Abacavir-induced liver toxicity is a rare event almost exclusively occurring in HLA B*5701-positive patients. Herein, we report one case of abnormal liver function tests occurring in a young HLA B*5701-negative woman on a stable nevirapine-based regimen with no history of liver problems or alcohol abuse after switching to abacavir from tenofovir. We also investigated the reasons for abacavir discontinuation in a cohort of patients treated with abacavir-lamivudine-nevirapine.

  5. Abacavir-induced liver toxicity.

    Science.gov (United States)

    Pezzani, Maria Diletta; Resnati, Chiara; Di Cristo, Valentina; Riva, Agostino; Gervasoni, Cristina

    2016-01-01

    Abacavir-induced liver toxicity is a rare event almost exclusively occurring in HLA B*5701-positive patients. Herein, we report one case of abnormal liver function tests occurring in a young HLA B*5701-negative woman on a stable nevirapine-based regimen with no history of liver problems or alcohol abuse after switching to abacavir from tenofovir. We also investigated the reasons for abacavir discontinuation in a cohort of patients treated with abacavir-lamivudine-nevirapine.

  6. Acoustically-Induced Electrical Signals

    Science.gov (United States)

    Brown, S. R.

    2014-12-01

    We have observed electrical signals excited by and moving along with an acoustic pulse propagating in a sandstone sample. Using resonance we are now studying the characteristics of this acousto-electric signal and determining its origin and the controlling physical parameters. Four rock samples with a range of porosities, permeabilities, and mineralogies were chosen: Berea, Boise, and Colton sandstones and Austin Chalk. Pore water salinity was varied from deionized water to sea water. Ag-AgCl electrodes were attached to the sample and were interfaced to a 4-wire electrical resistivity system. Under computer control, the acoustic signals were excited and the electrical response was recorded. We see strong acoustically-induced electrical signals in all samples, with the magnitude of the effect for each rock getting stronger as we move from the 1st to the 3rd harmonics in resonance. Given a particular fluid salinity, each rock has its own distinct sensitivity in the induced electrical effect. For example at the 2nd harmonic, Berea Sandstone produces the largest electrical signal per acoustic power input even though Austin Chalk and Boise Sandstone tend to resonate with much larger amplitudes at the same harmonic. Two effects are potentially responsible for this acoustically-induced electrical response: one the co-seismic seismo-electric effect and the other a strain-induced resistivity change known as the acousto-electric effect. We have designed experimental tests to separate these mechanisms. The tests show that the seismo-electric effect is dominant in our studies. We note that these experiments are in a fluid viscosity dominated seismo-electric regime, leading to a simple interpretation of the signals where the electric potential developed is proportional to the local acceleration of the rock. Toward a test of this theory we have measured the local time-varying acoustic strain in our samples using a laser vibrometer.

  7. Nifedipine-Induced gingival overgrowth

    OpenAIRE

    Florio, Ornella; School of Dentistry of São Jose dos Campos - State University of São Paulo; Tfouni, Maysa; School of Dentistry of São Jose dos Campos - State University of São Paulo; Balducci, Ivan; School of Dentistry of São Jose dos Campos - State University of São Paulo; Marco, Andrea Carvalho de; School of Dentistry of São Jose dos Campos - State University of São Paulo; Neves Jardini, Maria Aparecida; School of Dentistry of São Jose dos Campos - State University of São Paulo; Dias Almeida, Janete; School of Dentistry of São Jose dos Campos - State University of São Paulo

    2013-01-01

    Objective: The objective of the present study was to evaluate gingival overgrowth induced by nifedipine and to correlate it with plaque accumulation. Material and Methods: Sixty patients were divided into a treated group (n=30) consisting of hypertensive patients treated with nifedipine and a control group (n=30) consisting of patients without arterial hypertension. The following exams were performed on the first visit: anamnesis, measurement of blood pressure, weight and height, extra- and i...

  8. Ellipticity induced in vacuum birefringence

    CERN Document Server

    Torgrimsson, Greger

    2014-01-01

    We consider signals of photon-photon scattering in laser-based, low energy experiments. In particular, we consider the ellipticity induced on a probe beam by a strong background field, and compare it with a recent worldline expression for the photon polarisation flip amplitude. When the probe and the background are plane waves, the ellipticity is equal to the flip amplitude. Here we investigate the ellipticity-amplitude relation for more physical fields.

  9. Teriparatide Induced Delayed Persistent Hypercalcemia

    Directory of Open Access Journals (Sweden)

    Nirosshan Thiruchelvam

    2014-01-01

    Full Text Available Teriparatide, a recombinant PTH, is an anabolic treatment for osteoporosis that increases bone density. Transient hypercalcemia is a reported side effect of teriparatide that is seen few hours following administration of teriparatide and resolves usually within 16 hours of drug administration. Persistent hypercalcemia, although not observed in clinical trials, is rarely reported. The current case describes a rare complication of teriparatide induced delayed persistent hypercalcemia.

  10. MRI-induced retrocalcaneal bursitis

    Energy Technology Data Exchange (ETDEWEB)

    Tol, J.L.; Dijk, C.N. van [Dept. of Orthopaedic Surgery, University of Amsterdam (Netherlands); Maas, M. [Dept. of Radiology, University of Amsterdam (Netherlands)

    1999-10-01

    This case report describes a patient with acute retrocalcaneal bursitis, which developed after MRI examination of the ankle. The sagittal T2*-weighted gradient echo sequence revealed an extensive susceptibility artifact in the area surrounding the Achilles tendon near its insertion at the os calcis. This artifact was caused by postsurgical metallic particles. We postulate that these particles were mechanically stimulated by the magnetic field and induced the inflammatory response. (orig.)

  11. Heparin-Induced Thrombocytopenia Antibody Test

    Science.gov (United States)

    ... Global Sites Search Help? Heparin-induced Thrombocytopenia PF4 Antibody Share this page: Was this page helpful? Also known as: Heparin-PF4 Antibody; HIT Antibody; HIT PF4 Antibody; Heparin Induced Antibody; ...

  12. Hypolipidimic effect of some medicinal plants on diabetic rats

    Directory of Open Access Journals (Sweden)

    Eman G.E.Helal * and Mohamed M. A. Shahat

    2006-06-01

    Full Text Available Our aim was to evaluate the hypolipidimic effect of aqueous extract of a famous mixture used in Saudi Arabia folk medicine that consists of Nigella sativa, Commiphora myrrha, Boswellia carterii Birdw, Ferule assa-foetida and Aloe vera and also the extract of each plant alone on alloxan induced diabetic rats. Material and Methods :-The present study was carried out on 80 adult male albino rats (120 ± 20 g.b.wt. , the rats were divided randomly into 8 groups, the first group served as control group, the second group as alloxan induced diabetic rats, the third group was diabetic rats treated with mixture of folk medicinal plant ( 0.01g /100 g b. wt. ,the fourth group: diabetic rats treated with Nigella sativa ( 0.01g /100 g b. wt. , the fifth group: diabetic rats treated with Aloe vera ( 0.005g /100 g b. wt. , the sixth group: diabetic rats treated with Ferule assa-foetida ( 0.01 g /100 g b. wt., the seventh: diabetic rats treated with Boswellia carterii Birdw ( 1ml/100 g b. wt. and the eighth group: diabetic rats treated with Commiphora myrrha ( 0.01 g ml/100 g b. wt. Results :- Serum total lipid, serum total cholesterol, LDL­cholesterol, and triglyceride recorded significant increases in diabetic, Nigella sativa, Commiphora myrrha, Boswellia carterii birdw and Aloe vera treated group. While the mixture and Ferule assa-foetida treated group, showed insignificant changes in serum total lipid, triglyceride, serum total cholesterol and LDL­cholesterol. On other hand, the mixture treated group and Ferule assa-foetida treated group showed significant decreased in the previous parameters. The serum HDL­cholesterol was significantly reduced in diabetic group throughout the experimental periods, otherwise, all treated group revealed insignificant changes till the end of experiment when compare with undiabetic rats. Conclusion: The aqueous extract of a mixture consists of Nigella sativa, Commiphora myrrha, Boswellia carterii Birdw, Ferule assa

  13. YAP Induces Human Naive Pluripotency

    Directory of Open Access Journals (Sweden)

    Han Qin

    2016-03-01

    Full Text Available The human naive pluripotent stem cell (PSC state, corresponding to a pre-implantation stage of development, has been difficult to capture and sustain in vitro. We report that the Hippo pathway effector YAP is nuclearly localized in the inner cell mass of human blastocysts. Overexpression of YAP in human embryonic stem cells (ESCs and induced PSCs (iPSCs promotes the generation of naive PSCs. Lysophosphatidic acid (LPA can partially substitute for YAP to generate transgene-free human naive PSCs. YAP- or LPA-induced naive PSCs have a rapid clonal growth rate, a normal karyotype, the ability to form teratomas, transcriptional similarities to human pre-implantation embryos, reduced heterochromatin levels, and other hallmarks of the naive state. YAP/LPA act in part by suppressing differentiation-inducing effects of GSK3 inhibition. CRISPR/Cas9-generated YAP−/− cells have an impaired ability to form colonies in naive but not primed conditions. These results uncover an unexpected role for YAP in the human naive state, with implications for early human embryology.

  14. Induced Modules of Restricted Lie Superalgebras

    Institute of Scientific and Technical Information of China (English)

    刘文德

    2005-01-01

    In this paper we first prove the PBW theorem for reduced universal enveloping algebras of restricted Lie superalgebras. Then the notion of an induced module is introduced and the dimension formula of induced modules is established.Finally, using the results above, we obtain a property of induced modules pertaining to automorphisms of Lie superalgebras and isomorphisms of modules.

  15. Mutations induced by ultraviolet light

    Energy Technology Data Exchange (ETDEWEB)

    Pfeifer, Gerd P. [Department of Biology, Beckman Research Institute, City of Hope, Duarte, CA 91010 (United States)]. E-mail: gpfeifer@coh.org; You, Young-Hyun [Department of Biology, Beckman Research Institute, City of Hope, Duarte, CA 91010 (United States); Besaratinia, Ahmad [Department of Biology, Beckman Research Institute, City of Hope, Duarte, CA 91010 (United States)

    2005-04-01

    The different ultraviolet (UV) wavelength components, UVA (320-400 nm), UVB (280-320 nm), and UVC (200-280 nm), have distinct mutagenic properties. A hallmark of UVC and UVB mutagenesis is the high frequency of transition mutations at dipyrimidine sequences containing cytosine. In human skin cancers, about 35% of all mutations in the p53 gene are transitions at dipyrimidines within the sequence 5'-TCG and 5'-CCG, and these are localized at several mutational hotspots. Since 5'-CG sequences are methylated along the p53 coding sequence in human cells, these mutations may be derived from sunlight-induced pyrimidine dimers forming at sequences that contain 5-methylcytosine. Cyclobutane pyrimidine dimers (CPDs) form preferentially at dipyrimidines containing 5-methylcytosine when cells are irradiated with UVB or sunlight. In order to define the contribution of 5-methylcytosine to sunlight-induced mutations, the lacI and cII transgenes in mouse fibroblasts were used as mutational targets. After 254 nm UVC irradiation, only 6-9% of the base substitutions were at dipyrimidines containing 5-methylcytosine. However, 24-32% of the solar light-induced mutations were at dipyrimidines that contain 5-methylcytosine and most of these mutations were transitions. Thus, CPDs forming preferentially at dipyrimidines with 5-methylcytosine are responsible for a considerable fraction of the mutations induced by sunlight in mammalian cells. Using mouse cell lines harboring photoproduct-specific photolyases and mutational reporter genes, we showed that CPDs (rather than 6-4 photoproducts or other lesions) are responsible for the great majority of UVB-induced mutations. An important component of UVB mutagenesis is the deamination of cytosine and 5-methylcytosine within CPDs. The mutational specificity of long-wave UVA (340-400 nm) is distinct from that of the shorter wavelength UV and is characterized mainly by G to T transversions presumably arising through mechanisms

  16. Statistical Seismology and Induced Seismicity

    Science.gov (United States)

    Tiampo, K. F.; González, P. J.; Kazemian, J.

    2014-12-01

    While seismicity triggered or induced by natural resources production such as mining or water impoundment in large dams has long been recognized, the recent increase in the unconventional production of oil and gas has been linked to rapid rise in seismicity in many places, including central North America (Ellsworth et al., 2012; Ellsworth, 2013). Worldwide, induced events of M~5 have occurred and, although rare, have resulted in both damage and public concern (Horton, 2012; Keranen et al., 2013). In addition, over the past twenty years, the increase in both number and coverage of seismic stations has resulted in an unprecedented ability to precisely record the magnitude and location of large numbers of small magnitude events. The increase in the number and type of seismic sequences available for detailed study has revealed differences in their statistics that previously difficult to quantify. For example, seismic swarms that produce significant numbers of foreshocks as well as aftershocks have been observed in different tectonic settings, including California, Iceland, and the East Pacific Rise (McGuire et al., 2005; Shearer, 2012; Kazemian et al., 2014). Similarly, smaller events have been observed prior to larger induced events in several occurrences from energy production. The field of statistical seismology has long focused on the question of triggering and the mechanisms responsible (Stein et al., 1992; Hill et al., 1993; Steacy et al., 2005; Parsons, 2005; Main et al., 2006). For example, in most cases the associated stress perturbations are much smaller than the earthquake stress drop, suggesting an inherent sensitivity to relatively small stress changes (Nalbant et al., 2005). Induced seismicity provides the opportunity to investigate triggering and, in particular, the differences between long- and short-range triggering. Here we investigate the statistics of induced seismicity sequences from around the world, including central North America and Spain, and

  17. Vincristine-Induced Cranial Neuropathy

    Directory of Open Access Journals (Sweden)

    Ahmad TALEBIAN*

    2014-01-01

    Full Text Available How to Cite This Article: Talebian A, Goudarzi RM, Mohammadzadeh M , Mirzadeh AS. Vincristine-Induced Cranial Neuropathy. Iran J Child Neurol. 2014 Winter; 8(1:66-68. AbstractVincristine (VCR is a vinca alkaloid that is used for treatment of many malignancies.The vinca alkaloids are neurotoxic, usually causing a peripheral neuropathy, but cranial neuropathies are rare as side effects. Described here is the case of a 2.5-year-old boy, a known case of Wilms’ tumor, treated by vincristine (0/067 mg/kg/day and dactinomycin (0/045 mg/kg/day after surgery. Three weeks after treatment, he presented with bilateral ptosis.Neurological examination revealed bilateral ptosis with normal pupillary reflex and eye movement. He received 3.015 mg cumulative dose of vincristine before development of ptosis.Treatment with pyridoxine (150 mg/m2 p.o. BID and pyridostigmine (3 mg/kg p.o. BID started as neuroprotective agents, and after 7 days the problem disappeared.The treatment continued for 6 weeks and there were no signs of ptosis or a recurrence in follow up 2 months later. References:Toopchizade V, Hosseini M, et al. Electrophysiological signs of neuropathy caused by vincristine. Medical Journal of Tabriz University of Medical Sciences. 2010 Autumn;31(3; 19-25.Gursel E.S. Vincristine-Induced Unilateral Ptosis in a Child. Pediatr Neurol 2009; 41:461-463.Ngamphaiboon N, Sweeney R, Wetzler M, Wang ES. Pyridoxine treatment of vincristine-induced cranial polyneuropathy in an adult patient with acute lymphocytic leukemia: Case report and review of the literature. Leuk Res. 2010 Aug;34(8:e194-6.Lash SC, Williams CP, Marsh CS, Crithchley C, Hodgkins PR, Mackie EJ. Acute Sixth-Nerve Palsy After Vincristine Therapy. Journal of AAPOS 2004 Feb;8(1: 67-8.Bay A, Yilmaz C, Yilmaz N, Oner AF. Vincristine induced cranial polyneuropathy. Indian J Pediatr. 2006 Jun;73(6:531-3.Tuxen M K, Hansen SW. Complication of treatment, Neurotoxicity secondary to antineoplastic

  18. High homocysteine induces betaine depletion.

    Science.gov (United States)

    Imbard, Apolline; Benoist, Jean-François; Esse, Ruben; Gupta, Sapna; Lebon, Sophie; de Vriese, An S; de Baulny, Helene Ogier; Kruger, Warren; Schiff, Manuel; Blom, Henk J

    2015-04-28

    Betaine is the substrate of the liver- and kidney-specific betaine-homocysteine (Hcy) methyltransferase (BHMT), an alternate pathway for Hcy remethylation. We hypothesized that BHMT is a major pathway for homocysteine removal in cases of hyperhomocysteinaemia (HHcy). Therefore, we measured betaine in plasma and tissues from patients and animal models of HHcy of genetic and acquired cause. Plasma was collected from patients presenting HHcy without any Hcy interfering treatment. Plasma and tissues were collected from rat models of HHcy induced by diet and from a mouse model of cystathionine β-synthase (CBS) deficiency. S-adenosyl-methionine (AdoMet), S-adenosyl-homocysteine (AdoHcy), methionine, betaine and dimethylglycine (DMG) were quantified by ESI-LC-MS/MS. mRNA expression was quantified using quantitative real-time (QRT)-PCR. For all patients with diverse causes of HHcy, plasma betaine concentrations were below the normal values of our laboratory. In the diet-induced HHcy rat model, betaine was decreased in all tissues analysed (liver, brain, heart). In the mouse CBS deficiency model, betaine was decreased in plasma, liver, heart and brain, but was conserved in kidney. Surprisingly, BHMT expression and activity was decreased in liver. However, in kidney, BHMT and SLC6A12 expression was increased in CBS-deficient mice. Chronic HHcy, irrespective of its cause, induces betaine depletion in plasma and tissues (liver, brain and heart), indicating a global decrease in the body betaine pool. In kidney, betaine concentrations were not affected, possibly due to overexpression of the betaine transporter SLC6A12 where betaine may be conserved because of its crucial role as an osmolyte.

  19. Sad music induces pleasant emotion.

    Science.gov (United States)

    Kawakami, Ai; Furukawa, Kiyoshi; Katahira, Kentaro; Okanoya, Kazuo

    2013-01-01

    In general, sad music is thought to cause us to experience sadness, which is considered an unpleasant emotion. As a result, the question arises as to why we listen to sad music if it evokes sadness. One possible answer to this question is that we may actually feel positive emotions when we listen to sad music. This suggestion may appear to be counterintuitive; however, in this study, by dividing musical emotion into perceived emotion and felt emotion, we investigated this potential emotional response to music. We hypothesized that felt and perceived emotion may not actually coincide in this respect: sad music would be perceived as sad, but the experience of listening to sad music would evoke positive emotions. A total of 44 participants listened to musical excerpts and provided data on perceived and felt emotions by rating 62 descriptive words or phrases related to emotions on a scale that ranged from 0 (not at all) to 4 (very much). The results revealed that the sad music was perceived to be more tragic, whereas the actual experiences of the participants listening to the sad music induced them to feel more romantic, more blithe, and less tragic emotions than they actually perceived with respect to the same music. Thus, the participants experienced ambivalent emotions when they listened to the sad music. After considering the possible reasons that listeners were induced to experience emotional ambivalence by the sad music, we concluded that the formulation of a new model would be essential for examining the emotions induced by music and that this new model must entertain the possibility that what we experience when listening to music is vicarious emotion.

  20. Esophagitis Induced by Doxycycline Treatment

    Directory of Open Access Journals (Sweden)

    Engin Şenel

    2016-09-01

    Full Text Available Esophagitis is the most common disease of the esophagus. Drug use is one of the reasons of chemical esophagitis. Herein, we report two male patients of 17 and 18 years of age who developed esophagitis in acne treatment with doxycycline. Both patients took doxycycline capsules for approximately one week. Ulcerations were detected at upper and mid-esophagus of the 17-year-old patient. Circular ulcerations were found at mid-esophagus of the 18-year-old case. Doxycycline induced esophagitis is a preventable disease with the physician giving appropriate medication ingestion advice to the patient.

  1. Sertraline induced acute mandibular dystonia

    Directory of Open Access Journals (Sweden)

    Dhanya Raveendranathan

    2015-01-01

    Full Text Available Specific serotonin reuptake inhibitors have been linked with the occurrence of drug-induced parkinsonism, dystonia, dyskinesia, and akathisia. Here, we describe a patient with a diagnosis of emotionally unstable personality disorder and depression who developed severe mandibular dystonia with sertraline in the absence of concurrent prescription of medications, which have potential action on the dopaminergic system. This case highlights the need for clinicians to be aware of this alarming acute adverse effect with sertraline, which is conventionally considered to be well-tolerated and safe.

  2. Drug-induced peripheral neuropathy

    DEFF Research Database (Denmark)

    Vilholm, Ole Jakob; Christensen, Alex Alban; Zedan, Ahmed;

    2014-01-01

    Peripheral neuropathy can be caused by medication, and various descriptions have been applied for this condition. In this MiniReview, the term 'drug-induced peripheral neuropathy' (DIPN) is used with the suggested definition: Damage to nerves of the peripheral nervous system caused by a chemical...... substance used in the treatment, cure, prevention or diagnosis of a disease. Optic neuropathy is included in this definition. A distinction between DIPN and other aetiologies of peripheral neuropathy is often quite difficult and thus, the aim of this MiniReview is to discuss the major agents associated...

  3. Opioid induced nausea and vomiting.

    Science.gov (United States)

    Smith, Howard S; Laufer, Andras

    2014-01-05

    Opioids are broad spectrum analgesics that are an integral part of the therapeutic armamentarium to combat pain in the palliative care population. Unfortunately, among the adverse effects of opioids that may be experienced along with analgesia is nausea, vomiting, and/or retching. Although it is conceivable that in the future, using combination agents (opioids combined with agents which may nullify emetic effects), currently nausea/vomiting remains a significant issue for certain patients. However, there exists potential current strategies that may be useful in efforts to diminish the frequency and/or intensity of opioid-induced nausea/vomiting (OINV).

  4. Fluoroquinolone-induced Achilles tendinitis.

    Science.gov (United States)

    Tam, P K; Ho, Carmen T K

    2014-12-01

    We report a case of Achilles tendinitis after intake of ciprofloxacin for treatment of respiratory tract infection. Fluoroquinolone-induced tendinopathy is an uncommon but increasingly recognised adverse effect of this antibiotic class. Most of the cases occur in the Achilles tendon and may lead to tendon rupture. Possible predisposing risk factors include use of steroid, patients with renal impairment or renal transplant, old age, and being an athlete. The drug should be stopped once this condition is suspected. Symptomatic treatment should be given and orthopaedic referral is desirable if tendon rupture occurs.

  5. HYPOGLYCEMIA INDUCED BY ANTIDIABETIC SULFONYLUREAS.

    Science.gov (United States)

    Confederat, Luminiţa; Constantin, Sandra; Lupaşcu, Florentina; Pânzariu, Andreea; Hăncianu, Monica; Profire, Lenuţa

    2015-01-01

    Diabetes mellitus is a major health problem due to its increasing prevalence and life-threatening complications. Antidiabetic sulfonylureas represent the first-line drugs in type 2 diabetes even though the most common associated risk is pharmacologically-induced hypoglycemia. In the development of this side effect are involved several factors including the pharmacokinetic and pharmacodynamic profile of the drug, patient age and behavior, hepatic or renal dysfunctions, or other drugs associated with a high risk of interactions. If all these are controlled, the risk-benefit balance can be equal to other oral antidiabetic drugs.

  6. Clozapine-induced late leukopenia.

    LENUS (Irish Health Repository)

    Latif, Z

    2012-03-01

    A patient with a 28-year history of schizophrenia was treated with a wide range of antipsychotic medications since diagnosis. She had experienced no clinically significant symptomatic relief until she commenced treatment on clozapine. Her psychotic symptoms, self care, and general sense of well-being improved significantly. After 6 years of successful treatment, she developed leukopenia and clozapine was discontinued. The following issues will be discussed in the article: rechallenge with clozapine following leukopenia during previous therapy and the choice of and haematological monitoring needs with other antipsychotic medications after clozapine-induced blood dyscrasia.

  7. Adsorption-induced step formation

    DEFF Research Database (Denmark)

    Thostrup, P.; Christoffersen, Ebbe; Lorensen, Henrik Qvist

    2001-01-01

    Through an interplay between density functional calculations, Monte Carlo simulations and scanning tunneling microscopy experiments, we show that an intermediate coverage of CO on the Pt(110) surface gives rise to a new rough equilibrium structure with more than 50% step atoms. CO is shown to bin...... so strongly to low-coordinated Pt atoms that it can break Pt-Pt bonds and spontaneously form steps on the surface. It is argued that adsorption-induced step formation may be a general effect, in particular at high gas pressures and temperatures....

  8. Bathtub vortex induced by instability

    Science.gov (United States)

    Mizushima, Jiro; Abe, Kazuki; Yokoyama, Naoto

    2014-10-01

    The driving mechanism and the swirl direction of the bathtub vortex are investigated by the linear stability analysis of the no-vortex flow as well as numerical simulations. We find that only systems having plane symmetries with respect to vertical planes deserve research for the swirl direction. The bathtub vortex appearing in a vessel with a rectangular cross section having a drain hole at the center of the bottom is proved to be induced by instability when the flow rate exceeds a threshold. The Coriolis force is capable of determining the swirl direction to be cyclonic.

  9. Neutrino induced 1-pion production

    CERN Document Server

    González-Jiménez, R; Van Dessel, N; Pandey, V; Jachowicz, N

    2016-01-01

    Neutrino-induced pion production constitutes an important contribution to neutrino-nucleus scattering cross sections at intermediate energies. A deep understanding of this process is mandatory for a correct interpretation of neutrino-oscillation experiments. We aim at contributing to the ongoing effort to understand the various experimental results obtained by different collaborations in a wide range of energies. In particular, in this work we analyze recent MiniBooNE and MINERvA charged-current neutrino 1-pion production data. We use a relativistic theoretical approach which accounts for resonant and non-resonant 1-pion production contributions.

  10. Ion beam induced luminescence: Relevance to radiation induced bystander effects

    Energy Technology Data Exchange (ETDEWEB)

    Ahmad, S.B., E-mail: ahmad.rabilal@gmail.com [Medical Physics and Applied Radiation Sciences, University of McMaster, Hamilton, Ontario (Canada); McNeill, F.E., E-mail: fmcneill@mcmaster.ca [Medical Physics and Applied Radiation Sciences, University of McMaster, Hamilton, Ontario (Canada); Byun, S.H., E-mail: soohyun@mcmaster.ca [Medical Physics and Applied Radiation Sciences, University of McMaster, Hamilton, Ontario (Canada); Prestwich, W.V., E-mail: prestwic@mcmaster.ca [Medical Physics and Applied Radiation Sciences, University of McMaster, Hamilton, Ontario (Canada); Seymour, C., E-mail: seymouc@mcmaster.ca [Medical Physics and Applied Radiation Sciences, University of McMaster, Hamilton, Ontario (Canada); Mothersill, C.E., E-mail: mothers@mcmaster.ca [Medical Physics and Applied Radiation Sciences, University of McMaster, Hamilton, Ontario (Canada)

    2012-10-01

    The aim of this work is quantify the light emitted as a result of charged particle interaction in materials which may be of relevance to radiation induced 'bystander effects' studies. We have developed a system which employs single photon counting to measure the light emitted from samples irradiated under vacuum by a charged particle beam. The system uses a fast photomultiplier tube with a peak cathode response at 420 nm. It has been tested in a proof-of-principle experiment using polystyrene targets. Light output, as a result of irradiation, was measured. The luminescence yield appears to have a non-linear behavior with the incident ion fluence: it rises exponentially to an asymptotic value. The target was irradiated with beam energies varying from 1 to 2 MeV and showed saturation at or before an incident fluence rate of 3 Multiplication-Sign 10{sup 13} H{sup +}/cm{sup 2} s. The average saturation value for the photon output was found to be 40 Multiplication-Sign 10{sup 6} cps. Some measurements were performed using filters to study the emission at specific wavelengths. In the case of filtered light measurements, the photon output was found to saturate at 28 Multiplication-Sign 10{sup 3}, 10 Multiplication-Sign 10{sup 6}, and 35 Multiplication-Sign 10{sup 6} cps for wavelengths of 280 {+-} 5 nm, 320 {+-} 5 nm and 340 {+-} 5 nm respectively. The light output reaches a maximum value because of damage induced in the polymer. Our measurements indicate a 'damage cross section' of the order of 10{sup -14} cm{sup 2}. The average radiant intensity was found to increase at wavelengths of 280 and 320 nm when the proton energy was increased. This was not found to occur at 340 nm. In conclusion, the light emission at specific wavelengths was found to depend upon the incident proton fluence and the proton energy. The wavelengths of the emitted light measured in this study have significance for the understanding of radiation induced bystander effects.

  11. Condensation induced water hammer safety

    Energy Technology Data Exchange (ETDEWEB)

    Gintner, M.A.

    1997-03-10

    Condensation induced water hammer events in piping systems can cause catastrophic steam system failures which can result in equipment damage, personal injury, and even death. As an industry, we have learned to become accustomed to the ''banging'' that we often hear in our steam piping systems, and complacent in our actions to prevent it. It is unfortunate that lives are lost needlessly, as this type of water hammer event is preventable if one only applies some basic principles when operating and maintaining their steam systems. At the U. S. Department of Energy's Hanford Site where I work, there was one such accident that occurred in 1993 which took the life of a former co-worker and friend of mine. Hanford was established as part of the Manhattan Project during World War II. it is a 560 square mile complex located along the banks of the Columbia River in Southeastern Washington State. For almost 45 years, hanford's mission was to produce weapons grade plutonium for our nations defense programs. Today, Hanford no longer produces plutonium, but is focused on site clean-up and economic diversification. Hanford still uses steam for heating and processing activities, utilizing over 20 miles of piping distribution systems similar to those found in industry. Although these aging systems are still sound, they cannot stand up to the extreme pressure pulses developed by a condensation induced water hammer.

  12. [Autoimmune hepatitis induced by isotretionine].

    Science.gov (United States)

    Guzman Rojas, Patricia; Gallegos Lopez, Roxana; Ciliotta Chehade, Alessandra; Scavino, Yolanda; Morales, Alejandro; Tagle, Martín

    2016-01-01

    We describe a case of a teenage patient with the diagnosis of drug induced autoimmune hepatitis. The patient is a 16 years old female, with the past medical history of Hashimoto’s hypothyroidism controlled with levothyroxine, who started treatment with Isotretionin (®Accutane) 20 mg q/12 hours for a total of 3 months for the treatment of severe acne. The physical examination was within normal limits and the results of the laboratory exams are: Baseline values of ALT 28 U/L, AST 28 U/L. Three months later: AST 756 U/L, ALT 1199U/L, alkaline phosphatase 114 U/L, with normal bilirrubin levels throughout the process. The serology studies were negative for all viral hepatitis; ANA titers were positive (1/160) and igG levels were also elevated. A liver biopsy was performed, and was compatible with the diagnosis of autoimmune hepatitis. Corticosteroid therapy was started with Prednisone 40 mg per day one week after stopping the treatment with isotretionin, observing an improvement in the laboratory values. We describe this case and review the world literature since there are no reported cases of Isotretinoin-induced autoimmune hepatitis.

  13. Radiation-induced cardiovascular effects

    Science.gov (United States)

    Tapio, Soile

    Recent epidemiological studies indicate that exposure to ionising radiation enhances the risk of cardiovascular mortality and morbidity in a moderate but significant manner. Our goal is to identify molecular mechanisms involved in the pathogenesis of radiation-induced cardiovascular disease using cellular and mouse models. Two radiation targets are studied in detail: the vascular endothelium that plays a pivotal role in the regulation of cardiac function, and the myocardium, in particular damage to the cardiac mitochondria. Ionising radiation causes immediate and persistent alterations in several biological pathways in the endothelium in a dose- and dose-rate dependent manner. High acute and cumulative doses result in rapid, non-transient remodelling of the endothelial cytoskeleton, as well as increased lipid peroxidation and protein oxidation of the heart tissue, independent of whether exposure is local or total body. Proteomic and functional changes are observed in lipid metabolism, glycolysis, mitochondrial function (respiration, ROS production etc.), oxidative stress, cellular adhesion, and cellular structure. The transcriptional regulators Akt and PPAR alpha seem to play a central role in the radiation-response of the endothelium and myocardium, respectively. We have recently started co-operation with GSI in Darmstadt to study the effect of heavy ions on the endothelium. Our research will facilitate the identification of biomarkers associated with adverse cardiac effects of ionising radiation and may lead to the development of countermeasures against radiation-induced cardiac damage.

  14. Coffee induces autophagy in vivo

    Science.gov (United States)

    Pietrocola, Federico; Malik, Shoaib Ahmad; Mariño, Guillermo; Vacchelli, Erika; Senovilla, Laura; Chaba, Kariman; Niso-Santano, Mireia; Maiuri, Maria Chiara; Madeo, Frank; Kroemer, Guido

    2014-01-01

    Epidemiological studies and clinical trials revealed that chronic consumption coffee is associated with the inhibition of several metabolic diseases as well as reduction in overall and cause-specific mortality. We show that both natural and decaffeinated brands of coffee similarly rapidly trigger autophagy in mice. One to 4 h after coffee consumption, we observed an increase in autophagic flux in all investigated organs (liver, muscle, heart) in vivo, as indicated by the increased lipidation of LC3B and the reduction of the abundance of the autophagic substrate sequestosome 1 (p62/SQSTM1). These changes were accompanied by the inhibition of the enzymatic activity of mammalian target of rapamycin complex 1 (mTORC1), leading to the reduced phosphorylation of p70S6K, as well as by the global deacetylation of cellular proteins detectable by immunoblot. Immunohistochemical analyses of transgenic mice expressing a GFP–LC3B fusion protein confirmed the coffee-induced relocation of LC3B to autophagosomes, as well as general protein deacetylation. Altogether, these results indicate that coffee triggers 2 phenomena that are also induced by nutrient depletion, namely a reduction of protein acetylation coupled to an increase in autophagy. We speculate that polyphenols contained in coffee promote health by stimulating autophagy. PMID:24769862

  15. Stress proteins induced by arsenic.

    Science.gov (United States)

    Del Razo, L M; Quintanilla-Vega, B; Brambila-Colombres, E; Calderón-Aranda, E S; Manno, M; Albores, A

    2001-12-01

    The elevated expression of stress proteins is considered to be a universal response to adverse conditions, representing a potential mechanism of cellular defense against disease and a potential target for novel therapeutics. Exposure to arsenicals either in vitro or in vivo in a variety of model systems has been shown to cause the induction of a number of the major stress protein families such as heat shock proteins (Hsp). Among them are members with low molecular weight, such as metallotionein and ubiquitin, as well as ones with masses of 27, 32, 60, 70, 90, and 110 kDa. In most of the cases, the induction of stress proteins depends on the capacity of the arsenical to reach the target, its valence, and the type of exposure, arsenite being the biggest inducer of most Hsp in several organs and systems. Hsp induction is a rapid dose-dependent response (1-8 h) to the acute exposure to arsenite. Thus, the stress response appears to be useful to monitor the sublethal toxicity resulting from a single exposure to arsenite. The present paper offers a critical review of the capacity of arsenicals to modulate the expression and/or accumulation of stress proteins. The physiological consequences of the arsenic-induced stress and its usefulness in monitoring effects resulting from arsenic exposure in humans and other organisms are discussed.

  16. Inducible competitors and adaptive diversification

    Institute of Scientific and Technical Information of China (English)

    Beren W.ROBINSON; David W.PFENNIG

    2013-01-01

    Identifying the causes of diversification is central to evolutionary biology.The ecological theory of adaptive diversification holds that the evolution of phenotypic differences between populations and species-and the formation of new species-stems from divergent natural selection,often arising from competitive interactions.Although increasing evidence suggests that phenotypic plasticity can facilitate this process,it is not generally appreciated that competitively mediated selection often also provides ideal conditions for phenotypic plasticity to evolve in the first place.Here,we discuss how competition plays at least two key roles in adaptive diversification depending on its pattern.First,heterogenous competition initially generates heterogeneity in resource use that favors adaptive plasticity in the form of"inducible competitors".Second,once such competitively induced plasticity evolves,its capacity to rapidly generate phenotypic variation and expose phenotypes to alternate selective regimes allows populations to respond readily to selection favoring diversification,as may occur when competition generates steady diversifying selection that permanently drives the evolutionary divergence of populations that use different resources.Thus,competition plays two important roles in adaptive diversification--one well-known and the other only now emerging-mediated through its effect on the evolution of phenotypic plasticity.

  17. Simulations of Cavitating Cryogenic Inducers

    Science.gov (United States)

    Dorney, Dan (Technical Monitor); Hosangadi, Ashvin; Ahuja, Vineet; Ungewitter, Ronald J.

    2004-01-01

    Simulations of cavitating turbopump inducers at their design flow rate are presented. Results over a broad range of Nss, numbers extending from single-phase flow conditions through the critical head break down point are discussed. The flow characteristics and performance of a subscale geometry designed for water testing are compared with the fullscale configuration that employs LOX. In particular, thermal depression effects arising from cavitation in cryogenic fluids are identified and their impact on the suction performance of the inducer quantified. The simulations have been performed using the CRUNCH CFD[R] code that has a generalized multi-element unstructured framework suitable for turbomachinery applications. An advanced multi-phase formulation for cryogenic fluids that models temperature depression and real fluid property variations is employed. The formulation has been extensively validated for both liquid nitrogen and liquid hydrogen by simulating the experiments of Hord on hydrofoils; excellent estimates of the leading edge temperature and pressure depression were obtained while the comparisons in the cavity closure region were reasonable.

  18. Inducible competitors and adaptive diversification

    Directory of Open Access Journals (Sweden)

    Beren W. ROBINSON, David W. PFENNIG

    2013-08-01

    Full Text Available Identifying the causes of diversification is central to evolutionary biology. The ecological theory of adaptive diversification holds that the evolution of phenotypic differences between populations and species––and the formation of new species––stems from divergent natural selection, often arising from competitive interactions. Although increasing evidence suggests that phenotypic plasticity can facilitate this process, it is not generally appreciated that competitively mediated selection often also provides ideal conditions for phenotypic plasticity to evolve in the first place. Here, we discuss how competition plays at least two key roles in adaptive diversification depending on its pattern. First, heterogenous competition initially generates heterogeneity in resource use that favors adaptive plasticity in the form of “inducible competitors”. Second, once such competitively induced plasticity evolves, its capacity to rapidly generate phenotypic variation and expose phenotypes to alternate selective regimes allows populations to respond readily to selection favoring diversification, as may occur when competition generates steady diversifying selection that permanently drives the evolutionary divergence of populations that use different resources. Thus, competition plays two important roles in adaptive diversification––one well-known and the other only now emerging––mediated through its effect on the evolution of phenotypic plasticity [Current Zoology 59 (4: 537–552, 2013].

  19. Doxorubicin-induced ovarian toxicity

    Directory of Open Access Journals (Sweden)

    Rizel Shulamith

    2010-03-01

    Full Text Available Abstract Background Young cancer patients may occasionally face infertility and premature gonadal failure. Apart from its direct effect on follicles and oocytes, chemotherapy may induce ovarian toxicity via an impact on the entire ovary. The role of doxorubicin in potential ovarian failure remains obscure. Our intention was to elucidate doxorubicin-related toxicity within ovaries. Methods Female mice were injected intraperitoneally with 7.5 or 10 mg/kg doxorubicin and their ovaries were visualized in vivo by high resolution MRI, one day and one month following treatment. Ovaries of other treated mice were excised and weighed at the same post-treatment intervals. Ovarian histological sections were stained for TUNEL or active caspase-3 and follicles were counted and categorized. Ovulation rates were evaluated in superovulated female mice treated with doxorubicin. Results A single injection of doxorubicin resulted in a major reduction in both ovarian size and weight that lasted even one month post treatment. A dramatic reduction in ovulation rate was observed one week after treatment, followed by a partial recovery at one month. Histological examination revealed positive staining of TUNEL and active caspase-3. We observed a significant reduction in the population of secondary and primordial follicles one month following treatment. Conclusions Our results may imply a mechanism of chemotherapy-induced ovarian toxicity, manifested by reduced ovulation and accompanied by a reduction in ovarian size, caused probably by an acute insult to the ovary.

  20. Preference pulses induced by reinforcement.

    Science.gov (United States)

    Hachiga, Yosuke; Sakagami, Takayuki; Silberberg, Alan

    2014-11-01

    Eight rats responded on concurrent Variable-Ratio 20 Extinction schedules for food reinforcement. The assignment of variable-ratio reinforcement to a left or right lever varied randomly following each reinforcer, and was cued by illumination of a stimulus light above that lever. Postreinforcement preference levels decreased substantially and reliably over time when the lever that just delivered reinforcement was now in extinction; however, if that lever was once again associated with variable ratio, this decrease in same-lever preference tended to be small, and for some subjects, not in evidence. The changes in preference level to the extinction lever were well described by a modified version of Killeen, Hanson, and Osborne's (1978) induction model. Consistent with this model's attribution of preference change to induction, we attribute preference change in this report to a brief period of reinforcer-induced arousal that energizes responding to the lever that delivered the last reinforcer. After a few seconds, this induced responding diminishes, and the operant responding that remains comes under the control of the stimulus light cuing the lever providing variable-ratio reinforcement.

  1. Sildenafil Induced Acute Interstitial Nephritis

    Directory of Open Access Journals (Sweden)

    Ryan Burkhart

    2015-01-01

    Full Text Available Acute interstitial nephritis (AIN is characterized by inflammation of the renal interstitium and usually occurs in a temporal relationship with the medication. We present a case of an Asian male who had nephrotic range proteinuria and presented with acute kidney injury. The patient reported an acute change in physical appearance and symptomatology after the ingestion of a single dose of sildenafil. Renal biopsy was notable for minimal change disease (MCD with acute and chronic interstitial nephritis. Renal replacement and glucocorticoid therapy were initiated. Renal recovery within six weeks permitted discontinuation of dialysis. AIN superimposed on MCD is a known association of NSAID induced nephropathy. The temporal association and the absence of any new drugs suggest that the AIN was most likely due to the sildenafil. NSAIDs are less likely to have caused the AIN given their remote use. The ease of steroid responsiveness would also suggest another cause as NSAID induced AIN is often steroid resistant. The MCD was most likely idiopathic given the lack of temporal association with a secondary cause. As the number of sildenafil prescriptions increases, more cases of AIN may be identified and physician awareness for this potential drug disease association is necessary.

  2. Coffee induces autophagy in vivo.

    Science.gov (United States)

    Pietrocola, Federico; Malik, Shoaib Ahmad; Mariño, Guillermo; Vacchelli, Erika; Senovilla, Laura; Chaba, Kariman; Niso-Santano, Mireia; Maiuri, Maria Chiara; Madeo, Frank; Kroemer, Guido

    2014-01-01

    Epidemiological studies and clinical trials revealed that chronic consumption coffee is associated with the inhibition of several metabolic diseases as well as reduction in overall and cause-specific mortality. We show that both natural and decaffeinated brands of coffee similarly rapidly trigger autophagy in mice. One to 4 h after coffee consumption, we observed an increase in autophagic flux in all investigated organs (liver, muscle, heart) in vivo, as indicated by the increased lipidation of LC3B and the reduction of the abundance of the autophagic substrate sequestosome 1 (p62/SQSTM1). These changes were accompanied by the inhibition of the enzymatic activity of mammalian target of rapamycin complex 1 (mTORC1), leading to the reduced phosphorylation of p70(S6K), as well as by the global deacetylation of cellular proteins detectable by immunoblot. Immunohistochemical analyses of transgenic mice expressing a GFP-LC3B fusion protein confirmed the coffee-induced relocation of LC3B to autophagosomes, as well as general protein deacetylation. Altogether, these results indicate that coffee triggers 2 phenomena that are also induced by nutrient depletion, namely a reduction of protein acetylation coupled to an increase in autophagy. We speculate that polyphenols contained in coffee promote health by stimulating autophagy.

  3. Coalescence-induced nanodroplet jumping

    Science.gov (United States)

    Cha, Hyeongyun; Xu, Chenyu; Sotelo, Jesus; Chun, Jae Min; Yokoyama, Yukihiro; Enright, Ryan; Miljkovic, Nenad

    2016-10-01

    Water vapor condensation on superhydrophobic surfaces has received much attention in recent years due to the ability of such surfaces to shed microscale water droplets via coalescence-induced droplet jumping, resulting in heat transfer, anti-icing, and self-cleaning performance enhancement. Here we report the coalescence-induced removal of water nanodroplets (R ≈500 nm ) from superhydrophobic carbon nanotube (CNT) surfaces. The two-droplet coalescence time is measured for varying droplet Ohnesorge numbers, confirming that coalescence prior to jumping is governed by capillary-inertial dynamics. By varying the conformal hydrophobic coating thickness on the CNT surface, the minimum jumping droplet radius is shown to increase with increasing solid fraction and decreasing apparent advancing contact angle, allowing us to explore both hydrodynamic limitations stemming from viscous dissipation and surface adhesion limitations. We find that, even for the smallest nanostructure length scale (≤100 nm) and lowest surface adhesions, nonideal surface interactions and the evolved droplet morphology play defining roles in limiting the minimum size for jumping on real surfaces. The outcomes of this work demonstrate the ability to passively shed nanometric water droplets, which has the potential to further increase the efficiency of systems that can harness jumping droplets for a wide range of energy and water applications.

  4. Induced gravity II: grand unification

    Science.gov (United States)

    Einhorn, Martin B.; Jones, D. R. Timothy

    2016-05-01

    As an illustration of a renormalizable, asymptotically-free model of induced gravity, we consider an SO(10) gauge theory interacting with a real scalar multiplet in the adjoint representation. We show that dimensional transmutation can occur, spontaneously breaking SO(10) to SU(5)⊗U(1), while inducing the Planck mass and a positive cosmological constant, all proportional to the same scale v. All mass ratios are functions of the values of coupling constants at that scale. Below this scale (at which the Big Bang may occur), the model takes the usual form of Einstein-Hilbert gravity in de Sitter space plus calculable corrections. We show that there exist regions of parameter space in which the breaking results in a local minimum of the effective action giving a positive dilaton (mass)2 from two-loop corrections associated with the conformal anomaly. Furthermore, unlike the singlet case we considered previously, some minima lie within the basin of attraction of the ultraviolet fixed point. Moreover, the asymptotic behavior of the coupling constants also lie within the range of convergence of the Euclidean path integral, so there is hope that there will be candidates for sensible vacua. Although open questions remain concerning unitarity of all such renormalizable models of gravity, it is not obvious that, in curved backgrounds such as those considered here, unitarity is violated. In any case, any violation that may remain will be suppressed by inverse powers of the reduced Planck mass.

  5. Induced Gravity II: Grand Unification

    CERN Document Server

    Einhorn, Martin B

    2016-01-01

    As an illustration of a renormalizable, asymptotically-free model of induced gravity, we consider an $SO(10)$ gauge theory interacting with a real scalar multiplet in the adjoint representation. We show that dimensional transmutation can occur, spontaneously breaking $SO(10)$ to $SU(5){\\otimes}U(1),$ while inducing the Planck mass and a positive cosmological constant, all proportional to the same scale $v$. All mass ratios are functions of the values of coupling constants at that scale. Below this scale (at which the Big Bang may occur), the model takes the usual form of Einstein-Hilbert gravity in de Sitter space plus calculable corrections. We show that there exist regions of parameter space in which the breaking results in a local minimum of the effective action, and a {\\bf positive} dilaton $(\\hbox{mass})^2$ from two-loop corrections associated with the conformal anomaly. Furthermore, unlike the singlet case we considered previously, some minima lie within the basin of attraction of the ultraviolet fixed ...

  6. Magnetically induced QCD Kondo effect

    Science.gov (United States)

    Ozaki, Sho; Itakura, Kazunori; Kuramoto, Yoshio

    2016-10-01

    The "QCD Kondo effect" stems from the color exchange interaction in QCD with non-Abelian property, and can be realized in a high-density quark matter containing heavy-quark impurities. We propose a novel type of the QCD Kondo effect induced by a strong magnetic field. In addition to the fact that the magnetic field does not affect the color degrees of freedom, two properties caused by the Landau quantization in a strong magnetic field are essential for the "magnetically induced QCD Kondo effect"; (1) dimensional reduction to 1 +1 -dimensions, and (2) finiteness of the density of states for lowest energy quarks. We demonstrate that, in a strong magnetic field B , the scattering amplitude of a massless quark off a heavy quark impurity indeed shows a characteristic behavior of the Kondo effect. The resulting Kondo scale is estimated as ΛK≃√{eqB }αs1 /3exp {-4 π /Ncαslog (4 π /αs)} where αs and Nc are the fine structure constant of strong interaction and the number of colors in QCD, and eq is the electric charge of light quarks.

  7. Amylin induces hypoglycemia in mice

    Directory of Open Access Journals (Sweden)

    Luiz H. Guerreiro

    2013-03-01

    Full Text Available Amylin is a 37-aminoacid pancreatic protein that exerts control over several metabolic events such as glycemia and lacticemia. Amylin has long been shown to induce increases in arterial plasma glucose. We decided to investigate whether amylin plays additional roles in the glucose metabolism. We evaluated glucose homeostasis using whole blood from the tail tip of fasting, conscious, unrestrained normal and streptozotocyn-induced diabetic mice following subcutaneous administration of mouse amylin. Subcutaneous injection of 1 μg mouse amylin caused a transient decrease in whole blood glucose in both normal and diabetic mice in the absence of insulin. The blood glucose levels were lowest approximately 2 hours after amylin administration, after that they gradually recovered to the levels of the control group. The hypoglycemic effect followed a dose-dependent response ranging from 0.1 to 50 µg / mouse. These results reveal the ability for amylin in the direct control of glycemia at low doses in the absence of insulin.

  8. Dispersive mudslide-induced tsunamis

    Directory of Open Access Journals (Sweden)

    A. Rubino

    1998-01-01

    Full Text Available A nonlinear nested model for mudslide-induced tsunamis is proposed in which three phases of the life of the wave, i.e. the generation, far-field propagation and costal run-up are described by means of different mathematical models, that are coupled through appropriate matching procedures. The generation and run-up dynamics are simulated through a nonlinear shallow-water model with movable lateral boundaries: in the generation region two active layers are present, the lower one describing the slide descending on a sloping topography. For the intermediate phase, representing wave propagation far from the generation region, the hydrostatic assumption is not assumed as appropriate in general and, therefore, a nonlinear model allowing for weak phase dispersion, namely a Kadomtsev-Petviashvili equation, is used. This choice is made in order to assess the relevance of dispersive features such as solitary waves and dispersive tails. It is shown that in some realistic circumstances dispersive mudslide-induced tsunami waves can be produced over relatively short, distances. In such cases the use of a hydrostatic model throughout the whole tsunami history turns out to give erroneous results. In particular, when solitary waves are generated during the tsunami propagation in the open sea, the resulting run-up process yields peculiar wave forms leading to amplified coastal inundations with respect to a mere hydrostatic context.

  9. Shear induced phase transitions induced in edible fats

    Science.gov (United States)

    Mazzanti, Gianfranco; Welch, Sarah E.; Marangoni, Alejandro G.; Sirota, Eric B.; Idziak, Stefan H. J.

    2003-03-01

    The food industry crystallizes fats under different conditions of temperature and shear to obtain products with desired crystalline phases. Milk fat, palm oil, cocoa butter and chocolate were crystallized from the melt in a temperature controlled Couette cell. Synchrotron x-ray diffraction studies were conducted to examine the role of shear on the phase transitions seen in edible fats. The shear forces on the crystals induced acceleration of the alpha to beta-prime phase transition with increasing shear rate in milk fat and palm oil. The increase was slow at low shear rates and became very strong above 360 s-1. In cocoa butter the acceleration between beta-prime-III and beta-V phase transition increased until a maximum of at 360 s-1, and then decreased, showing competition between enhanced heat transfer and viscous heat generation.

  10. Amoxicillin-induced aseptic meningoencephalitis

    Directory of Open Access Journals (Sweden)

    Radi Shahien

    2010-06-01

    Full Text Available Radi Shahien1, Vetaly Vieksler1, Abdalla Bowirrat11Department of Neurology and Neurophysiology, Ziv Medical Center, Safed, IsraelAbstract: Meningitis is usually produced by an infectious agent, but there are multiple noninfectious causes. Drug-induced aseptic meningitis (DIAM is an important entity and has been reported as an uncommon adverse reaction with numerous agents. Thus, DIAM constitutes a diagnostic and patient management challenge. We present a patient with three episodes of aseptic meningitis due to amoxicillin, and then review the literature on this rare idiosyncratic event which may occur after local or systemic drug administration. A 77-year-old man was admitted to our hospital with fever, headache, and neck stiffness. Seven days before admission he had a dental and gingival inflammation. He was treated with two oral doses of 500 mg daily of amoxicillin for one week. The seventh day he awoke with the complaints that prompted hospital admittance. Amoxicillin was stopped 1 day before his admission. From his history we knew of two similar episodes: The first episode was after a dental procedure 3 months before this incident. He had received a 1-week course of postprocedure amoxicillin of 500 mg daily and had similar headache, fever, and chills during the entire course of treatment. He wasn’t admitted to the hospital, because he stopped taking amoxicillin and he felt spontaneous pain relief after taking symptomatic pain treatment. The second episodes was 6 months after his first admission, he had been admitted to our hospital with the same symptoms. Amoxicillin was stopped and changed with intravenous (IV ceftriaxone (CTRX for 10 days due to suspected partial untreated meningitis. The patient improved rapidly within 2 days and was discharged from the hospital. On the basis of these three confirmed episodes of meningitis after recurrent exposure to amoxicillin, with repetitive negative testing for viral, bacterial, and mycobacterial

  11. Spatially dependent electromagnetically induced transparency

    CERN Document Server

    Radwell, Neal; Piccirillo, Bruno; Barnett, Stephen M; Franke-Arnold, Sonja

    2014-01-01

    Recent years have seen vast progress in the generation and detection of structured light, with potential applications in high capacity optical data storage and continuous variable quantum technologies. Here we measure the transmission of structured light through cold rubidium atoms and observe regions of electromagnetically induced transparency (EIT). We use q-plates to generate a probe beam with azimuthally varying phase and polarisation structure, and its right and left circular polarisation components provide the probe and control of an EIT transition. We observe an azimuthal modulation of the absorption profile that is dictated by the phase and polarisation structure of the probe laser. Conventional EIT systems do not exhibit phase sensitivity. We show, however, that a weak transverse magnetic field closes the EIT transitions, thereby generating phase dependent dark states which in turn lead to phase dependent transparency, in agreement with our measurements.

  12. Radiative collision-induced photoionization

    Energy Technology Data Exchange (ETDEWEB)

    Nayfeh, M.H.; Payne, M.G.

    1978-05-01

    Semiclassical expressions of two-photon ionization of atoms induced by radiative collisions are derived. The dependence of the ionization yield on the atomic forces, field intensity, and energy gap is derived. Although absorption tends to decrease as the field intensity rises due to stimulated emission at the second crossing, the two-photon ionization yield can be nearly saturated at the first crossing, thus enhancing the absorption. Both regions, ionization in single collisions and ionization between collisions, are treated. In the latter we find that saturation of the ionization can be achieved at much reduced intensities. This process promises an extremely sensitive method for studying radiative collisions, especially when absorption or fluorescence becomes extremely weak.

  13. Current-Induced Membrane Discharge

    DEFF Research Database (Denmark)

    Andersen, Mathias Bækbo; van Soestbergen, M.; Mani, A.;

    2012-01-01

    Possible mechanisms for overlimiting current (OLC) through aqueous ion-exchange membranes (exceeding diffusion limitation) have been debated for half a century. Flows consistent with electro-osmotic instability have recently been observed in microfluidic experiments, but the existing theory...... neglects chemical effects and remains to be quantitatively tested. Here, we show that charge regulation and water self-ionization can lead to OLC by "current-induced membrane discharge'' (CIMD), even in the absence of fluid flow, in ion-exchange membranes much thicker than the local Debye screening length....... Salt depletion leads to a large electric field resulting in a local pH shift within the membrane with the effect that the membrane discharges and loses its ion selectivity. Since salt co-ions, H+ ions, and OH- ions contribute to OLC, CIMD interferes with electrodialysis (salt counterion removal...

  14. Inducible models of bone loss.

    Science.gov (United States)

    Doucette, Casey R; Rosen, Clifford J

    2014-12-11

    Bone is an essential organ that not only confers structural stability to the organism, but also serves as a reservoir for hematopoietic elements and is thought to affect systemic homeostasis through the release of endocrine factors as well as calcium. The loss of bone mass due to an uncoupling of bone formation and bone resorption leads to increased fragility that can result in devastating fractures. Further understanding of the effects of environmental stimuli on the development of bone disease in humans is needed, and they can be studied using animal models. Here, we present established and novel methods for the induction of bone loss in mice, including manipulation of diet and environment, administration of drugs, irradiation, and surgically induced hormone deficiency. All of these models are directly related to human cases, and thus, can be used to investigate the causes of bone loss resulting from these interventions.

  15. Human-induced Arctic moistening.

    Science.gov (United States)

    Min, Seung-Ki; Zhang, Xuebin; Zwiers, Francis

    2008-04-25

    The Arctic and northern subpolar regions are critical for climate change. Ice-albedo feedback amplifies warming in the Arctic, and fluctuations of regional fresh water inflow to the Arctic Ocean modulate the deep ocean circulation and thus exert a strong global influence. By comparing observations to simulations from 22 coupled climate models, we find influence from anthropogenic greenhouse gases and sulfate aerosols in the space-time pattern of precipitation change over high-latitude land areas north of 55 degrees N during the second half of the 20th century. The human-induced Arctic moistening is consistent with observed increases in Arctic river discharge and freshening of Arctic water masses. This result provides new evidence that human activity has contributed to Arctic hydrological change.

  16. Decoherence induced by fluctuating boundaries

    CERN Document Server

    De Lorenci, V A

    2012-01-01

    The effects of fluctuating boundaries on a superposition state of a quantum particle in a box is studied. We consider a model in one space dimension in which the initial state is a coherent superposition of two energy eigenstates. The locations of the walls of the box are assumed to undergo small fluctuation with a Gaussian probability distribution. The spatial probability density of the particle contains an interference term, which is found to decay in time due to the boundary fluctuations. At late times, this term vanishes and the quantum coherence is lost. The system is now described by a density matrix rather than a pure quantum state.This model gives a simple illustration of how environment-induced decoherence can take place in quantum systems. It can also serve as an analog model for the effects of spacetime geometry fluctuations on quantum systems.

  17. Pressure induced polymerization of Formates

    Science.gov (United States)

    Tschauner, Oliver

    2004-03-01

    The discovery of pressure induced polymerization of CO2 inspired us to search for C-O based chain structures forming at high pressure. We used salts of carboxylic acids as starting materials and exposed them to pressures between 10 and 30 GPa. Upon heating to temperatures above 1800 K we observed deprotonation and significant changes in the Raman shifts of C-O streching modes. Structure analysis based on powder diffraction patterns collected at sector 16 of the APS showed formation of extended C-O chain structures with the cations of the salts residing in the interchain spaces. These new high pressure polymers are interesting by their mechanical strength and provide basic molecular patterns of organic metallic conductors.

  18. Drug-induced liver injury

    DEFF Research Database (Denmark)

    Nielsen, Mille Bækdal; Ytting, Henriette; Skalshøi Kjær, Mette

    2017-01-01

    biochemical findings included bilirubin elevated to above 3.2 × ULN, ALT elevated to above 9 × ULN in 86%, INR above 1.4 in 70%. Twenty two patients needed treatment in the liver intensive care unit. Fifteen patients developed acute liver failure with a severe outcome. Six patients were liver transplanted......OBJECTIVE: The idiosyncratic subtype of drug-induced liver injury (DILI) is a rare reaction to medical treatment that in severe cases can lead to acute liver failure and death. The aim of this study was to describe the presentation and outcome of DILI and to identify potential predictive factors...... and outcome. RESULTS: Of 43 patients, 25 (58%) were female with a mean age of 54 years. The two most frequent causes of DILI were Disulfiram (30%) and antibiotics (19%). The most common symptoms were jaundice, nausea, fatigue and gastrointestinal discomfort. At the time of admission, the most frequent...

  19. Linezolid-induced optic neuropathy

    Directory of Open Access Journals (Sweden)

    Divya Karuppannasamy

    2014-01-01

    Full Text Available Many systemic antimicrobials have been implicated to cause ocular adverse effects. This is especially relevant in multidrug therapy where more than one drug can cause a similar ocular adverse effect. We describe a case of progressive loss of vision associated with linezolid therapy. A 45-year-old male patient who was on treatment with multiple second-line anti-tuberculous drugs including linezolid and ethambutol for extensively drug-resistant tuberculosis (XDR-TB presented to us with painless progressive loss of vision in both eyes. Color vision was defective and fundus examination revealed optic disc edema in both eyes. Ethambutol-induced toxic optic neuropathy was suspected and tablet ethambutol was withdrawn. Deterioration of vision occurred despite withdrawal of ethambutol. Discontinuation of linezolid resulted in marked improvement of vision. Our report emphasizes the need for monitoring of visual function in patients on long-term linezolid treatment.

  20. Radiocontrast-induced renal failure

    Energy Technology Data Exchange (ETDEWEB)

    Misson, R.T.; Cutler, R.E.

    1985-05-01

    Review of the literature concerning contrast-induced renal dysfunction shows that the currently used agents are remarkably safe with careful patient selection. Clinically apparent kidney failure after their use is essentially nonexistent in those without preexistent renal insufficiency. The incidence rises rapidly in those with azotemia from any cause, however, and diabetic persons with nephropathy are perhaps at special risk. Vigorous volume expansion is possibly effective as a preventive measure and may attenuate adverse effects in those in whom postcontrast dysfunction occurs. New agents are becoming available. It is not yet known if these will prove safer or cost-effective. They have some experimentally demonstrated and theoretical advantages over the presently used agents. 58 references, 1 figure, 2 tables.

  1. Capecitabine-Induced Coronary Vasospasm

    Directory of Open Access Journals (Sweden)

    Danish Henry

    2016-10-01

    Full Text Available Capecitabine, an oral prodrug of 5-fluorouracil (5-FU, is approved for early-stage and advanced colorectal cancer and metastatic breast cancer. Cardiotoxicity of 5-FU is well described in the literature. However, cardiac adverse effects of capecitabine are poorly described. We report a case of coronary vasospasm induced by capecitabine. A 41-year-old female with metastatic breast cancer presented with chest pain 3 days after starting capecitabine. The chest pain was relieved by rest and exacerbated by exertion. Her physical examination was unremarkable except for a rapid heart rate of 100 bpm. Electrocardiogram test showed no acute ischemic changes. Troponin tests were negative. CT angiography of the chest was negative for acute pulmonary embolism. An echocardiogram showed a left ventricular ejection fraction of 60% without any wall motion abnormalities. The chest pain resolved with aspirin and analgesic use. She was discharged following an inconclusive cardiac workup. Further use of capecitabine was discontinued.

  2. Lattice Induced Transparency in Metasurfaces

    CERN Document Server

    Manjappa, Manukumara; Singh, Ranjan

    2016-01-01

    Lattice modes are intrinsic to the periodic structures and their occurrence can be easily tuned and controlled by changing the lattice constant of the structural array. Previous studies have revealed excitation of sharp absorption resonances due to lattice mode coupling with the plasmonic resonances. Here, we report the first experimental observation of a lattice induced transparency (LIT) by coupling the first order lattice mode (FOLM) to the structural resonance of a metamaterial resonator at terahertz frequencies. The observed sharp transparency is a result of the destructive interference between the bright mode and the FOLM mediated dark mode. As the FOLM is swept across the metamaterial resonance, the transparency band undergoes large change in its bandwidth and resonance position. Besides controlling the transparency behaviour, LIT also shows a huge enhancement in the Q-factor and record high group delay of 28 ps, which could be pivotal in ultrasensitive sensing and slow light device applications.

  3. Exercise-induced cardiac remodeling.

    Science.gov (United States)

    Weiner, Rory B; Baggish, Aaron L

    2012-01-01

    Early investigations in the late 1890s and early 1900s documented cardiac enlargement in athletes with above-normal exercise capacity and no evidence of cardiovascular disease. Such findings have been reported for more than a century and continue to intrigue scientists and clinicians. It is well recognized that repetitive participation in vigorous physical exercise results in significant changes in myocardial structure and function. This process, termed exercise-induced cardiac remodeling (EICR), is characterized by structural cardiac changes including left ventricular hypertrophy with sport-specific geometry (eccentric vs concentric). Associated alterations in both systolic and diastolic functions are emerging as recognized components of EICR. The increasing popularity of recreational exercise and competitive athletics has led to a growing number of individuals exhibiting these findings in routine clinical practice. This review will provide an overview of EICR in athletes.

  4. Canagliflozin-Induced Diabetic Ketoacidosis

    Science.gov (United States)

    Turner, Jessica; Begum, Tahmina; Smalligan, Roger D.

    2016-01-01

    Introduction: Sodium-glucose co-transporter 2 (SGLT-2) inhibitors are relatively new antihyperglycemic agents that lower renal glucose reabsorption. They are used as adjunctive therapy to standard diabetes treatment. Case Report: We present the case of a 62-year-old woman with a past medical history of type 2 diabetes mellitus and sudden-onset diabetic ketoacidosis (DKA). Use of canagliflozin, a SGLT-2 inhibitor, was determined to be the cause of the DKA. The patient ultimately recovered after 5 days in the intensive care unit. She was changed to long- and short-acting insulins and instructed to avoid canagliflozin. Conclusion: Although SGLT-2 inhibitors are effective at lowering a patient’s hemoglobin A1C, physicians must be aware of the rare but dangerous potential adverse effect of inducing DKA. This article reports an illustrative case and presents a review of the literature. PMID:27635409

  5. Current-induced membrane discharge

    CERN Document Server

    Andersen, M B; Mani, A; Bruus, H; Biesheuvel, P M; Bazant, M Z

    2012-01-01

    Possible mechanisms for over-limiting current (OLC) through aqueous ion-exchange membranes (exceeding diffusion limitation) have been debated for half a century. Flows consistent with electro-osmotic instability (EOI) have recently been observed in microfluidic experiments, but the existing theory neglects chemical effects and remains to be quantitatively tested. Here, we show that charge regulation and water self-ionization can lead to OLC by "current-induced membrane discharge" (CIMD), even in the absence of fluid flow. Salt depletion leads to a large electric field which expels water co-ions, causing the membrane to discharge and lose its selectivity. Since salt co-ions and water ions contribute to OLC, CIMD interferes with electrodialysis (salt counter-ion removal) but could be exploited for current-assisted ion exchange and pH control. CIMD also suppresses the extended space charge that leads to EOI, so it should be reconsidered in both models and experiments on OLC.

  6. Canagliflozin-Induced Diabetic Ketoacidosis

    Directory of Open Access Journals (Sweden)

    Jessica Turner MSIV

    2016-08-01

    Full Text Available Introduction: Sodium-glucose co-transporter 2 (SGLT-2 inhibitors are relatively new antihyperglycemic agents that lower renal glucose reabsorption. They are used as adjunctive therapy to standard diabetes treatment. Case Report: We present the case of a 62-year-old woman with a past medical history of type 2 diabetes mellitus and sudden-onset diabetic ketoacidosis (DKA. Use of canagliflozin, a SGLT-2 inhibitor, was determined to be the cause of the DKA. The patient ultimately recovered after 5 days in the intensive care unit. She was changed to long- and short-acting insulins and instructed to avoid canagliflozin. Conclusion: Although SGLT-2 inhibitors are effective at lowering a patient’s hemoglobin A1C, physicians must be aware of the rare but dangerous potential adverse effect of inducing DKA. This article reports an illustrative case and presents a review of the literature.

  7. Nuclear dynamics induced by antiprotons

    CERN Document Server

    Feng, Zhao-Qing

    2015-01-01

    Reaction dynamics in collisions of antiprotons on nuclei is investigated within the Lanzhou quantum molecular dynamics model. The reaction channels of elastic scattering, annihilation, charge exchange and inelastic collisions of antiprotons on nucleons have been included in the model. Dynamics on particle production, in particular pions, kaons, antikaons and hyperons, is investigated in collisions of $\\overline{p}$ on $^{12}$C, $^{20}$Ne, $^{40}$Ca and $^{181}$Ta from a low to high incident momenta. It is found that the annihilations of $\\overline{p}$ on nucleons are of importance on the dynamics of particle production in phase space. Hyperons are mainly produced via meson induced reactions on nucleons and strangeness exchange collisions, which lead to the delayed emission in antiproton-nucleus collisions.

  8. Hemolysis induced by PMIVSD occluder.

    Science.gov (United States)

    Rao, D Sheshagiri; Barik, Ramachandra; Siva Prasad, Akula

    2016-09-01

    Hemolysis related to occluder, prosthetic valve, and prosthetic ring used for mitral valve annuloplasty are not very unusual. However, hemolysis related to transcathetor closure of post-myocardial infarction ventricular septal defect (PMIVSD) is infrequent. A close follow-up for spontaneous resolution with or without blood transfusion has been reported in a few cases. Occasionally, surgical retrieval is unavoidable or lifelong blood transfusion is required if surgery cannot be done because of higher risk. In this illustration, we have showed a close follow-up of a case of hemolysis induced by atrial septal occluder used for VSD closure after myocardial infarction. Despite successful device closure of PMIVSD which is difficult, a close watch is needed for complications like residual leak, device embolization, and hemolysis.

  9. Laser induced nuclear waste transmutation

    CERN Document Server

    Hirlimann, Charles

    2016-01-01

    When producing electricity that collects the mass energy that is available at the time of the induced disintegration of radioactive elements, other unstable elements are produced with half-life span durations ranging from less than one second to hundreds of thousands of years and which are considered as waste. Managing nuclear waste with a half-life of less than 30 years is an easy task, as our societies clearly know how to keep buildings safe for more than a century, the time it takes for the activity to be divided by a factor of 8. High-activity, long-lasting waste that can last for thousands of years or even longer, up to geological time laps, cannot be taken care of for such long durations. Therefore, these types of waste are socially unacceptable; nobody wants to leave a polluted planet to descendants.

  10. Tenofovir induced lichenoid drug eruption.

    Science.gov (United States)

    Gupta, Mrinal; Gupta, Heena; Gupta, Anish

    2015-01-01

    Cutaneous adverse reactions are a common complication of anti-retroviral therapy. Tenofovir is a newer anti-retroviral drug belonging to the nucleotide reverse transcriptase inhibitor group. Systemic adverse effects like nausea, vomiting, diarrhea, hepatotoxicity and renal toxicity are common with tenofovir but cutaneous adverse effects are rare. Lichenoid drug eruptions are a common adverse effect seen with a large variety of drugs including antimalarials, antihypertensives, nonsteroidal anti-inflammatory drugs and diuretics. Lichenoid drug eruption is a rare cutaneous adverse effect of tenofovir with only a single case reported till date. Here, we report a case of tenofovir induced lichenoid drug eruption in a 54-year-old human immunodeficiency virus affected male who presented with generalized lichenoid eruption after 6 weeks of initiation of tenofovir and complete clearance on cessation of the drug.

  11. Current-Induced Effects in Nanoscale Conductors

    OpenAIRE

    2005-01-01

    We present an overview of current-induced effects in nanoscale conductors with emphasis on their description at the atomic level. In particular, we discuss steady-state current fluctuations, current-induced forces, inelastic scattering and local heating. All of these properties are calculated in terms of single-particle wavefunctions computed using a scattering approach within the static density-functional theory of many-electron systems. Examples of current-induced effects in atomic and mole...

  12. Treatment of Laser-Induced Retinal Injuries

    Science.gov (United States)

    1989-06-29

    Distribution List (enclosed) bI’TF rruIoN STATEMEN A Approved for publi reljaso Disatbunon Unlimited TREATMENT OF LASER-INDUCED RETINAL INJURIES FINAL...suprathreshold retinal laser lesions II. Subthreshold retinal laser lesions III. Effect of steroid treatment on laser-induced retinal injury Discussion and...In the present study we investigated the effect of corticosteroid treatment of argon laser-induced retinal injury on vitreal accumulation of both

  13. Innovation Inducement Prizes: Connecting Research to Policy

    OpenAIRE

    Besharov, Douglas J.; Heidi L. Williams

    2012-01-01

    Innovation inducement prizes have been used for centuries. In the United States, a recent federal policy change—the America COMPETES Reauthorization Act of 2010—clarified and simplified a path by which all federal agencies can offer innovation inducement prizes, thus intensifying interest in how government agencies can most effectively design and apply such prizes. This paper aims to review and synthesize the academic literature on innovation inducement prizes, to clarify what has been learne...

  14. Drug-induced status epilepticus.

    Science.gov (United States)

    Cock, Hannah R

    2015-08-01

    Drug-induced status epilepticus (SE) is a relatively uncommon phenomenon, probably accounting for less than 5% of all SE cases, although limitations in case ascertainment and establishing causation substantially weaken epidemiological estimates. Some antiepileptic drugs, particularly those with sodium channel or GABA(γ-aminobutyric acid)-ergic properties, frequently exacerbate seizures and may lead to SE if used inadvertently in generalized epilepsies or less frequently in other epilepsies. Tiagabine seems to have a particular propensity for triggering nonconvulsive SE sometimes in patients with no prior history of seizures. In therapeutic practice, SE is most commonly seen in association with antibiotics (cephalosporins, quinolones, and some others) and immunotherapies/chemotherapies, the latter often in the context of a reversible encephalopathy syndrome. Status epilepticus following accidental or intentional overdoses, particularly of antidepressants or other psychotropic medications, has also featured prominently in the literature: whilst there are sometimes fatal consequences, this is more commonly because of cardiorespiratory or metabolic complications than as a result of seizure activity. A high index of suspicion is required in identifying those at risk and in recognizing potential clues from the presentation, but even with a careful analysis of patient and drug factors, establishing causation can be difficult. In addition to eliminating the potential trigger, management should be as for SE in any other circumstances, with the exception that phenobarbitone is recommended as a second-line treatment for suspected toxicity-related SE where the risk of cardiovascular complications is higher anyways and may be exacerbated by phenytoin. There are also specific recommendations/antidotes in some situations. The outcome of drug-induced status epilepticus is mostly good when promptly identified and treated, though less so in the context of overdoses. This article is

  15. Fisheries-induced disruptive selection.

    Science.gov (United States)

    Landi, Pietro; Hui, Cang; Dieckmann, Ulf

    2015-01-21

    Commercial harvesting is recognized to induce adaptive responses of life-history traits in fish populations, in particular by shifting the age and size at maturation through directional selection. In addition to such evolution of a target stock, the corresponding fishery itself may adapt, in terms of fishing policy, technological progress, fleet dynamics, and adaptive harvest. The aim of this study is to assess how the interplay between natural and artificial selection, in the simplest setting in which a fishery and a target stock coevolve, can lead to disruptive selection, which in turn may cause trait diversification. To this end, we build an eco-evolutionary model for a size-structured population, in which both the stock׳s maturation schedule and the fishery׳s harvest rate are adaptive, while fishing may be subject to a selective policy based on fish size and/or maturity stage. Using numerical bifurcation analysis, we study how the potential for disruptive selection changes with fishing policy, fishing mortality, harvest specialization, life-history tradeoffs associated with early maturation, and other demographic and environmental parameters. We report the following findings. First, fisheries-induced disruptive selection is readily caused by commonly used fishing policies, and occurs even for policies that are not specific for fish size or maturity, provided that the harvest is sufficiently adaptive and large individuals are targeted intensively. Second, disruptive selection is more likely in stocks in which the selective pressure for early maturation is naturally strong, provided life-history tradeoffs are sufficiently consequential. Third, when a fish stock is overexploited, fisheries targeting only large individuals might slightly increase sustainable yield by causing trait diversification (even though the resultant yield always remains lower than the maximum sustainable yield that could be obtained under low fishing mortality, without causing disruptive

  16. [Induced abortion in China: problems and interventions].

    Science.gov (United States)

    Wu, Shang-chun; Qiu, Hong-yan

    2010-10-01

    Pooled literatures showed that the induced abortion in China faces many problems:the number of induced abortion remains large; most cases are young and nulliparity women; the frequency of abortion is high; and the interval between one and another abortion is short. Health promotion strategies should be applied to address these problems. It is important to increase the population's awareness of contraception,especially among nulliparity and migrant populations. Routine and effective contraceptive methods should be recommended and emphasized during induced abortion and delivery to lower the rate of induced abortion.

  17. An evaluation of a hubless inducer and a full flow hydraulic turbine driven inducer boost pump

    Science.gov (United States)

    Lindley, B. K.; Martinson, A. R.

    1971-01-01

    The purpose of the study was to compare the performance of several configurations of hubless inducers with a hydrodynamically similar conventional inducer and to demonstrate the performance of a full flow hydraulic turbine driven inducer boost pump using these inducers. A boost pump of this type consists of an inducer connected to a hydraulic turbine with a high speed rotor located in between. All the flow passes through the inducer, rotor, and hydraulic turbine, then into the main pump. The rotor, which is attached to the main pump shaft, provides the input power to drive the hydraulic turbine which, in turn, drives the inducer. The inducer, rotating at a lower speed, develops the necessary head to prevent rotor cavitation. The rotor speed is consistent with present main engine liquid hydrogen pump designs and the overall boost pump head rise is sufficient to provide adequate main pump suction head. This system would have the potential for operating at lower liquid hydrogen tank pressures.

  18. Herbal and plant therapy in patients with inflammatory bowel disease.

    Science.gov (United States)

    Triantafyllidi, Aikaterini; Xanthos, Theodoros; Papalois, Apostolos; Triantafillidis, John K

    2015-01-01

    The use of herbal therapy in inflammatory bowel disease (IBD) is increasing worldwide. The aim of this study was to review the literature on the efficacy of herbal therapy in IBD patients. Studies on herbal therapy for IBD published in Medline and Embase were reviewed, and response to treatment and remission rates were recorded. Although the number of the relevant clinical studies is relatively small, it can be assumed that the efficacy of herbal therapies in IBD is promising. The most important clinical trials conducted so far refer to the use of mastic gum, tormentil extracts, wormwood herb, aloe vera, triticum aestivum, germinated barley foodstuff, and boswellia serrata. In ulcerative colitis, aloe vera gel, triticum aestivum, andrographis paniculata extract and topical Xilei-san were superior to placebo in inducing remission or clinical response, and curcumin was superior to placebo in maintaining remission; boswellia serrata gum resin and plantago ovata seeds were as effective as mesalazine, whereas oenothera biennis had similar relapse rates as ω-3 fatty acids in the treatment of ulcerative colitis. In Crohn's disease, mastic gum, Artemisia absinthium, and Tripterygium wilfordii were superior to placebo in inducing remission and preventing clinical postoperative recurrence, respectively. Herbal therapies exert their therapeutic benefit by different mechanisms including immune regulation, antioxidant activity, inhibition of leukotriene B4 and nuclear factor-kappa B, and antiplatelet activity. Large, double-blind clinical studies assessing the most commonly used natural substances should urgently be conducted.

  19. Towards inducing superconductivity into graphene

    Science.gov (United States)

    Efetov, Dmitri K.

    Graphenes transport properties have been extensively studied in the 10 years since its discovery in 2004, with ground-breaking experimental observations such as Klein tunneling, fractional quantum Hall effect and Hofstadters butterfly. Though, so far, it turned out to be rather poor on complex correlated electronic ground states and phase transitions, despite various theoretical predictions. The purpose of this thesis is to help understanding the underlying theoretical and experimental reasons for the lack of strong electronic interactions in graphene, and, employing graphenes high tunability and versatility, to identify and alter experimental parameters that could help to induce stronger correlations. In particular graphene holds one last, not yet experimentally discovered prediction, namely exhibiting intrinsic superconductivity. With its vanishingly small Fermi surface at the Dirac point, graphene is a semi-metal with very weak electronic interactions. Though, if it is doped into the metallic regime, where the size of the Fermi surface becomes comparable to the size of the Brillouin zone, the density of states becomes sizeable and electronic interactions are predicted to be dramatically enhanced, resulting in competing correlated ground states such as superconductivity, magnetism and charge density wave formation. Following these predictions, this thesis first describes the creation of metallic graphene at high carrier doping via electrostatic doping techniques based on electrolytic gates. Due to graphenes surface only properties, we are able to induce carrier densities above n>1014 cm-2 (epsilonF>1eV) into the chemically inert graphene. While at these record high carrier densities we yet do not observe superconductivity, we do observe fundamentally altered transport properties as compared to semi-metallic graphene. Here, detailed measurements of the low temperature resistivity reveal that the electron-phonon interactions are governed by a reduced, density

  20. Vaccination with IL-6 analogues induces autoantibodies to IL-6 and influences experimentally induced inflammation

    DEFF Research Database (Denmark)

    Galle, Pia; Jensen, Lene; Andersson, Christina

    2007-01-01

    ; yet they appear healthy and do not exhibit overt clinical or laboratory abnormalities. We induced comparable levels of aAb-IL-6 in different mouse strains by vaccination with immunogenic IL-6 analogues. We observed that the induced aAb-IL-6 protected against collagen-induced arthritis and experimental...

  1. Psychiatric sequelae of induced abortion.

    Science.gov (United States)

    Gibbons, M

    1984-03-01

    An attempt is made to identify and document the problems of comparative evaluation of the more recent studies of psychiatric morbidity after abortion and to determine the current consensus so that when the results of the joint RCGP/RCOG study of the sequelae of induced abortion become available they can be viewed in a more informed context. The legalization of abortion has provided more opportunities for studies of subsequent morbidity. New laws have contributed to the changing attitudes of society, and the increasing acceptability of the operation has probably influenced the occurrence of psychiatric sequelae. The complexity of measuring psychiatric sequelae is evident from the many terms used to describe symptomatology and behavioral patterns and from the number of assessment techniques involved. Numerous techniques have been used to quantify psychiatric sequelae. Several authors conclude that few psychiatric problems follow an induced abortion, but many studies were deficient in methodology, material, or length of follow-up. A British study in 1975 reported a favorable outcome for a "representative sample" of 50 National Health Service patients: 68% of these patients had an absence of or only mild feelings of guilt, loss, or self reproach and considered abortion as the best solution to their problem. The 32% who had an adverse outcome reported moderate to severe feelings of guilt, regret, loss, and self reproach, and there was evidence of mental illness. In most of these cases the adverse outcome was related to the patient's environment since the abortion. A follow-up study of 126 women, which compared the overall reaction to therapeutic abortion between women with a history of previous mild psychiatric illness and those without reported that a significantly different emotional reaction could not be demonstrated between the 2 groups. In a survey among women seeking an abortion 271 who were referred for a psychiatric opinion regarding terminations of pregnancy

  2. Opioid-Induced Constipation and Bowel Dysfunction

    DEFF Research Database (Denmark)

    Müller-Lissner, Stefan; Bassotti, Gabrio; Coffin, Benoit

    2016-01-01

    OBJECTIVE:  To formulate timely evidence-based guidelines for the management of opioid-induced bowel dysfunction. SETTING:  Constipation is a major untoward effect of opioids. Increasing prescription of opioids has correlated to increased incidence of opioid-induced constipation. However, the inh...

  3. Induced disease resistance signaling in plants

    NARCIS (Netherlands)

    Verhagen, B.W.M.; Loon, L.C. van; Pieterse, C.M.J.

    2006-01-01

    To protect themselves from disease, plants have evolved sophisticated inducible defense mechanisms in which the signal molecules salicylic acid, jasmonic acid and ethylene often play crucial roles. Elucidation of signaling pathways controlling induced disease resistance is a major objective in resea

  4. Inducible limb-shaking transitory ischemic attacks

    DEFF Research Database (Denmark)

    Rosenbaum, Sverre; Ovesen, Christian; Futrell, Nancy

    2016-01-01

    with exercise-induced weakness associated with tremor in his right arm. His left internal carotid artery was occluded at the bifurcation. Administration of statin and antiplatelet did not relieve his symptoms, and his stereotypic, exercise-induced "limb-shaking" episodes persisted. He underwent successful...

  5. Innovation Inducement Prizes: Connecting Research to Policy

    Science.gov (United States)

    Besharov, Douglas J.; Williams, Heidi

    2012-01-01

    Innovation inducement prizes have been used for centuries. In the United States, a recent federal policy change--the America COMPETES Reauthorization Act of 2010--clarified and simplified a path by which all federal agencies can offer innovation inducement prizes, thus intensifying interest in how government agencies can most effectively design…

  6. Nucleosynthesis by photon-induced reactions

    Energy Technology Data Exchange (ETDEWEB)

    Mohr, P. E-mail: mohr@ikpAu-darmstadt.de; Babilon, M.; Galaviz, D.; Sonnabend, K.; Vogt, K.; Zilges, A

    2003-05-19

    Similar to the well-known Gamow window for charged particle induced reactions, there exists an effective energy window for photon-induced reactions. Properties of this window are discussed in detail for ({gamma}, n) and ({gamma}, {alpha}) reactions. These reactions are important for the nucleosynthesis of rare neutron-deficient p nuclei.

  7. Cycloserine induced psychosis with hepatic dysfunction

    Directory of Open Access Journals (Sweden)

    Vishal R Tandon

    2015-01-01

    Full Text Available With the increase in the cases of multidrug resistance tuberculosis, second line anti-tubercular drugs like the cycloserine are being prescribed frequently. Isoniazid and ethambutol are reported to cause psychosis like state; however, few reports of cycloserine induced psychosis are available. To the best of our knowledge, this is the first case of cycloserine induced psychosis with hepatic dysfunction.

  8. Induced floral heteromorphism in Petunia hybrida

    Directory of Open Access Journals (Sweden)

    S. G. Kashikar

    2014-02-01

    Full Text Available Floral heteromorphism induced in Petunia hybrida with several chemical mutagens and gamma-radiation is discussed. Potentials of these mutagens in inducing various forms are described. The effect of heteromorphism on flower production, pollen sterility and seed set besides cross and self compatibilities between different heteromorphic forms have also been reported.

  9. Gravitational Zero Point Energy induces Physical Observables

    OpenAIRE

    Garattini, Remo

    2010-01-01

    We consider the contribution of Zero Point Energy on the induced Cosmological Constant and on the induced Electric/Magnetic charge in absence of matter fields. The method is applicable to every spherically symmetric background. Extensions to a generic $f(R) $ theory are also allowed. Only the graviton appears to be fundamental to the determination of Zero Point Energy.

  10. Minimal Mimicry: Mere Effector Matching Induces Preference

    Science.gov (United States)

    Sparenberg, Peggy; Topolinski, Sascha; Springer, Anne; Prinz, Wolfgang

    2012-01-01

    Both mimicking and being mimicked induces preference for a target. The present experiments investigate the minimal sufficient conditions for this mimicry-preference link to occur. We argue that mere effector matching between one's own and the other person's movement is sufficient to induce preference, independent of which movement is actually…

  11. HOW TO REDUCE NEEDLE INSERTION INDUCED PAIN

    Institute of Scientific and Technical Information of China (English)

    王斌; 董莉

    2001-01-01

    Acupuncture needle insertion always results in pain in the local area due to stimulating the free nerve endings—algesireceptors of the skin. In spite of mildness, this pain may induce many patients' fright, and thus, hinders more extensive application of acupuncture. In the present paper, the author introduces some methods for reducing needle insertion induced pain.

  12. Laser-Induced Energy Transfer in Solids

    NARCIS (Netherlands)

    Morsink, J.B.W.; Rullmann, Johan; Wiersma, Douwe

    1981-01-01

    Laser-induced energy transfer was observed and studied in the system pentacene doped into naphthalene. The transfer spectrum shows a remarkable correspondence with the host density of states function. The rate for laser-induced energy transfer is given and it is concluded that most likely, intermole

  13. Uridine prevents fenofibrate-induced fatty liver.

    Directory of Open Access Journals (Sweden)

    Thuc T Le

    Full Text Available Uridine, a pyrimidine nucleoside, can modulate liver lipid metabolism although its specific acting targets have not been identified. Using mice with fenofibrate-induced fatty liver as a model system, the effects of uridine on liver lipid metabolism are examined. At a daily dosage of 400 mg/kg, fenofibrate treatment causes reduction of liver NAD(+/NADH ratio, induces hyper-acetylation of peroxisomal bifunctional enzyme (ECHD and acyl-CoA oxidase 1 (ACOX1, and induces excessive accumulation of long chain fatty acids (LCFA and very long chain fatty acids (VLCFA. Uridine co-administration at a daily dosage of 400 mg/kg raises NAD(+/NADH ratio, inhibits fenofibrate-induced hyper-acetylation of ECHD, ACOX1, and reduces accumulation of LCFA and VLCFA. Our data indicates a therapeutic potential for uridine co-administration to prevent fenofibrate-induced fatty liver.

  14. Drug-Induced Oxidative Stress and Toxicity

    Directory of Open Access Journals (Sweden)

    Damian G. Deavall

    2012-01-01

    Full Text Available Reactive oxygen species (ROS are a byproduct of normal metabolism and have roles in cell signaling and homeostasis. Species include oxygen radicals and reactive nonradicals. Mechanisms exist that regulate cellular levels of ROS, as their reactive nature may otherwise cause damage to key cellular components including DNA, protein, and lipid. When the cellular antioxidant capacity is exceeded, oxidative stress can result. Pleiotropic deleterious effects of oxidative stress are observed in numerous disease states and are also implicated in a variety of drug-induced toxicities. In this paper, we examine the nature of ROS-induced damage on key cellular targets of oxidative stress. We also review evidence implicating ROS in clinically relevant, drug-related side effects including doxorubicin-induced cardiac damage, azidothymidine-induced myopathy, and cisplatin-induced ototoxicity.

  15. Vincristine-Induced Cranial Neuropathy

    Directory of Open Access Journals (Sweden)

    Ahmad TALEBIAN*

    2013-12-01

    Full Text Available How to Cite This Article: Talebian A, Goudarzi RM, Mohammadzadeh M , Mirzadeh AS. Vincristine-Induced Cranial Neuropathy. Iran J Child Neurol. 2014 Winter; 8(1:66-68. Abstract Vincristine (VCR is a vinca alkaloid that is used for treatment of many malignancies. The vinca alkaloids are neurotoxic, usually causing a peripheral neuropathy, but cranial neuropathies are rare as side effects. Described here is the case of a 2.5-year-old boy, a known case of Wilms’ tumor, treated by vincristine (0/067 mg/kg/day and dactinomycin (0/045 mg/kg/day after surgery. Three weeks after treatment, he presented with bilateral ptosis. Neurological examination revealed bilateral ptosis with normal pupillary reflex and eye movement. He received 3.015 mg cumulative dose of vincristine before development of ptosis. Treatment with pyridoxine (150 mg/m2 p.o. BID and pyridostigmine (3 mg/kg p.o. BID started as neuroprotective agents, and after 7 days the problem disappeared. The treatment continued for 6 weeks and there were no signs of ptosis or a recurrence in follow up 2 months later.

  16. Ibuprofen-induced hypersensitivity syndrome.

    Science.gov (United States)

    Nanau, Radu M; Neuman, Manuela G

    2010-06-01

    Ibuprofen is a widely used antipyretic and analgesic nonsteroidal antiinflammatory drug (NSAID). With the aging of the population, there will be a significant increase in the prevalence of painful degenerative and inflammatory rheumatic conditions. This increase likely will lead to a parallel increase in the use of NSAIDs, including ibuprofen. The primary effect of the NSAIDs is to inhibit cyclooxygenase (prostaglandin synthase), thereby impairing the ultimate transformation of arachidonic acid to prostaglandins, prostacyclin, and thromboxanes. Although in the majority of cases it is safe, this NSAID, ibuprofen, can produce an unpredictable, idiosyncratic, type B reaction that may pose a major concern in clinical practice. Type B reactions are known to occur in susceptible individuals. The true hypersensitivity reaction (HSR) is a systemic disease defined by the triad of fever, rash, and internal organ involvement that starts 1 day to 12 weeks after the initiation of therapy. HSR has limited the therapeutic use of many drugs, including ibuprofen. Hypersensitivity syndrome associated with ibuprofen is a host-dependent drug reaction that is idiosyncratic in nature. This reaction likely is caused by a combination of metabolic and immunologic factors. Immune mediated components, such as T-cell and their products cytokines and chemokines, can exacerbate cellular responses and create complex pathways that lead to a variety of clinical manifestations. Our review presents an ibuprofen-induced clinical manifestation of hypersensitivity syndrome and the necessity of wisely monitoring the patients clinically and by laboratory investigations when prescribing this drug.

  17. Diclofenac Induced Fixed Drug Eruption

    Directory of Open Access Journals (Sweden)

    Dr. Umeshchandra C Honnaddi

    2016-02-01

    Full Text Available Background: Diclofenac is the most commonly used non-steroidal anti-inflammatory drug (NSAID for treating various inflammatory and painful conditions. It is generally well tolerated; gastric upset is the most common adverse effect. However very few cases of fixed drug eruptions were reported. Here we present a case of Diclofenac Induced Fixed Drug Eruption. A 62 year old male patient developed fixed drug eruptions with plaques on left thigh two days after receiving diclofenac for osteoarthritic pain. Other etiologies including insect bite, infections were ruled out. One week later after stopping the drug, the lesions were subsided. Diclofenac was strongly suspected as the casual drug. CD8+ effector T-cells have shown to play an important role. However it seems to be a reversible and drug related event. Although it is not life-threatening, fixed drug eruption can have significant effect on the quality of life of patients.Conclusion: Diclofenac is one of the most commonly prescribed NSAIDs by the Physicians. It is usually well tolerated, gastric upset is the most common adverse effect noted with this drug. This case is being reported to highlight a drug as safe as Diclofenac may also be associated with Fixed Drug Eruptions.

  18. Radiation-induced gene responses

    Energy Technology Data Exchange (ETDEWEB)

    Woloschak, G.E.; Paunesku, T.; Shearin-Jones, P.; Oryhon, J.

    1996-12-31

    In the process of identifying genes that are differentially regulated in cells exposed to ultraviolet radiation (UV), we identified a transcript that was repressed following the exposure of cells to a combination of UV and salicylate, a known inhibitor of NF-kappaB. Sequencing this band determined that it has identify to lactate dehydrogenase, and Northern blots confirmed the initial expression pattern. Analysis of the sequence of the LDH 5` region established the presence of NF-kappaB, Sp1, and two Ap-2 elements; two partial AP- 1; one partial RE, and two halves of E-UV elements were also found. Electromobility shift assays were then performed for the AP-1, NF- kappaB, and E-UV elements. These experiments revealed that binding to NF-kappaB was induced by UV but repressed with salicylic acid; UV did not affect AP-1 binding, but salicylic acid inhibited it alone or following UV exposure; and E-UV binding was repressed by UV, and salicylic acid had little effect. Since the binding of no single element correlated with the expression pattern of LDH, it is likely that multiple elements govern UV/salicylate-mediated expression.

  19. Chemotherapy-induced sclerosing cholangitis

    Energy Technology Data Exchange (ETDEWEB)

    Sandrasegaran, K.; Alazmi, W.M.; Tann, M.; Fogel, E.L.; McHenry, L.; Lehman, G.A

    2006-08-15

    Aim: To review the computed tomography (CT), magnetic resonance imaging (MRI) and cholangiographic findings of chemotherapy-induced sclerosing cholangitis (CISC). Methods: Between January 1995 and December 2004, 11 patients in the endoscopic retrograde cholangiography database were identified with CISC. Twelve CT, four MRI, 69 endoscopic and nine antegrade cholangiographic studies in these patients were reviewed. Serial change in appearance and response to endoscopic treatment were recorded. Results: CISC showed segmental irregular biliary dilatation with strictures of proximal extrahepatic bile ducts. The distal 5 cm of common bile duct was not affected in any patient. CT and MRI findings included altered vascular perfusion of one or more liver segments, liver metastases or peritoneal carcinomatosis. Biliary strictures needed repeated stenting in 10 patients (mean: every 4.7 months). Cirrhosis (n = 1) or confluent fibrosis (n = 0) were uncommon findings. Conclusion: CISC shares similar cholangiographic appearances to primary sclerosing cholangitis (PSC). Unlike PSC, biliary disease primarily involved ducts at the hepatic porta rather than intrahepatic ducts. Multiphasic contrast-enhanced CT or MRI may show evidence of perfusion abnormalities, cavitary liver lesions, or metastatic disease.

  20. Cyclophosphamide-induced temporomandibular synostosis.

    Science.gov (United States)

    Bacon, W

    1983-06-01

    The study of malformations helps toward a better understanding of normal development, which is of significance to the orthodontist. Experiments in teratology have induced an extensive variety of facial abnormalities, but temporomandibular joint (TMJ) synostosis has never been previously reported. Ten pregnant female rabbits were treated with a daily injection of 50 mg. cyclophosphamide (DNA synthesis inhibitor), from day 11 to day 14, which is the period that precedes formation of the face. The control sample comprised five female rabbits. The fetuses were obtained by cesarean section on day 28 and stained with alizarin. Six of the ten treated female animals produced offspring that had TMJ synostosis. The skull with TMJ synostosis showed a retrognathic mandibular pattern in relation to the maxilla, and the bony trabeculae in the mandibular angle showed a downward orientation instead of the horizontal orientation seen in animals without synostosis. The length of the heads was significantly smaller in the treatment group than in the control group; within the treatment group, the heads with synostosis were significantly smaller than those without synostosis. It could be hypothesized that the cyclophosphamide might have affected intrinsic factors in the temporomandibular mesenchyma; an impairment in the development and function of the mandibular musculature, which is a vital factor in joint development and maintenance, might also have contributed to the genesis of the malformation. The association of immobilization and mandibular hypodevelopment seems to be in agreement with today's theories on maxillofacial growth.

  1. Bleomycin-Induced Lung Injury

    Directory of Open Access Journals (Sweden)

    Tomás Reinert

    2013-01-01

    Full Text Available Bleomycin is a chemotherapeutic agent commonly used to treat curable diseases such as germinative tumors and Hodgkin’s lymphoma. The major limitation of bleomycin therapy is pulmonary toxicity, which can be life threatening in up to 10% of patients receiving the drug. The mechanism of bleomycin-induced pneumonitis (BIP involves oxidative damage, relative deficiency of the deactivating enzyme bleomycin hydrolase, genetic susceptibility, and the elaboration of inflammatory cytokines. Ultimately, BIP can progress to lung fibrosis. The diagnosis of BIP is established by the combination of systemic symptoms, radiological and histological findings, and respiratory function tests abnormalities, while other disorders should be excluded. Although the diagnosis and pathophysiology of this disease have been better characterized over the past few years, there is no effective therapy for the disease. In general, the clinical picture is extremely complex. A greater understanding of the BIP pathogenesis may lead to the development of new agents capable of preventing or even treating the injury already present. Physicians who prescribe bleomycin must be aware of the potential pulmonary toxicity, especially in the presence of risk factors. This review will focus on BIP, mainly regarding recent advances and perspectives in diagnosis and treatment.

  2. Transgenic technologies to induce sterility

    Directory of Open Access Journals (Sweden)

    Wimmer Ernst A

    2009-11-01

    Full Text Available Abstract The last few years have witnessed a considerable expansion in the number of tools available to perform molecular and genetic studies on the genome of Anopheles mosquitoes, the vectors of human malaria. As a consequence, knowledge of aspects of the biology of mosquitoes, such as immunity, reproduction and behaviour, that are relevant to their ability to transmit disease is rapidly increasing, and could be translated into concrete benefits for malaria control strategies. Amongst the most important scientific advances, the development of transgenic technologies for Anopheles mosquitoes provides a crucial opportunity to improve current vector control measures or design novel ones. In particular, the use of genetic modification of the mosquito genome could provide for a more effective deployment of the sterile insect technique (SIT against vector populations in the field. Currently, SIT relies on the release of radiation sterilized males, which compete with wild males for mating with wild females. The induction of sterility in males through the genetic manipulation of the mosquito genome, already achieved in a number of other insect species, could eliminate the need for radiation and increase the efficiency of SIT-based strategies. This paper provides an overview of the mechanisms already in use for inducing sterility by transgenesis in Drosophila and other insects, and speculates on possible ways to apply similar approaches to Anopheles mosquitoes.

  3. Naproxen-induced liver injury

    Institute of Scientific and Technical Information of China (English)

    Sharif Ali; Jason D Pimentel; Chan Ma

    2011-01-01

    BACKGROUND: Nonsteroidal anti-inflammatory drugs (NSAIDs) have been reported to induce liver injury. Patterns of the injury usually range from mild elevations of liver enzymes to sometimes severe fulminant hepatic failure. Likewise, naproxen is a propionic acid derivative NSAID that was introduced in 1980 and has been available as an over-the-counter medication since 1994, but has rarely been reported to cause liver injury. METHODS: We treated a 30-year-old woman with jaundice and intractablepruritusthatdevelopedshortlyaftertakingnaproxen. We reviewed the medical history and liver histopathology of the patient as well as all previously published case reports of naproxen-associated liver toxicity in the English language literature. RESULTS: The liver biochemical profile of the patient revealed a mixed cholestasis and hepatitis pattern. Consecutive liver biopsies demonstrated focal lobular inflammation, hepatocyte drop-out, and a progressive loss of the small interlobular bile ducts (ductopenia). The biopsy performed two years after onset of the disease showed partial recovery of a small number of bile ducts; however, 10 years passed before the biochemical profile returned to near normal. CONCLUSIONS:  Naproxen-associated liver toxicity remains a rare entity, but should be considered in any patient presenting with cholestasis shortly after its use. Liver injury is most commonly seen in a mixed pattern characterized by cholestasis and hepatitis. The resulting liver damage may take years to resolve.

  4. Studies on tumor induced angiogenesis.

    Science.gov (United States)

    Ambrus, J L; Ambrus, C M; Forgach, P; Stadler, S; Halpern, J; Sayyid, S; Niswander, P; Toumbis, C

    1992-01-01

    Methods were developed to test angiogenic response to human tumor implants and various biologic agents in the cornea of rabbits and non-human primates (Macaca arctoides). Crude PDGF preparations were found to have significant angiogenic effect. Purified, recombinant PDGF preparations were also effective inhibitors (e.g. pentoxifylline (Px) (which also were found to release PgI2 and t-PA) inhibited human tumor implant induced angiogenesis and reduced spontaneous metastases in 3 transplantable murine tumors (Furth-Columbia Wilms' tumor in Furth-Wistar rats, C-1300 neuroblastoma in A/J mice and HM-Kim mammary carcinoma in Wistar rats) but not in the NIH adenocarcinoma in Balb/c mice. Sodium diethyldithiocarbamate (DDTC), a metal complexing agent with special affinity to copper and anti-thyroid as well as, immune stimulating activity was shown to be anti-angiogenic and to potentiate the effect of Px. The anti-fibrinolytic agents epsilon amino caproic acid (EACA) and tranaxamic acid (t-AMCHA) were anti-angiogenic. DDTC and Px were synergistic from this point of view.

  5. Vascular calcification: Inducers and inhibitors

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Donghyun, E-mail: dhlee@cau.ac.kr [Department of Biomedical Engineering, Division of Integrative Engineering, Chung-Ang University, 221 Heukseok-Dong, Dongjak-Gu, Seoul 156-756 (Korea, Republic of)

    2011-09-15

    Highlights: {center_dot} Types of vascular calcification processes. {center_dot} Inducers of vascular calcification. {center_dot} Inhibitors of vascular calcifications. {center_dot} Clinical utility for vascular calcification therapy. {center_dot} Implications for the development of new tissue engineering strategies. - Abstract: Unlike the traditional beliefs, there are mounting evidences suggesting that ectopic mineral depositions, including vascular calcification are mostly active processes, many times resembling that of the bone mineralization. Numbers of agents are involved in the differentiation of certain subpopulation of smooth muscle cells (SMCs) into the osteoblast-like entity, and the activation and initiation of extracellular matrix ossification process. On the other hand, there are factors as well, that prevent such differentiation and ectopic calcium phosphate formation. In normal physiological environments, activities of such procalcific and anticalcific regulatory factors are in harmony, prohibiting abnormal calcification from occurring. However, in certain pathophysiological conditions, such as atherosclerosis, chronic kidney disease (CKD), and diabetes, such balances are altered, resulting in abnormal ectopic mineral deposition. Understanding the factors that regulate the formation and inhibition of ectopic mineral formation would be beneficial in the development of tissue engineering strategies for prevention and/or treatment of such soft-tissue calcification. Current review focuses on the factors that seem to be clinically relevant and/or could be useful in developing future tissue regeneration strategies. Clinical utilities and implications of such factors are also discussed.

  6. Ifosfamide-Induced Fanconi's Syndrome

    Directory of Open Access Journals (Sweden)

    Lin-Kun Lee

    2014-06-01

    Full Text Available Ifosfamide is an alkylating antineoplastic prodrug used to treat many solid tumors. The metabolism of ifosfamide is via CYP450 3A4 and 2B6 and produces active ifosfamide mustard, the toxic metabolite acrolein and chloroacetaldehyde (CAA. Additionally, CAA is believed to induce proximal tubular dysfunction which results in Fanconi's syndrome. It is a condition not commonly encountered in adults receiving ifosfamide but relatively common in children. Herein, we have reported a 25-year-old woman with a history of synovial sarcoma with multiple lung metastasis and repetitive locoregional recurrence. She received chemotherapy with high dose ifosfamide as her antineoplastic treatment. Before her 4th cycle of chemotherapy, the patient's pre-chemotherapy evaluation revealed proteinuria, glucosuria, phosphateuria, hypophosphatemia and non-anion gap metabolic acidosis. The above conditions were consistent with Fanconi's syndrome. We treated her with electrolyte supplement and close monitoring of the noted laboratory abnormalities. Fortunately, the laboratory abnormality gradually resolved. Our case highlights the rare potential complication of ifosfamide, especially in patients who had received a high cumulive dose. To avoid this rare but potentially debilitating condition, patients whose cumulative ifosfamide dose reaches threshold should be closely monitored.

  7. Propylthiouracil-induced autoimmune disease

    Directory of Open Access Journals (Sweden)

    Santosh Paiaulla

    2015-01-01

    Full Text Available Hyperthyroidism is a condition characterized by excessive production of thyroid hormones. Propylthiouracil (PTU is commonly used as first line drug in the management of hyperthyroidism. This is a case report of 24-year-old female, a known case of hyperthyroidism since 4 years, who came with a history of fever and myalgia since 3 days and dyspnea with coughing out of blood since 1 day. Patient was taking PTU (100 mg per day since 4 years for hyperthyroidism. Patient was immediately intubated for type-II respiratory failure. Diagnosed to be having PTU-induced autoimmune disease. PTU was stopped and treated with methylprednisolone and cyclophosphamide. Clinical features improved over a period of 8 days and discharged home successfully. Having a high suspicion for the onset of autoimmune disease in hyperthyroidism patients who are on PTU therapy and timely treatment with immunosuppressants and supportive care along with the withdrawal of the drug can make a difference in morbidity and mortality.

  8. Bimatoprost-induced chemical blepharoplasty.

    Science.gov (United States)

    Sarnoff, Deborah S; Gotkin, Robert H

    2015-05-01

    We report significant changes in the appearance of the periorbital area, beyond eyelash enhancement, induced by the topical application of bimatoprost ophthalmic solution, 0.03% (Latisse®, Allergan, Inc., Irvine, CA). To our knowledge, this is the first report in the dermatology or plastic surgery literature describing the rejuvenating effect and overall improvement in the appearance of the periorbital area resulting from applying Latisse to the upper eyelid margins. To date, reports in the literature discuss side-effects and potential complications of topical bimatoprost therapy causing a constellation of findings known as PAP (prostaglandin-associated periorbitopathy). While periorbitopathy implies pathology or a state of disease, we report changes that can be perceived as an improvement in the overall appearance of the periorbital area. We, therefore, propose a name change from PAP to PAPS - prostaglandin- associated periorbital syndrome. This better describes the beneficial, as well as the possible negative effects of topical bimatoprost. Although there is a risk for periorbital disfigurement, when used bilaterally, in properly selected candidates and titrated appropriately, bimatoprost can be beneficial. The striking improvement in the appearance of some individuals warrants further research into the potential use of topical bimatoprost to achieve a "chemical blepharoplasty."

  9. Mantle superplumes induce geomagnetic superchrons

    Directory of Open Access Journals (Sweden)

    Peter eOlson

    2015-07-01

    Full Text Available We use polarity reversal systematics from numerical dynamos to quantify the hypothesis that the modulation of geomagnetic reversal frequency, including geomagnetic superchrons, results from changes in core heat flux related to growth and collapse of lower mantle superplumes. We parameterize the reversal frequency sensitivity from numerical dynamos in terms of average core heat flux normalized by the difference between the present-day core heat flux and the core heat flux at geomagnetic superchron onset. A low-order polynomial fit to the 0-300 Ma Geomagnetic Polarity Time Scale (GPTS reveals that a decrease in core heat flux relative to present-day of approximately 30% can account for the Cretaceous Normal Polarity and Kiaman Reverse Polarity Superchrons, whereas the hyper-reversing periods in the Jurassic require a core heat flux equal to or higher than present-day. Possible links between GPTS transitions, large igneous provinces (LIPs, and the two lower mantle superplumes are explored. Lower mantle superplume growth and collapse induce GPTS transitions by increasing and decreasing core heat flux, respectively. Age clusters of major LIPs postdate transitions from hyper-reversing to superchron geodynamo states by 30-60 Myr, suggesting that superchron onset may be contemporaneous with LIP-forming instabilities produced during collapses of lower mantle superplumes.

  10. Anatomopathological Changes Induced by Mycotoxins

    Directory of Open Access Journals (Sweden)

    Emil Tirziu

    2011-10-01

    Full Text Available Fungi or mycetes represents the biggest group of microorganisms from the entire biologic system (nearly 250.000 species, very widespread in nature. They are inferior vegetal organisms, heterotrophic, lacking chlorophyll or other trophic pigments, which grow up on live organic substrates or on decaying substrates. The intensive researches from the last two decades had proved that only 30 – 40% from the total number of fungi species is capable to synthesize some toxic metabolites, and, among this species, only 60 species had proved to be dangerous for human or animals. Researches about mycotoxins action upon factors that interfere with the natural or acquired immunity are relatively recent and most of them refer to aflatoxins. The immune-suppression phenomena rely on morphological and histological modifications of lymphoid organs, changes of blood parameters, changes of functional capacity of humoral and some cellular factors. The presence of mycotoxins in feed causes major economic losses, either by their direct action (defined by disease state or indirectly, by affecting the specific and nonspecific resistance of the organism. In the present study we studied the effect of aflatoxins upon the main organs involved in immune response, pathological changes induced by mycotoxins. To determine the influence of mycotoxins on food conversion, weighings were made at the beginning and the end of the experimental period.

  11. Ciprofloxacin induced fixed drug eruption

    Directory of Open Access Journals (Sweden)

    M. Ravishankar

    2014-12-01

    Full Text Available Fixed drug eruption (FDE is a clinical entity occurring in the same site or sites each time the drug is administered. Acute lesions appear as sharply marginated erythematous plaques, which are usually found on lips, genitalia, abdomen, and legs. The eruptions usually occur within hours of administration of the offending agent and resolves spontaneously without scarring after few weeks of onset. Most common drugs causing FDE are sulfonamides, tetracyclines, salicylates, barbiturates, doxycycline, fluconazole, clarithromycin, etc. Ciprofloxacin, a widely used fluoroquinolone antimicrobial, induces cutaneous adverse drug reactions (ADRs in about 1-2% of treated patients. Urticaria, angioedema, maculopapular exanthems, and photosensitivity are the most frequently documented cutaneous adverse reactions. In this case report, the patient soon after taking ciprofloxacin tablets, developed itching in the lips, palms and in scrotal region. On continuing the treatment, the next day he developed fluid filled lesions over palm, knuckle, and hyperpigmentation. He gives a history of severe itching and rashes in scrotal region. He gives a history of similar complaints in the previous month after taking ciprofloxacin medication. There was no history of intake of any other medication. On examination, bullous lesions and pustules in finger webs, hyperpigmentation on knuckles, and scrotal erosions were seen. In the present case report, the patient presented with FDE immediately after oral administration of ciprofloxacin and got completely cured after stopping the drug and taking adequate treatment. According to the Naranjo's ADR probability scale (score=8, this ADR is categorized as a and ldquo;probable and rdquo; reaction to the drug. [Int J Basic Clin Pharmacol 2014; 3(6.000: 1096-1097

  12. Noise-induced hearing loss

    Directory of Open Access Journals (Sweden)

    Mariola Sliwinska-Kowalska

    2012-01-01

    Full Text Available Noise-induced hearing loss (NIHL still remains a problem in developed countries, despite reduced occupational noise exposure, strict standards for hearing protection and extensive public health awareness campaigns. Therefore NIHL continues to be the focus of noise research activities. This paper summarizes progress achieved recently in our knowledge of NIHL. It includes papers published between the years 2008-2011 (in English, which were identified by a literature search of accessible medical and other relevant databases. A substantial part of this research has been concerned with the risk of NIHL in the entertainment sector, particularly in professional, orchestral musicians. There are also constant concerns regarding noise exposure and hearing risk in "hard to control" occupations, such as farming and construction work. Although occupational noise has decreased since the early 1980s, the number of young people subject to social noise exposure has tripled. If the exposure limits from the Noise at Work Regulations are applied, discotheque music, rock concerts, as well as music from personal music players are associated with the risk of hearing loss in teenagers and young adults. Several recent research studies have increased the understanding of the pathomechanisms of acoustic trauma, the genetics of NIHL, as well as possible dietary and pharmacologic otoprotection in acoustic trauma. The results of these studies are very promising and offer grounds to expect that targeted therapies might help prevent the loss of sensory hair cells and protect the hearing of noise-exposed individuals. These studies emphasize the need to launch an improved noise exposure policy for hearing protection along with developing more efficient norms of NIHL risk assessment.

  13. Metoclopramide-induced cardiac arrest

    Directory of Open Access Journals (Sweden)

    Martha M. Rumore

    2011-11-01

    Full Text Available The authors report a case of cardiac arrest in a patient receiving intravenous (IV metoclopramide and review the pertinent literature. A 62-year-old morbidly obese female admitted for a gastric sleeve procedure, developed cardiac arrest within one minute of receiving metoclopramide 10 mg via slow intravenous (IV injection. Bradycardia at 4 beats/min immediately appeared, progressing rapidly to asystole. Chest compressions restored vital function. Electrocardiogram (ECG revealed ST depression indicative of myocardial injury. Following intubation, the patient was transferred to the intensive care unit. Various cardiac dysrrhythmias including supraventricular tachycardia (SVT associated with hypertension and atrial fibrillation occurred. Following IV esmolol and metoprolol, the patient reverted to normal sinus rhythm. Repeat ECGs revealed ST depression resolution without pre-admission changes. Metoclopramide is a non-specific dopamine receptor antagonist. Seven cases of cardiac arrest and one of sinus arrest with metoclopramide were found in the literature. The metoclopramide prescribing information does not list precautions or adverse drug reactions (ADRs related to cardiac arrest. The reaction is not dose related but may relate to the IV administration route. Coronary artery disease was the sole risk factor identified. According to Naranjo, the association was possible. Other reports of cardiac arrest, severe bradycardia, and SVT were reviewed. In one case, five separate IV doses of 10 mg metoclopramide were immediately followed by asystole repeatedly. The mechanism(s underlying metoclopramide’s cardiac arrest-inducing effects is unknown. Structural similarities to procainamide may play a role. In view of eight previous cases of cardiac arrest from metoclopramide having been reported, further elucidation of this ADR and patient monitoring is needed. Our report should alert clinicians to monitor patients and remain diligent in surveillance and

  14. Mitochondrial rejuvenation after induced pluripotency.

    Directory of Open Access Journals (Sweden)

    Steven T Suhr

    Full Text Available BACKGROUND: As stem cells of the early embryo mature and differentiate into all tissues, the mitochondrial complement undergoes dramatic functional improvement. Mitochondrial activity is low to minimize generation of DNA-damaging reactive oxygen species during pre-implantation development and increases following implantation and differentiation to meet higher metabolic demands. It has recently been reported that when the stem cell type known as induced pluripotent stem cells (IPSCs are re-differentiated for several weeks in vitro, the mitochondrial complement progressively re-acquires properties approximating input fibroblasts, suggesting that despite the observation that IPSC conversion "resets" some parameters of cellular aging such as telomere length, it may have little impact on other age-affected cellular systems such as mitochondria in IPSC-derived cells. METHODOLOGY/PRINCIPAL FINDINGS: We have examined the properties of mitochondria in two fibroblast lines, corresponding IPSCs, and fibroblasts re-derived from IPSCs using biochemical methods and electron microscopy, and found a dramatic improvement in the quality and function of the mitochondrial complement of the re-derived fibroblasts compared to input fibroblasts. This observation likely stems from two aspects of our experimental design: 1 that the input cell lines used were of advanced cellular age and contained an inefficient mitochondrial complement, and 2 the re-derived fibroblasts were produced using an extensive differentiation regimen that may more closely mimic the degree of growth and maturation found in a developing mammal. CONCLUSIONS/SIGNIFICANCE: These results - coupled with earlier data from our laboratory - suggest that IPSC conversion not only resets the "biological clock", but can also rejuvenate the energetic capacity of derived cells.

  15. Induced resistance in rice against insects.

    Science.gov (United States)

    Karban, R; Chen, Y

    2007-08-01

    Vaccinations are the mainstay of western preventive medicine, and they have been used to protect some crops against disease and insect pests. We consider rice as a model for protection using induced resistance since it is one of the most important staple crops and there have been significant new developments in: cross-resistance among rice insects, chemical pathways involved in induced resistance, sequencing the rice genome and expression of genes conferring resistance against rice insect pests. Insect attack has been found to cause lesions that kill planthopper eggs and early stages of gall midges. Damaged plants released volatiles that made them less likely to be chosen by planthoppers and more attractive to parasitoids. Chemical elicitors have been developed for dicotyledonous plants and these can induce resistance in rice, although rice does not fit models developed to explain signalling in dicots. For example, salicylic acid did not increase in rice after infection by pathogens and did not appear to be the mobile signal for induced resistance against pathogens although it was involved in induced responses to phloem-feeding insects. Jasmonic acid acted as a signal in some induced responses to pathogens as well as chewing insects. Many of the genes associated with induced resistance in rice have recently been mapped, and techniques are being developed to incorporate them into the genome of cultivated varieties. Attempts to control insect pests of rice will affect interactions with pathogens, predators and parasites, and other organisms in this agroecosystem.

  16. Research progress of exercise-induced fatigue

    Directory of Open Access Journals (Sweden)

    Peng-yi DAI

    2016-12-01

    Full Text Available Exercise-induced fatigue is a comprehensive response to a variety of physiological and biochemical changes in the body, and can affect people's quality of life to different extents. If no timely recovery after occurrence of fatigue, accumulated gradually, it can lead to "burnout", a "overtraining syndrome", "chronic fatigue syndrome", etc., which will cause endocrine disturbance, immune suppression, even physical illness. Exercise-induced fatigue becomes an important factor endangering human health. In recent years, many experts and scholars at home and abroad are committed to the research of exercise-induced fatigue, and have put forward a variety of hypothesis to explain the cause of exercise-induced fatigue. They expect to find out the methods for preventing and eliminating exercise-induced fatigue. This article discusses mainly the pathogenesis, model building, elimination/ relief, etc. of exercise-induced fatigue to point out the research achievements of exercise-induced fatigue and its existing problems. DOI: 10.11855/j.issn.0577-7402.2016.11.14

  17. Preventing infective complications relating to induced abortion.

    Science.gov (United States)

    Mary, Nirmala; Mahmood, Tahir A

    2010-08-01

    Infective complications following induced abortions are still a common cause of morbidity and mortality. This review focusses on defining the strategies to improve care of women seeking an induced abortion and to reduce infective complications. We have considered the evidence for screening and cost-effectiveness for antibiotic prophylaxis. Current evidence suggests that treating all women with prophylactic antibiotics in preference to screening and treating is the most cost-effective way of reducing infective complications following induced abortions. The final strategy to prevent infective complications should be individualized for each region/area depending on the prevalence of organisms causing pelvic infections and the resources available.

  18. Laser-induced damage in optical materials

    CERN Document Server

    Ristau, Detlev

    2014-01-01

    Dedicated to users and developers of high-powered systems, Laser-Induced Damage in Optical Materials focuses on the research field of laser-induced damage and explores the significant and steady growth of applications for high-power lasers in the academic, industrial, and military arenas. Written by renowned experts in the field, this book concentrates on the major topics of laser-induced damage in optical materials and most specifically addresses research in laser damage that occurs in the bulk and on the surface or the coating of optical components. It considers key issues in the field of hi

  19. Epidural Naloxone to Prevent Buprenorphine Induced PONV

    Directory of Open Access Journals (Sweden)

    Ashok Jadon

    2008-01-01

    Full Text Available Epidural infusion of local analgesic and opioid are commonly used for postoperative pain relief. This combina-tion gives excellent anlgesia but nausea and vomiting remains a major concern. Low dose epidural naloxone prevents PONV induced by spinal opioids like morphine, fentanyl and sufentanil. However, it is not known that epidural naloxone administration prevents PONV induced by epidural buprenorphine. We have reported three cases of major abdominal operation in which lowdose epidural infusion of naloxone releived the symptom of buprenorphine induced severe PONV and improved the quality of analgesia.

  20. Terbinafine-induced lichenoid drug eruption.

    Science.gov (United States)

    Zheng, Yue; Zhang, Jie; Chen, Haiyan; Lai, Wei; Maibach, Howard I

    2017-03-01

    Drug-induced lichen planus has been induced by antibiotics, anticonvulsants, antidiabetics, antimalarials, antitubercular drugs, antihypertensives, psychiatric drugs, chemotherapeutic agents, diuretic, heavy metals, NSAIDs, etc. Terbinafine, an antifungal agent, is widely used for dermatophyte infections and onychomycosis. Cutaneous adverse effects of terbinafine are rarely reported. Here, we report a case of terbinafine-induced lichenoid drug eruption in a 22-year-old who presented with generalized lichenoid eruption 2 weeks after terbinafine initiation of. The body and lip cleared completely after 8 weeks of drug withdrawal; nail change cleared after 12 weeks.

  1. Evolution of the B3 DNA binding superfamily: new insights into REM family gene diversification.

    Directory of Open Access Journals (Sweden)

    Elisson A C Romanel

    Full Text Available BACKGROUND: The B3 DNA binding domain includes five families: auxin response factor (ARF, abscisic acid-insensitive3 (ABI3, high level expression of sugar inducible (HSI, related to ABI3/VP1 (RAV and reproductive meristem (REM. The release of the complete genomes of the angiosperm eudicots Arabidopsis thaliana and Populus trichocarpa, the monocot Orysa sativa, the bryophyte Physcomitrella patens,the green algae Chlamydomonas reinhardtii and Volvox carteri and the red algae Cyanidioschyzon melorae provided an exceptional opportunity to study the evolution of this superfamily. METHODOLOGY: In order to better understand the origin and the diversification of B3 domains in plants, we combined comparative phylogenetic analysis with exon/intron structure and duplication events. In addition, we investigated the conservation and divergence of the B3 domain during the origin and evolution of each family. CONCLUSIONS: Our data indicate that showed that the B3 containing genes have undergone extensive duplication events, and that the REM family B3 domain has a highly diverged DNA binding. Our results also indicate that the founding member of the B3 gene family is likely to be similar to the ABI3/HSI genes found in C. reinhardtii and V. carteri. Among the B3 families, ABI3, HSI, RAV and ARF are most structurally conserved, whereas the REM family has experienced a rapid divergence. These results are discussed in light of their functional and evolutionary roles in plant development.

  2. Vibration-induced droplet atomization

    Science.gov (United States)

    Vukasinovic, Bojan

    The atomization of liquid drops is investigated experimentally using laser vibrometry, high-speed imaging, and particle tracking techniques. The spray is generated by a novel vibration-induced droplet atomization (VIDA) process in which a sessile drop is atomized by an underlying vibrating thin metal diaphragm, resulting in rapid ejection of small secondary droplets from the free surface of the primary drop. Under some conditions, the primary drop can be atomized extremely rapidly by a bursting-like mechanism (e.g., a 0.1 ml water drop can be atomized in 0.4 seconds). The present research has focused on four major areas: global characteristics of VIDA process, instability modes and free surface dynamics of the forced drop, mechanisms of the interface breakup, and parametric characterization of the ensuing spray. Prior to atomization, the drop free surface undergoes three transitions: from axisymmetric standing waves to azimuthal waves, to a newly-observed lattice mode, and to a disordered pre-ejection state. The droplet ejection results from localized collapse of surface troughs and initiation and ultimate breakup of momentary liquid spikes. Breakup begins with capillary pinch-off from spike tips and can be followed by additional pinching of liquid droplets. For a relatively low-viscosity liquid, e.g., water, a capillary-wave instability of the spike is observed in some cases, while for a very viscous liquid, e.g., a glycerin/water solution, the first breakup occurs near the stem of the spike, with or without subsequent breakup of the detached, elongated thread. Different mechanisms dominating the primary breakup of the spike are operative in the low- and high-viscosity ejection regimes. When ejection of the secondary droplets is triggered, the evolution and rate of atomization depend on the coupled dynamics of the primary drop and the vibrating diaphragm. Due to these dynamics, the process can be either self-intensifying or self-decaying. The resulting VIDA spray

  3. Subsurface Airflow Induced by Natural Forcings

    Institute of Scientific and Technical Information of China (English)

    Jiu J. Jiao; LI Hai-long

    2004-01-01

    Subsurface air flow can be induced by natural processes, such as atmospheric or barometric pressure changes, water table fluctuations, topographic effects, and rainfall infiltration. Barometric pressure fluctuations are the most common cause of subsurface air flow, which can be significant under favourable geological conditions. This process has been studied most extensively because of its application to passive soil vapor extraction. Soil air flow induced by water table fluctuations can be significant, particularly where the fluctuations are of high frequency, for example, in tidal-influenced coastal areas. Topographic effects can lead to strong subsoil air flow in areas with great elevation differences. Rainfall infiltration usually produces only weak airflow. Air flow induced by these natural processes has important environmental and engineering implications. Among the different processes, air flow induced by tidal fluctuations has been studied the least, although it has exciting applications to coastal engineering projects and environmental remediation.

  4. A case of dapsone induced methaemoglobinaemia.

    LENUS (Irish Health Repository)

    O'Dwyer, D

    2008-09-01

    We present a case of dapsone induced methaemoglobinaemia that occurred in a patient who presented to the Emergency Department of a University Hospital. It is an uncommon condition that requires specific and urgent treatment in severe cases.

  5. Drug Induced Hearing Loss: What Is Ototoxicity?

    Science.gov (United States)

    ... page please turn JavaScript on. Feature: Drug-Induced Hearing Loss What Is Ototoxicity? Past Issues / Spring 2016 Table ... of patients taking these drugs." "Antibiotics Caused My Hearing Loss..." Gulab Lalwani Photo Courtesy of: Gulab Lalwani When ...

  6. Waveguides induced by grey screening solitons

    Institute of Scientific and Technical Information of China (English)

    Lu Ke-Qing; Zhao Wei; Yang Yan-Long; Zhang Mei-Zhi; Li Jin-Ping; Liu Hong-Jun; Zhang Yan-Peng

    2006-01-01

    We investigate the properties of waveguides induced by one-dimensional grey screening solitons in biased photore-fractive crystals. The results show that waveguides induced by grey screening solitons are always of single mode for all intensity ratios, i.e. the ratios between the peak intensity of the soliton and the dark irradiance. Our analysis indicates that the energy confined near the centre of the grey soliton and the propagation constant of the guided mode of the waveguide induced by the grey screening soliton increase monotonically with intensity ratio increasing. On the other hand, when the soliton greyness increases, the energy confined near the centre of the grey soliton and the propagation constant of the guided mode of the waveguide induced by the grey screening soliton decrease monotonically. Relevant examples are provided where photorefractive crystal is of the strontium barium niobate type.

  7. Thermally induced morphological transition of silver fractals

    DEFF Research Database (Denmark)

    Solov'yov, Ilia; Solov'yov, Andrey; Kébaili, Nouari;

    2014-01-01

    We present both experimental and theoretical study of thermally induced morphological transition of silver nanofractals. Experimentally, those nanofractals formed from deposition and diffusion of preformed silver clusters on cleaved graphite surfaces exhibit dendritic morphologies that are highly...

  8. Noise-induced synchronization for phase turbulence

    OpenAIRE

    Sakaguchi, H.

    2003-01-01

    Phase turbulence is suppressed by applying common noise additively to the Kuramoto-Sivashinsky type equation, and the noise-induced phase synchronization is realized. The noise strength necessary for the suppression of phase turbulence is evaluated theoretically.

  9. Animal models of glucocorticoid-induced glaucoma.

    Science.gov (United States)

    Overby, Darryl R; Clark, Abbot F

    2015-12-01

    Glucocorticoid (GC) therapy is widely used to treat a variety of inflammatory diseases and conditions. While unmatched in their anti-inflammatory and immunosuppressive activities, GC therapy is often associated with the significant ocular side effect of GC-induced ocular hypertension (OHT) and iatrogenic open-angle glaucoma. Investigators have generated GC-induced OHT and glaucoma in at least 8 different species besides man. These models mimic many features of this condition in man and provide morphologic and molecular insights into the pathogenesis of GC-OHT. In addition, there are many clinical, morphological, and molecular similarities between GC-induced glaucoma and primary open-angle glaucoma (POAG), making animals models of GC-induced OHT and glaucoma attractive models in which to study specific aspects of POAG.

  10. Metamaterial transparency induced by cooperative electromagnetic interactions

    CERN Document Server

    Jenkins, Stewart D

    2013-01-01

    We propose a cooperative asymmetry-induced transparency, CAIT, formed by collective excitations in metamaterial arrays of discrete resonators. CAIT can display a sharp transmission resonance even when the constituent resonators individually exhibit broad resonances. We further show how dynamically reconfiguring the metamaterial allows one to actively control the transparency. While reminiscent of electromagnetically induced transparency, which can be described by independent emitters, CAIT relies on a cooperative response resulting from strong radiative couplings between the resonators.

  11. Electromagnetically induced classical and quantum Lau effect

    Science.gov (United States)

    Qiu, Tianhui; Yang, Guojian; Xiong, Jun; Xu, Deqin

    2016-07-01

    We present two schemes of Lau effect for an object, an electromagnetically induced grating generated based on the electromagnetically induced effect. The Lau interference pattern is detected either directly in the way of the traditional Lau effect measurement with a classical thermal light being the imaging light, or indirectly and nonlocally in the way of two-photon coincidence measurement with a pair of entangled photons being the imaging light.

  12. A Case of Olanzapine-Induced Fever

    Science.gov (United States)

    Yang, Cho-Hsiang; Chen, Ying-Yeh

    2017-01-01

    Olanzapine, a frequently used second-generation antipsychotic, has rarely been implicated as a cause of drug-induced fever in the absence of neuroleptic malignant syndrome. We describe a patient who developed isolated fever following olanzapine monotherapy, which subsided after discontinuation of olanzapine. Blockade of dopaminergic receptors and elevated cytokines concentration are possible mechanisms of fever development during treatment with olanzapine. This case calls for attention to olanzapine-induced fever in clinical practice. PMID:28138204

  13. Medium-induced multi-photon radiation

    CERN Document Server

    Ma, Hao; Tywoniuk, Konrad

    2011-01-01

    We study the spectrum of multi-photon radiation off a fast quark in medium in the BDMPS/ASW approach. We reproduce the medium-induced one-photon radiation spectrum in dipole approximation, and go on to calculate the two-photon radiation in the Moli\\`{e}re limit. We find that in this limit the LPM effect holds for medium-induced two-photon ladder emission.

  14. Contrast induced hyperthyroidism due to iodine excess

    OpenAIRE

    Mushtaq, Usman; Price, Timothy; Laddipeerla, Narsing; Townsend, Amanda; Broadbridge, Vy

    2009-01-01

    Iodine induced hyperthyroidism is a thyrotoxic condition caused by exposure to excessive iodine. Historically this type of hyperthyroidism has been described in areas of iodine deficiency. With advances in medicine, iodine induced hyperthyroidism has been observed following the use of drugs containing iodine—for example, amiodarone, and contrast agents used in radiological imaging. In elderly patients it is frequently difficult to diagnose and control contrast related hyperthyroidism, as most...

  15. How does relativity affect magnetically induced currents?

    Science.gov (United States)

    Berger, R J F; Repisky, M; Komorovsky, S

    2015-09-21

    Magnetically induced probability currents in molecules are studied in relativistic theory. Spin-orbit coupling (SOC) enhances the curvature and gives rise to a previously unobserved current cusp in AuH or small bulge-like distortions in HgH2 at the proton positions. The origin of this curvature is magnetically induced spin-density arising from SOC in the relativistic description.

  16. Isoniazid induced childhood diabetes: A rare phenomenon

    OpenAIRE

    2015-01-01

    Drugs raise blood glucose concentrations via two broad mechanisms: By reducing insulin biosynthesis or secretion, or by reducing tissue sensitivity to insulin. Until date, there have been very few reported cases of isoniazid induced diabetes. We are presenting a case report of 6-year-old child with isoniazid induced diabetes who was misdiagnosed initially as a case of type 1 diabetes mellitus. We hereby stress that before diagnosing a patient with diabetes-type 1 or 2, a detailed history of d...

  17. Surgical Treatment of Laser Induced Eye Injuries

    Science.gov (United States)

    1990-12-05

    AD-A234 849 CONTRACT NO.: DAMD17-89-C-9026 TITLE: SURGICAL TREATMENT OF LASER INDUCED EYE INJURIES AUTHORS: Leonard M. Hjelmeland, Maurice B. Landers...62787A 62787A878 BA JDA318205 11. TITLE (Include Secirity Classification) (U) Surgical Treatment of Laser Induced Eye Injuries 12. PERSONAL AUTHOR(S...TERMS (Continue on reverse if necessary and identify by block number) FIELD GROUP SUB-GROUP RA 3; Lasers; Eye injury ; Surgery 09 03 06 04 19. ABSTRACT

  18. TALEN-Induced Translocations in Human Cells.

    Science.gov (United States)

    Piganeau, Marion; Renouf, Benjamin; Ghezraoui, Hind; Brunet, Erika

    2016-01-01

    Induction of chromosomal translocations in human cells is of a great interest to study tumorigenesis and genome instability. Here, we explain in detail a method to induce translocations using the transcription activator-like effector nucleases (TALENs). We describe how to detect translocation formation by PCR, calculate translocation frequency by 96-well PCR screen, and analyze breakpoint junctions. When inducing cancer translocations, it is also possible to detect the fusion gene by FISH analysis or western blot.

  19. Insect inducible antimicrobial peptides and their applications.

    Science.gov (United States)

    Ezzati-Tabrizi, Reyhaneh; Farrokhi, Naser; Talaei-Hassanloui, Reza; Alavi, Seyed Mehdi; Hosseininaveh, Vahid

    2013-12-01

    Antimicrobial peptides (AMPs) are found as important components of the innate immune system (host defense) of all invertebrates. These peptides can be constitutively expressed or induced in response to microbial infections. Indeed, they vary in their amino acid sequences, potency and antimicrobial activity spectra. The smaller AMPs act greatly by disrupting the structure or function of microbial cell membranes. Here, the insect innate immune system with emphasis on inducible antimicrobial peptide properties against microbial invaders has been discussed.

  20. Nonadiabatic Induced Dipole Moment by High Intensity Femtosecond Optical Pulses

    OpenAIRE

    Koprinkov, I. G.

    2006-01-01

    Nonadiabtic dressed states and nonadiabatic induced dipole moment in the leading order of nonadiabaticity is proposed. The nonadiabatic induced dipole moment is studied in the femtosecond time domain.