WorldWideScience

Sample records for bos taurus bos

  1. Genetic effects on beef tenderness in Bos indicus composite and Bos taurus cattle.

    Science.gov (United States)

    O'Connor, S F; Tatum, J D; Wulf, D M; Green, R D; Smith, G C

    1997-07-01

    Bos indicus composite and Bos taurus cattle, originating from diverse production environments, were used to quantify genetic variation in marbling, 24-h calpastatin activity, and beef tenderness and to identify strategies for prevention of beef tenderness problems in Bos indicus composite cattle. Comparisons among 3/8 Bos indicus breeds (Braford, Red Brangus, Simbrah) revealed significant differences in marbling and 24-h calpastatin activity, but not in tenderness. Compared with Bos taurus cattle, 3/ 8 Bos indicus cattle had similar marbling scores but higher 24-h calpastatin activities. Also, beef from 3/8 Bos indicus composites aged more slowly from 1 to 7 d and was less tender at 4, 7, 14, 21, and 35 d postmortem than beef from Bos taurus cattle. However, beef from 3/8 Bos indicus cattle was relatively tender if it was aged for a sufficient period of time (21 d). The delayed response to aging and greater toughness of beef from 3/8 Bos indicus cattle was associated with Brahman breed effects and was not related to the Bos taurus germplasm source. Marbling was moderately heritable (.52 +/- .21) but exhibited positive genetic correlations with shear force at d 1 through 14 of aging, suggesting that, in these cattle, selection for increased marbling would have an unfavorable effect on beef tenderness. A low heritability estimate for 24-h calpastatin activity (.15 +/- .15), coupled with low genetic correlations between calpastatin activity and shear force at 7, 14, and 35 d, suggested that selection for low calpastatin activity would have little effect on aged beef tenderness. Panel tenderness and shear force at 7, 14, and 21 d were moderately heritable (.27 to .47), indicating that aged beef tenderness could be improved by direct selection (via progeny testing). Comparisons among Simbrah, Senegus x Simbrah, and Red Angus x Simmental steers showed that inclusion of a tropically adapted Bos taurus breed (Senepol) could be an effective strategy for preventing beef

  2. Effect of monensin inclusion on intake, digestion, and ruminal fermentation parameters by Bos taurus indicus and Bos taurus taurus steers consuming bermudagrass hay

    Science.gov (United States)

    Effects of monensin inclusion and cattle subspecies on utilization of bermudagrass hay (13.7% CP, 77.3% NDF, and 38.8% ADF) were evaluated using ruminally cannulated steers (5 Bos taurus indicus [BI] and 5 Bos taurus taurus [BT]; 398 kg BW). Subspecies were concurrently subjected to a 2-period, 2-t...

  3. Polymorphism and Mobilization of Rransposons in Bos taurus

    DEFF Research Database (Denmark)

    Guldbrandtsen, Bernt; Sahana, Goutam; Lund, Mogens Sandø

    The bovine genome assembly was explored to detect putative retrotransposon sequences. In total 87,310 such sites were detected. Four breeds of dairy cattle (Bos taurus) were examined with respect to the presence, segregation or complete absence of the putative retrotransposon. A total of 10...

  4. Superovulation and embryo production in tropical adapted Bos taurus (Caracu and Bos indicus (Nelore cows

    Directory of Open Access Journals (Sweden)

    Rafael Herrera Alvarez

    2011-01-01

    Full Text Available The aim of this study was to compare ovarian response and embryo production of superovulated Bos indicus and Bos taurus cows adapted to the environmental conditions from São Paulo State, Brazil. Ninety non-lactating cows from Caracu ( Bos taurus, n=40 and Nelore (Bos indicus, n=50 were treated with an intravaginal device containing progesterone (1.38 mg; CIDRB ®, Pfizer Animal Health, Montreal, Québec, Canada and 2.5 mg, intramuscularly (IM, of estradiol benzoate (Estrogin®, Farmavet, São Paulo, Brazil. Four days later, all animals were treated with multiple IM injections of 400 IU of FSH (Pluset®, Calier, Spain in decreasing doses (75–75; 75–50; 50–25, and 25–25 IU at 12-h intervals over 4 days. On the seventh day, CIDR-B device was removed and cows received, IM, 150 ìg of cloprostenol (Veteglan®, Calier, Spain. Cows were then inseminated 48 and 62 h after cloprostenol treatment and embryos were recovered non-surgically seven days after first insemination. Differences in the number of corpora lutea (CL number, total number of structures (ova/embryos, and number of transferable embryos were analyzed by Student t test. There was no difference (P > 0.05 in the average number of CL, total ova/embryos and transferable embryos of Caracu (11.4 ± 3.3; 8.6 ± 2.6 e 6.0 ± 2.4 and Nelore (12.0 ± 4.1; 9.0 ± 4.3 e 5.1 ± 2.9 cows, respectively. These results suggest that Caracu and Nelore cows superovulated in tropical climate had similar ovarian responses and embryo production.

  5. Life-cycle biological efficiency of Bos indicus x Bos taurus and Bos taurus crossbred cow-calf production to weaning.

    Science.gov (United States)

    Green, R D; Cundiff, L V; Dickerson, G E

    1991-09-01

    A deterministic model was developed that accounted for all biological inputs and outputs for a theoretical herd of F1 females at age equilibrium mated to produce three-way terminal-cross calves and for the required proportion of straightbred cows needed to produce replacements. Two Bos indicus x Bos taurus vs two Bos taurus x Bos taurus types of crossbred cows were compared in the production environment of south-central Nebraska. The four types of F1 females were from Hereford (H) or Angus (A) dams and by H or A (HA), Pinzgauer (Pz), Brahman (Bm), or Sahiwal (Sw) sires. The crossbred females were assumed mated to Red Poll (R) sires for their first calving and to Simmental (S) sires thereafter. Two evaluations of efficiency for each of the four breeding systems were total cow and calf feed energy input 1) per unit of only weaned calf weight output (CALFEFF, Mcal/kg) and 2) per unit of weaned calf plus .55 x cull cow weight output (TVALEFF, Mcal/kg). Results for a terminal age of 7 yr in systems using HA, Pz, Bm, and Sw crossbred cows, respectively, were 64.9, 64.5, 60.9, and 59.3 Mcal/kg for CALFEFF and 45.7, 46.4, 44.1, and 43.7 Mcal/kg for TVALEFF. Changing terminal age to 11 yr reduced CALFEFF about 6% but increased TVALEFF about 7%, because total inputs increased more than output value (10 vs 3%) from 7 to 11 yr terminal ages. These results suggest differences in efficiency among these breed crosses favoring the Bos indicus crossbred cows by over 4% in this particular environment.

  6. Genetic parameters for growth traits of a Brazilian Bos taurus x Bos indicus beef composite.

    Science.gov (United States)

    Mourão, G B; Ferraz, J B S; Eler, J P; Balieiro, J C C; Bueno, R S; Mattos, E C; Figueiredo, L G G

    2007-12-11

    The genetic analysis of composite data is very complicated, mainly because it is necessary to adjust data to the effects of heterosis and breed complementarity, and because there is usually considerable confounding of these data with several other effects, such as contemporary group effects, breed composition of the animal and maternal breed composition, among others. Data on birth weight (n = 151,083), weaning weight adjusted to 205 days (n = 137,257), yearling weight adjusted to 390 days (n = 61,410), weight gain from weaning to yearling (n = 56,653), and scrotum circumference (n = 23,323) and muscle score (n = 54,770), both adjusted to 390 days, from Bos taurus x Bos indicus composite beef calves born from 1994 to 2003 were analyzed to estimate (co)variance components and genetic parameters of growth traits. The animals belonged to the Montana Tropical program. Estimation was made by three models that approach adjustment to heterozygosis in order to suggest the best model. The RM model included contemporary groups, class of age of dam, outcrossing percentages for direct and maternal effects, and direct and maternal additive genetic breed effects as covariates; the R model was the same as RM, but without additive maternal breed effects, and H was the same as RM, but not considering any additive breed effect. Both R2 values and consistency of genetic parameters indicate that the more complex model (RM), which considers maternal and individual additive genetic breed effect, produces the best estimates when compared to other models. The R model seems to overestimate (co)variance components. The magnitudes of direct and maternal heritability estimates, obtained in this study, would permit genetic improvement for weight and growth traits, as much by selection of direct genetic effects for weight and growth as for the improvement of maternal performance, but in different lineages. Therefore, the correlations between these effects were unfavorable.

  7. Introgresión genética de bos indicus (bovidae) en bovinos criollos colombianos de origen bos taurus

    OpenAIRE

    SÁNCHEZ ISAZA, CARLOS ARTURO; JIMÉNEZ ROBAYO, LIGIA MERCEDES; BUENO ANGULO, MARTA LUCÍA

    2008-01-01

    El presente trabajo evidencia desde el punto de vista citogenético la introgresión genética, de origen paterno, de Bos indicus en ganado criollo colombiano descendiente de Bos taurus. Para este estudio se realizó el análisis cariológico de la morfología del cromosoma Y a partir de muestras de sangre heparinizada de 67 bovinos machos pertenecientes a siete razas criollas colombianas. Se reporta la presencia de cuatro ejemplares pertenecientes ...

  8. MADURACIÓN DEL SOLOMO (Biceps femoris EN VACAS DE DESCARTE Bos indicus Y Bos taurus

    Directory of Open Access Journals (Sweden)

    Roger Alonso Cubero-Rojas

    2013-01-01

    Full Text Available El objetivo de este trabajo fue evaluar el efecto de la maduración sobre la terneza del músculo Biceps femoris en vacas de descarte Bos indicus y Bos taurus. En la planta procesadora de Montecillos R.L., ubicada en Alajuela, se realizó la escogencia y sacrificio de los animales, la maduración y empaque al vacío de la carne. La cocción, determinación de la terneza y evaluación sensorial se llevó a cabo a los 0, 14 y 28 días de maduración, en el Laboratorio de Análisis Sensorial del Centro de Investigaciones en Tecnología de Alimentos de la Universidad de Costa Rica, ubicado en San Pedro de Montes de Oca, San José, en julio del año 2011. De acuerdo con la evaluación instrumental, la especie y la cronometría dental no fueron factores significativos en la determinación de la terneza de la carne, mientras que el tiempo de maduración sí mostró cambios altamente significativos (p>0,001 sobre el mismo parámetro. Los mejores resultados se obtuvieron a los 28 días, donde B. indicus mostró 3,78 kg de fuerza al corte, mientras que para B. taurus se obtuvo 3,88 kg. En la evaluación sensorial, los animales B. indicus se calificaron como más jugosos (p=0,016 y con mejor sabor (p<0,001. Se determinó una relación inversa entre sabor y tiempo de maduración, lo cual indicó que a mayor tiempo de maduración el sabor de la carne se volvió menos agradable al paladar.

  9. In vivo comparison of susceptibility between Bos indicus and Bos taurus cattle types to Theileria parva infection

    Directory of Open Access Journals (Sweden)

    S.G. Ndungu

    2005-09-01

    Full Text Available The objective of this study was to determine whether Bos taurus cattle differ form Bos indicus in their susceptibility to infection with the Muguga stabilate of Theileria parva and in their resistance to the resultant disease. Ten Friesians (B. taurus, ten improved Borans (B. indicus, ten unimproved Borans (B. indicus and ten Zebus (B. indicus born to dams from an East Coast fever (ECF endemic area were inoculated with an infective dose50 dilution of T. parva Muguga stabilate 147. All the animals except one Friesian and one Zebu developed schizont parasitosis. All the improved Borans, nine of the Friesians, eight of the unimproved Borans and six of the Zebus developed a febrile response. Four of the improved Borans, four of the Friesians and three of the unimproved Borans died of theileriosis. No significant difference (P > 0.05 in the prepatent period occurred between the groups, but the Zebus had a significantly shorter duration of schizont parasitosis (P > 0.05 and took a significantly shorter time to recover (P > 0.05 than the other three groups. There was no significant difference in the two parameters between the other three groups. The study showed that three B. indicus breds and a B. taurus breed are equally susceptible to T. parva infection. However, Zebus born to dams from an ECF endemic area showed a better ability to control the course of disease than cattle from ECF free areas.

  10. Clotting of cow (Bos taurus) and goat milk ( Capra hircus ) using ...

    African Journals Online (AJOL)

    The ease to locally produce kid rennet contrary to that of calve has led us to compare the proteolytic and clotting activities of these two rennets depending on their action on goat (Capra hircus) milk and cow (Bos taurus) milk. The proteolysis was measured by determining the increase of non-protein nitrogen according to the ...

  11. Sarcocystis heydorni, n. sp. (Apicomplexa: Protozoa) with cattle (Bos taurus) and human (Homo sapiens) cycle

    Science.gov (United States)

    Cattle (Bos taurus) are intermediate hosts for four species of Sarcocystis, S. cruzi, S. hirsuta, S. hominis, and S. rommeli. Of these four species, mature sarcocysts of S. cruzi are thin-walled (< 1µm) whereas S. hirsuta, S. hominis, and S. rommeli have thick walls (4 µm or more). Here we describe ...

  12. Anticorpos em bovinos (Bos indicus e Bos taurus e bubalinos (Bubalus bubalis inoculados com oocistos de Toxoplasma gondii. Estudo comparativo

    Directory of Open Access Journals (Sweden)

    Oliveira F.C.R.

    2000-01-01

    Full Text Available Três animais de cada espécie (Bos indicus, Bos taurus e Bubalus bubalis foram inoculados, via oral, com 2×10(5 oocistos de Toxoplasma gondii. Seis outros animais, dois de cada espécie, foram mantidos como testemunhas. A resposta de anticorpos avaliada por meio da reação de imunofluorescência indireta iniciou-se a partir do quinto dia pós-inoculação (DPI nos zebuínos e bubalinos, e no sétimo DPI nos taurinos. Os títulos sorológicos nos taurinos permaneceram elevados até o final do experimento (70º DPI, alcançando níveis máximos (1:16.384 entre o 42º e 49º DPI. Nos zebuínos e bubalinos o maior título de anticorpos anti-Toxoplasma foi de 1:256. A resposta de anticorpos mais ou menos acentuada não está necessariamente relacionada à sensibilidade ao T. gondii.

  13. Differences in Beef Quality between Angus (Bos taurus taurus and Nellore (Bos taurus indicus Cattle through a Proteomic and Phosphoproteomic Approach.

    Directory of Open Access Journals (Sweden)

    Rafael Torres de Souza Rodrigues

    Full Text Available Proteins are the major constituents of muscle and are key molecules regulating the metabolic changes during conversion of muscle to meat. Brazil is one of the largest exporters of beef and most Brazilian cattle are composed by zebu (Nellore genotype. Bos indicus beef is generally leaner and tougher than Bos taurus such as Angus. The aim of this study was to compare the muscle proteomic and phosphoproteomic profile of Angus and Nellore. Seven animals of each breed previously subjected the same growth management were confined for 84 days. Proteins were extracted from Longissimus lumborum samples collected immediately after slaughter and separated by two-dimensional electrophoresis. Pro-Q Diamond stain was used in phosphoproteomics. Proteins identification was performed using matrix assisted laser desorption/ionization time-of-flight mass spectrometry. Tropomyosin alpha-1 chain, troponin-T, myosin light chain-1 fragment, cytoplasmic malate dehydrogenase, alpha-enolase and 78 kDa glucose-regulated protein were more abundant in Nellore, while myosin light chain 3, prohibitin, mitochondrial stress-70 protein and heat shock 70 kDa protein 6 were more abundant in Angus (P<0.05. Nellore had higher phosphorylation of myosin regulatory light chain-2, alpha actin-1, triosephosphate isomerase and 14-3-3 protein epsilon. However, Angus had greater phosphorylation of phosphoglucomutase-1 and troponin-T (P<0.05. Therefore, proteins involved in contraction and muscle organization, myofilaments expressed in fast or slow-twitch fibers and heat shock proteins localized in mitochondria or sarcoplasmic reticulum and involved in cell flux of calcium and apoptosis might be associated with differences in beef quality between Angus and Nellore. Furthermore, prohibitin appears to be a potential biomarker of intramuscular fat in cattle. Additionally, differences in phosphorylation of myofilaments and glycolytic enzymes could be involved with differences in muscle

  14. Nutritive value and meat quality of domestic cattle (Bos taurus, zubron (Bos taurus × Bison bonasus and European bison (Bison bonasus meat

    Directory of Open Access Journals (Sweden)

    Andrzej Łozicki

    2017-10-01

    Full Text Available The objective of the experiment was to study the nutritive value and meat quality aspects of domestic cattle (Bos taurus, zubron (Bos taurus × Bison bonasus and European bison (Bison bonasus meat. The bulls and zubrons were fattened to 600–650 kg of body weight using the same feeding regimen. The European bison meat was from selective shooting of males. The meat was analysed for chemical composition, fatty acid composition, meat quality characteristics and thiobarbituric acid reactive substance (TBARS value. Compared to beef, zubron and European bison meat had a lower content of crude fat, crude ash and a higher moisture content. The meat of the zubrons and European bison showed a lower content of saturated fatty acids and a higher content of polyunsaturated fatty acids compared to beef. The shear force of meat was highest for European bison meat and lowest for beef. Higher a* and b* colour parameters were established in European bison and zubron meat. The highest TBARS value was found in beef.

  15. Bos frontalis

    Indian Academy of Sciences (India)

    SAMEEULLAH MEMON

    2018-02-28

    Feb 28, 2018 ... study, we have investigated the structural and functional characteristics and possible duplication of the MHC-DQA genes in gayal ... Keywords. major histocompatibility complex; gayal; DQA1 gene; DQA2 gene; immunity; polymorphisms; Bos frontalis. Introduction. The potential of an organism for ...

  16. Bill E. Kunkle Interdisciplinary Beef Symposium: Temperament and acclimation to human handling influence growth, health, and reproductive responses in Bos taurus and Bos indicus cattle.

    Science.gov (United States)

    Cooke, R F

    2014-12-01

    Temperament in cattle is defined as the fear-related behavioral responses when exposed to human handling. Our group evaluates cattle temperament using 1) chute score on a 1 to 5 scale that increases according to excitable behavior during restraint in a squeeze chute, 2) exit velocity (speed of an animal exiting the squeeze chute), 3) exit score (dividing cattle according to exit velocity into quintiles using a 1 to 5 scale where 1=cattle in the slowest quintile and 5=cattle in the fastest quintile), and 4) temperament score (average of chute and exit scores). Subsequently, cattle are assigned a temperament type of adequate temperament (ADQ; temperament score≤3) or excitable temperament (EXC; temperament score>3). To assess the impacts of temperament on various beef production systems, our group associated these evaluation criteria with productive, reproductive, and health characteristics of Bos taurus and Bos indicus-influenced cattle. As expected, EXC cattle had greater plasma cortisol vs. ADQ cattle during handling, independent of breed type (B. indicus×B. taurus, P<0.01; B. taurus, P<0.01; B. indicus, P=0.04) or age (cows, P<0.01; heifers or steers, P<0.01). In regards to reproduction, EXC females had reduced annual pregnancy rates vs. ADQ cohorts across breed types (B. taurus, P=0.03; B. indicus, P=0.05). Moreover, B. taurus EXC cows also had decreased calving rate (P=0.04), weaning rate (P=0.09), and kilograms of calf weaned/cow exposed to breeding (P=0.08) vs. ADQ cohorts. In regards to feedlot cattle, B. indicus EXC steers had reduced ADG (P=0.02) and G:F (P=0.03) during a 109-d finishing period compared with ADQ cohorts. Bos taurus EXC cattle had reduced weaning BW (P=0.04), greater acute-phase protein response on feedlot entry (P≤0.05), impaired feedlot receiving ADG (P=0.05), and reduced carcass weight (P=0.07) vs. ADQ cohorts. Acclimating B. indicus×B. taurus or B. taurus heifers to human handling improved temperament (P≤0.02), reduced plasma

  17. Sequence diversity between class I MHC loci of African native and introduced Bos taurus cattle in Theileria parva endemic regions

    DEFF Research Database (Denmark)

    Obara, Isaiah; Nielsen, Morten; Jeschek, Marie

    2016-01-01

    MHC genes is dependent on the presence of codons specifying certain critical amino acid residues that line the peptide binding groove. Compared with European Bos taurus in which class I MHC allelic polymorphisms have been examined extensively, published data on class I MHC transcripts in African...

  18. The Brain of the Domestic Bos taurus: Weight, Encephalization and Cerebellar Quotients, and Comparison with Other Domestic and Wild Cetartiodactyla.

    Directory of Open Access Journals (Sweden)

    Cristina Ballarin

    Full Text Available The domestic bovine Bos taurus is raised worldwide for meat and milk production, or even for field work. However the functional anatomy of its central nervous system has received limited attention and most of the reported data in textbooks and reviews are derived from single specimens or relatively old literature. Here we report information on the brain of Bos taurus obtained by sampling 158 individuals, 150 of which at local abattoirs and 8 in the dissecting room, these latter subsequently formalin-fixed. Using body weight and fresh brain weight we calculated the Encephalization Quotient (EQ, and Cerebellar Quotient (CQ. Formalin-fixed brains sampled in the necropsy room were used to calculate the absolute and relative weight of the major components of the brain. The data that we obtained indicate that the domestic bovine Bos taurus possesses a large, convoluted brain, with a slightly lower weight than expected for an animal of its mass. Comparisons with other terrestrial and marine members of the order Cetartiodactyla suggested close similarity with other species with the same feeding adaptations, and with representative baleen whales. On the other hand differences with fish-hunting toothed whales suggest separate evolutionary pathways in brain evolution. Comparison with the other large domestic herbivore Equus caballus (belonging to the order Perissodactyla indicates that Bos taurus underwent heavier selection of bodily traits, which is also possibly reflected in a comparatively lower EQ than in the horse. The data analyzed suggest that the brain of domestic bovine is potentially interesting for comparative neuroscience studies and may represents an alternative model to investigate neurodegeneration processes.

  19. Urinary excretion of purine derivatives as an index of microbial protein supply in cross-bred (Bos indicus x Bos taurus) cattle in tropical environment

    International Nuclear Information System (INIS)

    Ojeda, A.; Parra, O.

    1999-01-01

    Four experiments were carried out to establish a response model between urinary excretion of purine derivatives (PD) and microbial production in Bos indicus x Bos taurus cross-bred cattle: LZ, MZ and HZ (3/8, 1/2 and 5/8 Bos indicus, respectively). The fasting PD excretion was considered as endogenous excretion and amounted to 268 (± 85.1), 294 (± 128.1) and 269 (± 68.4) μmol/kg W 0.75 for LZ, MZ and HZ, respectively. Urinary recovery of absorbed purine bases (PB) was calculated as the urinary recovery of a single dose of intrajugular infused uric acid (1,3- 15 N). In HZ crossbred cattle 83% (± 20.3) of infused uric acid was recovered in the urinary PD. The relationship between duodenal purine absorption (X, mmol/d) and urinary PD excretion (Y, mmol/d) was defined in HZ crossbred cattle as Y = 0.83 X + 0.269W 0.75 (± 85.1), assuming that the endogenous contribution was constant and independent of the exogenous PB supply. The activity of xanthine oxidase (EC 1.2.3.2.) was determined in HZ and MZ and was found to be higher in the liver (0.62 and 0.66 units/g, respectively) than in intestinal mucosa (0.09 and 0.03 units/g, respectively), whereas xanthine oxidase activity was practically absent in plasma of both cross breeds. The ratio PB:total N was determined in microbial extracts taken from rumen fluid of cows fed Bermuda grass (Cynodon dactylon) as the sole diet or supplemented (ratio of 80:20, grass: supplement) with gluten feed, soybean hulls or Gliricidia species and were found to range from 1.52-1.62 μmol PB/mg N. (author)

  20. Dinâmica folicular e taxa de prenhez em novilhas receptoras de embrião (Bos taurus indicus x Bos taurus taurus tratadas com o protocolo "Ovsynch" para inovulação em tempo fixo

    Directory of Open Access Journals (Sweden)

    Pietro Sampaio Baruselli

    2003-01-01

    Full Text Available Objetivou-se avaliar a eficiência da sincronização da ovulação para inovulação em tempo fixo em novilhas Bos taurus indicus x Bos taurus taurus receptoras de embrião. No Experimento 1, a dinâmica folicular foi acompanhada durante o protocolo "Ovsynch" (G1; n=35 e após a aplicação de PGF2alfa (G2; n=34. No Experimento 2, os mesmos tratamentos foram realizados a campo em 168 (G1 e 177 (G2 novilhas. No D6, colheu-se sangue para dosagem de P4 e se realizaram exames ultra-sonográficos. No D7, realizou-se a inovulação. No Experimento 1, 45,7% dos animais ovularam após o 1º GnRH (P;0,05. Ao final, a taxa de prenhez no Gl foi de 35,7% e no G2 de 25,4% (P<0,05. Foram detectadas em estro 53,7% das novilhas do G2 e 33,3% do Gl (P<0,05. Os corpos lúteos com maior área determinaram maiores concentrações de P4 e taxa de concepção (P<0,05. A sincronização da ovulação para inovulação em tempo fixo aumentou as taxas de ovulação, de aproveitamento e de prenhez em novilhas receptoras de embrião.

  1. Effect of protein supplementation on reproductive and productive performance in Bos indicus x Bos taurus heifers raised in the humid tropics of Costa Rica.

    Science.gov (United States)

    Maquivar, Martin G; Galina, Carlos S; Galindo, Jaime R; Estrada, Sandra; Molina, Rafael; Mendoza, German David

    2010-04-01

    In order to evaluate the effect of protein supplementation on the productive and reproductive performance of heifers, 45 Bos indicus x Bos taurus heifers, 673 +/- 146 days of age and weighing about 340 kg, were divided into two groups. The control group (n = 23) continued without supplementation, but the supplemented group (SG; n = 22) received concentrate at a rate of 1% BW kg per day. Animals were adapted to the concentrate over a 15-day period and then supplemented for 30 days, after which estrus was synchronized using a progesterone implant. Back fat thickness (BFT) was assessed by ultrasound. The SG had better average daily weight gain than the nonsupplemented group (0.63 +/- 0.16 vs. 0.51 +/- 0.13 kg/day, P 0.70 cm) showed a better ovulation percentage than those with low BFT (heifers with high BFT tended to be better than heifers with low BFT in this same group (67% vs. 30%, respectively, P < 0.10). It is concluded that protein supplementation improved reproductive performance and that ultrasonography to measure BFT may be used to estimate reproductive performance.

  2. A cytoarchitectonic and myeloarchitectonic study of the insular cortex of the bull, Bos taurus.

    Science.gov (United States)

    Russo, Domenico; Paparcone, Rosa; Genovese, Angelo

    2008-01-01

    The mammalian Insula is characterised by considerable morphologic variability, however, it shows a cytoarchitectonic homogeneity within the species so far studied. Three cytoarchitectonic areas are generally recognisable in the Insula: an "agranular", a "dysgranular" and a "granular" area. The numerous functions attributed to the Insula (visceral sensory, visceral motor, somatosensorial, supplementary motor area, area speech and/or language related, etc.) have recently attracted renewed interest. Considering the involvement of the Insula in the control of gastroenteric motility and the structural and functional complexity of this region in ruminants, it seemed interesting to analyse the cyto- and myelo-architectonic arrangement of the Insula of the bull, Bos taurus. Unlike that of the other species described, all the insular Neocortex of the bull, is of the "agranular" type. The latter includes at least four variants that differ according to the organisation of the cortical layer pattern. Considering the available evidence in laboratory animals and primates of a role played by the agranular insular cortex in gastroenteric motility control, the trademark presence of a very much extended insular agranular cortex in the Insula of the bull may be related to the necessity of motor activity control of a gastroenteric complex that is extensively more developed than in the monogastric species.

  3. Seasonality of Oxygen isotope composition in cow (Bos taurus) hair and its model interpretation

    Science.gov (United States)

    Chen, Guo; Schnyder, Hans; Auerswald, Karl

    2017-04-01

    Oxygen isotopes in animal and human tissues are expected to be good recorders of geographical origin and migration histories based on the isotopic relationship between hair oxygen and annual precipitation and the well-known spatial pattern of oxygen isotope composition in meteoric water. However, seasonal variation of oxygen isotope composition may diminish the origin information in the tissues. Here the seasonality of oxygen isotope composition in tail hair was investigated in a domestic suckler cow (Bos taurus) that underwent different ambient conditions, physiological states, and keeping and feeding strategies during five years. A detailed mechanistic model involving in ambient conditions, soil properties and animal physiology was built to explain this variation. The measured oxygen isotope composition in hair was significantly related (panalysis. Modelling suggested that this relation was only partly derived from the direct influence of feed moisture. Ambient conditions (temperature, moisture) did not only influence the isotopic signal of precipitation but also affected the animal itself (drinking water demand, transcutaneous vapor etc.). The clear temporal variation thus resulted from complex interactions with multiple influences. The twofold influence of ambient conditions via the feed and via the animal itself is advantageous for tracing the geographic origin because the oxygen isotope composition is then less influenced by variations in moisture uptake; however, it is unfavorable for indicating the production system, e.g. to distinguish between milk produced from fresh grass or from silage.

  4. Bovine Genome Database: new tools for gleaning function from the Bos taurus genome.

    Science.gov (United States)

    Elsik, Christine G; Unni, Deepak R; Diesh, Colin M; Tayal, Aditi; Emery, Marianne L; Nguyen, Hung N; Hagen, Darren E

    2016-01-04

    We report an update of the Bovine Genome Database (BGD) (http://BovineGenome.org). The goal of BGD is to support bovine genomics research by providing genome annotation and data mining tools. We have developed new genome and annotation browsers using JBrowse and WebApollo for two Bos taurus genome assemblies, the reference genome assembly (UMD3.1.1) and the alternate genome assembly (Btau_4.6.1). Annotation tools have been customized to highlight priority genes for annotation, and to aid annotators in selecting gene evidence tracks from 91 tissue specific RNAseq datasets. We have also developed BovineMine, based on the InterMine data warehousing system, to integrate the bovine genome, annotation, QTL, SNP and expression data with external sources of orthology, gene ontology, gene interaction and pathway information. BovineMine provides powerful query building tools, as well as customized query templates, and allows users to analyze and download genome-wide datasets. With BovineMine, bovine researchers can use orthology to leverage the curated gene pathways of model organisms, such as human, mouse and rat. BovineMine will be especially useful for gene ontology and pathway analyses in conjunction with GWAS and QTL studies. © The Author(s) 2015. Published by Oxford University Press on behalf of Nucleic Acids Research.

  5. EFECTO DE LA SUPLEMENTACION DE DOS TIPOS DE ACIDOS GRASOS SOBRE EL REINICIO DE LA ACTIVIDAD OVARICA Y METABOLITOS DE LIPIDOS EN VACAS F1 (Bos Taurus x Bos indicus) DURANTE EL POSPARTO TEMPRANO

    OpenAIRE

    HUANTE CATALÁN, ROBERTO

    2012-01-01

    Se realizó una investigación, bajo una serie de tres experimentos, en los cuales se determinó el cambio de peso vivo (PV) y ganancia de peso en becerros, el reinicio de actividad ovárica (RAO), y la concentración sérica de colesterol (COL) y lipoproteínas de alta densidad (HDL), en vacas F1 suplementadas con dos tipos de ácidos grasos durante el posparto temprano. Se emplearon veinte vacas Bos taurus x Bos indicus, de 400-450 kg y condición corporal de 2 – 2.5 puntos. Los animales...

  6. Effects of Bos taurus autosome 9-located quantitative trait loci haplotypes on the disease phenotypes of dairy cows with experimentally induced Escherichia coli mastitis

    DEFF Research Database (Denmark)

    Khatun, Momena; Sørensen, Peter; Jørgensen, Hanne Birgitte Hede

    2013-01-01

    Several quantitative trait loci (QTL) affecting mastitis incidence and mastitis-related traits such as somatic cell score exist in dairy cows. Previously, QTL haplotypes associated with susceptibility to Escherichia coli mastitis in Nordic Holstein-Friesian (HF) cows were identified on Bos taurus...... the HH group did. However, we also found interactions between the effects of haplotype and biopsy for body temperature, heart rate, and PMNL. In conclusion, when challenged with E. coli mastitis, HF cows with the specific Bos taurus autosome 9-located QTL haplotypes were associated with differences...

  7. A Novel Protocol to Assess Acclimation Rate in Bos taurus Heifers during Yard Weaning

    Directory of Open Access Journals (Sweden)

    Jessica E. Monk

    2018-04-01

    Full Text Available The speed with which animals acclimate to a new environment could be an important measure of ability to cope with management induced stress. This study developed a measure of acclimation rate in a group of 50 Bos taurus heifers during yard weaning over nine days. We recorded the time and order in which heifers moved through a novel funnel structure into a feeding yard daily. We hypothesised that addition of an obstacle at the entrance would increase the time it took heifers to move through the funnel, but that they would acclimate to the obstacle over a three-day period. The change in latency to move through could then be used as a measure of acclimation rate. We hypothesised that individuals which acclimated to obstacles at a faster rate might display favourable temperament as assessed by flight time. All heifers took longer to move through the funnel after a novel object was introduced, then latency decreased over the following two days while the object was present. This indicates the protocol could be useful for measuring acclimation rate at a group level. Individual acclimation rate variables, measured as change in times and orders of heifers between test days, did not appear to have any consistent relationships with flight time or weight change during or post-weaning (p > 0.05. We concluded that the protocol was inappropriate for assessing acclimation rate at an individual level, due to social effects while testing heifers as a group. Heifers which were consistently one of the first 20 to move through the funnel had a significantly greater average weight 5 and 10 months post-weaning (345 ± 9 kg and 518 ± 10 kg respectively than heifers which were consistently one of the last 20 through the funnel (311 ± 8 kg and 484 ± 8 kg respectively; p < 0.001. This may indicate order of movement through the funnel was related to feeding motivation or another aspect of temperament not reflected by flight time.

  8. Isolation and characteristics of the melanocortin 1 receptor gene (MC1R) in the Chinese yakow (Bos grunniens×Bos taurus).

    Science.gov (United States)

    Xi, Dongmei; Wu, Min; Fan, Yueyuan; Huo, Yinqiang; Leng, Jing; Gou, Xiao; Mao, Huaming; Deng, Weidong

    2012-05-01

    The Chinese yakow is the offspring of yak (Bos grunniens) and Yellow cattle (Bos taurus). The melanocortin 1receptor gene (MC1R) plays a crucial role in determining coat colour of mammals. To investigate the relationship of polymorphism of the MC1R with coat colour in the Chinese yakow, the coding sequence (CDS) and the flanking region of MC1R were sequenced from 84 Chinese yakow samples and compared with the sequences of the MC1R from other bovid species. A fragment of 1134 base pair (bp) sequences including the full CDS (954bp) and parts of the 5'- and 3'-untranslated regions (162 and 18bp, respectively) of the Chineseyakow MC1R were obtained. A total of 13 single nucleotide polymorphisms (SNPs) including 4 SNPs (T-129C, A-127C, C-106T, G-1A) in the 5'-untranslated region and 9 SNPs (C201T, T206C, C340A, C375T, T663C, G714C, C870T, G871A and T890C) in the CDS were identified, revealing high genetic variability. Four novel SNPs including T206C, G714C, C870T and T890C, which have not been reported previously in bovid species, were retrieved. Within 9 coding SNPs, C201T, C375T, T663C and C870T were silent mutations, while T206C, C340A, G714C, G871A and T890C were mis-sense mutations, corresponding to amino acid changes p.L69P, p.Q114K, p.K238N, p.A291N and p.I297T, respectively. Amino acid sequences alignment showed a more than 96% similarity with other ruminates. However, three classical bovine MC1R loci the E(D), E(+) and e were not retrieved in the Chinese yakow, indicating other genes or factors could be involved in affecting coat colour in this species. Copyright © 2012 Elsevier B.V. All rights reserved.

  9. Feed intake and weight changes in Bos indicus-Bos taurus crossbred steers following Bovine Viral Diarrhea Virus Type 1b challenge under production conditions

    Science.gov (United States)

    Bovine viral diarrhea virus (BVDV) has major impacts on beef cattle production worldwide, but the understanding of host animal genetic influence on illness is limited. This study evaluated rectal temperature, weight change and feed intake in Bos indicus crossbred steers (n = 366) that were challenge...

  10. Identity of Sarcocystis species of the water buffalo (Bubalus bubalis) and cattle (Bos taurus) and the suppression of Sarcocystis sinensis as a nomen nudum

    Science.gov (United States)

    There are uncertainties concerning the identity and host species specificity of Sarcocystis species of the water buffalo (Bubalus bubalis) and cattle (Bos taurus). Currently, in cattle three species are recognized with known endogenous stages, viz.: S. cruzi (with canine definitive host), S. hirsuta...

  11. THE INFLUENCE OF AUTOLYSIS ON THE PROTEIN-PEPTIDE PROFILE OF Bos taurus AND Sus scrofa HEART AND AORTA TISSUES

    Directory of Open Access Journals (Sweden)

    I. M. Chernukha

    2016-01-01

    Full Text Available The article presents the results of autolytic processes impact on the protein-peptide profile of Bos taurus and Sus scrofa cardiac muscle and aorta. The results of tissue-specific protein identification are also presented as well as the effect of autolysis. Apolipoprotein A-1 involved in the formation of high-density lipoproteins, peroxiredoxin-1 involved in the suppression of oxidative stress, galectin-1 induced apoptosis of T-lymphocytes, as well as number of heat shock proteins with molecular weight less than 30 kDa were identified in Sus scrofa aorta tissue. It was discovered that functional proteins with molecular weight less than 30 kDa are retained during the freezing process, but destroyed under the action of autolytic enzymes. This work was supported by the Russian Science Foundation (project No. 16–16–10073.

  12. Vaccine-induced rabies case in a cow (Bos taurus): Molecular characterisation of vaccine strain in brain tissue.

    Science.gov (United States)

    Vuta, Vlad; Picard-Meyer, Evelyne; Robardet, Emmanuelle; Barboi, Gheorghe; Motiu, Razvan; Barbuceanu, Florica; Vlagioiu, Constantin; Cliquet, Florence

    2016-09-22

    Rabies is a fatal neuropathogenic zoonosis caused by the rabies virus of the Lyssavirus genus, Rhabdoviridae family. The oral vaccination of foxes - the main reservoir of rabies in Europe - using a live attenuated rabies virus vaccine was successfully conducted in many Western European countries. In July 2015, a rabies vaccine strain was isolated from the brain tissues of a clinically suspect cow (Bos taurus) in Romania. The nucleotide analysis of both N and G gene sequences showed 100% identity between the rabid animal, the GenBank reference SAD B19 strain and five rabies vaccine batches used for the national oral vaccination campaign targeting foxes. Copyright © 2016 Elsevier Ltd. All rights reserved.

  13. Effect of Vitamin E and Polyunsaturated Fatty Acids on Cryopreserved Sperm Quality in Bos taurus Bulls Under Testicular Heat Stress.

    Science.gov (United States)

    Losano, João D A; Angrimani, Daniel S R; Dalmazzo, Andressa; Rocha, Carolina C; Brito, Maíra M; Perez, Eduardo G A; Tsunoda, Roberta H; Góes, Paola A A; Mendes, Camilla M; Assumpção, Mayra E O A; Barnabe, Valquiria H; Nichi, Marcilio

    2018-04-03

    Taurine bulls are highly susceptible to heat stress, leading to increased oxidative stress (OS) and impaired sperm viability. Polyunsaturated fatty acids (PUFAs) supplementation can be an alternative to improve semen quality, which also results in more sperm susceptibility to lipid peroxidation. Moreover, this deleterious effect can be exacerbated in animals affected by heat stress. Vitamin E is a key antioxidant that counteracts lipid peroxidation of sperm membrane caused by OS. Thus, combining PUFAs with vitamin E may improve sperm quality. In this context, this study aimed to evaluate the effect of interaction between PUFAs and vitamin E on sperm quality in Bos taurus bulls under testicular heat stress. Sixteen taurine bulls under testicular heat stress were randomly assigned in four groups: Control, Vitamin E, PUFA, and PUFA + Vitamin E. All groups lasted for 60 days. Samples were cryopreserved/thawed and analyzed for motility variables (CASA), membrane and acrosome integrity, mitochondrial activity, susceptibility to oxidative stress, DNA integrity, and sperm-binding capacity. Results showed that vitamin E had a beneficial effect on some sperm characteristics, whereas PUFA supplementation had an adverse effect when the two treatments were evaluated separately. Finally, the association between PUFAs and vitamin E did not improve sperm quality.

  14. Candidate SNPs for carcass and meat traits in Nelore animals and in their crosses with Bos taurus

    Directory of Open Access Journals (Sweden)

    Rogério Abdallah Curi

    2012-02-01

    Full Text Available The objective of this work was to evaluate the effects of single-nucleotide polymorphisms (SNPs in the genes IGF1 (AF_017143.1:g.198C>T, MSTN (AF_320998.1:g.433C>A, MYOD1 (NC_007313:g.1274A>G and MYF5 (NC_007303:g.1911A>G on carcass and meat traits in Nelore (Bos indicus and Nelore x B. taurus. A total of 300 animals were genotyped and phenotyped for rib eye area (REA, backfat thickness (BT, intramuscular fat (IF, shear force (SF and myofibrillar fragmentation index (MFI. The effects of allele substitution for each SNP were estimated by regression of the evaluated phenotypes on the number of copies of a particular allele using the general linear model. The polymorphism at IGF1 was non-informative in Nelore animals. In crossbred animals, the IGF1 C allele was associated with greater REA. However, this relation was not significant after Bonferroni correction for multiple testing. The A allele of the MSTN polymorphism was absent in Nelore cattle and was only found in two crossbred animals. The polymorphisms of MYOD1 and MYF5 were little informative in Nelore animals with G allele frequency of 0.097 and A allele frequency of 0.031, respectively. These markers show no association with the analyzed traits in the total sample of evaluated animals.

  15. Feed Intake and Weight Changes in Bos indicus-Bos taurus Crossbred Steers Following Bovine Viral Diarrhea Virus Type 1b Challenge Under Production Conditions.

    Science.gov (United States)

    Runyan, Chase A; Downey-Slinker, Erika D; Ridpath, Julia F; Hairgrove, Thomas B; Sawyer, Jason E; Herring, Andy D

    2017-12-12

    Bovine viral diarrhea virus (BVDV) has major impacts on beef cattle production worldwide, but the understanding of host animal genetic influence on illness is limited. This study evaluated rectal temperature, weight change and feed intake in Bos indicus crossbred steers ( n = 366) that were challenged with BVDV Type 1b, and where family lines were stratified across three vaccine treatments of modified live (MLV), killed, (KV) or no vaccine (NON). Pyrexia classification based on 40.0 °C threshold following challenge and vaccine treatment were investigated for potential interactions with sire for weight change and feed intake following challenge. Pyrexia classification affected daily feed intake (ADFI, p = 0.05), and interacted with day ( p gain (ADG) and cumulative feed intake during the first 14 day post-challenge; ADG (CV of 104%) and feed efficiency were highly variable in the 14-day period immediately post-challenge as compared to the subsequent 14-day periods. A sire × vaccine strategy interaction affected ADFI ( p < 0.001), and a sire by time period interaction affected ADG ( p = 0.03) and total feed intake ( p = 0.03). This study demonstrates that different coping responses may exist across genetic lines to the same pathogen, and that subclinical BVDV infection has a measurable impact on cattle production measures.

  16. Feed Intake and Weight Changes in Bos indicus-Bos taurus Crossbred Steers Following Bovine Viral Diarrhea Virus Type 1b Challenge Under Production Conditions

    Directory of Open Access Journals (Sweden)

    Chase A. Runyan

    2017-12-01

    Full Text Available Bovine viral diarrhea virus (BVDV has major impacts on beef cattle production worldwide, but the understanding of host animal genetic influence on illness is limited. This study evaluated rectal temperature, weight change and feed intake in Bos indicus crossbred steers (n = 366 that were challenged with BVDV Type 1b, and where family lines were stratified across three vaccine treatments of modified live (MLV, killed, (KV or no vaccine (NON. Pyrexia classification based on 40.0 °C threshold following challenge and vaccine treatment were investigated for potential interactions with sire for weight change and feed intake following challenge. Pyrexia classification affected daily feed intake (ADFI, p = 0.05, and interacted with day (p < 0.001 for ADFI. Although low incidence of clinical signs was observed, there were marked reductions in average daily gain (ADG and cumulative feed intake during the first 14 day post-challenge; ADG (CV of 104% and feed efficiency were highly variable in the 14-day period immediately post-challenge as compared to the subsequent 14-day periods. A sire × vaccine strategy interaction affected ADFI (p < 0.001, and a sire by time period interaction affected ADG (p = 0.03 and total feed intake (p = 0.03. This study demonstrates that different coping responses may exist across genetic lines to the same pathogen, and that subclinical BVDV infection has a measurable impact on cattle production measures.

  17. RENDIMIENTO Y COMPOSICIÓN CORPORAL DE CUYES (CAVIA PORCELLUS) SUPLEMENTADOS CON TRES NIVELES DE HARINA DE SANGRE BOVINO (BOS TAURUS) PROCESADA ARTESANALMENTE

    OpenAIRE

    ZAMORA HUAMÁN, SEGUNDO JOSÉ

    2016-01-01

    This research aimed to evaluate the performance and body composition of Guinea pigs (Cavia porcellus) supplemented with three levels of bovine blood meal (Bos taurus) processed by hand in Small Animals Module of Chachapoyas Experimental Station of the Toribio Rodríguez of Mendoza of Amazonas National University. Food rations were evaluated in an iso energy and iso protein levels with 4%, 8% and 12% of blood meal, using 36 Guinea Pigs weaned males of 21 days of age, divided into groups of ...

  18. Efecto de la manipulación del semen criopreservado de bovinos Bos Taurus sobre la integridad espermática

    OpenAIRE

    Norberto Villa-Duque; Claudia Marcela Amaya-Torres; Darwin García-Rojas; Natalia Nieto-Omeara; Natalia Terán-Acuña

    2016-01-01

    En el estudio se evaluó el efecto de descongelar y aplicar semen de bovinos Bos Taurus en 33 ganaderías del Magdalena Medio colombiano, y se estudió in vitro el efecto de la injuria encontrada sobre la integridad de las membranas espermáticas. La información en fincas se recopiló mediante formulario específico, mientras que el estudio in vitro se ejecutó en el laboratorio de Biotecnología Reproductiva Animal del Instituto Universitario de la Paz (Barrancabermeja, Santander). El estudio consis...

  19. Is the American Zebu really Bos indicus?

    Directory of Open Access Journals (Sweden)

    Meirelles Flávio V.

    1999-01-01

    Full Text Available The American continent was colonized in the 16th century by Europeans who first introduced cattle of Bos taurus origin. Accounts register introduction of Bos indicus cattle into South America in the 19th and continuing through the 20th century, and most reported imports were males derived from the Indian subcontinent. In the present study we show, by using mitochondrial DNA (mtDNA polymorphism, major participation of matrilineages of taurus origin in the American Zebu purebred origin, i.e., 79, 73 and 100% for the Nellore, Gyr and Brahman breeds, respectively. Moreover, we have created a restriction map identifying polymorphism among B. taurus and B. indicus mtDNA using three restriction enzymes. Results are discussed concerning American Zebu origins and potential use of this information for investigating the contribution of cytoplasmic genes in cattle production traits.

  20. Quantitative trait loci mapping of calving and conformation traits on Bos taurus autosome 18 in the German Holstein population.

    Science.gov (United States)

    Brand, B; Baes, C; Mayer, M; Reinsch, N; Seidenspinner, T; Thaller, G; Kühn, Ch

    2010-03-01

    Linkage, linkage disequilibrium, and combined linkage and linkage disequilibrium analyses were performed to map quantitative trait loci (QTL) affecting calving and conformation traits on Bos taurus autosome 18 (BTA18) in the German Holstein population. Six paternal half-sib families consisting of a total of 1,054 animals were genotyped on 28 genetic markers in the telomeric region on BTA18 spanning approximately 30 Mb. Calving traits, body type traits, and udder type traits were investigated. Using univariately estimated breeding values, maternal and direct effects on calving ease and stillbirth were analyzed separately for first- and further-parity calvings. The QTL initially identified by separate linkage and linkage disequilibrium analyses could be confirmed by a combined linkage and linkage disequilibrium analysis for udder composite index, udder depth, fore udder attachment, front teat placement, body depth, rump angle, and direct effects on calving ease and stillbirth. Concurrence of QTL peaks and a similar shape of restricted log-likelihood ratio profiles were observed between udder type traits and for body depth and calving traits, respectively. Association analyses were performed for markers flanking the most likely QTL positions by applying a mixed model including a fixed allele effect of the maternally inherited allele and a random polygenic effect. Results indicated that microsatellite marker DIK4234 (located at 53.3 Mb) is associated with maternal effects on stillbirth, direct effects on calving ease, and body depth. A comparison of effects for maternally inherited DIK4234 alleles indicated a favorable, positive correlation of maternal and direct effects on calving. Additionally, the association of maternally inherited DIK4234 marker alleles with body depth implied that conformation traits might provide the functional background of the QTL for calving traits. For udder type traits, the strong coincidence of QTL peaks and the position of the QTL in a

  1. Social relationships enhance the time spent eating and intake of a novel diet in pregnant Hanwoo (Bos taurus coreanae) heifers.

    Science.gov (United States)

    Shin, Dong-Han; Kang, Hyun-Min; Seo, Seongwon

    2017-01-01

    The objective of this study was to evaluate the effects of social relationships on the feed intake, eating behavior, and growth, upon exposure to a novel diet, in Hanwoo ( Bos taurus coreanae ) heifers during pregnancy. Twenty-four pregnant Hanwoo heifers, averaging 438 ± 27.8 kg in weight, 21 months in age, and 194 ± 8.5 days in pregnancy, were involved in a two-month (eight weeks) experiment. The heifers were randomly assigned to either the single housing group (SG; one individual per pen, n = 12), or the paired housing group (PG; two individuals per pen, n = 12). All pens were of the same size (5 × 5 m) and provided with one feed bin, which automatically recorded the individual feed intake and eating behavior. As the experiment began, the diet of the heifers was switched from a total mixed ration (TMR; 250 g/kg ryegrass straw and 750 g/kg concentrate mix) to a forage-only diet (mixed hay cubes composed of 500 g/kg alfalfa, 250 g/kg timothy, and 250 g/kg blue grass hay). The heifers were fed ad libitum twice a day. The individual feed intake and eating behavior were recorded daily throughout the experiment, and body weights (BWs) were measured every four weeks before the morning feeding. PG animals visited the feed bin 22% less often than SG. PG, however, stayed 39% longer in the feed bin and consumed 40% more feed per visit, compared with SG. Consequently, PG heifers spent 23% more time in eating and had 16% more daily dry matter intake than SG during the experiment. Average daily gain during the experimental period tended to be greater in PG than in SG. When pregnant Hanwoo heifers encountered a novel diet, social relationships (i.e., presence of a pen-mate) enhanced their time spent eating and feed intake. Social interactions, even with an unfamiliar individual, may be helpful for pregnant Hanwoo heifers cope with a diet challenge compared to solitary situation.

  2. Social relationships enhance the time spent eating and intake of a novel diet in pregnant Hanwoo (Bos taurus coreanae heifers

    Directory of Open Access Journals (Sweden)

    Dong-Han Shin

    2017-05-01

    Full Text Available The objective of this study was to evaluate the effects of social relationships on the feed intake, eating behavior, and growth, upon exposure to a novel diet, in Hanwoo (Bos taurus coreanae heifers during pregnancy. Twenty-four pregnant Hanwoo heifers, averaging 438 ± 27.8 kg in weight, 21 months in age, and 194 ± 8.5 days in pregnancy, were involved in a two-month (eight weeks experiment. The heifers were randomly assigned to either the single housing group (SG; one individual per pen, n = 12, or the paired housing group (PG; two individuals per pen, n = 12. All pens were of the same size (5 × 5 m and provided with one feed bin, which automatically recorded the individual feed intake and eating behavior. As the experiment began, the diet of the heifers was switched from a total mixed ration (TMR; 250 g/kg ryegrass straw and 750 g/kg concentrate mix to a forage-only diet (mixed hay cubes composed of 500 g/kg alfalfa, 250 g/kg timothy, and 250 g/kg blue grass hay. The heifers were fed ad libitum twice a day. The individual feed intake and eating behavior were recorded daily throughout the experiment, and body weights (BWs were measured every four weeks before the morning feeding. PG animals visited the feed bin 22% less often than SG. PG, however, stayed 39% longer in the feed bin and consumed 40% more feed per visit, compared with SG. Consequently, PG heifers spent 23% more time in eating and had 16% more daily dry matter intake than SG during the experiment. Average daily gain during the experimental period tended to be greater in PG than in SG. When pregnant Hanwoo heifers encountered a novel diet, social relationships (i.e., presence of a pen-mate enhanced their time spent eating and feed intake. Social interactions, even with an unfamiliar individual, may be helpful for pregnant Hanwoo heifers cope with a diet challenge compared to solitary situation.

  3. COMPORTAMIENTO REPRODUCTIVO Y PRODUCTIVO DE VACAS Bos indicus, Bos taurus Y SUS CRUCES EN UN SISTEMA DE PRODUCCIÓN VACA:CRÍA EN YUCATÁN, MÉXICO

    Directory of Open Access Journals (Sweden)

    Gilberto Timoteo Mejía Bautista

    2009-11-01

    Full Text Available El objetivo de este estudio fue comparar el comportamiento reproductivo y productivo de vacas Bos indicus, Bos taurus y sus cruces en un sistema vaca:cría en Yucatán, México. Se utilizó la información de 310 vacas Brahman (Br, 191 Nelore (Ne, 140 Cebú Comercial (CC, 49 Suizo Pardo (SP y 69 cruzadas con SP (Cz que parieron durante un periodo de 20 años. Los indicadores estudiados fueron edad al primer parto (EPP, intervalo entre partos (IEP, peso al destete a 205 días (PDA205 y peso al destete por día de interparto (PDA/IEP. Se utilizaron modelos fijos para determinar los efectos de año de nacimiento (AN o parto (AP, época de nacimiento (EN o parto (EP, número de parto (NP, sexo de la cría (SX y grupo racial de la vaca (GRV sobre los indicadores y modelos mixtos para la repetibilidad calculada mediante los componentes de varianza entre y dentro de vaca. Las medias generales y desviaciones estándar para EPP, IEP, PDA205 y PDA/IEP fueron, 1091.7±137.9 días, 432.9±96.9 días, 164.3±25.5 kg y 401±159 g, respectivamente. El AN y EN afectaron la EPP; el AP, EP y NP afectaron al IEP, PDA205 y PDA/IEP (P

  4. Juridica; Bos, bouw en gemeenten

    NARCIS (Netherlands)

    Kistenkas, F.H.

    2011-01-01

    Bouwen in het bos van de ecologische hoofdstructuur. Geen probleem als niemand bezwaar maakt.... Uiteindelijk is de gemeente vergunningverlener aan zichzelf, is wetgever in eigen zaak en maakt voor zichzelf een lucratief bestemmingsplan. Aldus de analyse van wetskenner Fred Kistenkas

  5. Indicadores de estresse térmico e utilização da somatotropina bovina (bST em vacas leiteiras mestiças (Bos taurus x Bos indicus no semi-árido do Nordeste

    Directory of Open Access Journals (Sweden)

    Oliveira Neto Joaquim Batista de

    2001-01-01

    Full Text Available O objetivo do presente experimento foi avaliar a resposta ao bST de vacas mestiças (Bos taurus x Bos indicus criadas no semi-árido do Ceará. Quinze vacas (segunda e terceira parições; 42 a 155 dias pós-parto receberam cinco aplicações de bST a intervalos de 14 dias e outras 15 foram utilizadas como controle. A dieta dos animais consistiu de capim-elefante e concentrado. Durante a primeira aplicação de bST, a produção de leite dos animais tratados (12,6 kg/dia não diferiu dos animais controle (11,3 Kg/dia mas, na segunda e terceira aplicações, a diferença entre os grupos foi significativa (2,0 e 2,2 kg. Na quarta aplicação de bST, houve aumento na diferença entre os grupos (3,0 kg e, na quinta aplicação, esta diferença foi de 3,4 kg (14,0 kg versus 10,6 kg/dia. A interação tratamento com bST e estágio de lactação não foi significativa. As temperaturas do leite e retal foram maiores (0,6 e 0,1°C, respectivamente nos animais tratados com bST que nos animais controles, mas estas diferenças não foram significativas. Para o grupo de 30 animais, houve correlações entre produção e temperatura do leite (r = 0, 38 a 0,69. Com base no cálculo do índice de temperatura e umidade, os animais estiveram submetidos a estresse térmico ameno (manhã ou moderado (à tarde. Portanto, animais mestiços criados no semi-árido do Nordeste aumentaram a produção de leite devido ao bST, sem, no entanto, apresentar indicativos de estresse térmico severo.

  6. Comparação entre a população folicular ovariana antral e pré-antral de fêmeas Bos indicus e ½ Bos indicus X Bos taurus

    OpenAIRE

    Leticia Schmidt Siloto

    2012-01-01

    O objetivo deste trabalho foi comparar a população folicular ovariana antral e pré-antral de vacas Nelore (indicus) e ½ NeloreXAngus (indicus-taurus). Fêmeas indicus (n=20) e indicus-taurus (n=20) foram submetidas à aspiração folicular em dia aleatório do ciclo estral (D0), a fim de promover a ablação de todos os folículos ≥3mm e o início de uma nova onda de crescimento folicular. Em seguida foram submetidas à avaliações ultrassonográficas por cinco dias (D4, D19, D34, D49 e D64) para c...

  7. Efeitos da injeção de cloreto de cálcio pós-morte e tempo de maturação no amaciamento e nas perdas por cozimento do músculo Longissimus dorsi de animais Bos indicus e Bos taurus selecionados para ganho de peso Effects of postmortem calcium chloride injection and aging time on tenderness and cooking losses of Longissimus dorsi muscle from Bos indicus and Bos taurus animals selected for weight gain

    Directory of Open Access Journals (Sweden)

    Aparecida Carla de Moura

    1999-01-01

    Full Text Available O objetivo deste estudo foi avaliar o efeito da injeção pós-morte de cloreto de cálcio (CaCl2 e o tempo de maturação no amaciamento e nas perdas por cozimento do músculo longissimus dorsi de animais Bos indicus e Bos taurus selecionados para ganho de peso. Foram usados 64 machos inteiros (16 Caracu, 16 Guzerá, 16 Nelore Controle e 16 Nelore Seleção. Vinte quatro horas após o abate, foi retirada uma amostra do músculo Longissiumus dorsi (contra-filé entre a 6ª e 9ª vértebras lombares e dividida em nove subamostras. Em cada grupo de três subamostras escolhidas ao acaso, foi injetada, na quantia correspondente a 10% do seu peso, uma das seguintes soluções: a água (controle, b 200 mM de CaCl2 e c 300 mM de CaCl2. Cada subamostra foi, então, embalada a vácuo, congelada (- 2ºC e maturada por 1,7 ou 14 dias até a realização de testes de força de cisalhamento e perdas por cozimento (evaporação, gotejamento e perdas totais. Foi usado delineamento experimental completamente casualizado com parcelas subdivididas, em que a parcela correspondia à raça e a sub-parcela, à combinação entre três níveis de CaCl2 e três tempos de maturação. A raça influenciou a força de cisalhamento, mas não influiu nas perdas por cozimento A maturação por um período de sete dias reduziu os valores de força de cisalhamento e as perdas por evaporação, gotejamento e totais. Maiores concentrações de CaCl2 resultaram em menor força de cisalhamento e maiores perdas por evaporação, embora não tenham influenciado as perdas por gotejamento e totais. A concentração de 200 mM CaCl2 apresentou a melhor redução para a força de cisalhamento. A injeção pós-morte de uma solução de CaCl2 aumentou o processo de amaciamento, sem influir nas perdas por cozimento.ABSTRACT - The objective of this study was to evaluate the effect of postmortem calcium chloride (CaCl2 injection and aging time on tenderness and cooking losses of Longissimus

  8. Avaliação das concentrações plasmáticas de cortisol e progesterona em vacas nelore (Bos taurus indicus) submetidas a manejo diário ou manejo semanal

    OpenAIRE

    Maziero, Rosiára Rosária Dias [UNESP; Martin, Ian [UNESP; Mattos, Maria Clara Costa; Ferreira, João Carlos Pinheiro [UNESP

    2012-01-01

    This study evaluates the plasma concentration of progesterone and cortisol in cows submitted to daily or weekly handling. For this experiment, seven primiparous or multiparous Nelore cows (Bos taurus indicus) were monitored for 21 days (experiment 1) and 9 weeks (experiment 2) through rectal palpation and ultrasonographic examination of the female reproductive tract, as well as jugular venipuncture. Plasma concentration of progesterone and cortisol (ng/mL) was determined by radioimmunoassay f...

  9. Different doses of equine chorionic gonadotropin on ovarian follicular growth and pregnancy rate of suckled Bos taurus beef cows subjected to timed artificial insemination protocol.

    Science.gov (United States)

    Pessoa, G A; Martini, A P; Carloto, G W; Rodrigues, M C C; Claro Júnior, I; Baruselli, P S; Brauner, C C; Rubin, M I B; Corrêa, M N; Leivas, F G; Sá Filho, M F

    2016-03-15

    This study evaluated the effect of different doses of eCG (control, 300 or 400 IU) administered at progesterone (P4) device removal in suckled Bos taurus beef cows undergoing a timed artificial insemination (TAI) protocol. A total of 966 cows received a P4 insert and 2.0 mg intramuscular estradiol benzoate at the onset of the synchronization. After 9 days, P4 insert was removed, and 12.5 mg of dinoprost tromethamine and 1 mg of estradiol cypionate were administered, followed by TAI 48 hours later. Then, the cows received one of three treatments as follows: control (n = 323), 300 (n = 326), or 400 IU of eCG (n = 317). A subset (n = 435) of cows in anestrus had their ovaries evaluated using ultrasound at the time of P4 removal and at TAI. Data were analyzed by orthogonal contrasts (C): C1 (eCG effect) and C2 (eCG dose effect). Estrous occurrence (control = 53.7%, 300 IU = 70.6%, and 400 IU = 77.0%) and pregnancy per artificial insemination (control = 29.7%, 300 IU = 44.8%, and 400 IU = 47.6%) were improved by eCG treatment (C1; P = 0.0004 and P 0.15). In conclusion, the eCG treatment administered at the time of P4 removal increased the occurrence of estrus, the larger follicles at TAI, and pregnancy per artificial insemination of suckled B taurus beef cows. Despite the greater occurrence of estrus in noncyclic cows receiving 400 IU of eCG, both eCG doses (300 and 400 IU) were equally efficient to improve pregnancy to artificial insemination. Copyright © 2016 Elsevier Inc. All rights reserved.

  10. Heat-tolerant versus heat-sensitive Bos taurus cattle: influence of air temperature and breed on the acute phase response to a provocative immune challenge.

    Science.gov (United States)

    Carroll, J A; Burdick Sanchez, N C; Chaffin, R; Chase, C C; Coleman, S W; Spiers, D E

    2013-10-01

    The difference in the acute phase response of a heat-tolerant and a heat-sensitive Bos taurus breed to a lipopolysaccharide (LPS) challenge when housed at different air temperatures (Ta) was studied. Angus (ANG; heat-sensitive; n = 11; 306 ± 26 kg BW) and Romosinuano (RO; heat-tolerant; n = 10; 313 ± 32 kg BW) heifers were transported from the USDA Agricultural Research Service SubTropical Agricultural Research Station in Florida to the Brody Environmental Chambers at the University of Missouri, Columbia. Heifers were housed in stanchions in 4 temperature-controlled environmental chambers. Initially, Ta in the 4 chambers was cycling at thermoneutrality (TN; 18.5°C-23.5°C) for a 1-wk adjustment period, followed by an increase in 2 of the 4 chambers to cycling heat stress (HS; 24°C-38°C) for 2 wk. On day 19, heifers were fitted with jugular catheters and rectal temperature (RT) recording devices. On day 20, heifers were challenged with LPS (0.5 μg/kg BW; 0 h), sickness behavior scores (SBSs) were recorded, and blood samples were collected at 0.5-h intervals from -2 to 8 h and again at 24 h relative to LPS challenge at 0 h. Serum was isolated and stored at -80°C until analyzed for cortisol and cytokine concentrations. A breed by Ta interaction (P heat-tolerant RO and heat-sensitive ANG heifers under different Ta which may aid in elucidating differences in productivity, disease resistance, and longevity among cattle breeds. Published by Elsevier Inc.

  11. Efecto de la manipulación del semen criopreservado de bovinos Bos Taurus sobre la integridad espermática

    Directory of Open Access Journals (Sweden)

    Norberto Villa-Duque

    2016-01-01

    Full Text Available En el estudio se evaluó el efecto de descongelar y aplicar semen de bovinos Bos Taurus en 33 ganaderías del Magdalena Medio colombiano, y se estudió in vitro el efecto de la injuria encontrada sobre la integridad de las membranas espermáticas. La información en fincas se recopiló mediante formulario específico, mientras que el estudio in vitro se ejecutó en el laboratorio de Biotecnología Reproductiva Animal del Instituto Universitario de la Paz (Barrancabermeja, Santander. El estudio consistió en someter pajillas comerciales de 0.5 ml de toros Holstein y Pardo Suizo a la técnica convencional y a tres modificaciones de esta (injurias mediante un diseño randomizado. Ninguna de las fincas evaluadas aplicó correctamente la práctica de la inseminación artificial; errores notorios fueron: exceso de tiempo durante la extracción de la pajilla, descongelación en la región axilar y no combinación correcta entre tiempo y temperatura. Los resultados evidenciaron diferencia significativa (P<0.05 por efecto de la raza para la integridad y resistencia de las membranas espermáticas, para la integridad de las membranas por efecto de los tratamientos cuando la pajilla se descongelo a temperatura corporal en la región axilar y para la integridad de la membrana acrosomal cuando la extracción de la pajilla se realizó en forma incorrecta. El semen de la raza Holstein evidencia una ligera tendencia a ser más resistente que el de la raza Pardo Suizo.

  12. Mitogenomes from Egyptian Cattle Breeds: New Clues on the Origin of Haplogroup Q and the Early Spread of Bos taurus from the Near East.

    Directory of Open Access Journals (Sweden)

    Anna Olivieri

    Full Text Available Genetic studies support the scenario that Bos taurus domestication occurred in the Near East during the Neolithic transition about 10 thousand years (ky ago, with the likely exception of a minor secondary event in Italy. However, despite the proven effectiveness of whole mitochondrial genome data in providing valuable information concerning the origin of taurine cattle, until now no population surveys have been carried out at the level of mitogenomes in local breeds from the Near East or surrounding areas. Egypt is in close geographic and cultural proximity to the Near East, in particular the Nile Delta region, and was one of the first neighboring areas to adopt the Neolithic package. Thus, a survey of mitogenome variation of autochthonous taurine breeds from the Nile Delta region might provide new insights on the early spread of cattle rearing outside the Near East.Using Illumina high-throughput sequencing we characterized the mitogenomes from two cattle breeds, Menofi (N = 17 and Domiaty (N = 14, from the Nile Delta region. Phylogenetic and Bayesian analyses were subsequently performed.Phylogenetic analyses of the 31 mitogenomes confirmed the prevalence of haplogroup T1, similar to most African cattle breeds, but showed also high frequencies for haplogroups T2, T3 and Q1, and an extremely high haplotype diversity, while Bayesian skyline plots pointed to a main episode of population growth ~12.5 ky ago. Comparisons of Nile Delta mitogenomes with those from other geographic areas revealed that (i most Egyptian mtDNAs are probably direct local derivatives from the founder domestic herds which first arrived from the Near East and the extent of gene flow from and towards the Nile Delta region was limited after the initial founding event(s; (ii haplogroup Q1 was among these founders, thus proving that it underwent domestication in the Near East together with the founders of the T clades.

  13. Background-oriented schlieren (BOS) techniques

    Science.gov (United States)

    Raffel, Markus

    2015-03-01

    This article gives an overview of the background-oriented schlieren (BOS) technique, typical applications and literature in the field. BOS is an optical density visualization technique, belonging to the same family as schlieren photography, shadowgraphy or interferometry. In contrast to these older techniques, BOS uses correlation techniques on a background dot pattern to quantitatively characterize compressible and thermal flows with good spatial and temporal resolution. The main advantages of this technique, the experimental simplicity and the robustness of correlation-based digital analysis, mean that it is widely used, and variant versions are reviewed in the article. The advantages of each variant are reviewed, and further literature is provided for the reader.

  14. Tissue-specific and minor inter-individual variation in imprinting of IGF2R is a common feature of Bos taurus Concepti and not correlated with fetal weight.

    Directory of Open Access Journals (Sweden)

    Daniela Bebbere

    Full Text Available The insulin-like growth factor 2 receptor (IGF2R is essential for prenatal growth regulation and shows gene dosage effects on fetal weight that can be affected by in-vitro embryo culture. Imprinted maternal expression of murine Igf2r is well documented for all fetal tissues excluding brain, but polymorphic imprinting and biallelic expression were reported for IGF2R in human. These differences have been attributed to evolutionary changes correlated with specific reproductive strategies. However, data from species suitable for testing this hypothesis are lacking. The domestic cow (Bos taurus carries a single conceptus with a similar gestation length as human. We identified 12 heterozygous concepti informative for imprinting studies among 68 Bos taurus fetuses at Day 80 of gestation (28% term and found predominantly maternal IGF2R expression in all fetal tissues but brain, which escapes imprinting. Inter-individual variation in allelic expression bias, i.e. expression of the repressed paternal allele relative to the maternal allele, ranged from 4.6-8.9% in heart, 4.3-10.2% in kidney, 6.1-11.2% in liver, 4.6-15.8% in lung and 3.2-12.2% in skeletal muscle. Allelic bias for mesodermal tissues (heart, skeletal muscle differed significantly (P<0.05 from endodermal tissues (liver, lung. The placenta showed partial imprinting with allelic bias of 22.9-34.7% and differed significantly (P<0.001 from all other tissues. Four informative fetuses were generated by in-vitro fertilization (IVF with embryo culture and two individuals displayed fetal overgrowth. However, there was no evidence for changes in imprinting or DNA methylation after IVF, or correlations between allelic bias and fetal weight. In conclusion, imprinting of Bos taurus IGF2R is similar to mouse except in placenta, which could indicate an effect of reproductive strategy. Common minor inter-individual variation in allelic bias and absence of imprinting abnormalities in IVF fetuses suggest

  15. Sequence diversity between class I MHC loci of African native and introduced Bos taurus cattle in Theileria parva endemic regions: in silico peptide binding prediction identifies distinct functional clusters.

    Science.gov (United States)

    Obara, Isaiah; Nielsen, Morten; Jeschek, Marie; Nijhof, Ard; Mazzoni, Camila J; Svitek, Nicholas; Steinaa, Lucilla; Awino, Elias; Olds, Cassandra; Jabbar, Ahmed; Clausen, Peter-Henning; Bishop, Richard P

    2016-05-01

    There is strong evidence that the immunity induced by live vaccination for control of the protozoan parasite Theileria parva is mediated by class I MHC-restricted CD8(+) T cells directed against the schizont stage of the parasite that infects bovine lymphocytes. The functional competency of class I MHC genes is dependent on the presence of codons specifying certain critical amino acid residues that line the peptide binding groove. Compared with European Bos taurus in which class I MHC allelic polymorphisms have been examined extensively, published data on class I MHC transcripts in African taurines in T. parva endemic areas is very limited. We utilized the multiplexing capabilities of 454 pyrosequencing to make an initial assessment of class I MHC allelic diversity in a population of Ankole cattle. We also typed a population of exotic Holstein cattle from an African ranch for class I MHC and investigated the extent, if any, that their peptide-binding motifs overlapped with those of Ankole cattle. We report the identification of 18 novel allelic sequences in Ankole cattle and provide evidence of positive selection for sequence diversity, including in residues that predominantly interact with peptides. In silico functional analysis resulted in peptide binding specificities that were largely distinct between the two breeds. We also demonstrate that CD8(+) T cells derived from Ankole cattle that are seropositive for T. parva do not recognize vaccine candidate antigens originally identified in Holstein and Boran (Bos indicus) cattle breeds.

  16. Obtenção de oócitos e produção in vitro de embriões em doadoras lactantes da raça Gir (Bos taurus indicus)

    OpenAIRE

    Ferreira, Marcos Brandão Dias [UNESP

    2011-01-01

    Raças zebuínas (Bos taurus indicus) e seus cruzamentos têm papel fundamental na pecuária brasileira, e a raça Gir, em especial, acrescenta rusticidade e produtividade nas suas descendentes leiteiras. A produção in vitro de embriões bovinos é uma biotécnica de alto valor econômico, que, aliada à utilização de sêmen sexado para cromossoma X, possibilita a multiplicação com fêmeas de valor genético superior. Foram realizados dois experimentos com o objetivo de avaliar a produção in vitro (PIV) d...

  17. (Bos grunniens) in Qinghai-Tibetan Plateau

    African Journals Online (AJOL)

    DR. NJ TONUKARI

    2012-10-30

    Oct 30, 2012 ... usage bias and gene length in Drosophila melanogaster. J. Mol. Evol. 55:52-64. Mota AF, Martinez ML, Coutinho LL (2004). Genotyping BoLA-DRB3 alleles in Brazilian Dairy Gir cattle (Bos indicus) by temperature- gradient gel electrophoresis (TGGE) and direct sequencing. Eur. J. Immunogen. 31:31-35.

  18. [Argyrophilic structures of the larval forms of 2 strains of Paramphistomum microbothrium: 1 a parasite of Isidora guernei and Ovis aries, the other a parasite of Isidora truncata and Bos taurus].

    Science.gov (United States)

    Diaw, O T; Samnaliev, P; Pino, L A; Bayssade-Dufour, C; Albaret, J L; Vassiliades, G

    1983-01-01

    The life cycle of a Paramphistome from North Senegal is completed starting from cercariae shed by naturally infected Isidora guernei: a sheep and then uninfected Isidora guernei were successively infected experimentally. Adults obtained were identifiable as P. phillerouxi or as P. microbothrium. Species determination cannot be made on the basis of argentophilic structures in the miracidium. Morphology of sporocysts and rediae differs from that observed in P. phillerouxi but is undistinguishable from that described in P. microbothrium. Cercarial chaetotaxy differs from that of P. phillerouxi. Mollusc host: Isidora guernei belongs to the same genus as Isidora truncata and I. alluaudi, reported hosts to P. microbothrium. Therefore the material is provisionally identified as P. microbothrium. To confirm this, a strain of P. microbothrium from naturally infected Bos taurus in Egypt was studied. Miracidia were used to experimentally infect Isidora truncata; cercariae obtained were identical to those previously described for this species from I. truncata and I. alluaudi. Cercarial chaetotaxy was not significantly different from that of material from North Senegal. They represent therefore two strains of Paramphistomum microbothrium.

  19. Le Flaubert de Charles Du Bos

    Directory of Open Access Journals (Sweden)

    Jacques Neefs

    2009-01-01

    Full Text Available Charles Du Bos a porté une attention constante à l’œuvre de Flaubert (à l’exclusion de Bouvard et Pécuchet qui semble ne pas exister pour lui, à Madame Bovary et à L’Éducation sentimentale en particulier. La mise en relation de son étude : « Sur le milieu intérieur chez Flaubert », écrite en 1921, avec des textes du Journal de 1923 et de 1937, les rapprochements avec Gogol, Thomas Hardy, Tolstoï, Baudelaire, Henry James qui traversent les écrits de Du Bos, permettent de suivre ce que celui-ci décrit comme « l’expérience spirituelle » d’une matérialité comprise dans la conquête de la triple exigence du Beau, du Vivant et du Vrai. Du Bos décèle la force de l’œuvre de Flaubert dans la « disproportion » du style, et dans la puissance d’absorption qui fait la densité de cette prose, et qui désigne un extraordinaire travail de conversion. L’obscure expérience spirituelle ainsi poursuivie est celle d’un absolu de l’art, expérience paradoxale d’un « mystique qui ne croit à rien » (comme se désignait Flaubert lui-même, que le critique lie à une interrogation sur sa propre conversion.Charles Du Bos devoted an unflagging attention to Flaubert’s work (except for Bouvard et Pécuchet, which, apparently, according to him did not exist, to Madame Bovary and in particular L’Éducation sentimentale. The connection between his essay “Sur le milieu intérieur chez Flaubert”, written in 1921, and extracts from his Journal, from 1923 to 1937, the comparisons with Gogol, Thomas Hardy, Tolstoy, Baudelaire, and Henry James that run through the writings of Du Bos, allow us to follow what he terms “the spiritual experience” of a materiality encompassed in the conquest of the triple demand of the Beautiful, the Living, the Truth. Du Bos detects the power of Flaubert’s work in the “disproportion” of his style, and the power of absorption that forms the density of his prose, showing an

  20. Phylogenetic relationships of Malayan gaur with other species of the genus Bos based on cytochrome b gene DNA sequences.

    Science.gov (United States)

    Rosli, M K A; Zakaria, S S; Syed-Shabthar, S M F; Zainal, Z Z; Shukor, M N; Mahani, M C; Abas-Mazni, O; Md-Zain, B M

    2011-03-22

    The Malayan gaur (Bos gaurus hubbacki) is one of the three subspecies of gaurs that can be found in Malaysia. We examined the phylogenetic relationships of this subspecies with other species of the genus Bos (B. javanicus, B. indicus, B. taurus, and B. grunniens). The sequence of a key gene, cytochrome b, was compared among 20 Bos species and the bongo antelope, used as an outgroup. Phylogenetic reconstruction was employed using neighbor joining and maximum parsimony in PAUP and Bayesian inference in MrBayes 3.1. All tree topologies indicated that the Malayan gaur is in its own monophyletic clade, distinct from other species of the genus Bos. We also found significant branching differences in the tree topologies between wild and domestic cattle.

  1. Temperature Studies for ATLAS MDT BOS Chambers

    CERN Document Server

    Engl, A.; Biebel, O.; Mameghani, R.; Merkl, D.; Rauscher, F.; Schaile, D.; Ströhmer, R.

    Data sets with high statistics taken at the cosmic ray facility, equipped with 3 ATLAS BOS MDT chambers, in Garching (Munich) have been used to study temperature and pressure effects on gas gain and drifttime. The deformation of a thermally expanded chamber was reconstructed using the internal RasNik alignment monitoring system and the tracks from cosmic data. For these studies a heating system was designed to increase the temperature of the middle chamber by up to 20 Kelvins over room temperature. For comparison the temperature effects on gas properties have been simulated with Garfield. The maximum drifttime decreased under temperature raise by -2.21 +- 0.08 ns/K, in agreement with the results of pressure variations and the Garfield simulation. The increased temperatures led to a linear increase of the gas gain of about 2.1% 1/K. The chamber deformation has been analyzed with the help of reconstructed tracks. By the comparison of the tracks through the reference chambers with these through the test chamber ...

  2. The BOS loci of Arabidopsis are required for resistance to Botrytis cinerea infection.

    Science.gov (United States)

    Veronese, Paola; Chen, Xi; Bluhm, Burton; Salmeron, John; Dietrich, Robert; Mengiste, Tesfaye

    2004-11-01

    Three Botrytis-susceptible mutants bos2, bos3, and bos4 which define independent and novel genetic loci required for Arabidopsis resistance to Botrytis cinerea were isolated. The bos2 mutant is susceptible to B. cinerea but retains wild-type levels of resistance to other pathogens tested, indicative of a defect in a response pathway more specific to B. cinerea. The bos3 and bos4 mutants also show increased susceptibility to Alternaria brassicicola, another necrotrophic pathogen, suggesting a broader role for these loci in resistance. bos4 shows the broadest range of effects on resistance, being more susceptible to avirulent strain of Pseudomonas syringae pv. tomato. Interestingly, bos3 is more resistant than wild-type plants to virulent strains of the biotrophic pathogen Peronospora parasitica and the bacterial pathogen P. syringae pv. tomato. The Pathogenesis Related gene 1 (PR-1), a molecular marker of the salicylic acid (SA)-dependent resistance pathway, shows a wild-type pattern of expression in bos2, while in bos3 this gene was expressed at elevated levels, both constitutively and in response to pathogen challenge. In bos4 plants, PR-1 expression was reduced compared with wild type in response to B. cinerea and SA. In bos3, the mutant most susceptible to B. cinerea and with the highest expression of PR-1, removal of SA resulted in reduced PR-1 expression but no change to the B. cinerea response. Expression of the plant defensin gene PDF1-2 was generally lower in bos mutants compared with wild-type plants, with a particularly strong reduction in bos3. Production of the phytoalexin camalexin is another well-characterized plant defense response. The bos2 and bos4 mutants accumulate reduced levels of camalexin whereas bos3 accumulates significantly higher levels of camalexin than wild-type plants in response to B. cinerea. The BOS2, BOS3, and BOS4 loci may affect camalexin levels and responsiveness to ethylene and jasmonate. The three new mutants appear to mediate

  3. Draft genome of the gayal, Bos frontalis

    Science.gov (United States)

    Wang, Ming-Shan; Zeng, Yan; Wang, Xiao; Nie, Wen-Hui; Wang, Jin-Huan; Su, Wei-Ting; Xiong, Zi-Jun; Wang, Sheng; Qu, Kai-Xing; Yan, Shou-Qing; Yang, Min-Min; Wang, Wen; Dong, Yang; Zhang, Ya-Ping

    2017-01-01

    Abstract Gayal (Bos frontalis), also known as mithan or mithun, is a large endangered semi-domesticated bovine that has a limited geographical distribution in the hill-forests of China, Northeast India, Bangladesh, Myanmar, and Bhutan. Many questions about the gayal such as its origin, population history, and genetic basis of local adaptation remain largely unresolved. De novo sequencing and assembly of the whole gayal genome provides an opportunity to address these issues. We report a high-depth sequencing, de novo assembly, and annotation of a female Chinese gayal genome. Based on the Illumina genomic sequencing platform, we have generated 350.38 Gb of raw data from 16 different insert-size libraries. A total of 276.86 Gb of clean data is retained after quality control. The assembled genome is about 2.85 Gb with scaffold and contig N50 sizes of 2.74 Mb and 14.41 kb, respectively. Repetitive elements account for 48.13% of the genome. Gene annotation has yielded 26 667 protein-coding genes, of which 97.18% have been functionally annotated. BUSCO assessment shows that our assembly captures 93% (3183 of 4104) of the core eukaryotic genes and 83.1% of vertebrate universal single-copy orthologs. We provide the first comprehensive de novo genome of the gayal. This genetic resource is integral for investigating the origin of the gayal and performing comparative genomic studies to improve understanding of the speciation and divergence of bovine species. The assembled genome could be used as reference in future population genetic studies of gayal. PMID:29048483

  4. De prijsvorming van hout uit het Nederlandse bos

    NARCIS (Netherlands)

    Slangen, L.H.G.

    1984-01-01

    De prijsvorming van hout op stam en hout geveld uit het Nederlandse bos op het niveau van het bosbedrijf staat centraal in deze publikatie. Na een schets van een aantal facetten die invloed hebben op de prijsvorming wordt nader ingegaan op de prijsvorming zelf. Onderzocht wordt of er verschil in

  5. Testicular compensation in Nguni (Bos indicus, Sanga) bulls with ...

    African Journals Online (AJOL)

    Testicular compensation in Nguni. (Bos indicus, Sanga) bulls with unilateral gonadal hypoplasia and aplasia. G.W. Kay* and E.H.H. Meyer. Animal and Dairy Science Research Institute, Private Bag X2,. Irene, 1675 Republic of South Africa. *To whom correspondence should be addressed. The testosterone response to ...

  6. Combining ART and FBP for improved fidelity of tomographic BOS

    Science.gov (United States)

    Hartmann, Ulrich; Seume, Joerg R.

    2016-09-01

    Engine component defects along the hot-gas path (HGP) of jet engines influence the density distribution of the flow, and thus result in characteristic patterns in the exhaust jet. These characteristic patterns can be reconstructed with the optical background-oriented schlieren (BOS) method in a tomographic set-up, which in turn allows the identification of defects inside the engine through an exhaust jet analysis. The quality of the tomographic reconstruction strongly influences how easily defects can be detected inside the jet engine. In particular, the presence of high gradients in the reconstruction area has a strong impact on the reconstruction quality. An algebraic reconstruction algorithm (ART) is implemented and compared to a filtered-back projection (FBP) algorithm in terms of the capability of performing high-gradient tomographic BOS reconstructions. A combination of both algorithms is presented which significantly improves the reconstruction quality of high-gradient tomographic BOS in terms of artifact reduction. The combination of both algorithms is applied to both synthetic and real measurement data in this paper, in order to show possible applications and the achievable improvement of high-gradient tomographic BOS reconstructions.

  7. Mitochondrial DNA single nucleotide polymorphism associated with weight estimated breeding values in Nelore cattle (Bos indicus

    Directory of Open Access Journals (Sweden)

    Fernando Henrique Biase

    2007-01-01

    Full Text Available We sampled 119 Nelore cattle (Bos indicus, 69 harboring B. indicus mtDNA plus 50 carrying Bos taurus mtDNA, to estimate the frequencies of putative mtDNA single nucleotide polymorphisms (SNPs and investigate their association with Nelore weight and scrotal circumference estimated breeding values (EBVs. The PCR restriction fragment length polymorphism (PCR-RFLP method was used to detect polymorphisms in the mitochondrial asparagine, cysteine, glycine, leucine and proline transporter RNA (tRNA genes (tRNAasn, tRNAcys, tRNAgly, tRNAleu and tRNApro. The 50 cattle carrying B. taurus mtDNA were monomorphic for all the tRNA gene SNPs analyzed, suggesting that they are specific to mtDNA from B. indicus cattle. No tRNAcys or tRNAgly polymorphisms were detected in any of the cattle but we did detect polymorphic SNPs in the tRNAasn, tRNAleu and tRNApro genes in the cattle harboring B. indicus mtDNA, with the same allele observed in the B. taurus sequence being present in the following percentage of cattle harboring B. indicus mtDNA: 72.46% for tRNAasn, 95.23% for tRNAleu and 90.62% for tRNApro. Analyses of variance using the tRNAasn SNP as the independent variable and EBVs as the dependent variable showed that the G -> T SNP was significantly associated (p < 0.05 with maternal EBVs for weight at 120 and 210 days (p < 0.05 and animal's EBVs for weight at 210, 365 and 455 days. There was no association of the tRNAasn SNP with the scrotal circumference EBVs. These results confirm that mtDNA can affect weight and that mtDNA polymorphisms can be a source of genetic variation for quantitative traits.

  8. Electrocardiogram of Clinically Healthy Mithun (Bos frontalis): Variation among Strains

    Science.gov (United States)

    Sanyal, Sagar; Das, Pradip Kumar; Ghosh, Probal Ranjan; Das, Kinsuk; Vupru, Kezha V.; Rajkhowa, Chandan; Mondal, Mohan

    2010-01-01

    A study was conducted to establish the normal electrocardiogram in four different genetic strains of mithun (Bos frontalis). Electrocardiography, cardiac electrical axis, heart rate, rectal temperature and respiration rate were recorded in a total of 32 adult male mithun of four strains (n = 8 each). It was found that the respiration and heart rates were higher (P electrocardiogram of mithun revealed that the amplitude and duration of P wave, QRS complex and T wave were different among four different genetic strains of mithun and the electrical axis of QRS complex for Nagamese and Mizoram mithuns are dissimilar to bovine species. PMID:20886013

  9. Ovariectomy effect in heifers Nelore x Angus, Bos taurus indicus x Bos taurus taurus on the weight gains /Efeito da ovariectomia em novilhas Nelore x Angus, Bos taurus indicus x Bos taurus taurus sobre os ganhos de peso

    Directory of Open Access Journals (Sweden)

    Sérgio do Nascimento Kronka

    2007-10-01

    Full Text Available This study aimed to evaluate the weight gain in cross breed heifers Nelore X Angus, spayed and nonspayed, kept on pasture and confinement. The animals were allotted in two groups as follows: group 1 consisted of 30 nonspayed heifers with 18 months old. Group 2 was composed of 30 spayed heifers with 18 months old. The animals were allotted in pasture of Brachiaria decumbens and weighted at 39and 75 days. Significant difference was observed between the average daily gain of the two groups – G1 and G2 (75th day, respectively (0.51 kg and 0.65 kg; PEsse estudo teve o objetivo de avaliar o ganho de peso em novilhas mestiças Nelore x Angus, castradas e não castradas, mantidas em pastagem e confinamento. Os animais foram alocados em dois grupos assim constituídos: grupo 1 formado por 30 novilhas não castradas com 18 meses de idade. Grupo 2 composto por 30 novilhas castradas com 18 meses de idade. Os animais foram mantidos em pastagem de Brachiaria decumbens e pesados aos 39 e 75 dias. Diferença significativa foi observada entre o ganho médio diário dos dois grupos – G1 e G2 (75ºdia, respectivamente (0,51 kg e 0,65 kg; P < 0,01. No dia seguinte (76ºdia, todos os animais foram transferidos e mantidos por 144 dias no confinamento. Diferença significativa foi observada entre o ganho médio diário dos dois grupos – G1 e G2 (144ºdia, respectivamente (0,73 kg e 0,58 kg; P < 0,01. Os resultados desse experimento mostraram que novilhas castradas apresentaram um maior ganho diário em pastagem.

  10. A complete mitochondrial genome sequence from a mesolithic wild aurochs (Bos primigenius).

    LENUS (Irish Health Repository)

    Edwards, Ceiridwen J

    2010-01-01

    BACKGROUND: The derivation of domestic cattle from the extinct wild aurochs (Bos primigenius) has been well-documented by archaeological and genetic studies. Genetic studies point towards the Neolithic Near East as the centre of origin for Bos taurus, with some lines of evidence suggesting possible, albeit rare, genetic contributions from locally domesticated wild aurochsen across Eurasia. Inferences from these investigations have been based largely on the analysis of partial mitochondrial DNA sequences generated from modern animals, with limited sequence data from ancient aurochsen samples. Recent developments in DNA sequencing technologies, however, are affording new opportunities for the examination of genetic material retrieved from extinct species, providing new insight into their evolutionary history. Here we present DNA sequence analysis of the first complete mitochondrial genome (16,338 base pairs) from an archaeologically-verified and exceptionally-well preserved aurochs bone sample. METHODOLOGY: DNA extracts were generated from an aurochs humerus bone sample recovered from a cave site located in Derbyshire, England and radiocarbon-dated to 6,738+\\/-68 calibrated years before present. These extracts were prepared for both Sanger and next generation DNA sequencing technologies (Illumina Genome Analyzer). In total, 289.9 megabases (22.48%) of the post-filtered DNA sequences generated using the Illumina Genome Analyzer from this sample mapped with confidence to the bovine genome. A consensus B. primigenius mitochondrial genome sequence was constructed and was analysed alongside all available complete bovine mitochondrial genome sequences. CONCLUSIONS: For all nucleotide positions where both Sanger and Illumina Genome Analyzer sequencing methods gave high-confidence calls, no discrepancies were observed. Sequence analysis reveals evidence of heteroplasmy in this sample and places this mitochondrial genome sequence securely within a previously identified

  11. Physiological responses of newborn Bos indicus and Bos indicus x Bos taurus calves after exposure to cold.

    Science.gov (United States)

    Godfrey, R W; Smith, S D; Guthrie, M J; Stanko, R L; Neuendorff, D A; Randel, R D

    1991-01-01

    Brahman (n = 9) and 1/2 Simmental x 1/4 Brahman x 1/4 Hereford (n = 11) calves were utilized to determine the influence of exposure to cold on the physiology of the neonate. All calves were removed from their dams within 20 min of birth and prior to suckling. Calves were assigned randomly within breed to either a warm (W; 31 degrees C) or cold (C; 4 degrees C) environmental treatment group. Jugular blood samples were collected via indwelling catheters at 20-min intervals for 180 min. At 100 to 120 min of sampling, all calves were given 1.2 liters of colostrum from their dams via stomach tube. At 120 min, C calves were placed in the W environment. Calf vigor score (CVS) and rectal temperature were determined at each time blood was collected. Serum or plasma was analyzed for glucose (GLU), lactate (LAC), blood urea nitrogen (BUN), hemoglobin (HEM), triglyceride (TRG), triiodothyronine (T3), thyroxine (T4), insulin (INS), cortisol (CORT) and nonesterified fatty acid (NEFA) concentration. Rectal temperature was lower (P less than .01) in C Brahman than in W Brahman and C or W crossbred calves. Crossbred calves had higher (P less than .01) CVS than Brahman calves. Calves in W had lower (P less than .01) GLU than C calves. Brahman calves had higher GLU, LAC, BUN, TRG, T3, T4 and CORT (P less than .05) than crossbred calves. The C Brahman calves had the highest (P less than .05) TRG, CORT, T3 and T4 of all groups. Concentration of NEFA were higher (P less than .01) in C than in W calves.(ABSTRACT TRUNCATED AT 250 WORDS)

  12. Molecular Cloning, Bioinformatics Analysis and Expression of Insulin-Like Growth Factor 2 from Tianzhu White Yak, Bos grunniens

    Directory of Open Access Journals (Sweden)

    Quanwei Zhang

    2014-01-01

    Full Text Available The IGF family is essential for normal embryonic and postnatal development and plays important roles in the immune system, myogenesis, bone metabolism and other physiological functions, which makes the study of its structure and biological characteristics important. Tianzhu white yak (Bos grunniens domesticated under alpine hypoxia environments, is well adapted to survive and grow against severe hypoxia and cold temperatures for extended periods. In this study, a full coding sequence of the IGF2 gene of Tianzhu white yak was amplified by reverse transcription PCR and rapid-amplification of cDNA ends (RACE for the first time. The cDNA sequence revealed an open reading frame of 450 nucleotides, encoding a protein with 179 amino acids. Its expression in different tissues was also studied by Real time PCR. Phylogenetic tree analysis indicated that yak IGF2 was similar to Bos taurus, and 3D structure showed high similarity with the human IGF2. The putative full CDS of yak IGF2 was amplified by PCR in five tissues, and cDNA sequence analysis showed high homology to bovine IGF2. Moreover the super secondary structure prediction showed a similar 3D structure with human IGF2. Its conservation in sequence and structure has facilitated research on IGF2 and its physiological function in yak.

  13. A complete mitochondrial genome sequence from a mesolithic wild aurochs (Bos primigenius.

    Directory of Open Access Journals (Sweden)

    Ceiridwen J Edwards

    Full Text Available BACKGROUND: The derivation of domestic cattle from the extinct wild aurochs (Bos primigenius has been well-documented by archaeological and genetic studies. Genetic studies point towards the Neolithic Near East as the centre of origin for Bos taurus, with some lines of evidence suggesting possible, albeit rare, genetic contributions from locally domesticated wild aurochsen across Eurasia. Inferences from these investigations have been based largely on the analysis of partial mitochondrial DNA sequences generated from modern animals, with limited sequence data from ancient aurochsen samples. Recent developments in DNA sequencing technologies, however, are affording new opportunities for the examination of genetic material retrieved from extinct species, providing new insight into their evolutionary history. Here we present DNA sequence analysis of the first complete mitochondrial genome (16,338 base pairs from an archaeologically-verified and exceptionally-well preserved aurochs bone sample. METHODOLOGY: DNA extracts were generated from an aurochs humerus bone sample recovered from a cave site located in Derbyshire, England and radiocarbon-dated to 6,738+/-68 calibrated years before present. These extracts were prepared for both Sanger and next generation DNA sequencing technologies (Illumina Genome Analyzer. In total, 289.9 megabases (22.48% of the post-filtered DNA sequences generated using the Illumina Genome Analyzer from this sample mapped with confidence to the bovine genome. A consensus B. primigenius mitochondrial genome sequence was constructed and was analysed alongside all available complete bovine mitochondrial genome sequences. CONCLUSIONS: For all nucleotide positions where both Sanger and Illumina Genome Analyzer sequencing methods gave high-confidence calls, no discrepancies were observed. Sequence analysis reveals evidence of heteroplasmy in this sample and places this mitochondrial genome sequence securely within a previously

  14. Background Oriented Schlieren (BOS) and other Flow Visualization Developments and Applications at GRC

    Science.gov (United States)

    Clem, Michelle; Woike, Mark

    2013-01-01

    This is a presentation to be given at an internal NASA Advanced Schlieren Working Group Meeting. The presentation will cover the recent developments and applications of flow visualization methods at GRC. The topics being discussed will include the use of Background Oriented Schlieren (BOS) in the study of screech and its associated shock spacing as well as in the investigation of broadband shock noise reduction in the Jet-Surface Interaction Tests. In addition, other flow visualiztion methods will be discussed in an on-going study comparing schlieren, shadowgraph, BOS, and focusing schlieren.

  15. BIOACTIVE PEPTIDES OF THE COW MILK WHEY PROTEINS (Bos taurus

    Directory of Open Access Journals (Sweden)

    A. V. Iukalo

    2013-10-01

    Full Text Available Data on the biological functions of milk whey proteins, which are implemented at the level of their proteolytic degradation products — bioactive peptides have been reviewed. The main functions of these proteins is to provide the amino acid nutrition of mammals in the early stages of development, as well as the transport of fatty acids, retinol, involved in the synthesis of lactose, ions of calcium and iron, immune protection, antimicrobial action, etc. However, in recent years, it has been found that milk proteins like casein are precursors of biologically active peptides. Аngiotensin — converting enzyme, opioid peptides which are opiate receptor agonists, anti–microbial peptides, peptides with immunomodulatory and hypocholesterolemic action, and peptides affecting motility have been found among the products of proteolytic degradation of ?-lactoglobulin, ?-laktoalbumin, lactoferrin and milk whey albumin. Also data on the possible participation of peptides from milk whey proteins in the implementation of the biological functions of both the assimilation of calcium, antioxidant effect, the regulation of appetite, anticarcinogenic are provided. The authors assume that the phenomenon of bioactive peptides formation could be considered as an additional function of natural food proteins, which gives advantages to the mammals and has a positive effect on their development in the postnatal period. Ways of bioactive peptides formation, their resistance to action of proteolytic enzymes, the ability to cross into the bloodstream and have biological effects have been also discussed. Up to date, only a few products with bioactive peptides from milk whey proteins are obtained. Further studies of their structure, mechanism of action, ways of formation and methods of isolation are required for their wider use. Formation of functional products based on bioactive peptides from milk whey proteins will allow efficient use of milk whey, which is often a byproduct of the dairy industry.

  16. Ethnoveterinary survey of tradomedical importance of Bos taurus L ...

    African Journals Online (AJOL)

    Purpose: To evaluate the ethnoveterinary uses of cow by-products from Nigeria and South Africa. Methods: A field survey was conducted from January to September, 2015 by conducting interviews with 110 respondents who provided information in respect of the use of cow urine, bile and dung in their folk medicine in ...

  17. Ethnoveterinary survey of tradomedical importance of Bos taurus L ...

    African Journals Online (AJOL)

    wounds, skin diseases, agriculture, bio- pesticides, pest repellents and possibly alternate energy source and ... age range of 45-82 years old. The selection was purely based on their recognition as knowledgeable .... The wound healing of cow urine was reported in Wister albino rats and the outcome of the treatment ...

  18. Assessment of Ruminal Bacterial and Archaeal Community Structure in Yak (Bos grunniens)

    NARCIS (Netherlands)

    Zhou, Zhenming; Fang, Lei; Meng, Qingxiang; Li, Shengli; Chai, Shatuo; Liu, Shujie; Schonewille, Jan Thomas

    2017-01-01

    The aim of this study was to determine the microbial community composition in the rumen of yaks under different feeding regimes. Microbial communities were assessed by sequencing bacterial and archaeal 16S ribosomal RNA gene fragments obtained from yaks (Bos grunniens) from Qinghai-Tibetan Plateau,

  19. Measurement of the fluctuating temperature field in a heated swirling jet with BOS tomography

    Science.gov (United States)

    Lang, Henning M.; Oberleithner, Kilian; Paschereit, C. Oliver; Sieber, Moritz

    2017-07-01

    This work investigates the potential of background-oriented schlieren tomography (3D-BOS) for the temperature field reconstruction in a non-isothermal swirling jet undergoing vortex breakdown. The evaluation includes a quantitative comparison of the mean and phase-averaged temperature field with thermocouple and fast-response resistance thermometer as well as a qualitative comparison between the temperature field and the flow field obtained from particle image velocimetry (PIV). Compared to other temperature-measuring techniques, 3D-BOS enables non-invasive capturing of the entire three-dimensional temperature field. In contrast to previous 3D-BOS applications, the present investigation makes use of the special character of the flow, which provides a global instability that leads to a rotational symmetry of the jet. Additionally, the rotational motion of the jet is used to obtain a tomographic reconstruction from a single camera. The quality of 3D-BOS results with respect to the physical setup as well as the numerical procedure is analyzed and discussed. Furthermore, a new approach for the treatment of thin occluding objects in the field of view is presented.

  20. Genetic origin, admixture and population history of aurochs (Bos primigenius) and primitive European cattle

    NARCIS (Netherlands)

    Upadhyay, M R; Chen, W|info:eu-repo/dai/nl/371747228; Lenstra, J A|info:eu-repo/dai/nl/067852335; Goderie, C R J; MacHugh, D E; Park, S D E; Magee, D A; Matassino, D; Ciani, F; Megens, H-J; van Arendonk, J A M; Groenen, M A M|info:eu-repo/dai/nl/412585650; Marsan, P A; Balteanu, V; Dunner, S; Garcia, J F; Ginja, C; Kantanen, J

    2017-01-01

    The domestication of taurine cattle initiated ~10 000 years ago in the Near East from a wild aurochs (Bos primigenius) population followed by their dispersal through migration of agriculturalists to Europe. Although gene flow from wild aurochs still present at the time of this early dispersion is

  1. Genetic origin, admixture and population history of aurochs (Bos primigenius) and primitive European cattle

    NARCIS (Netherlands)

    Upadhyay, M.R.; Chen, W.; Lenstra, J.A.; Goderie, C.R.J.; MacHugh, D.E.; Park, S.D.E.; Magee, D.A.; Matassino, D.; Ciani, F.; Megens, H.J.; Arendonk, van J.A.M.; Groenen, M.A.M.

    2017-01-01

    The domestication of taurine cattle initiated ~10 000 years ago in the Near East from a wild aurochs (Bos primigenius) population followed by their dispersal through migration of agriculturalists to Europe. Although gene flow from wild aurochs still present at the time of this early dispersion is

  2. Polycyclic aromatic hydrocarbon degradation by the white rot fungus Bjerkandera sp. strain BOS55

    NARCIS (Netherlands)

    Kotterman, M.

    1998-01-01

    Outline of this thesis
    In this thesis the conditions for optimal PAH oxidation by the white rot fungus Bjerkandera sp. strain BOS55 were evaluated. In Chapter 2, culture conditions like aeration and cosubstrate concentrations,

  3. Recent Status of Banteng (Bos javanicus Conservation in East Java and Its Perspectives on Ecotourism Planning

    Directory of Open Access Journals (Sweden)

    Luchman Hakim

    2015-09-01

    Full Text Available The aims of this article are to examine the recent status of Banteng Bos javanicus conservation in East Java, identify the roots of conservation problems and propose the non-consumptive and sustainable uses of Banteng by implementing ecotourism. Recently, Banteng population distributes in Alas Purwo, Meru Betiri, and Baluran National Parks. The population in Alas Purwo and Meru Betiri were relatively stable yearly. Rapid population decrease found in Baluran National Park. The roots of threats may be categorized into two factors, socio-economic and ecological factors. Socio-economic problems lead to the increase of habitat disturbance, poaching, and illegal hunting. Ecological aspect was ranging from invasion of exotic plant species, competitors, predators, drought, forest fire and vegetation changes. Lack of habitat management also recognized as an important factor to drive Bos javanicus decline and extinction. Ecotourism in the national park may become one of the significant and effective stimuli to support Banteng conservation.

  4. Development of Uncertainty Quantification Method for MIR-PIV Measurement using BOS Technique

    International Nuclear Information System (INIS)

    Seong, Jee Hyun; Song, Min Seop; Kim, Eung Soo

    2014-01-01

    Matching Index of Refraction (MIR) is frequently used for obtaining high quality PIV measurement data. ven small distortion by unmatched refraction index of test section can result in uncertainty problems. In this context, it is desirable to construct new concept for checking errors of MIR and following uncertainty of PIV measurement. This paper proposes a couple of experimental concept and relative results. This study developed an MIR uncertainty quantification method for PIV measurement using SBOS technique. From the reference data of the BOS, the reliable SBOS experiment procedure was constructed. Then with the combination of SBOS technique with MIR-PIV technique, velocity vector and refraction displacement vector field was measured simultaneously. MIR errors are calculated through mathematical equation, in which PIV and SBOS data are put. These errors are also verified by another BOS experiment. Finally, with the applying of calculated MIR-PIV uncertainty, correct velocity vector field can be obtained regardless of MIR errors

  5. Genome sequencing of the extinct Eurasian wild aurochs, Bos primigenius, illuminates the phylogeography and evolution of cattle.

    Science.gov (United States)

    Park, Stephen D E; Magee, David A; McGettigan, Paul A; Teasdale, Matthew D; Edwards, Ceiridwen J; Lohan, Amanda J; Murphy, Alison; Braud, Martin; Donoghue, Mark T; Liu, Yuan; Chamberlain, Andrew T; Rue-Albrecht, Kévin; Schroeder, Steven; Spillane, Charles; Tai, Shuaishuai; Bradley, Daniel G; Sonstegard, Tad S; Loftus, Brendan J; MacHugh, David E

    2015-10-26

    Domestication of the now-extinct wild aurochs, Bos primigenius, gave rise to the two major domestic extant cattle taxa, B. taurus and B. indicus. While previous genetic studies have shed some light on the evolutionary relationships between European aurochs and modern cattle, important questions remain unanswered, including the phylogenetic status of aurochs, whether gene flow from aurochs into early domestic populations occurred, and which genomic regions were subject to selection processes during and after domestication. Here, we address these questions using whole-genome sequencing data generated from an approximately 6,750-year-old British aurochs bone and genome sequence data from 81 additional cattle plus genome-wide single nucleotide polymorphism data from a diverse panel of 1,225 modern animals. Phylogenomic analyses place the aurochs as a distinct outgroup to the domestic B. taurus lineage, supporting the predominant Near Eastern origin of European cattle. Conversely, traditional British and Irish breeds share more genetic variants with this aurochs specimen than other European populations, supporting localized gene flow from aurochs into the ancestors of modern British and Irish cattle, perhaps through purposeful restocking by early herders in Britain. Finally, the functions of genes showing evidence for positive selection in B. taurus are enriched for neurobiology, growth, metabolism and immunobiology, suggesting that these biological processes have been important in the domestication of cattle. This work provides important new information regarding the origins and functional evolution of modern cattle, revealing that the interface between early European domestic populations and wild aurochs was significantly more complex than previously thought.

  6. Suplementasi Blok Multinutrisi terhadap Kecernaan Bahan Kering dan Bahan Organik Ransum pada Sapi Bali (Bos sondaicus)

    OpenAIRE

    Nababan, Rimbun H.A.H.

    2011-01-01

    RIMBUN HOT ASI HASOLOAN NABABAN : The Supplementation Nutrition Block in Feed on The Digestibility of Dry Matter and Organic Matter of Bos sondaicus. Under advised by MA’RUF TAFSIN and ROESWANDY. The nutrition supplement is a feed additive which can increase the quality feed of cattle then increase the palatability of feed. The nutrition supplement can manipulate the microorganism in cattle and finally can support the digestibility of cattle. The present experiment was conducted to inv...

  7. A randomised controlled trial of azithromycin therapy in bronchiolitis obliterans syndrome (BOS) post lung transplantation

    Science.gov (United States)

    Corris, Paul A; Ryan, Victoria A; Small, Therese; Lordan, James; Fisher, Andrew J; Meachery, Gerard; Johnson, Gail; Ward, Chris

    2015-01-01

    Background We conducted a placebo-controlled trial of azithromycin therapy in bronchiolitis obliterans syndrome (BOS) post lung transplantation. Methods We compared azithromycin (250 mg alternate days, 12 weeks) with placebo. Primary outcome was FEV1 change at 12 weeks. Results 48 patients were randomised; (25 azithromycin, 23 placebo). It was established, post randomisation that two did not have BOS. 46 patients were analysed as intention to treat (ITT) with 33 ‘Completers’. ITT analysis included placebo patients treated with open-label azithromycin after study withdrawal. Outcome The ITT analysis (n=46, 177 observations) estimated mean difference in FEV1 between treatments (azithromycin minus placebo) was 0.035 L, with a 95% CI of −0.112 L to 0.182 L (p=0.6). Five withdrawals, who were identified at the end of the study as having been randomised to placebo (four with rapid loss in FEV1, one withdrawn consent) had received rescue open-label azithromycin, with improvement in subsequent FEV1 at 12 weeks. Study Completers showed an estimated mean difference in FEV1 between treatment groups (azithromycin minus placebo) of 0.278 L, with 95% CI for the mean difference: 0.170 L to 0.386 L (p=azithromycin group had ≥10% gain in FEV1 from baseline. No patients in the placebo group had ≥10% gain in FEV1 from baseline while on placebo (p=0.002). Seven serious adverse events, three azithromycin, four in the placebo group, were deemed unrelated to study medication. Conclusions Azithromycin therapy improves FEV1 in patients with BOS and appears superior to placebo. This study strengthens evidence for clinical practice of initiating azithromycin therapy in BOS. Trial registration number EU-CTR, 2006-000485-36/GB. PMID:25714615

  8. Effect of ruminally protected Methionine on the productive and reproductive performance of grazing Bos indicus heifers raised in the humid tropics of Costa Rica.

    Science.gov (United States)

    Alonso, L; Maquivar, M; Galina, C S; Mendoza, G D; Guzmán, A; Estrada, S; Villareal, M; Molina, R

    2008-12-01

    With the objective of evaluating the effect of methionine supplementation prior to a breeding program, thirty one heifers (Bos taurus x Bos indicus) were used averaging 386 +/- 29 days of age and a mean body weight of 402.6 +/- 28 kg. Fifteen of the animals received a supplement (SG) during 45 days with molasses-urea mixture (2 kg molasses + 407 g urea/head/day), plus 10 g of ruminally protected methionine. The other sixteen heifers did not receive supplement (CG). Fecal and pastures samples were collected to assess dry herbage intake and digestibility. Serial ultrasound measurements from the ovary were performed in both groups to evaluate follicular dynamics. The heifers were categorized according to their follicular size and presence of a CL. Forage intake and dry matter digestibility were reduced (P heifers, however, total intake, final weight, daily gain and dorsal back fat were not affected. After the supplementation period, the percentage of females in the categories or = 9 mm, the percentage of animals was 60% in SG and 18.8% in CG (P < 0.05). The percentage of ovulation for the SG and CG was 86.7% and 62.5%, respectively (P < 0.05). The combination of supplementation with methionine-urea and molasses at the end of the dry season and the anticipated onset of the rainy season favored the establishment of ovarian activity and follicular dynamics.

  9. Dosimetric evaluation of using in-house BoS Frame Fixation Tool for the Head and Neck Cancer Patient

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Kwang Suk; Jo, Kwang Hyun; Choi, Byeon Ki [Dept. of Radiation Oncology, Samsung Seoul Hospital, Seoul (Korea, Republic of)

    2016-06-15

    BoS(Base of Skull) Frame, the fixation tool which is used for the proton of brain cancer increases the lateral penumbra by increasing the airgap (the distance between patient and beam jet), due to the collision of the beam of the posterior oblique direction. Thus, we manufactured the fixation tool per se for improving the limits of BoS frame, and we'd like to evaluate the utility of the manufactured fixation tool throughout this study. We've selected the 3 patients of brain cancer who have received the proton therapy from our hospital, and also selected the 6 beam angles; for this, we've selected the beam angle of the posterior oblique direction. We've measured the planned BoS frame and the distance of Snout for each beam which are planned for the treatment of the patient using the BoS frame. After this, we've proceeded with the set-up that is above the location which was recommended by the manufacturer of the BoS frame, at the same beam angle of the same patient, by using our in-house Bos frame fixation tool. The set-up was above 21 cm toward the superior direction, compared to the situation when the BoS frame was only used with the basic couch. After that, we've stacked the snout to the BoS frame as much as possible, and measured the distance of snout. We've also measured the airgap, based on the gap of that snout distance; and we've proceeded the normalization based on each dose (100% of each dose), after that, we've conducted the comparative analysis of lateral penumbra. Moreover, we've established the treatment plan according to the changed airgap which has been transformed to the Raystation 5.0 proton therapy planning system, and we've conducted the comparative analysis of DVH(Dose Volume Histogram). When comparing the result before using the in-house Bos frame fixation tool which was manufactured for each beam angle with the result after using the fixation tool, we could figure out that airgap than when

  10. Dosimetric evaluation of using in-house BoS Frame Fixation Tool for the Head and Neck Cancer Patient

    International Nuclear Information System (INIS)

    Kim, Kwang Suk; Jo, Kwang Hyun; Choi, Byeon Ki

    2016-01-01

    BoS(Base of Skull) Frame, the fixation tool which is used for the proton of brain cancer increases the lateral penumbra by increasing the airgap (the distance between patient and beam jet), due to the collision of the beam of the posterior oblique direction. Thus, we manufactured the fixation tool per se for improving the limits of BoS frame, and we'd like to evaluate the utility of the manufactured fixation tool throughout this study. We've selected the 3 patients of brain cancer who have received the proton therapy from our hospital, and also selected the 6 beam angles; for this, we've selected the beam angle of the posterior oblique direction. We've measured the planned BoS frame and the distance of Snout for each beam which are planned for the treatment of the patient using the BoS frame. After this, we've proceeded with the set-up that is above the location which was recommended by the manufacturer of the BoS frame, at the same beam angle of the same patient, by using our in-house Bos frame fixation tool. The set-up was above 21 cm toward the superior direction, compared to the situation when the BoS frame was only used with the basic couch. After that, we've stacked the snout to the BoS frame as much as possible, and measured the distance of snout. We've also measured the airgap, based on the gap of that snout distance; and we've proceeded the normalization based on each dose (100% of each dose), after that, we've conducted the comparative analysis of lateral penumbra. Moreover, we've established the treatment plan according to the changed airgap which has been transformed to the Raystation 5.0 proton therapy planning system, and we've conducted the comparative analysis of DVH(Dose Volume Histogram). When comparing the result before using the in-house Bos frame fixation tool which was manufactured for each beam angle with the result after using the fixation tool, we could figure out that airgap than when

  11. Detection of Theileria annulata carriers in Holstein–Friesian (Bos taurus taurus) and Sistani (Bos taurus indicus) cattle breeds by polymerase chain reaction in Sistan region, Iran

    OpenAIRE

    Majidiani, Hamidreza; Nabavi, Reza; Ganjali, Maryam; Saadati, Dariush

    2015-01-01

    Theileria annulata is common in tropical and subtropical regions especially in Iran and causes great economic losses in cattle industry. In Iran the epidemiological aspects of bovine theileriosis in different breeds of cattle is poorly understood. The aim of present study is comparison of the number of T. annulata carriers in the two major cattle breeds (Holstein–Friesian and Sistani) in Sistan of Iran by giemsa and polymerase chain reaction (PCR) methods. During winter 2013, 160 native cattl...

  12. The BOS-X approach: achieving drastic cost reduction in CPV through holistic power plant level innovation

    Science.gov (United States)

    Plesniak, A.; Garboushian, V.

    2012-10-01

    In 2011, the Amonix Advanced Technology Group was awarded DOE SunShot funding in the amount of 4.5M to design a new Balance of System (BOS) architecture utilizing Amonix MegaModules™ focused on reaching the SunShot goal of 0.06-$0.08/kWhr LCOE. The project proposal presented a comprehensive re-evaluation of the cost components of a utility scale CPV plant and identified critical areas of focus where innovation is needed to achieve cost reduction. As the world's premier manufacturer and most experienced installer of CPV power plants, Amonix is uniquely qualified to lead a rethinking of BOS architecture for CPV. The presentation will focus on the structure of the BOS-X approach, which looks for the next wave of cost reduction in CPV through evaluation of non-module subsystems and the interaction between subsystems during the lifecycle of a solar power plant. Innovation around nonmodule components is minimal to date because CPV companies are just now getting enough practice through completion of large projects to create ideas and tests on how to improve baseline designs and processes. As CPV companies increase their installed capacity, they can utilize an approach similar to the methodology of BOS-X to increase the competitiveness of their product. Through partnership with DOE, this holistic approach is expected to define a path for CPV well aligned with the goals of the SunShot Initiative.

  13. Internationale gevolgen van geïntegreerd bosbeheer in Nederland; verwaarloost Nederland de rol van bos als natuurlijke hulpbron?

    NARCIS (Netherlands)

    Nabuurs, G.J.; Schelhaas, M.J.; Goede, de D.

    2001-01-01

    De lange-termijneffecten van een meer natuurlijk bosbeheer in Europa wat betreft de leeftijdsklassenverdeling van het Europese bos en de verwachte veranderingen in de import- en exportstromen van naald- en loofhout binnen Europa (Scandinavië, Oost-Europa, Centraal-Europa, Middellandse-Zeegebied).

  14. Comparison of methanogen diversity of yak (Bos grunniens and cattle (Bos taurus from the Qinghai-Tibetan plateau, China

    Directory of Open Access Journals (Sweden)

    Huang Xiao

    2012-10-01

    Full Text Available Abstract Background Methane emissions by methanogen from livestock ruminants have significantly contributed to the agricultural greenhouse gas effect. It is worthwhile to compare methanogen from “energy-saving” animal (yak and normal animal (cattle in order to investigate the link between methanogen structure and low methane production. Results Diversity of methanogens from the yak and cattle rumen was investigated by analysis of 16S rRNA gene sequences from rumen digesta samples from four yaks (209 clones and four cattle (205 clones from the Qinghai-Tibetan Plateau area (QTP. Overall, a total of 414 clones (i.e. sequences were examined and assigned to 95 operational taxonomic units (OTUs using MOTHUR, based upon a 98% species-level identity criterion. Forty-six OTUs were unique to the yak clone library and 34 OTUs were unique to the cattle clone library, while 15 OTUs were found in both libraries. Of the 95 OTUs, 93 putative new species were identified. Sequences belonging to the Thermoplasmatales-affiliated Linage C (TALC were found to dominate in both libraries, accounting for 80.9% and 62.9% of the sequences from the yak and cattle clone libraries, respectively. Sequences belonging to the Methanobacteriales represented the second largest clade in both libraries. However, Methanobrevibacter wolinii (QTPC 110 was only found in the cattle library. The number of clones from the order Methanomicrobiales was greater in cattle than in the yak clone library. Although the Shannon index value indicated similar diversity between the two libraries, the Libshuff analysis indicated that the methanogen community structure of the yak was significantly different than those from cattle. Conclusion This study revealed for the first time the molecular diversity of methanogen community in yaks and cattle in Qinghai-Tibetan Plateau area in China. From the analysis, we conclude that yaks have a unique rumen microbial ecosystem that is significantly different from that of cattle, this may also help to explain why yak produce less methane than cattle.

  15. Molecular characterization of Cryptosporidium spp. in calves (Bos taurus and Bos indicus in the Formiga city, Minas Gerais - Brazil

    Directory of Open Access Journals (Sweden)

    Roberto César Araujo Lima

    2014-02-01

    Full Text Available Cryptosporidiosis is a waterborne disease, has as aggravating the difficulty of preventing environmental contamination and lack of effective therapeutic measures. With marked importance to the cattle, causes inflammation and intestinal villous atrophy resulting in loss of absorptive surface. This study aimed to perform molecular characterization of Cryptosporidium spp. in calves in the city of Formiga, Minas Gerais. A total of 300 faeces samples from Holstein calves, Nelore and indefinite breed, both healthy, were evaluated by negative contrast staining technique of malachite green and through the reaction of nested PCR for amplification of DNA fragments of the 18S subunit of the RNA gene ribosomal. Occurrence of 5.33 % ( 16/300 for malachite green and 4.66 % ( 14/300 by PCR was observed, whereas no correlation was found between positive and variables studied. Through molecular characterization were identified Cryptosporidium andersoni and Cryptosporidium ryanae species. In conclusion, we observed a low incidence of infection and elimination of Cryptosporidium spp. oocysts, the absence of clinical signs in animals, strong agreement between the results obtained by the two techniques. Beyond, with the molecular characterization ( nested PCR , species of C. andersoni and C. ryanae were diagnosed in age groups not present in the literature. These two species of Cryptosporidium are described above for the first time parasitizing cattle in the state of Minas Gerais.

  16. Comparison of methanogen diversity of yak (Bos grunniens) and cattle (Bos taurus) from the Qinghai-Tibetan plateau, China

    Science.gov (United States)

    2012-01-01

    Background Methane emissions by methanogen from livestock ruminants have significantly contributed to the agricultural greenhouse gas effect. It is worthwhile to compare methanogen from “energy-saving” animal (yak) and normal animal (cattle) in order to investigate the link between methanogen structure and low methane production. Results Diversity of methanogens from the yak and cattle rumen was investigated by analysis of 16S rRNA gene sequences from rumen digesta samples from four yaks (209 clones) and four cattle (205 clones) from the Qinghai-Tibetan Plateau area (QTP). Overall, a total of 414 clones (i.e. sequences) were examined and assigned to 95 operational taxonomic units (OTUs) using MOTHUR, based upon a 98% species-level identity criterion. Forty-six OTUs were unique to the yak clone library and 34 OTUs were unique to the cattle clone library, while 15 OTUs were found in both libraries. Of the 95 OTUs, 93 putative new species were identified. Sequences belonging to the Thermoplasmatales-affiliated Linage C (TALC) were found to dominate in both libraries, accounting for 80.9% and 62.9% of the sequences from the yak and cattle clone libraries, respectively. Sequences belonging to the Methanobacteriales represented the second largest clade in both libraries. However, Methanobrevibacter wolinii (QTPC 110) was only found in the cattle library. The number of clones from the order Methanomicrobiales was greater in cattle than in the yak clone library. Although the Shannon index value indicated similar diversity between the two libraries, the Libshuff analysis indicated that the methanogen community structure of the yak was significantly different than those from cattle. Conclusion This study revealed for the first time the molecular diversity of methanogen community in yaks and cattle in Qinghai-Tibetan Plateau area in China. From the analysis, we conclude that yaks have a unique rumen microbial ecosystem that is significantly different from that of cattle, this may also help to explain why yak produce less methane than cattle. PMID:23078429

  17. PÉRDIDA DE PESO EN BOVINOS Bos indicus Y Bos taurus DURANTE EL PROCESO DE SUBASTA

    Directory of Open Access Journals (Sweden)

    Pablo Rodr\\u00EDguez-Rodr\\u00EDguez

    2012-01-01

    Full Text Available El objetivo del presente trabajo fue determinar la pérdida de peso de bovinos en subasta. Se evaluó además el porcentaje de merma correspondiente al peso del animal según su sexo, el patrón racial, la categoría comercial, el peso vivo de entrada a las instalaciones de la subasta y el tiempo de espera de cada animal desde el ingreso hasta el momento de su remate. Se analizaron un total de 629 animales en la subasta Asociación Cámara de Ganaderos Unidos del Sur, ubicada en Pérez Zeledón, San José, Costa Rica, entre agosto y noviembre del 2011. El sexo del animal y el patrón racial no tuvieron efecto significativo sobre los kilogramos de peso perdidos. Mientras que, según la categoría comercial, el periodo de espera y el peso de ingreso (p<0,05, se pueden perder entre 4,31 y 9,91; entre 6,16 y 7,31; y entre 3,52 y 9,54 kilos por animal, respectivamente. Para el porcentaje de merma, las variables patrón racial, categoría comercial y el periodo de espera presentaron efectos significativos, no así el sexo y el peso de ingreso. El porcentaje de merma fluctuó entre 1,57 a 2,54%.

  18. Different true-protein sources do not modify the metabolism of crossbred Bos taurus × Bos indicus growing heifers

    Directory of Open Access Journals (Sweden)

    Diego Azevedo Mota

    2015-02-01

    Full Text Available The present study was conducted to investigate the effect of alternative true-protein sources to soybean meal, with different ruminal degradability, using a sugarcane-based diet, on nutrient digestion, ruminal fermentation, efficiency of microbial protein synthesis and passage rate in prepubertal dairy heifers. Eight crossbred rumen- and duodenum-cannulated Holstein × Gyr dairy heifers (202.0±11.5 kg BW were evaluated in a 4 × 4 Latin square experimental design with four treatments and four periods in two simultaneous replicates. Dietary treatments were: soybean meal; cottonseed meal; peanut meal; and sunflower meal. When associated with diets containing sugarcane, the different protein sources did not affect intake or digestibility of dry mater, crude protein, organic matter and neutral detergent fiber. The average ruminal pH, NH3-N and concentration of total volatile fatty acids were not different among the diets supplied. The concentration of butyric acid was different among the protein sources, wherein the animals fed the diet with sunflower meal presented lower values than those fed the other sources. Diets did not affect nitrogen balance, microbial nitrogen, microbial synthesisefficiency, estimated dry matter flow, or passage rate. Alternative protein sources can be used to reduce the costs without changing the animal metabolism.

  19. Bos grunniens

    African Journals Online (AJOL)

    STORAGESEVER

    2009-03-06

    Mar 6, 2009 ... genera viz indicine (Dubey, 2008) and taurine (Liefers et al., 2003; Konfortnov et al., 2006; Friedman and Halaas,. 1998) in exon 2 were found to be fixed with T allele. The observed allele fixation might be due high altitude adaptation or bulky body selection by nature for its survival, but this needs more ...

  20. Iberian Odonata distribution: data of the BOS Arthropod Collection (University of Oviedo, Spain).

    Science.gov (United States)

    Torralba-Burrial, Antonio; Ocharan, Francisco J

    2013-01-01

    Odonata are represented from the Iberian Peninsula by 79 species. However, there exists a significant gap in accessible knowledge about these species,especially regarding their distribution. This data paper describes the specimen-based Odonata data of the Arthropod Collection of the Department of Biología de Organismos y Sistemas (BOS), University of Oviedo, Spain. The specimens were mainly collected from the Iberian Peninsula (98.63% of the data records), especially the northern region. The earliest specimen deposited in the collection dates back to 1950, while the 1980's and 2000's are the best-represented time periods. Between 1950 and 2009, 16, 604 Odonata specimens were deposited and are documented in the dataset. Approximately 20% of the specimens belong to the families Coenagrionidae and Calopterygidae. Specimens include the holotype and paratypes of the Iberian subspecies Calopteryx haemorrhoidalis asturica Ocharan, 1983 and Sympetrum vulgatum ibericum Ocharan, 1985. The complete dataset is also provided in Darwin Core Archive format.

  1. Aktivitas Manusia dan Distribusi Banteng (Bos Javanicus D’alton 1832 di Taman Nasional Alas Purwo

    Directory of Open Access Journals (Sweden)

    Muhammad Ali Imron

    2013-01-01

    Full Text Available Human Activities and Distribution of Banteng (Bos Javanicus D’alton 1832 in Alas Purwo National Park This study aims to comprehend whether human activities contribute to the presence of banteng (Bos sundaicus d’Alton 1836 in the Alas Purwo National Park (APNP. We laid continuous strip line transects from centre of human activities to the direction of core area of APNP. Three locations were selected: Sadengan grazing area, Giri Salaka Hinduism praying area, and Kutorejo village; representing low to high human disturbance respectively. We collected both direct and indirect presence of banteng as well as human activities within 20 metre strip lines with 10 metre width. Data were compiled each 100 metres and analyzed with means comparison to observe difference among locations. Correlation analyses were used to assess the relation between distance from centre of human activities, human activities and banteng presence. Regression analysis was used when  significant correlations found. Our non parametric test showed that human disturbances are significantly different among sites (Kruskal Wallis Test; df 2 = 6.220, p< 0.05. In similar tendency but different manner, it is showed that the different levels of human disturbance conveyed significant difference in number of banteng’s tracks (Kruskal Wallis Test; df 2 = 18.888, p< 0.05. The distance from centre of human activities is negatively related to number of human tracks (Spearman rho; r2= -0.307 N= 64, p<0.05* and also to number of banteng’s tracks (Spearman rho, r2= -0.728 N= 30, p<0.05**. The regression analysis showed that number of human tracks explained 18.6% of total variation on number of Banteng’s tracks, while distance from centre of human activities explained 59%.

  2. Hvordan påvirker indvandrernes integration, ressourcer og diaspora deres bosætningspræferencer?

    DEFF Research Database (Denmark)

    Andersen, Hans Skifter

    Etniske minoriteters boligønsker må i vid udstrækning antages, at have de samme årsager, som generelt er fundet i forbindelse med studier af boligvalg i Danmark og andre europæiske lande. Men indvandreres bosætning i Danmark og andre lande afviger så meget fra den indfødte befolknings, at den ikk...

  3. Cloning of an endangered species (Bos gaurus) using interspecies nuclear transfer.

    Science.gov (United States)

    Lanza, R P; Cibelli, J B; Diaz, F; Moraes, C T; Farin, P W; Farin, C E; Hammer, C J; West, M D; Damiani, P

    2000-01-01

    Approximately 100 species become extinct a day. Despite increasing interest in using cloning to rescue endangered species, successful interspecies nuclear transfer has not been previously described, and only a few reports of in vitro embryo formation exist. Here we show that interspecies nuclear transfer can be used to clone an endangered species with normal karyotypic and phenotypic development through implantation and the late stages of fetal growth. Somatic cells from a gaur bull (Bos gaurus), a large wild ox on the verge of extinction, (Species Survival Plan animals) were electrofused with enucleated oocytes from domestic cows. Twelve percent of the reconstructed oocytes developed to the blastocyst stage, and 18% of these embryos developed to the fetal stage when transferred to surrogate mothers. Three of the fetuses were electively removed at days 46 to 54 of gestation, and two continued gestation longer than 180 (ongoing) and 200 days, respectively. Microsatellite marker and cytogenetic analyses confirmed that the nuclear genome of the cloned animals was gaurus in origin. The gaur nuclei were shown to direct normal fetal development, with differentiation into complex tissue and organs, even though the mitochondrial DNA (mtDNA) within all the tissue types evaluated was derived exclusively from the recipient bovine oocytes. These results suggest that somatic cell cloning methods could be used to restore endangered, or even extinct, species and populations.

  4. DGAT1 and ABCG2 polymorphism in Indian cattle (Bos indicus and buffalo (Bubalus bubalis breeds

    Directory of Open Access Journals (Sweden)

    Mishra Bina

    2006-11-01

    Full Text Available Abstract Background Indian cattle (Bos indicus and riverine buffalo (Bubalus bubalis give a poor yield of milk but it has a high fat and protein percentage compared to taurine cattle. The identification of QTLs (Quantitative Trait Loci on BTA14 and BTA6 and its subsequent fine mapping has led to identification of two non conservative mutations affecting milk production and composition. Our objective was to estimate the frequency of K232A (DGAT1 – diacylglycerol – acyltransferase 1 and Y581S (ABCG2 – ATP binding cassette sub family G member 2 polymorphisms in diverse cattle and buffalo breeds of India having large variation in terms of milk production. Results We screened the reported missense mutations in six cattle and five buffalo breeds. The DGAT1K and ABCG2Y alleles were found to be fixed in Indian cattle and buffalo breeds studied. Conclusion This study provides an indirect evidence that all the Indian cattle and buffalo breeds have fixed alleles with respect to DGAT1 and ABCG2 genes reported to be responsible for higher milk fat yield, higher fat and protein percent.

  5. Harvestmen of the BOS Arthropod Collection of the University of Oviedo (Spain) (Arachnida, Opiliones)

    Science.gov (United States)

    Merino-Sáinz, Izaskun; Anadón, Araceli; Torralba-Burrial, Antonio

    2013-01-01

    Abstract There are significant gaps in accessible knowledge about the distribution and phenology of Iberian harvestmen (Arachnida: Opiliones). Harvestmen accessible datasets in Iberian Peninsula are unknown, an only two other datasets available in GBIF are composed exclusively of harvestmen records. Moreover, only a few harvestmen data from Iberian Peninsula are available in GBIF network (or in any network that allows public retrieval or use these data). This paper describes the data associated with the Opiliones kept in the BOS Arthropod Collection of the University of Oviedo, Spain (hosted in the Department of Biología de Organismos y Sistemas), filling some of those gaps. The specimens were mainly collected from the northern third of the Iberian Peninsula. The earliest specimen deposited in the collection, dating back to the early 20th century, belongs to the P. Franganillo Collection. The dataset documents the collection of 16,455 specimens, preserved in 3,772 vials. Approximately 38% of the specimens belong to the family Sclerosomatidae, and 26% to Phalangidae; six other families with fewer specimens are also included. Data quality control was incorporated at several steps of digitisation process to facilitate reuse and improve accuracy. The complete dataset is also provided in Darwin Core Archive format, allowing public retrieval, use and combination with other biological, biodiversity of geographical variables datasets. PMID:24146596

  6. Quantitative proteomic analysis of whey proteins in the colostrum and mature milk of yak (Bos grunniens).

    Science.gov (United States)

    Yang, Yongxin; Zhao, Xiaowei; Yu, Shumin; Cao, Suizhong

    2015-02-01

    Yak (Bos grunniens) is an important natural resource in mountainous regions. To date, few studies have addressed the differences in the protein profiles of yak colostrum and milk. We used quantitative proteomics to compare the protein profiles of whey from yak colostrum and milk. Milk samples were collected from 21 yaks after calving (1 and 28 d). Whey protein profiles were generated through isobaric tag for relative and absolute quantification (iTRAQ)-labelled proteomics. We identified 183 proteins in milk whey; of these, the expression levels of 86 proteins differed significantly between the whey from colostrum and milk. Haemoglobin expression showed the greatest change; its levels were significantly higher in the whey from colostrum than in mature milk whey. Functional analysis revealed that many of the differentially expressed proteins were associated with biological regulation and response to stimuli. Further, eight differentially expressed proteins involved in the complement and coagulation cascade pathway were enriched in milk whey. These findings add to the general understanding of the protein composition of yak milk, suggest potential functions of the differentially expressed proteins, and provide novel information on the role of colostral components in calf survival. © 2014 Society of Chemical Industry.

  7. Iberian Odonata distribution: data of the BOS Arthropod Collection (University of Oviedo, Spain

    Directory of Open Access Journals (Sweden)

    Antonio Torralba-Burrial

    2013-06-01

    Full Text Available Odonata are represented from the Iberian Peninsula by 79 species. However, there exists a significant gap in accessible knowledge about these species, especially regarding their distribution. This data paper describes the specimen-based Odonata data of the Arthropod Collection of the Department of Biología de Organismos y Sistemas (BOS, University of Oviedo, Spain. The specimens were mainly collected from the Iberian Peninsula (98.63% of the data records, especially the northern region. The earliest specimen deposited in the collection dates back to 1950, while the 1980’s and 2000’s are the best-represented time periods. Between 1950 and 2009, 16,604 Odonata specimens were deposited and are documented in the dataset. Approximately 20% of the specimens belong to the families Coenagrionidae and Calopterygidae. Specimens include the holotype and paratypes of the Iberian subspecies Calopteryx haemorrhoidalis asturica Ocharan, 1983 and Sympetrum vulgatum ibericum Ocharan, 1985. The complete dataset is also provided in Darwin Core Archive format.

  8. Evaluation of foot and mouth vaccination for yak (Bos grunniens) in Pakistan.

    Science.gov (United States)

    Mortenson, J A; Khan, E H Haq; Ali, I; Manzoor, S; Jamil, A; Abubakar, M; Afzal, M; Hussain, M

    2017-04-01

    In northern Pakistan, many farming communities rely on domestic yak (Bos grunniens) as a principle source of income. A 2006 participatory disease surveillance report from this region indicated that foot-and-mouth disease (FMD) is the most prevalent annual disease of yak. Our objectives of this study were to determine exposure levels of yak to FMD virus; implement a vaccination program based on current, regional FMD virus serotypes and subtypes; and quantify immune responses following vaccination. Blood samples were used to determine pre-vaccination exposure of animals to FMD virus by antibody presence to non-structural proteins of FMD virus using a 3-ABC trapping indirect ELISA. Vaccine used consisted of FMD serotypes 'O' (PanAsia-2), 'A' (Iran-05), and 'Asia-1' (Shamir), but changed later during the study to match newly circulating viruses in the country ('O'-PanAsia-2; 'A'-Turk-06 and Asia-1-Sindh-08). Three hundred sixty-three blood samples were tested from selected villages to determine pre-vaccination FMD virus exposure in yak with an average of 37.7%. Immune responses from initial vaccination and booster dose 30 days later showed clear protective levels (as mean percent inhibition) of antibodies against structural proteins of serotypes 'O,' 'A,' and 'Asia-1.' These responses remained above threshold positive level even at day 210 following initial vaccination. Results of sero-surveillance and anecdotal information of repeated FMD outbreaks demonstrate the persistence of FMD virus of yak in northern Pakistan. Laboratory results and field observations clearly indicated that yak can be protected against FMD with a good quality vaccine with FMD serotype(s) matching current, regionally circulating FMD virus.

  9. Objective measures for the assessment of post-operative pain in bos indicus bull calves following castration

    DEFF Research Database (Denmark)

    Musk, Gabrielle C.; Jacobsen, Stine; Hyndman, Timothy H.

    2017-01-01

    The aim of the study was to assess pain in Bos indicus bull calves following surgical castration. Forty-two animals were randomised to four groups: no castration (NC, n = 6); castration with pre-operative lidocaine (CL, n = 12); castration with pre-operative meloxicam (CM, n = 12); and, castration...... in the concentrations of SAA, haptoglobin, and fibrinogen in all of the groups from day 0 to 3. Iron concentrations were not different at the time points it was measured. The results of this study suggest that animals rest for longer periods after the pre-operative administration of meloxicam. The other objective...

  10. Analysis of the Plant bos1 Mutant Highlights Necrosis as an Efficient Defence Mechanism during D. dadantii/Arabidospis thaliana Interaction

    Science.gov (United States)

    Patrit, Oriane; Simond-Côte, Elizabeth; Hermand, Victor; Van Gijsegem, Frédérique

    2011-01-01

    Dickeya dadantii is a broad host range phytopathogenic bacterium provoking soft rot disease on many plants including Arabidopsis. We showed that, after D. dadantii infection, the expression of the Arabidopsis BOS1 gene was specifically induced by the production of the bacterial PelB/C pectinases able to degrade pectin. This prompted us to analyze the interaction between the bos1 mutant and D. dadantii. The phenotype of the infected bos1 mutant is complex. Indeed, maceration symptoms occurred more rapidly in the bos1 mutant than in the wild type parent but at a later stage of infection, a necrosis developed around the inoculation site that provoked a halt in the progression of the maceration. This necrosis became systemic and spread throughout the whole plant, a phenotype reminiscent of that observed in some lesion mimic mutants. In accordance with the progression of maceration symptoms, bacterial population began to grow more rapidly in the bos1 mutant than in the wild type plant but, when necrosis appeared in the bos1 mutant, a reduction in bacterial population was observed. From the plant side, this complex interaction between D. dadantii and its host includes an early plant defence response that comprises reactive oxygen species (ROS) production accompanied by the reinforcement of the plant cell wall by protein cross-linking. At later timepoints, another plant defence is raised by the death of the plant cells surrounding the inoculation site. This plant cell death appears to constitute an efficient defence mechanism induced by D. dadantii during Arabidopsis infection. PMID:21533045

  11. Analysis of the plant bos1 mutant highlights necrosis as an efficient defence mechanism during D. dadantii/Arabidospis thaliana interaction.

    Directory of Open Access Journals (Sweden)

    Yvan Kraepiel

    Full Text Available Dickeya dadantii is a broad host range phytopathogenic bacterium provoking soft rot disease on many plants including Arabidopsis. We showed that, after D. dadantii infection, the expression of the Arabidopsis BOS1 gene was specifically induced by the production of the bacterial PelB/C pectinases able to degrade pectin. This prompted us to analyze the interaction between the bos1 mutant and D. dadantii. The phenotype of the infected bos1 mutant is complex. Indeed, maceration symptoms occurred more rapidly in the bos1 mutant than in the wild type parent but at a later stage of infection, a necrosis developed around the inoculation site that provoked a halt in the progression of the maceration. This necrosis became systemic and spread throughout the whole plant, a phenotype reminiscent of that observed in some lesion mimic mutants. In accordance with the progression of maceration symptoms, bacterial population began to grow more rapidly in the bos1 mutant than in the wild type plant but, when necrosis appeared in the bos1 mutant, a reduction in bacterial population was observed. From the plant side, this complex interaction between D. dadantii and its host includes an early plant defence response that comprises reactive oxygen species (ROS production accompanied by the reinforcement of the plant cell wall by protein cross-linking. At later timepoints, another plant defence is raised by the death of the plant cells surrounding the inoculation site. This plant cell death appears to constitute an efficient defence mechanism induced by D. dadantii during Arabidopsis infection.

  12. relationship of thyroid and adrenal function to growth rate in bos ...

    African Journals Online (AJOL)

    ductivity of Bas taurus breeds is higher than that of. Bas indicus breeds. However, feed intake and growth rate of Bas taurus breeds decreases rapidly as temperature in- creases (Fuller, 1969). Differences in heat tolerance and thermal stability between breeds have been attributed to differences in anatomy, in metabolic ...

  13. Bekalking en toevoegen van nutriënten; evaluatie van de effecten op de vitaliteit van het bos; een veldonderzoek naar boomgroei

    NARCIS (Netherlands)

    Wolf, R.J.A.M.; Engels, M.E.; Knotters, M.; Schraven, R.; Boertjes, M.

    2006-01-01

    Dit rapport doet verslag van een deelonderzoek uit de Evaluatie van effectgerichte maatregelen in multifunctionele bossen 2004-2005 en is gericht op de effecten van de maatregelen bemes-ting en bekalking in bossen als overbruggingsmaatregel in het kader van het Overlevingsplan Bos en Natuur (OBN).

  14. Verantwoordelijkheden bij risico- en crisisbeheersing van bos- en natuurbranden : taken en bevoegdheden bij risicoberheersing, bestrijding, nazorg en herstel en een overzicht van de hiaten in regelgeving en taakverdeling

    NARCIS (Netherlands)

    Raffe, van J.K.

    2011-01-01

    In 2007/2008 is gekeken welke partijen een rol spelen bij de risico- en crisisbeheersing van (grote) bos- en natuurbranden, wat hun rol precies is en welke taken en bevoegdheden ze hebben. Ook is geïnventariseerd welke hiaten er zijn in de bestaande taakverdeling en regelgeving. Hiaten die de

  15. Effect of Ractopamine Hydrochloride and Zilpaterol Hydrochloride on tenderness of longissimus steaks of Bos Taurus steers

    Science.gov (United States)

    Objectives: Three experiments were conducted to determine 1) the interaction of ractopamine hydrochloride (RH) inclusion rate (0 or 300 mg·hd-1·d-1 for last 30 to 34 d before harvest) and dietary protein level (13.5 or 17.5% CP) on LM slice shear force (SSF) at 14 d postmortem (Exp. 1); 2) the inter...

  16. Tick loads in Bos taurus cattle grazing in two contrasting production systems

    Directory of Open Access Journals (Sweden)

    Raquel Salazar B

    2016-05-01

    Full Text Available Objectives. To relate the effect of biotic and abiotic factors on Rhipicephalus (Boophilus microplus tick loads on cows grazing either in intensive silvopastoral systems (ISS (Lucerna or in grass pastures associated with sugarcane plantations (La Isabela. Materials and methods. Tick counts were performed on 27 Lucerne breed animals that were in different physiological states, six of which were grazing on forage grass paddocks associated with commercial sugarcane plantations and the remaining animals grazed in an ISS based on Leucaena leucocephala and Cynodon plectostachyus. The tick counts were made every 15 days. The data of temperature, humidity, and radiation were taken from a weather station that was inside the ISS. Results. There was a weak relationship between saturation deficit and tick load (R2=0.34 and another between UV radiation and tick load (R2=0.205 for animals grazing in ISS. There were differences in tick counts when comparing animals of similar productivity from both systems evaluated: in La Isabela (sugarcane grass paddocks average counts were 311 ticks perceptible to the touch (TPT and in Lucerna (ISS farm average counts were 206 TPT (p= 0.02. Additionally, there were greater tick counts in high productivity cows compared to low productivity cows. Conclusions. The abiotic and biotic factors of the ecosystem and animal productivity can affect the TPT counts. In ISS systems, tick counts can be lower than those observed in monoculture grazing systems.

  17. Origin and spread of Bos taurus: new clues from mitochondrial genomes belonging to haplogroup T1.

    Directory of Open Access Journals (Sweden)

    Silvia Bonfiglio

    Full Text Available BACKGROUND: Most genetic studies on modern cattle have established a common origin for all taurine breeds in the Near East, during the Neolithic transition about 10 thousand years (ka ago. Yet, the possibility of independent and/or secondary domestication events is still debated and is fostered by the finding of rare mitochondrial DNA (mtDNA haplogroups like P, Q and R. Haplogroup T1, because of its geographic distribution, has been the subject of several investigations pointing to a possible independent domestication event in Africa and suggesting a genetic contribution of African cattle to the formation of Iberian and Creole cattle. Whole mitochondrial genome sequence analysis, with its proven effectiveness in improving the resolution of phylogeographic studies, is the most appropriate tool to investigate the origin and structure of haplogroup T1. METHODOLOGY: A survey of >2200 bovine mtDNA control regions representing 28 breeds (15 European, 10 African, 3 American identified 281 subjects belonging to haplogroup T1. Fifty-four were selected for whole mtDNA genome sequencing, and combined with ten T1 complete sequences from previous studies into the most detailed T1 phylogenetic tree available to date. CONCLUSIONS: Phylogenetic analysis of the 64 T1 mitochondrial complete genomes revealed six distinct sub-haplogroups (T1a-T1f. Our data support the overall scenario of a Near Eastern origin of the T1 sub-haplogroups from as much as eight founding T1 haplotypes. However, the possibility that one sub-haplogroup (T1d arose in North Africa, in domesticated stocks, shortly after their arrival from the Near East, can not be ruled out. Finally, the previously identified "African-derived American" (AA haplotype turned out to be a sub-clade of T1c (T1c1a1. This haplotype was found here for the first time in Africa (Egypt, indicating that it probably originated in North Africa, reached the Iberian Peninsula and sailed to America, with the first European settlers.

  18. A fine structure genetic analysis evaluating ecoregional adaptability of a Bos taurus breed (Hereford.

    Directory of Open Access Journals (Sweden)

    H D Blackburn

    Full Text Available Ecoregional differences contribute to genetic environmental interactions and impact animal performance. These differences may become more important under climate change scenarios. Utilizing genetic diversity within a species to address such problems has not been fully explored. In this study Hereford cattle were genotyped with 50K Bead Chip or 770K Bovine Bead Chip to test the existence of genetic structure in five U.S. ecoregions characterized by precipitation, temperature and humidity and designated: cool arid (CA, cool humid (CH, transition zone (TZ, warm arid (WA, and warm humid (WH. SNP data were analyzed in three sequential analyses. Broad genetic structure was evaluated with STRUCTURE, and ADMIXTURE software using 14,312 SNPs after passing quality control variables. The second analysis was performed using principal coordinate analysis with 66 Tag SNPs associated in the literature with various aspects of environmental stressors (e.g., heat tolerance or production (e.g., milk production. In the third analysis TreeSelect was used with the 66 SNPs to evaluate if ecoregional allelic frequencies deviated from a central frequency and by so doing are indicative of directional selection. The three analyses suggested subpopulation structures associated with ecoregions from where animals were derived. ADMIXTURE and PCA results illustrated the importance of temperature and humidity and confirm subpopulation assignments. Comparisons of allele frequencies with TreeSelect showed ecoregion differences, in particular the divergence between arid and humid regions. Patterns of genetic variability obtained by medium and high density SNP chips can be used to acclimatize a temperately derived breed to various ecoregions. As climate change becomes an important factor in cattle production, this study should be used as a proof of concept to review future breeding and conservation schemes aimed at adaptation to climatic events.

  19. Global mapping of miRNA-target interactions in cattle (Bos taurus)

    DEFF Research Database (Denmark)

    Scheel, Troels K H; Moore, Michael J; Luna, Joseph M

    2017-01-01

    With roles in development, cell proliferation and disease, micro-RNA (miRNA) biology is of great importance and a potential therapeutic target. Here we used cross-linking immunoprecipitation (CLIP) and ligation of miRNA-target chimeras on the Argonaute (AGO) protein to globally map miRNA interact...

  20. Establishment of a pipeline to analyse non-synonymous SNPs in Bos taurus

    Directory of Open Access Journals (Sweden)

    Schreiber Mark

    2006-11-01

    Full Text Available Abstract Background Single nucleotide polymorphisms (SNPs are an abundant form of genetic variation in the genome of every species and are useful for gene mapping and association studies. Of particular interest are non-synonymous SNPs, which may alter protein function and phenotype. We therefore examined bovine expressed sequences for non-synonymous SNPs and validated and tested selected SNPs for their association with measured traits. Results Over 500,000 public bovine expressed sequence tagged (EST sequences were used to search for coding SNPs (cSNPs. A total of 15,353 SNPs were detected in the transcribed sequences studied, of which 6,325 were predicted to be coding SNPs with the remaining 9,028 SNPs presumed to be in untranslated regions. Of the cSNPs detected, 2,868 were predicted to result in a change in the amino acid encoded. In order to determine the actual number of non-synonymous polymorphic SNPs we designed assays for 920 of the putative SNPs. These SNPs were then genotyped through a panel of cattle DNA pools using chip-based MALDI-TOF mass spectrometry. Of the SNPs tested, 29% were found to be polymorphic with a minor allele frequency >10%. A subset of the SNPs was genotyped through animal resources in order to look for association with age of puberty, facial eczema resistance or meat yield. Three SNPs were nominally associated with resistance to the disease facial eczema (P Conclusion We have identified 15,353 putative SNPs in or close to bovine genes and 2,868 of these SNPs were predicted to be non-synonymous. Approximately 29% of the non-synonymous SNPs were polymorphic and common with a minor allele frequency >10%. Of the SNPs detected in this study, 99% have not been previously reported. These novel SNPs will be useful for association studies or gene mapping.

  1. Establishment of a pipeline to analyse non-synonymous SNPs in Bos taurus.

    Science.gov (United States)

    Lee, Michael A; Keane, Orla M; Glass, Belinda C; Manley, Tim R; Cullen, Neil G; Dodds, Ken G; McCulloch, Alan F; Morris, Chris A; Schreiber, Mark; Warren, Jonathan; Zadissa, Amonida; Wilson, Theresa; McEwan, John C

    2006-11-26

    Single nucleotide polymorphisms (SNPs) are an abundant form of genetic variation in the genome of every species and are useful for gene mapping and association studies. Of particular interest are non-synonymous SNPs, which may alter protein function and phenotype. We therefore examined bovine expressed sequences for non-synonymous SNPs and validated and tested selected SNPs for their association with measured traits. Over 500,000 public bovine expressed sequence tagged (EST) sequences were used to search for coding SNPs (cSNPs). A total of 15,353 SNPs were detected in the transcribed sequences studied, of which 6,325 were predicted to be coding SNPs with the remaining 9,028 SNPs presumed to be in untranslated regions. Of the cSNPs detected, 2,868 were predicted to result in a change in the amino acid encoded. In order to determine the actual number of non-synonymous polymorphic SNPs we designed assays for 920 of the putative SNPs. These SNPs were then genotyped through a panel of cattle DNA pools using chip-based MALDI-TOF mass spectrometry. Of the SNPs tested, 29% were found to be polymorphic with a minor allele frequency >10%. A subset of the SNPs was genotyped through animal resources in order to look for association with age of puberty, facial eczema resistance or meat yield. Three SNPs were nominally associated with resistance to the disease facial eczema (P 10%. Of the SNPs detected in this study, 99% have not been previously reported. These novel SNPs will be useful for association studies or gene mapping.

  2. Comparative bone histology of adult horses (Equus caballus) and cows (Bos taurus).

    Science.gov (United States)

    Zedda, M; Lepore, G; Manca, P; Chisu, V; Farina, V

    2008-12-01

    Bone microstructure of domestic herbivores is still not completely understood. Indeed, works focused on the bone histology of numerous Mammalian species frequently led to misunderstandings because of the high number of variations such as the kind of bone, section orientation, species, breed and age. Moreover, attempts to identify the species in archaeozoological studies by a mere qualitative approach have not been encouraging and in recent years quantitative methods, based on image processing and statistical analysis, have appeared. The present study was undertaken to determine whether morphometrical and morphological differences exist in the compact bone structure of the femur and humerus between horses and cows. Measurements such as area, perimeter, minimum and maximum diameter of osteons and Haversian canals as well as the osteonal density were carried out on cross sections of eight humeri and eight femurs of the two herbivores investigated. In agreement with other authors, the qualitative investigation confirmed that the compact bone of horses and cows can be classified as dense Haversian tissue. Osteons of the horse were more numerous and composed of a higher number of well-defined lamellae when compared with the cow. Diameter, perimeter and area of osteons and Haversian canals were always higher in horses than in cows and this pattern could be related to the different locomotor behaviour of these animals.

  3. Bovine Genome Database: supporting community annotation and analysis of the Bos taurus genome

    Directory of Open Access Journals (Sweden)

    Childs Kevin L

    2010-11-01

    Full Text Available Abstract Background A goal of the Bovine Genome Database (BGD; http://BovineGenome.org has been to support the Bovine Genome Sequencing and Analysis Consortium (BGSAC in the annotation and analysis of the bovine genome. We were faced with several challenges, including the need to maintain consistent quality despite diversity in annotation expertise in the research community, the need to maintain consistent data formats, and the need to minimize the potential duplication of annotation effort. With new sequencing technologies allowing many more eukaryotic genomes to be sequenced, the demand for collaborative annotation is likely to increase. Here we present our approach, challenges and solutions facilitating a large distributed annotation project. Results and Discussion BGD has provided annotation tools that supported 147 members of the BGSAC in contributing 3,871 gene models over a fifteen-week period, and these annotations have been integrated into the bovine Official Gene Set. Our approach has been to provide an annotation system, which includes a BLAST site, multiple genome browsers, an annotation portal, and the Apollo Annotation Editor configured to connect directly to our Chado database. In addition to implementing and integrating components of the annotation system, we have performed computational analyses to create gene evidence tracks and a consensus gene set, which can be viewed on individual gene pages at BGD. Conclusions We have provided annotation tools that alleviate challenges associated with distributed annotation. Our system provides a consistent set of data to all annotators and eliminates the need for annotators to format data. Involving the bovine research community in genome annotation has allowed us to leverage expertise in various areas of bovine biology to provide biological insight into the genome sequence.

  4. Intrinsic movement patterns of grazing Rocky Mountains elk (Cervus elaphus nelsonii) and beef cattle (Bos taurus)

    Science.gov (United States)

    Rocky Mountain elk and cattle are important components of mountainous ecosystems in the western United States and exist contemporaneously on many landscapes. These animals utilize similar resources yet the evolutionary lines that produced them have been distinct for approximately 30 million years. ...

  5. Spermatozoal transcripts expression levels are predictive of semen quality and conception rate in bulls (Bos taurus).

    Science.gov (United States)

    Parthipan, Sivashanmugam; Selvaraju, Sellappan; Somashekar, Lakshminarayana; Arangasamy, Arunachalam; Sivaram, Muniandy; Ravindra, Janivara Parameswaraiah

    2017-08-01

    Spermatozoal transcripts expression levels could be used to assess fertility potential of a male. The objective of the present study was to elucidate the predictive ability of the expression levels of growth, apoptosis and homeostasis regulating transcripts on sperm functions and fertility. The expression levels of spermatozoal RNA isolated from the neat semen samples were related to the good (discarded ejaculate, 40%, n = 6) quality semen producer and bulls (n = 12) with known conception rate. The relative fold expression levels of BMP2 were significantly (p conception rate (r = -0.57, p conception rate of the bull. The study provides ample evidence that the sperm transcripts expression levels might be used to predict quality semen production and bull fertility. Copyright © 2017 Elsevier Inc. All rights reserved.

  6. Casein genes of Bos taurus. II. Isolation and characterization of the β-casein gene

    International Nuclear Information System (INIS)

    Gorodetskii, S.I.; Tkach, T.M.; Kapelinskaya, T.V.

    1988-01-01

    The expression of the casein genes in the cells of the mammary gland is regulated by peptide and steroid hormones. In order to study the controlling mechanisms we have isolated and characterized the β-casein gene. The gene is 8.6 kb long and exceeds by a factor of 7.8 the length of the corresponding mRNA which is encoded by nine exons. The genomic clones incorporate in addition 8.5 kb and 4.5 kb of the 5'- and 3'-flanking regions. We have determined the sequence of the 5- and 3-terminals of the gene and have performed a comparative analysis of the corresponding regions of the rat β-casein gene. Furthermore we have identified the conversed sequences identical or homologous to the potential sections of binding to the nuclear factor CTF/NF-1 by glucocorticoid and progesterone receptors. The regulatory region of the bovine casein gene contains two variants of the TATA signal, flanking the duplication section in the promoter region

  7. Bos taurus strain:dairy beef (cattle): 1000 Bull Genomes Run 2, Bovine Whole Genome Sequence

    NARCIS (Netherlands)

    Bouwman, A.C.; Daetwyler, H.D.; Chamberlain, Amanda J.; Ponce, Carla Hurtado; Sargolzaei, Mehdi; Schenkel, Flavio S.; Sahana, Goutam; Govignon-Gion, Armelle; Boitard, Simon; Dolezal, Marlies; Pausch, Hubert; Brøndum, Rasmus F.; Bowman, Phil J.; Thomsen, Bo; Guldbrandtsen, Bernt; Lund, Mogens S.; Servin, Bertrand; Garrick, Dorian J.; Reecy, James M.; Vilkki, Johanna; Bagnato, Alessandro; Wang, Min; Hoff, Jesse L.; Schnabel, Robert D.; Taylor, Jeremy F.; Vinkhuyzen, Anna A.E.; Panitz, Frank; Bendixen, Christian; Holm, Lars-Erik; Gredler, Birgit; Hozé, Chris; Boussaha, Mekki; Sanchez, Marie Pierre; Rocha, Dominique; Capitan, Aurelien; Tribout, Thierry; Barbat, Anne; Croiseau, Pascal; Drögemüller, Cord; Jagannathan, Vidhya; Vander Jagt, Christy; Crowley, John J.; Bieber, Anna; Purfield, Deirdre C.; Berry, Donagh P.; Emmerling, Reiner; Götz, Kay Uwe; Frischknecht, Mirjam; Russ, Ingolf; Sölkner, Johann; Tassell, van Curtis P.; Fries, Ruedi; Stothard, Paul; Veerkamp, R.F.; Boichard, Didier; Goddard, Mike E.; Hayes, Ben J.

    2014-01-01

    Whole genome sequence data (BAM format) of 234 bovine individuals aligned to UMD3.1. The aim of the study was to identify genetic variants (SNPs and indels) for downstream analysis such as imputation, GWAS, and detection of lethal recessives. Additional sequences for later 1000 bull genomes runs can

  8. Clotting of cow (Bos taurus) and goat milk (Capra hircus) using calve ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-10-06

    Oct 6, 2008 ... and Finance, 2001). Much effort has been put into animal rearing and local milk production. This has led to improvements in the production of local milk products ..... beta-casein. J. Agric. Food Chem. 47: 3632-3639. Berridge NJ (1952). An improved method of observing the clotting of milk containing rennin.

  9. Bovine (Bos taurus) humoral immune response against Echinococcus granulosus and hydatid cyst infertility.

    Science.gov (United States)

    Paredes, Rodolfo; Godoy, Pablo; Rodríguez, Betsabé; García, María Pía; Cabezón, Carolina; Cabrera, Gonzalo; Jiménez, Verónica; Hellman, Ulf; Sáenz, Leonardo; Ferreira, Arturo; Galanti, Norbel

    2011-01-01

    Echinococcus granulosus, the agent of hydatid disease, presents an indirect life cycle, with canines (mainly dogs) as definitive hosts, and herbivores and human as intermediary ones. In intermediary hosts fertile and infertile cysts develop, but only the first ones develop protoscoleces, the parasite form infective to definitive hosts. We report the presence of bovine IgGs in the germinal layer from infertile cysts (GLIC), in an order of magnitude greater than in the germinal layer from fertile cysts (GLFC). When extracted with salt solutions, bovine IgGs from GLIC are associated with low or with high affinity (most likely corresponding to non specific and antigen specific antibodies, respectively). Specific IgGs penetrate both the cells of the germinal layer and HeLa cultured cells and recognize parasitic proteins. These results, taken together with previous ones from our laboratory, showing induction of apoptosis in the germinal layer of infertile hydatid cysts, provide the first coherent explanation of the infertility process. They also offer the possibility of identifying the parasite antigens recognized, as possible targets for immune modulation.

  10. Spatial movement of free-roaming cattle (Bos Taurus) when in proximity to wolves (Canis lupus)

    Science.gov (United States)

    In 1995 and 1996, 31 wolves were reintroduced into Yellowstone National Park and 35 in central Idaho. These populations have grown to more than 1,500 with more than 835 in Idaho. As wolf populations have grown, so has predation on livestock, complicating cow and ranch management. Our study was de...

  11. Genetic polymorphisms in the bovine toll-like receptor 4 (TLR4) and monocyte chemo attractant protein-1(CCL2) genes: SNPs distribution analysis in Bos indicus Sahiwal cattle breed.

    Science.gov (United States)

    Behl, Jyotsna Dhingra; Sharma, Anurodh; Kataria, R S; Verma, N K; Kimothi, Shiv Prasad; Bhatia, Avnish Kumar; Sodhi, Monika; Behl, Rahul; Joshi, B K

    2014-01-01

    Toll-like receptor 4 gene (TLR4) that recognizes the Gram negative bacterial ligand LPS was sequenced in the Bos indicus Sahiwal cattle breed. Ninety four single nucleotide polymorphisms (SNPs) were detected within 10.8 kb gene region. Seventeen of the SNPs were in the coding regions and the one at position 9589(A > G) in exon3 resulted in an amino acid change from Valine to Isoleucine. These SNPs led to generation of 27 TLR4 gene haplotypes. All the Sahiwal animals studied presently showed the occurrence of the genotype CC at gene position 9662, which codes for the amino acid threonine at position 674 of the TLR4 protein, and which had been reported to be associated with lower somatic cell score and, therefore, a lower susceptibility to mastitis, in Taurus cattle. This nucleotide configuration of the Toll-like receptor 4 gene of the Bos indicus Sahiwal cattle breed could possibly indicate toward a lower susceptibility to mastitis in the Sahiwal animals. Monocyte chemo-attractant protein-1 (CCL2) gene encoding for small inducible cytokine A2 that belongs to the CC chemokine family was also sequence characterized in these Sahiwal animals. The CCL2 gene was observed to have 12 polymorphic sites in 3.3 kb region of which one SNP at position 2500 (A > G) in exon 3 resulted in amino acid change from Valine to Isoleucine at position 46 of the mature CCL2 peptide. Seventeen haplotypes of the CCL2 gene were predicted corresponding to 12 genotypes detected.

  12. Absence of heat intolerance (panting) syndrome in foot-and-mouth disease-affected Indian cattle (Bos indicus) is associated with intact thyroid gland function.

    Science.gov (United States)

    Maddur, M S; Rao, S; Chockalingam, A K; Kishore, S; Gopalakrishna, S; Singh, N; Suryanarayana, V V S; Gajendragad, M R

    2011-06-01

    Foot-and-mouth disease (FMD) is a highly contagious and economically important viral disease with high morbidity and reduced productivity of affected animals. We studied the heat intolerance (HI) (panting) syndrome and the effect of FMD virus (FMDV) infection on thyroid gland function in Indian cattle (Bos indicus). Experimental infection with FMDV Asia 1 resulted in a mild form of disease with superficial lesions. Heat intolerance syndrome and its signs were not observed among the recovered animals. Subtle changes in the serum level of thyroid hormones, triiodothyronine (T₃) and thyroxine (T₄) were observed. However, there were no distinct histological changes in the thyroid gland, and FMDV antigens were not detected in the thyroid tissues. Our results thus suggest that the absence of panting syndrome in FMD-affected Bos indicus cattle may be associated with intact thyroid gland function.

  13. The relevance, biases, and importance of digitising opportunistic non-standardised collections: A case study in Iberian harvestmen fauna with BOS Arthropod Collection datasets (Arachnida, Opiliones

    Directory of Open Access Journals (Sweden)

    Izaskun Merino-Sáinz

    2014-04-01

    Full Text Available In this study, we analyse the relevance of harvestmen distribution data derived from opportunistic, unplanned, and non-standardised collection events in an area in the north of the Iberian Peninsula. Using specimens deposited in the BOS Arthropod Collection at the University of Oviedo, we compared these data with data from planned, standardised, and periodic collections with pitfall traps in several locations in the same area. The Arthropod Collection, begun in 1977, includes specimens derived from both sampling types, and its recent digitisation allows for this type of comparative analysis. Therefore, this is the first data-paper employing a hybrid approach, wherein subset metadata are described alongside a comparative analysis. The full dataset can be accessed through Spanish GBIF IPT at http://www.gbif.es:8080/ipt/archive.do?r=Bos-Opi, and the metadata of the unplanned collection events at http://www.gbif.es:8080/ipt/resource.do?r=bos-opi_unplanned_collection_events. We have mapped the data on the 18 harvestmen species included in the unplanned collections and provided records for some species in six provinces for the first time. We have also provided the locations of Phalangium opilio in eight provinces without published records. These results highlight the importance of digitising data from unplanned biodiversity collections, as well as those derived from planned collections, especially in scarcely studied groups and areas.

  14. Shiga toxin-producing Escherichia coli in yaks (Bos grunniens from the Qinghai-Tibetan Plateau, China.

    Directory of Open Access Journals (Sweden)

    Xiangning Bai

    Full Text Available Shiga toxin (Stx-producing Escherichia coli (STEC are recognized as important human pathogens of public health concern. Many animals are the sources of STEC. In this study we determined the occurrence and characteristics of the STEC in yaks (Bos grunniens from the Qinghai-Tibetan plateau, China. A total of 728 yak fecal samples was collected from June to August, 2012 and was screened for the presence of the stx 1 and stx 2 genes by TaqMan real-time PCR after the sample was enriched in modified Tryptone Soya Broth. Of the 138 (18.96% stx 1 and/or stx 2-positive samples, 85 (61.59% were confirmed to have at least 1 STEC isolate present by culture isolation, from which 128 STEC isolates were recovered. All STEC isolates were serotyped, genotyped by pulsed-field gel electrophoresis (PFGE and characterized for the presence of 16 known virulence factors. Fifteen different O serogroups and 36 different O:H serotypes were identified in the 128 STEC isolates with 21 and 4 untypable for the O and H antigens respectively. One stx 1 subtype (stx 1a and 5 stx 2 subtypes (stx 2a, stx 2b, stx 2c, stx 2d and stx 2g were present in these STEC isolates. Apart from lpfA O157/OI-141, lpfA O157/OI-154, lpfA O113, katP and toxB which were all absent, other virulence factors screened (eaeA, iha, efa1, saa, paa, cnf1, cnf2, astA, subA, exhA and espP were variably present in the 128 STEC isolates. PFGE were successful for all except 5 isolates and separated them into 67 different PFGE patterns. For the 18 serotypes with 2 or more isolates, isolates of the same serotypes had the same or closely related PFGE patterns, demonstrating clonality of these serotypes. This study was the first report on occurrence and characteristics of STEC isolated from yaks (Bos grunniens from the Qinghai-Tibetan plateau, China, and extended the genetic diversity and reservoir host range of STEC.

  15. Patterns of cell proliferation and apoptosis by topographic region in normal Bos taurus vs. Bos indicus crossbreeds bovine placentae during pregnancy

    Directory of Open Access Journals (Sweden)

    Ambrósio Carlos E

    2009-03-01

    Full Text Available Abstract Background Placental and fetal growth requires high rates of cellular turnover and differentiation, which contributes to conceptus development. The trophoblast has unique properties and a wide range of metabolic, endocrine and angiogenic functions, but the proliferative profile of the bovine placenta characterized by flow cytometry analysis and its role in fetal development are currently uncharacterized. Complete understanding of placental apoptotic and proliferative rates may be relevant to development, especially if related to the pathogenesis of pregnancy losses and placental abnormalities. Methods In this study, the proliferation activity and apoptosis in different regions of normal bovine placenta (central and boundary regions of placentomes, placentomal fusion, microplacentomes, and interplacentomal regions, from distinct gestation periods (Days 70 to 290 of pregnancy, were analyzed by flow cytometry. Results Our results indicated that microplacentomes presented a lower number of apoptotic cells throughout pregnancy, with a higher proliferative activity by the end of gestation, suggesting that such structures do not contribute significantly to normal of placental functions and conceptus development during pregnancy. The placentome edges revealed a higher number of apoptotic cells from Day 170 on, which suggests that placentome detachment may well initiate in this region. Conclusion Variations involving proliferation and apoptotic rates may influence placental maturation and detachment, compromising placental functions and leading to fetal stress, abnormalities in development and abortion, as frequently seen in bovine pregnancies from in vitro fertilization and cloning procedures. Our findings describing the pattern of cell proliferation and apoptosis in normal bovine pregnancies may be useful for unraveling some of the developmental deviations seen in nature and after in vitro embryo manipulations.

  16. Antibody titers to vaccination are not predictive of level of protection against a BVDV type 1b challenge in Bos indicus - Bos taurus steers.

    Science.gov (United States)

    Downey-Slinker, E D; Ridpath, J F; Sawyer, J E; Skow, L C; Herring, A D

    2016-09-30

    Subclinical illness associated with infection is thought to reduce performance and increase production costs in feedlot cattle, but underlying components remain largely unidentified. Vaccination is frequently used in feedlot settings but producers lack metrics that evaluate the effectiveness of vaccination programs. The goal of this study was to determine if levels of serum neutralizing antibody titers were predictive of levels of vaccine protection in a commercial setting. During this four-year study, Angus-Nellore steers housed in a production feedlot setting were assigned to 1 of 3 vaccine treatments: killed vaccine (kV), modified live virus (MLV) vaccine, or no vaccine (control), and were challenged with a noncytopathic 1b field strain of bovine viral diarrhea virus. Rectal temperature and levels of circulating lymphocytes and platelets were monitored following challenge. While no animals were diagnosed as clinically ill with respiratory disease, indicators of disease (pyrexia, lymphopenia, and thrombocytopenia) were observed. The MLV treatment elicited higher antibody titers to the vaccination than the kV, and calves in the MLV treatment had higher mean titers at challenge. The year that elicited the highest antibody response to the vaccination and the year with the lowest frequency of phenotypic responses to the challenge were not concurrent. The MLV treatment had the highest proportion, 34.68%, of animals that were protected against the challenge regardless of the pre-challenge antibody titer and had the fewest number of lymphopenia cases in response to the challenge. Both vaccine treatments mitigated thrombocytopenia when compared to the control treatment, and the MLV treatment reduced lymphopenia; however, these symptoms were not completely eliminated in vaccinated animals. Pyrexia was present in 40.11% of the animals, but no difference in the frequency of cases between treatments was observed. Pre-challenge vaccination response was not indicative of the level of protection nor was anamnestic antibody response correlated with health status. Copyright © 2016 The Author(s). Published by Elsevier Ltd.. All rights reserved.

  17. The Complete Mitochondrial Genome of an 11,450-year-old Aurochsen (Bos primigenius from Central Italy

    Directory of Open Access Journals (Sweden)

    Boscato Paolo

    2011-01-01

    Full Text Available Abstract Background Bos primigenius, the aurochs, is the wild ancestor of modern cattle breeds and was formerly widespread across Eurasia and northern Africa. After a progressive decline, the species became extinct in 1627. The origin of modern taurine breeds in Europe is debated. Archaeological and early genetic evidence point to a single Near Eastern origin and a subsequent spread during the diffusion of herding and farming. More recent genetic data are instead compatible with local domestication events or at least some level of local introgression from the aurochs. Here we present the analysis of the complete mitochondrial genome of a pre-Neolithic Italian aurochs. Results In this study, we applied a combined strategy employing both multiplex PCR amplifications and 454 pyrosequencing technology to sequence the complete mitochondrial genome of an 11,450-year-old aurochs specimen from Central Italy. Phylogenetic analysis of the aurochs mtDNA genome supports the conclusions from previous studies of short mtDNA fragments - namely that Italian aurochsen were genetically very similar to modern cattle breeds, but highly divergent from the North-Central European aurochsen. Conclusions Complete mitochondrial genome sequences are now available for several modern cattle and two pre-Neolithic mtDNA genomes from very different geographic areas. These data suggest that previously identified sub-groups within the widespread modern cattle mitochondrial T clade are polyphyletic, and they support the hypothesis that modern European breeds have multiple geographic origins.

  18. Prevalence of Circulating Antibodies to Bovine Herpesvirus 1 in Yaks (Bos grunniens) on the Qinghai-Tibetan Plateau, China.

    Science.gov (United States)

    Han, Zhaoqing; Gao, Jianfeng; Li, Kun; Shahzad, Muhammad; Nabi, Fazul; Zhang, Ding; Li, Jiakui; Liu, Zhengfei

    2016-01-01

    Bovine Herpesvirus 1 (BoHV-1) causes infections with many clinical signs, including rhinotracheitis, encephalitis, and genital lesions. The virus occurs worldwide in bovines, and in recent years, it has been reported in yaks (Bos grunniens) inhabiting the Tibetan Plateau in China. However, there is little epidemiologic data describing BoHV-1 infections in China's yak herds. We conducted a cross-sectional study on the Qinghai-Tibetan Plateau (QTP) in China July 2011-July 2012 to estimate the prevalence of BoHV-1 antibody in yak herds. We collected 1,840 serum samples from yaks on the QTP, in Tibet (988 yaks), Qinghai (475 yaks), and Sichuan (377 yaks) Provinces. Using an enzyme-linked immunosorbent assay, we found that 381 (38.6%) of the Tibetan samples, 212 (44.6%) of the Qinghai samples, and 105 (27.9%) of the Sichuan samples had detectable antibodies to BoHV-1. Given that this high prevalence of infection in yaks could result in heavy economic losses, we suggest that an effective management program, including vaccination and strategies for infection control, be developed.

  19. Effect of shadow availability at pasture on reproductive traits of Nelore bulls (Bos indicus raised in southeastern Brazil

    Directory of Open Access Journals (Sweden)

    Octavio Fabián Bao Tarragó

    2013-12-01

    Full Text Available Solar radiation is responsible for bull body temperature elevation. An alternative to minimize heat stress is to use artificial shade. Thus, this study aimed to evaluate the effect of thermal stress reduction, through shade availability, on reproductive characteristics of Nellore bulls (Bos indicus. For this, ten bulls were divided in: Available artificial shade (AS, n = 5 and Unavailable shade (US, n = 5. Each group was kept in two hectare paddocks, in which shade availability for group AS was artificially created. Animals were submitted to a clinical-reproductive evaluation and seminal analyses. No interaction was observed between treatments (AS and US and time (8 collections for all analyzed variables (P>0.05. No significant effect (P > 0.05 of treatment was observed for all parameters analyzed. So, it can be concluded that the absence of shaded areas during summer does not negatively affect reproductive characteristics such as: scrotal circumference, testicular consistency, progressive motility, percentage of rapidly moving cells (Computer Assisted Semen Analysis - CASA, morphology or sperm viability in Nellore bulls raised in southeastern Brazil, considering that results could be different in other regions of the country where average temperature is higher.

  20. Objective Measures for the Assessment of Post-Operative Pain in Bos indicus Bull Calves Following Castration

    Directory of Open Access Journals (Sweden)

    Gabrielle C Musk

    2017-09-01

    Full Text Available The aim of the study was to assess pain in Bos indicus bull calves following surgical castration. Forty-two animals were randomised to four groups: no castration (NC, n = 6; castration with pre-operative lidocaine (CL, n = 12; castration with pre-operative meloxicam (CM, n = 12; and, castration alone (C, n = 12. Bodyweight was measured regularly and pedometers provided data on activity and rest from day −7 (7 days prior to surgery to 13. Blood was collected for the measurement of serum amyloid A (SAA, haptoglobin, fibrinogen, and iron on days 0, 3 and 6. Bodyweight and pedometry data were analysed with a mixed effect model. The blood results were analysed with repeated measure one-way analysis of variance (ANOVA. There was no treatment effect on bodyweight or activity. The duration of rest was greatest in the CM group and lowest in the C group. There was a significant increase in the concentrations of SAA, haptoglobin, and fibrinogen in all of the groups from day 0 to 3. Iron concentrations were not different at the time points it was measured. The results of this study suggest that animals rest for longer periods after the pre-operative administration of meloxicam. The other objective assessments measured in this study were not able to consistently differentiate between treatment groups.

  1. Quality characteristics of Longissimus dorsi muscle from Bos indicus animals treated with vitamin D3 Características qualitativas do músculo Longissimus dorsi de animais Bos indicus tratados com vitaminaD3

    Directory of Open Access Journals (Sweden)

    Aparecida Carla de Moura Silveira Pedreira

    2003-12-01

    Full Text Available Among several techniques to improve beef tenderness, vitamin D3, important for calcium mobilization, has recently been developed as an alternative. It acts on the intracellular calcium-dependent proteases (mu- and m-calpain. Ten days prior to slaughter, 36 Nelore steers were fed 0, 3, 6 and 9 million IU of supplemental vitamin D3 (D3 per animal per day (an-1 d-1. Animals were slaughtered and tenderness (shear force, cooking losses (1, 8 and 15 days of aging, sensory evaluation, and minerals in blood plasma and muscle (Longissimus dorsi were measured. There were no differences (P > 0.05 among treatments for blood plasma and muscle mineral concentration, evaporation losses, and sensory juiciness. For drip and total loss, the smallest losses were for the 6 × 10(6 IU an-1 d-1 treatment. The control treatment resulted in lowest shear force and aging also tended to lower resistance to shearing. The 3 × 10(6 IU an-1 d-1 treatment had a positive effect on tenderness, flavor and overall palatability. High levels of supplemental D3 did not improve the quality characteristicsof Longissimus dorsi muscle from Bos indicus animals.Muitas técnicas são empregadas para melhorar a maciez da carne de bovinos. A mais recente usa a vitamina D3, que tem importância na mobilização do cálcio e na ativação das proteases cálcio-dependentes (mi- e m-calpaína. Neste estudo, 36 machos castrados (Nelore foram suplementados por via oral com quatro níveis de vitamina D3 (0, 3, 6 e 9 milhões de UI de vitamina D3 animal-1 dia-1 durante os 10 dias que antecederam o abate. Após o abate foram medidos a força de cisalhamento e perdas por cozimento (aos dias 1, 8 e 15 de maturação, pH, concentração de minerais no plasma sangüíneo e no músculo Longissimus dorsi, além de análise sensorial de amostras. Não houve (P > 0.05 efeito da dose de vitamina D3 na concentração de minerais no plasma sangüíneo e no músculo, nas perdas por evaporação, e na sucul

  2. Effects of calcium salts of soybean oil on factors that influence pregnancy establishment in Bos indicus beef cows.

    Science.gov (United States)

    Cooke, R F; Cappellozza, B I; Guarnieri Filho, T A; Depner, C M; Lytle, K A; Jump, D B; Bohnert, D W; Cerri, R L A; Vasconcelos, J L M

    2014-05-01

    The objective of this experiment was to compare fatty acid (FA) concentrations in plasma and reproductive tissues as well as hormones and expression of genes associated with pregnancy establishment in beef cows supplemented or not with Ca salts of soybean oil (CSSO) beginning after timed AI. Ninety nonlactating multiparous Nelore (Bos indicus) cows were timed inseminated on d 0 of the experiment and divided into 18 groups of 5 cows/group. Groups were randomly assigned to receive (as-fed basis) 100 g of a protein-mineral mix plus 100 g of ground corn per cow daily in addition to 1) 100 g/cow daily of CSSO (n = 9) or 2) 100 g/cow daily of kaolin (CON; rumen-inert indigestible substance; n = 9). All groups were maintained in a single Brachiaria brizanta pasture (24 ha) with ad libitum access to forage and water. However, groups were segregated daily and offered treatments individually at the working facility during the experimental period (d 0 to 18). Blood samples were collected and transrectal ultrasonography was performed to verify ovulation and estimate corpus luteum (CL) volume immediately before AI (d 0) and on d 7 and 18 of the experiment. On d 19, 36 cows (18 cows/treatment; 2 cows/group) diagnosed without the presence of a CL on d 0 but with a CL greater than 0.38 cm(3) in volume on d 7 and 18 were slaughtered for collection of conceptus, uterine luminal flushing, and tissue samples from the CL and endometrium. Cows receiving CSSO had greater concentrations of linoleic and other ω-6 FA in plasma (P establishment in endometrial, CL, and conceptus samples (P ≥ 0.12). In summary, supplementing beef cows with 100 g of CSSO beginning after AI favored incorporation of ω-6 FA into their circulation, reproductive tissues, and conceptus, without impacting expression of genes associated with pregnancy establishment on d 19 of gestation.

  3. Molecular epidemiology and characterization of bovine leukemia virus in domestic yaks (Bos grunniens) on the Qinghai-Tibet Plateau, China.

    Science.gov (United States)

    Wang, Meng; Wang, Yun; Baloch, Abdul Rasheed; Pan, Yangyang; Xu, Fang; Tian, Lili; Zeng, Qiaoying

    2018-03-01

    Bovine leukemia virus (BLV) is a member of the genus Deltaretrovirus of the family Retroviridae and cause a chronic lymphosarcoma, which is extensive in cattle. In yaks (Bos grunniens), the distribution, strains and genetic characteristics of BLV have rarely been studied. The aim of our study was to investigate BLV infections in domestic yaks and determine the genetic variability of BLV circulating in a region of the Qinghai Tibet Plateau, China. Blood samples were collected from 798 yaks, which were from different farms from Gansu, Qinghai and Sichuan provinces surrounding the Qinghai-Tibet Plateau. Nested PCR targeting BLV long terminal repeats was used to detect the BLV provirus. The highest prevalence of BLV infection was in Gansu province, where it was 18.93% (39/206) in white yaks from Tianzhu City and 19.14% (31/162) in black yaks from Gannan City. In Qinghai and Sichuan provinces, the prevalence of BLV in black yaks was 14.83% (35/236) and 14.94% (29/194), respectively. The prevalence of BLV was not significantly different in yaks up to one year old than in older animals. Phylogenetic analysis was performed using 16 different env-gp51 (497-bp) gene sequences from the three provinces and 71 known BLV strains, which revealed that in both Gansu and Qinghai provinces, genotypes 6 and 10 of the BLV strains were at high levels, whereas only genotype 10 was prevalent in Sichuan Province. Phylogenetic analysis and sequence comparisons revealed 95.7-99.8% sequence identity among the full-length env genes of 16 strains, nearly full-length genome sequences of six BLV strains, and those of the known genotypes 6 and 10 of BLV. This study provides comprehensive information is regarding the widespread infection of domestic yaks with BLV on the Qinghai-Tibet Plateau of China, and shows that at least two BLV genotypes (genotypes 6 and 10) are circulating in this population.

  4. Molecular and endocrine factors involved in future dominant follicle dynamics during the induction of luteolysis in Bos indicus cows.

    Science.gov (United States)

    Martinez, I Y H; Santos, A P C; Bottino, M P; Orlandi, R E; Santos, G; Simões, L M S; Souza, J C; Díaza, A M G; Binelli, M; Sales, J N S

    2018-04-15

    The growth profiles of the future dominant follicle (DF) and subordinate follicle (SF) and the gene expression of the granulosa cells during luteolysis induction in Bos indicus cows were evaluated. Forty cows were synchronized with a progesterone and estradiol based protocol. After synchronization, cows with a corpus luteum (CL) were evaluated by ultrasonography every 12 h, beginning at eight days post ovulation. Cows identified with a follicle of at least 6.0 mm in diameter in the second wave were split into two groups (BD-before follicular deviation and AD-after follicular deviation. In the BD group cows received 500 μg of cloprostenol (a synthetic analogue of prostaglandin F2α) when the DF reached a mean diameter of 7.0 mm (6.5-7.5 mm). In the AD group, cows received 500 μg of cloprostenol when the DF reached a mean diameter of 8.0 mm (7.5-8.5 mm). Cows in both groups were submitted to aspiration of the DF at 96 and 72 h after prostaglandin was given. Follicular aspirations were performed to quantify IGF1R, LHR and PAPPA transcripts in the granulosa cells. The diameter of the DF at the moment of prostaglandin administration (P = 0.001) and the growth rate of the SF (P = 0.05) were greater in the AD group. There was greater abundance of LHR transcripts in BD cows (P = 0.04). The remaining variables tested were similar between the experimental groups (P > 0.05). In conclusion, the induction of luteolysis before follicular deviation does not interfere with dominant follicle dynamics. However, it causes granulosa cell LHR down regulation. Copyright © 2018 Elsevier Inc. All rights reserved.

  5. Cow allergen (Bos d2) and endotoxin concentrations are higher in the settled dust of homes proximate to industrial-scale dairy operations.

    Science.gov (United States)

    Williams, D' Ann L; McCormack, Meredith C; Matsui, Elizabeth C; Diette, Gregory B; McKenzie, Shawn E; Geyh, Alison S; Breysse, Patrick N

    2016-01-01

    Airborne contaminants produced by industrial agricultural facilities contain chemical and biological compounds that can impact the health of residents living in close proximity. Settled dust can be a reservoir for these contaminants and can influence long-term exposures. In this study, we sampled the indoor- and outdoor-settled dust from 40 homes that varied in proximity to industrial-scale dairies (ISD; industrial-scale dairy, a term used in this paper to describe a large dairy farm and adjacent waste sprayfields, concentrated animal feeding operation or animal feeding operation, that uses industrial processes) in the Yakima Valley, Washington. We analyzed settled dust samples for cow allergen (Bos d2, a cow allergen associated with dander, hair, sweat and urine, it is a member of the lipocalin family of allergens associated with mammals), mouse allergen (Mus m1; major mouse allergen, a mouse urinary allergen, in the lipocalin family), dust mite allergens (Der p1 (Dermatophagoides pteronissinus 1) and Der f1 (Dermatophagoides farinae 1)), and endotoxin (a component of the cell walls of gram negative bacteria, lipopolysaccharide, which can be found in air and dust and can produce a strong inflammatory response). A concentration gradient was observed for Bos d2 and endotoxin measured in outdoor-settled dust samples based on proximity to ISD. Indoor-settled dust concentrations of Bos d2 and endotoxin were also highest in proximal homes. While the associated health effects of exposure to cow allergen in settled dust is unknown, endotoxin at concentrations observed in these proximal homes (100 EU/mg) has been associated with increased negative respiratory health effects. These findings document that biological contaminants emitted from ISDs are elevated in indoor- and outdoor-settled dust samples at homes close to these facilities and extend to as much as three miles (4.8 km) away.

  6. Pelepah dan Daun Kelapa Sawit Terfermentasi oleh Aspergillus niger Dalam Konsentrat Terhadap Kecernaan Bahan Kering dan Bahan Organik Ransum Pada Sapi iiiBali (Bos sondaicus)

    OpenAIRE

    Harahap, Yahya Partomuan

    2012-01-01

    YAHYA PARTOMUAN HARAHAP : The Oil Palm Frond Fermented by Aspergillus niger on The Digestibility of Dry Matter and Organic Matter on Bali cattle (Bos sondaicus). Under supervised by EDHY MIRWANDHONO and MA’RUF TAFSIN. The Oil Palm Frond is potensive to be an alternative feed. But the high of fiber in the oil palm frond has a negative effect to the digestibility. Utilizing of Aspergillus niger can increase the nutrition of oil palm frond. The objective of this research was conducted to inv...

  7. Production of volatile fatty acid in the rumen and its relationship with their concentration, intake of dry matter and digestible organic matter in buffalo (Bos bubalis) calves

    International Nuclear Information System (INIS)

    Verma, D.N.; Singh, U.B.

    1979-01-01

    The production rates of total volatile fatty acid (TVFA) in the rumen of buffalo (Bos bubalis) calves were estimated using a single injection isotope dilution technique. A series of twelve experiments were done with animals given wheat straw and concentrate mixture. The production rate of TVFA ranged from 19.77 to 24.84 moles/d depending upon the amount of food consumed by the animals. Highly significant correlations were observed between TVFA production and their concentration, dry matter and digestible organic matter intake. (auth.)

  8. Altas concentrações de FSH-p na maturação in vitro de oócitos Bos indicus High concentrations of FSH-p on the in vitro maturation of Bos indicus oocytes

    Directory of Open Access Journals (Sweden)

    Joana D'Arc Rocha Alves

    2001-08-01

    Full Text Available O objetivo deste trabalho foi avaliar a eficiência de diferentes concentrações de um FSH-p comercial sobre a maturação nuclear de oócitos Bos indicus, clivagem e desenvolvimento in vitro de embriões até estádios de blastocisto. Após seleção e transferência para o meio TCM 199/HEPES suplementado com diferentes concentrações de FSH-p (T1 = 10mg/m ; T2 = 20mg/m ; T3 = 40mg/m, os oócitos foram incubados, durante 24 horas, a 39ºC em atmosfera úmida contendo 5% de CO2. Parte dos oócitos foram retirados para análise da maturação nuclear e os demais foram transferidos para o meio de fecundação (mDM. Após 18 horas de incubação nas mesmas condições atmosféricas mencionadas para os oócitos, os presumíveis zigotos foram distribuídos no meio de desenvolvimento embrionário (KSOM contendo monocamada de células da granulosa. As porcentagens de metáfase II, de clivagem e de blastocisto foram, respectivamente, de 81,8/62,5/17,6% (T1; 55,6/64,0/19,5% (T2 e 50,0/65,0/16,3% (T3. A análise estatística revelou que uma menor porcentagem (P £ 0,05 de oócitos tratados com 20mg/m e 40mg/m de FSH-p alcançou o estádio de metáfase II e que as taxas de clivagem e blastocisto não diferiram (P ³ 0,05 entre os tratamentos. Os resultados permitem concluir que a adição de 20mg/m e 40mg/m de FSH-p ao meio de cultura interfere no processo de maturação nuclear, mas todas as concentrações testadas podem ser utilizadas sem prejuízo aparente para a clivagem e o posterior desenvolvimento embrionário.The aim of this work was to evaluate the efficiency of different concentrations of a commercial FSH-p on the nuclear maturation of Bos indicus oocytes, cleavage and in vitro development of embryos until blastocyst stages. The oocytes were selected and transferred to the maturation medium (TCM 199/25 mM HEPES supplemented with different concentrations of FSH-p (T1 = 10mg/m ; T2 - 20mg/m ; T3 - 40mg/m and after 24 hours of incubation, at 39º

  9. Effects of retinol on the in vitro development of Bos indicus embryos to blastocysts in two different culture systems.

    Science.gov (United States)

    Lima, P F; Oliveira, M A L; Gonçalves, P B D; Montagner, M M; Reichenbach, H-D; Weppert, M; Neto, C C C; Pina, V M R; Santos, M H B

    2004-10-01

    The objective of this study was to evaluate the effect of retinol on the in vitro development of early embryos of cultured Bos indicus (Expt 1) to the blastocyst stage in medium simplex of optimization (KSOM) or sintetic fluid of oviduct (SOF) or co-cultured (Expt 2) with an oviduct cell monolayer (OCM) in KSOM or SOF. A total of 3149 cumulus-oocyte complexes obtained by aspirating follicles (2-5 mm diameter) from ovaries of slaughtered animals were selected for IVM and incubated in TCM 199 supplemented with 25 mM HEPES at 39 degrees C in air with 5% CO(2) and maximum humidity for 24 h. In vitro fertilization (IVF) was performed in modified defined medium (mDM) medium. Eighteen hours after IVF, cumulus cells were removed and presumptive zygotes were randomly allocated to the experimental groups. Zygotes cultured (Expt 1) in KSOM + retinol, KSOM, SOF + retinol and SOF were incubated in maximum humidity at 39 degrees C, 5% CO(2), 5% O(2) and 90% N(2). Zygotes co-cultured (Expt 2) in KSOM + retinol + OCM, KSOM + OCM, SOF + retinol + OCM and SOF + OCM were incubated at 39 degrees C, 5% CO(2). In both experiments media were partially changed 48 h after IVF and unfertilized ova were removed. Afterwards embryos were kept in culture or co-culture for further 9 days. In Expt 1, blastocyst rates (day 7) were 14.6% (KSOM + retinol), 15.8% (KSOM), 16.4% (SOF + retinol) and 15.9% (SOF). In Expt 2, the blastocyst rates (day 7) were 25.4% (KSOM + retinol + OCM) 14.2% (KSOM + OCM), 24.3% (SOF + retinol + OCM) and 15.9% (SOF + OCM). The same influence profile of retinol was observed in the formation of the expanded (day 9) and hatched (day 11) blastocysts. The results obtained in Expt 2 demonstrated that the addition of 0.28 microg/ml retinol to the embryo culture media used in this study had a significant (p < 0.05) positive effect on bovine early embryonic development, under the conditions tested, and can be used to enhance in vitro embryo production.

  10. Physical composition, primary cuts and meat cuts of carcasses from Zebu and Bos taurus X Bos indicus crossbred cattle Composição física, cortes primários e cortes cárneos da carcaça de bovinos Zebu e de mestiços Bos taurus X Bos indicus

    Directory of Open Access Journals (Sweden)

    Daniel Perotto

    2009-09-01

    Full Text Available Data on hot carcass weight, hot carcass yield, hindquarter weights and physical components, forequarter and spare ribs, and the weights of the main commercial cuts from the hindquarters of twenty young intact bulls were assessed. The animals, belonging to four genetic groups (Nellore, ½ Guzerath + ½ Nellore (½ G + ½ N, ½ Red Angus + ½ Nellore (½ R + ½ N and ½ Marchigiana + ½ Nellore (½ M + ½ N, were raised on pastures, finished in dry lot and slaughtered at live weights ranging from 445 to 517 kg, and at ages ranging from 679 to 863 days. During the dry lot period, which lasted 114 days, animals were fed sorghum silage offered ad libitum, and a concentrate (13.5 MJ of ME, 18% CP in the DM at 1% live weight per day. Genetic group influenced hot carcass weight, forequarter weight, meat weight in the spare ribs, as well as meat and bone weights in the forequarter. Animals in the ½ M + ½ N group were superior both to those in the Nellore and in the ½ G + ½ N groups for hot carcass weight, forequarter weight and meat weight in the spare ribs. The ½ M + ½ N group also differed from the ½ R + ½ N and from the ½ G + ½ N groups in terms of forequarter weight and meat weight in the forequarter, respectively. Conversely, forequarter bone weight of ½ M + ½ N animals was higher than in animals from the Nellore and the ½ R + ½ N groups, respectively. There was no effect of genetic group on hindquarter cuts, except for higher shank and knuckle weights in the ½ M + ½ N group compared to the ½ G + ½ N and Nellore groups, respectively.Foram avaliados o peso e o rendimento de carcaça quente, os pesos dos cortes primários, os pesos dos componentes físicos dos cortes primários e os pesos dos principais cortes comerciais do traseiro especial de 20 bovinos machos não-castrados dos grupos genéticos Nelore, ½ Guzerá + ½ Nelore (½ G + ½ N, ½ Red Angus + ½ Nelore (½ R + ½ N e ½ Marchigiana + ½ Nelore (½ M + ½ N terminados em confinamento. O experimento durou em média 114 dias, período no qual os animais foram alimentados com silagem de sorgo à vontade e concentrado composto de 73,5% de grão de milho, 25% de caroço de algodão e 1,5% de ureia, perfazendo 13,5 MJ de EM e 18% de PB por kg de MS, fornecido à base de 1% do peso vivo do animal por dia. O grupo genético influenciou os pesos de carcaça quente, do dianteiro, da carne do costilhar e os pesos da carne e dos ossos do dianteiro. Animais do grupo ½ M + ½ N superaram os Nelore e os ½ G + ½ N em peso de carcaça quente e em peso do corte dianteiro e da porção de carne do costilhar. O grupo ½ M + ½ N distinguiu-se também do ½ R + ½ N quanto ao peso de dianteiro e do ½ G + ½ N quanto ao peso da carne do dianteiro. Por outro lado, a quantidade de ossos do dianteiro dos animais ½ M + ½ N foi superior à dos animais dos grupos Nelore e ½ R + ½ N. Não houve efeito de grupo genético sobre os cortes resultantes do desdobramento do traseiro especial, exceto pelo fato de os animais ½ M + ½ N apresentarem maior peso de músculo em comparação aos ½ G + ½ N e maior peso de patinho em comparação aos Nelore.

  11. Amino acid profile of salivary proteins and plasmatic trace mineral response to dietary condensed tannins in free-ranging zebu cattle (Bos indicus) as a marker of habitat degradation

    NARCIS (Netherlands)

    Yisehak, K.; Becker, A.; Rothman, J.M.; Dierenfeld, E.S.; Marescau, B.; Bosch, G.; Hendriks, W.H.; Janssens, G.P.J.

    2012-01-01

    In the southern hemisphere, foraging areas of cattle are affected by overgrazing and soil erosion resulting in decreased availability of grasses and increased amounts of browse plants high in condensed tannins (CT). This study aimed to identify biomarkers in free-ranging zebu cattle (Bos indicus)

  12. Novel polymorphisms in UTR and coding region of inducible heat shock protein 70.1 gene in tropically adapted Indian zebu cattle (Bos indicus) and riverine buffalo (Bubalus bubalis).

    Science.gov (United States)

    Sodhi, M; Mukesh, M; Kishore, A; Mishra, B P; Kataria, R S; Joshi, B K

    2013-09-25

    Due to evolutionary divergence, cattle (taurine, and indicine) and buffalo are speculated to have different responses to heat stress condition. Variation in candidate genes associated with a heat-shock response may provide an insight into the dissimilarity and suggest targets for intervention. The present work was undertaken to characterize one of the inducible heat shock protein genes promoter and coding regions in diverse breeds of Indian zebu cattle and buffaloes. The genomic DNA from a panel of 117 unrelated animals representing 14 diversified native cattle breeds and 6 buffalo breeds were utilized to determine the complete sequence and gene diversity of HSP70.1 gene. The coding region of HSP70.1 gene in Indian zebu cattle, Bos taurus and buffalo was similar in length (1,926 bp) encoding a HSP70 protein of 641 amino acids with a calculated molecular weight (Mw) of 70.26 kDa. However buffalo had a longer 5' and 3' untranslated region (UTR) of 204 and 293 nucleotides respectively, in comparison to Indian zebu cattle and Bos taurus wherein length of 5' and 3'-UTR was 172 and 286 nucleotides, respectively. The increased length of buffalo HSP70.1 gene compared to indicine and taurine gene was due to two insertions each in 5' and 3'-UTR. Comparative sequence analysis of cattle (taurine and indicine) and buffalo HSP70.1 gene revealed a total of 54 gene variations (50 SNPs and 4 INDELs) among the three species in the HSP70.1 gene. The minor allele frequencies of these nucleotide variations varied from 0.03 to 0.5 with an average of 0.26. Among the 14 B. indicus cattle breeds studied, a total of 19 polymorphic sites were identified: 4 in the 5'-UTR and 15 in the coding region (of these 2 were non-synonymous). Analysis among buffalo breeds revealed 15 SNPs throughout the gene: 6 at the 5' flanking region and 9 in the coding region. In bubaline 5'-UTR, 2 additional putative transcription factor binding sites (Elk-1 and C-Re1) were identified, other than three common sites

  13. Bosón de Higgs o la partícula de Dios: Entre el hito investigador y la quimera

    OpenAIRE

    Sanz Pascual, Julián

    2013-01-01

    Últimamente ha habido una eclosión informativa respecto a un descubrimiento científico que se supone va a ser histórico, la detección en el acelerador de partículas LHC de la partícula denominada el bosón de Higgs, bautizada como la partícula de Dios. Cabe considerar que la detección de esta partícula puede suponer una clave que va a revolucionar la física. Nosotros, que no somos físicos especializados, sino que pertenecemos a la filosofía, vamos a intentar una visión del tema desde ...

  14. Muon-spin relaxation study of the double perovskite insulators Sr2 BOsO6 (B  =  Fe, Y, ln).

    Science.gov (United States)

    Williams, R C; Xiao, F; Thomas, I O; Clark, S J; Lancaster, T; Cornish, G A; Blundell, S J; Hayes, W; Paul, A K; Felser, C; Jansen, M

    2016-02-24

    We present the results of zero-field muon-spin relaxation measurements made on the double perovskite insulators Sr2 BOsO6 (B = Fe,Y, In). Spontaneous muon-spin precession indicative of quasistatic long range magnetic ordering is observed in Sr2FeOsO6 within the AF1 antiferromagnetic phase for temperatures below [Formula: see text] K. Upon cooling below T2≈67 K the oscillations cease to be resolvable owing to the coexistence of the AF1 and AF2 phases, which leads to a broader range of internal magnetic fields. Using density functional calculations we identify a candidate muon stopping site within the unit cell, which dipole field simulations show to be consistent with the proposed magnetic structure. The possibility of incommensurate magnetic ordering is discussed for temperatures below TN = 53 K and 25 K for Sr2YOsO6 and Sr2InOsO6, respectively.

  15. El bosón de Higgs no te va a hacer la cama la física como nunca te la han contado

    CERN Document Server

    Santaolalla, Javier

    2016-01-01

    Viajes en el tiempo, agujeros negros, motores de antimateria, aceleración del universo… La física moderna suena a película, pero es ciencia, de la de verdad verdadera, la que nos cuenta una historia fascinante de descubrimientos y sueños cumplidos, de luchas y disputas, de pasión por comprender la naturaleza. Este divertido libro te ayudará a entender de una vez por todas lo que nos rodea, desde lo más pequeño a lo más grande, y a saber que el bosón de Higgs no te va a hacer la cama, ¡ni aunque le insistas!

  16. Presencia de bisonte (Bison priscus Bojanus, 1827 y uro (Bos primigenius Bojanus, 1827 en las cuevas del Búho y de la Zarzamora (Segovia, España

    Directory of Open Access Journals (Sweden)

    Arsuaga, J.L.

    2010-01-01

    Full Text Available Las cuevas de Búho y Zarzamora (Segovia, España son dos pequeños conductos kárstico, con entradas contiguas, desarrollados en las calizas cretácicas que afloran al norte del Sistema Central, en la zona de transición entre el piedemonte cristalino del paleozoico y la meseta terciaria de la cuenca del Duero. Los rellenos de estas cavidades han sido excavados en 1988-1990 y 2008-2010 y asignados al Pleistoceno superior. El origen de la acumulación de restos óseos en estas cuevas se interpreta como producto de la actividad de las hienas. El predominio de dos especies de équidos en la asociación de macrovertebrados sugiere ambientes abiertos. Hasta la fecha se han recuperado mas de 80 restos de bovino. La anatomía de los géneros Bos y Bison es muy similar, por lo que la distinción entre ellos es difícil. A falta de terceros molares inferiores, vértebras cervicales y cráneos, la asignación taxonómica se ha basado en elementos apendiculares ; astrágalo, tibia, metatarso y calcáneo. Se identifican 6 restos de Bison priscus que corresponden a 2 individuos y otros 9 restos de Bos primigenius que pertenecen a un mínimo de 2 individuos. Este hallazgo constituye la primera prueba de la presencia de bisonte en la meseta castellana para esta cronología.

  17. In-Depth Characterization of Sheep (Ovis aries Milk Whey Proteome and Comparison with Cow (Bos taurus.

    Directory of Open Access Journals (Sweden)

    Minh Ha

    Full Text Available An in-depth proteomic study of sheep milk whey is reported and compared to the data available in the literature for the cow whey proteome. A combinatorial peptide ligand library kit (ProteoMiner was used to normalize protein abundance in the sheep whey proteome followed by an in-gel digest of a 1D-PAGE display and an in-solution digestion followed by OFFGEL isoelectric focusing fractionation. The peptide fractions obtained were then analyzed by LC-MS/MS. This enabled identification of 669 proteins in sheep whey that, to our knowledge, is the largest inventory of sheep whey proteins identified to date. A comprehensive list of cow whey proteins currently available in the literature (783 proteins from unique genes was assembled and compared to the sheep whey proteome data obtained in this study (606 proteins from unique genes. This comparison revealed that while the 233 proteins shared by the two species were significantly enriched for immune and inflammatory responses in gene ontology analysis, proteins only found in sheep whey in this study were identified that take part in both cellular development and immune responses, whereas proteins only found in cow whey in this study were identified to be associated with metabolism and cellular growth.

  18. Accumulation and detoxification of metals and arsenic in tissues of cattle (Bos taurus), and the risks for human consumption

    Energy Technology Data Exchange (ETDEWEB)

    Roggeman, Saskia, E-mail: saskiaroggeman@gmail.com [Laboratory for Systemic Physiological and Ecotoxicological Research (SPHERE), Department of Biology, University of Antwerp, Groenenborgerlaan 171/U7, 2020 Antwerp (Belgium); de Boeck, Gudrun [Laboratory for Systemic Physiological and Ecotoxicological Research (SPHERE), Department of Biology, University of Antwerp, Groenenborgerlaan 171/U7, 2020 Antwerp (Belgium); De Cock, Hilde [General Medical Laboratory (Medvet/AML), Department of Pathology, Emiel Vloorsstraat 9, 2020 Antwerpen (Belgium); Blust, Ronny; Bervoets, Lieven [Laboratory for Systemic Physiological and Ecotoxicological Research (SPHERE), Department of Biology, University of Antwerp, Groenenborgerlaan 171/U7, 2020 Antwerp (Belgium)

    2014-01-01

    The aim of this study was to investigate metal accumulation and detoxification processes in cattle from polluted and unpolluted areas. Therefore dairy cows from farms and free ranging Galloway cows from nature reserves were used as study animals. The concentrations of Ag, Cd, Pb, Al, Cr, Mn, Fe, Co, Ni, Cu, Zn and As were determined in muscle, kidney, liver and lungs of cattle from polluted and reference areas in Belgium. In kidney and liver also the metallothionein concentrations were measured. For Ag, Mn, Co, Cu, Zn and As the concentrations in the different tissues were significantly higher in the sampled Galloways than in the sampled dairy cows. On the other hand Cd and Pb were significantly higher in tissues of both cattle breeds from polluted sites. Cadmium seemed to be the most important metal for metallothionein induction in kidneys whereas Zn seemed to be the most important metal for the induction of metallothionein in the liver. This study also suggested that only for Mn and Cd a significant part of the uptake occurs via the lungs. Although in muscle none of the Cd and Pb levels exceeded the European limits for human consumption, 40% of the livers and 85% of the kidneys of all examined cows were above the European limit for cadmium. Based on the existing minimum risk levels (MRLs) for chronic oral exposure, the present results suggested that a person of 70 kg should not eat more than 150 g cow meat per day because of the Cr levels in the muscles. - Highlights: •Cadmium induced metallothionein in kidney while Zn induced metallothionein in liver. •For Mn and Cd a significant part of the uptake happens via the lungs. •40% of the livers and 85% of the kidneys exceeded the European limit for cadmium. •A person of 70 kg should not eat more than 150 g bovine meat per day.

  19. The compartments of the parenchyma of the lymph nodes in newborn bull calves of domestic cattle (Bos taurus

    Directory of Open Access Journals (Sweden)

    P. N. Gavrilin

    2017-04-01

    Full Text Available The article analyzes the features of the structure of the lymphoid lobules of the parenchyma of the superficial somatic (Limphonodi subiliaci, L. cervicales superficiales, profund somatic (L. axillares proprii L. poplitei, somatovisceral (L. iliaci mediales, L. retropharyngei mediales and visceral (L. mediastinales caudales, L. ileocolici lymph nodes of newborn bull calves of domestic cattle. To visualize clearly the boundaries of the structural components of lymphoid lobules we used the author’s modification of the impregnation of total median frozen histological sections with silver nitrate. We have established a high level of tissue differentiation of the lymph nodes, a significant development of the lymphoid parenchyma, the division of the parenchyma into lymphoid lobules, the presence in the lobules of all the main structural components that are represented by two morphotypes. The first morphotype is ribbon-like perisinusoidal cords (interfollicular zone, paracortical and medullary cords. The second morphotype is rounded lymphoid formations (central zones of deep cortex units, lymphatic nodules. Lymphoid lobules are located along the marginal sinus in one row, they are better developed and differentiated in the visceral lymph nodes. In all the lymph nodes, the lymphoid lobules have a similar histoarchitectonic, and each structural component of the lymphoid lobules has a specific architectonic of the reticular meshwork and the density of the location of the fibroblastic reticulocytes. We determined that the structures of the first morphotype which provide the migration of lymphocytes, the detection of antigens and the accumulation of plasmocytes are more developed. We have established that the relative volume of structures of the first morphotype is 4.5–8.0 times larger than the volume of the structures of the second morphotype, which provide clonal proliferation of T and B lymphocytes, especially in deep somatic lymph nodes. Among the zones of the second morphotype, predominate T-dependent zones, the relative volume of which considerably exceeds the volume of B-dependent zones (lymphoid nodules: in the superficial somatic lymph nodes by 14–30 times, profound somatic by 12–14 times, somatovisceral by 6–7 times and visceral by 4.5–5.5 times. We determined that lymphatic nodules can form in different parts of compartments: in the interfollicular zone and paracortical cords of all lymph nodes and in the medullary cords of the visceral lymph nodes. The study shows that the parenchyma of the lymph nodes of newborn bull calves has a high degree of maturity, contains a full set of structural markers of immunocompetence, among which predominate the components that support lymphocyte migration, antigen detection and accumulation of plasma cells.

  20. Localisation of aphidicolin-induced break points in Holstein-Friesian cattle (Bos taurus using RBG-banding

    Directory of Open Access Journals (Sweden)

    Mernies Beatriz

    2002-11-01

    Full Text Available Abstract Fragile sites (FS seem to play a role in genome instability and may be involved in karyotype evolution and chromosome aberrations. The majority of common fragile sites are induced by aphidicolin. Aphidicolin was used at two different concentrations (0.15 and 0.30 μM to study the occurrence of FS in the cattle karyotype. In this paper, a map of aphidicolin induced break points and fragile sites in cattle chromosomes was constructed. The statistical analysis indicated that any band with three or more breaks was significantly damaged (P r = 0.54. On the contrary, 21 FS were identified on negative R bands while 9 FS were located on positive R bands.

  1. TERMOGRAFIA DIGITAL POR INFRAVERMELHO DO ESCROTO E QUALIDADE DO SÊMEN EM TOUROS NELORE (BOS TAURUS INDICUS

    Directory of Open Access Journals (Sweden)

    Felipe Rydygier de Ruediger

    2014-12-01

    Full Text Available Aimed to study the relationship between scrotal temperature on semen quality by use of infrared thermography in Nelore bulls bred extensively. There were scrotal thermography and semen collection. Climatic data were collected by means of globe thermometer. The thermograms of the scrotum were obtained by digital infrared thermography. We carried out ejaculates through electroejaculation for analysis of quantitative and qualitative characteristics. For the data, we used analysis of variance and subsequently applied the Tukey test at 5%. (p <0.05 between animals for sperm vigor, sperm motility between animals and between crops, sperm concentration, total sperm and total viable sperm between groups, between harvests for the scrotum temperatures and climate data. It was concluded that the surface temperatures of the scrotum and climatic factors influence the quality of semen. Thermography is recommended as a complementary test in the evaluation of reproductive bulls.

  2. PRODUCTIVITY AND TICK LOAD IN Bos Indicus X B. taurus CATTLE IN A TROPICAL DRY FOREST SILVOPASTORAL SYSTEM

    Directory of Open Access Journals (Sweden)

    Raquel Sofía Salazar Benjumea

    2015-04-01

    Full Text Available Rhipicephalus (Boophilus microplus ticks cause significant economic losses to the Colombian cattle sector: reduction in meat and milk production, blood losses and transmission of blood parasites. The degree of infestation depends on the breed, physiological state and nutrition of the animal and on microclimatic characteristics, which affect the tick life cycle. Diverse studies suggest that given the characteristics of intensive silvopastoral systems (ISS, tick loads within these systems are lower. In this study, the tick loads of grazing animals were monitored for five animal groups: three at an ISS and two at traditional farms located on the Valley of Ibague (Tolima. within the ISS, there were greater tick loads in high production cows (P = 0.026 and a positive relationship (P < 0.05 between milk production and tick load in August sampling. Greater tick counts were also observed in the in San Javier (traditional farm group compared to all other animal groups. We conclude that the dynamics of ticks is a complex phenomenon affected by many factors, whose association determines the observed tick population at any given time.

  3. Accumulation and detoxification of metals and arsenic in tissues of cattle (Bos taurus), and the risks for human consumption

    International Nuclear Information System (INIS)

    Roggeman, Saskia; de Boeck, Gudrun; De Cock, Hilde; Blust, Ronny; Bervoets, Lieven

    2014-01-01

    The aim of this study was to investigate metal accumulation and detoxification processes in cattle from polluted and unpolluted areas. Therefore dairy cows from farms and free ranging Galloway cows from nature reserves were used as study animals. The concentrations of Ag, Cd, Pb, Al, Cr, Mn, Fe, Co, Ni, Cu, Zn and As were determined in muscle, kidney, liver and lungs of cattle from polluted and reference areas in Belgium. In kidney and liver also the metallothionein concentrations were measured. For Ag, Mn, Co, Cu, Zn and As the concentrations in the different tissues were significantly higher in the sampled Galloways than in the sampled dairy cows. On the other hand Cd and Pb were significantly higher in tissues of both cattle breeds from polluted sites. Cadmium seemed to be the most important metal for metallothionein induction in kidneys whereas Zn seemed to be the most important metal for the induction of metallothionein in the liver. This study also suggested that only for Mn and Cd a significant part of the uptake occurs via the lungs. Although in muscle none of the Cd and Pb levels exceeded the European limits for human consumption, 40% of the livers and 85% of the kidneys of all examined cows were above the European limit for cadmium. Based on the existing minimum risk levels (MRLs) for chronic oral exposure, the present results suggested that a person of 70 kg should not eat more than 150 g cow meat per day because of the Cr levels in the muscles. - Highlights: •Cadmium induced metallothionein in kidney while Zn induced metallothionein in liver. •For Mn and Cd a significant part of the uptake happens via the lungs. •40% of the livers and 85% of the kidneys exceeded the European limit for cadmium. •A person of 70 kg should not eat more than 150 g bovine meat per day

  4. Host predilection and transmissibility of vesicular stomatitis New Jersey virus strains in domestic cattle (Bos taurus and swine (Sus scrofa

    Directory of Open Access Journals (Sweden)

    Smith Paul F

    2012-10-01

    Full Text Available Abstract Background Epidemiologic data collected during epidemics in the western United States combined with limited experimental studies involving swine and cattle suggest that host predilection of epidemic vesicular stomatitis New Jersey virus (VSNJV strains results in variations in clinical response, extent and duration of virus shedding and transmissibility following infection in different hosts. Laboratory challenge of livestock with heterologous VSNJV strains to investigate potential viral predilections for these hosts has not been thoroughly investigated. In separate trials, homologous VSNJV strains (NJ82COB and NJ82AZB, and heterologous strains (NJ06WYE and NJOSF [Ossabaw Island, sand fly] were inoculated into cattle via infected black fly bite. NJ82AZB and NJ06WYE were similarly inoculated into swine. Results Clinical scores among viruses infecting cattle were significantly different and indicated that infection with a homologous virus resulted in more severe clinical presentation and greater extent and duration of viral shedding. No differences in clinical severity or extent and duration of viral shedding were detected in swine. Conclusions Differences in clinical presentation and extent and duration of viral shedding may have direct impacts on viral spread during epidemics. Viral transmission via animal-to-animal contact and insect vectored transmission are likely to occur at higher rates when affected animals are presenting severe clinical signs and shedding high concentrations of virus. More virulent viral strains resulting in more severe disease in livestock hosts are expected to spread more rapidly and greater distances during epidemics than those causing mild or inapparent signs.

  5. Host predilection and transmissibility of vesicular stomatitis New Jersey virus strains in domestic cattle (Bos taurus) and swine (Sus scrofa).

    Science.gov (United States)

    Smith, Paul F; Howerth, Elizabeth W; Carter, Deborah; Gray, Elmer W; Noblet, Raymond; Berghaus, Roy D; Stallknecht, David E; Mead, Daniel G

    2012-10-03

    Epidemiologic data collected during epidemics in the western United States combined with limited experimental studies involving swine and cattle suggest that host predilection of epidemic vesicular stomatitis New Jersey virus (VSNJV) strains results in variations in clinical response, extent and duration of virus shedding and transmissibility following infection in different hosts. Laboratory challenge of livestock with heterologous VSNJV strains to investigate potential viral predilections for these hosts has not been thoroughly investigated. In separate trials, homologous VSNJV strains (NJ82COB and NJ82AZB), and heterologous strains (NJ06WYE and NJOSF [Ossabaw Island, sand fly]) were inoculated into cattle via infected black fly bite. NJ82AZB and NJ06WYE were similarly inoculated into swine. Clinical scores among viruses infecting cattle were significantly different and indicated that infection with a homologous virus resulted in more severe clinical presentation and greater extent and duration of viral shedding. No differences in clinical severity or extent and duration of viral shedding were detected in swine. Differences in clinical presentation and extent and duration of viral shedding may have direct impacts on viral spread during epidemics. Viral transmission via animal-to-animal contact and insect vectored transmission are likely to occur at higher rates when affected animals are presenting severe clinical signs and shedding high concentrations of virus. More virulent viral strains resulting in more severe disease in livestock hosts are expected to spread more rapidly and greater distances during epidemics than those causing mild or inapparent signs.

  6. Comet assay to determine genetic damage by the use of ivermectin in zebu cows (Bos taurus indicus

    Directory of Open Access Journals (Sweden)

    Donicer Montes-Vergara

    2017-05-01

    Full Text Available Objective. The objective of the work was evaluate the damage genetic caused by the use of ivermectin (IVM in cows zebu to concentrations of 1% and 3.15% through the test comet. Material and methods. 15 cows, were taken with age between 3 and 4 years old, average weight of 350 kg, body condition between 3 and 3.5. Three experimental groups with five animals per group, which were exposed to the concentration of IVM to 1% to 3.15% more group control (without application of IVM were used. Animal blood sample was performed by venipuncture jugular or medial flow with vacutainer® needle, extracting 8 ml of blood. The blood samples it was collected at 9, 18 and 27 days post-treatment. Results. The display of the comets is made by using fluorescence microscope, the cells were evaluated by means of visual log and the Comet image software. Evidenced the presence of nuclei with DNA migration in all analyzed plates. The values of classification of comets indicate cells with high levels of damage (grade 3: cells with high damage. The rate of DNA damage of the treatment to 1% to 3.15% was significant, to relate to the control group. Conclusions. The results obtained in this study demonstrate the likely genotoxic potential of the use of IVM in cattle.

  7. Genetic parameters of infectious bovine keratoconjunctivitis and its relationship with weight and parasite infestations in Australian tropical Bos taurus cattle

    DEFF Research Database (Denmark)

    Ali, A.; O'Neill, C.J.; Thomson, P.C.

    2012-01-01

    Background: Infectious bovine keratoconjunctivitis (IBK) or 'pinkeye' is an economically important ocular disease that significantly impacts animal performance. Genetic parameters for IBK infection and its genetic and phenotypic correlations with cattle tick counts, number of helminth (unspecified...... recorded for tick counts, helminth eggs counts as an indicator of intestinal parasites and live weights at several ages including 18 months. Results: Negative genetic correlations were estimated between IBK incidence and weight traits for animals in pre-weaning and post-weaning datasets. Genetic...... correlations among weight measurements were positive, with moderate to high values. Genetic correlations of IBK incidence with tick counts were positive for the pre-weaning and negative for the post-weaning datasets but negative with helminth eggs counts for the pre-weaning dataset and slightly positive...

  8. In-Depth Characterization of Sheep (Ovis aries) Milk Whey Proteome and Comparison with Cow (Bos taurus)

    Science.gov (United States)

    Ha, Minh; Sabherwal, Manya; Duncan, Elizabeth; Stevens, Stewart; Stockwell, Peter; McConnell, Michelle; Bekhit, Alaa El-Din; Carne, Alan

    2015-01-01

    An in-depth proteomic study of sheep milk whey is reported and compared to the data available in the literature for the cow whey proteome. A combinatorial peptide ligand library kit (ProteoMiner) was used to normalize protein abundance in the sheep whey proteome followed by an in-gel digest of a 1D-PAGE display and an in-solution digestion followed by OFFGEL isoelectric focusing fractionation. The peptide fractions obtained were then analyzed by LC-MS/MS. This enabled identification of 669 proteins in sheep whey that, to our knowledge, is the largest inventory of sheep whey proteins identified to date. A comprehensive list of cow whey proteins currently available in the literature (783 proteins from unique genes) was assembled and compared to the sheep whey proteome data obtained in this study (606 proteins from unique genes). This comparison revealed that while the 233 proteins shared by the two species were significantly enriched for immune and inflammatory responses in gene ontology analysis, proteins only found in sheep whey in this study were identified that take part in both cellular development and immune responses, whereas proteins only found in cow whey in this study were identified to be associated with metabolism and cellular growth. PMID:26447763

  9. Ultrastructure of spermiogenesis and the spermatozoon of Paramphistomum microbothrium [Fischoeder 1901] (Digenea: Paramphistomidae), a parasite of Bos taurus in Senegal.

    Science.gov (United States)

    Seck, Momar Talla; Marchand, Bernard; Bâ, Cheikh Tidiane

    2007-08-01

    The ultrastructural study of spermiogenesis and the spermatozoon of Paramphistomum microbothrium gave evidence of some characteristics of this digenean. The intercentriolar body located between two striated roots and two centrioles exhibits a symmetric plane. The two external bands of this intercentriolar body are made up of a line of granules. The striated roots are about 3.7 microm long. During spermiogenesis, a flagellar rotation of 90 degrees is described. The spermatozoon is characterized in its anterior part by the existence of external ornamentations and a lateral expansion exhibiting a "spine-like body". Such a spine-like body has never been described before in a digenean. The region II of the spermatozoon is asymmetrical and also characterized by the absence of mitochondrion. The posterior end of this spermatozoon exhibits a nucleus and a few microtubules.

  10. Ultrastructure of spermiogenesis and the spermatozoon of Paramphistomum microbothrium (Fischoeder 1901; Digenea, Paramphistomidae), a parasite of Bos taurus in Senegal.

    Science.gov (United States)

    Seck, Momar Talla; Marchand, Bernard; Bâ, Cheikh Tidiane

    2007-07-01

    The ultrastructural study of spermiogenesis and the spermatozoon of Paramphistomum microbothrium gave evidence of some characteristics of this digenean. The intercentriolar body located between two striated roots and two centrioles exhibits a symmetric plane. The two external bands of this intercentriolar body are made up of a line of granules. The striated roots are about 3.7-microm long. During spermiogenesis, a flagellar rotation of 90 degrees is described. The spermatozoon is characterized in its anterior part by the existence of external ornamentations and a lateral expansion exhibiting a "spine-like body." Such a spine-like body has never been described before in a digenean. The region II of the spermatozoon is asymmetrical and also characterized by the absence of mitochondrion. The posterior end of this spermatozoon exhibits a nucleus and a few microtubules.

  11. Predicting wolf (Canis lupus)-cattle (Bos Taurus) encounters and consequential effects on cattle resource selection patterns

    Science.gov (United States)

    The gray wolf population in Idaho has grown dramatically from the original 35 reintroduced individuals in 1995-1996 to 94 documented packs and a minimum population of 835 individuals in 2009. Wolf depredation on livestock has also increased dramatically with this population growth. Substantial spa...

  12. Research and development of evaluation system for photovoltaic power generation system. Research and survey on test and evaluation method for BOS component devices; Taiyoko hatsuden system hyoka gijutsu no kenkyu kaihatsu. Shuhen gijutsu hyoka system no kenkyu kaihatsu

    Energy Technology Data Exchange (ETDEWEB)

    Tatsuta, M. [New Energy and Industrial Technology Development Organization, Tokyo (Japan)

    1994-12-01

    This paper reports the study results on R and D of the evaluation method for BOS component devices in fiscal 1994. (1) On the study on requirements of BOS component devices for practical use, the study results on storage battery, inverter, protective device for system interconnection, and effective use means for storage battery were summarized. On the future device technology, it was clarified that the following value added technologies are promising: simple design of inverter circuit, cost reduction by common specification and mass production, and stabilization of voltage and compensation of momentary peak load by combining inverter with small-capacity storage batteries. (2) On the study on the performance test method for BOS component devices, basic characteristic (capacity, efficiency) test, PSOC charge/discharge cycle test, and accelerated life cycle test were performed for 4 kinds of new storage batteries developed by NEDO. The whole characteristic test results satisfied specifications, and long-term cycle test is in promotion for all new storage batteries. 3 figs., 4 tabs.

  13. Effects of electrical stimulation and postmortem storage on changes in titin, nebulin, desmin, troponin-T, and muscle ultrastructure in Bos indicus crossbred cattle.

    Science.gov (United States)

    Ho, C Y; Stromer, M H; Rouse, G; Robson, R M

    1997-02-01

    The effects of electrical stimulation (ES) on degradation of titin, nebulin, desmin, and troponin-T (TN-T) and on structural changes in the longissimus muscle (LM) from Brahman x Simmental (B x S) cattle (Bos indicus cross) were determined. The left side of seven B x S beef carcasses was stimulated (200 V, 20 Hz) within 1 h of death, and the right side was the nonstimulated (NS) control. Myofibrils for SDS-PAGE and samples for transmission electron microscopy were prepared from the LM at 0, 1, 3, 7, 14, and 28 d postmortem (PM). The SDS-PAGE results showed that the T1 band of titin was absent by 7 d in two animals, by 14 d in four animals, and by 28 d in one animal in both NS and ES samples. By SDS-PAGE, intact nebulin was gone by 7 d in two animals and by 14 d in five animals, but in blots, nebulin decreased by 7 d and was absent by 14 d in both NS and ES samples. The desmin band could still be seen as a light band at 28 d in Western blots of both NS and ES samples. A decrease in TN-T and a concomitant increase in the 30-kDa polypeptide were observed in both NS and ES samples. Western blots with a monoclonal antibody to TN-T confirmed that TN-T decreased at similar rates in NS and ES samples but showed that the 30-kDa polypeptide was more heavily labeled in ES samples from 7 to 28 d. Contraction nodes were present in O-d ES samples and were still observed in 28-d ES samples. Narrow, intermediate, and wide I-band fractures were seen earlier and at a greater frequency in ES than in NS samples. Overall, ES had no detectable effect on titin, nebulin, desmin, or TN-T degradation but accelerated the appearance and enhanced the frequency of three types of I-band fractures in the LM from Bos indicus crossbred cattle.

  14. PREVALENCE OF SULFONAMIDE AND FLORFENICOL RESISTANCE GENES IN ESCHERICHIA COLI ISOLATED FROM YAKS (BOS GRUNNIENS) AND HERDSMEN IN THE TIBETAN PASTURE.

    Science.gov (United States)

    Zhang, Anyun; Yang, Yunfei; Wang, Hongning; Lei, Changwei; Xu, Changwen; Guan, Zhongbin; Liu, Bihui; Huang, Xi; Peng, Linyao

    2015-07-01

    To determine the antimicrobial susceptibility profiles and prevalence of resistance genes in Escherichia coli isolated from yaks (Bos grunniens) and herdsmen in nine plateau pastures in Tibet, we isolated 184 nonidentical strains of E. coli from yaks and herdsmen. Antimicrobial susceptibility testing of 15 antimicrobials was conducted and the prevalence of sulfonamide resistance genes (sul1, sul2, and sul3) and florfenicol resistance genes (floR, cfr, cmlA, fexA, pexA, and estDL136) was determined. Escherichia coli isolated from yaks had a high resistance rate to sulfamethoxazole (44%), sulphafurazole (40.4%), and florfenicol (11.4%). Escherichia coli isolated from herdsmen had a high resistance rate to sulfamethoxazole (57%) and sulphafurazole (51%). In addition, sul genes were present in 93% of sulfonamide-resistant isolates (84/90), and 17 floR genes and four cmlA genes were found in 19 florfenicol-resistant isolates. Even though florfenicol is prohibited from use in humans, three floR genes were detected in strains isolated from herdsmen. The three floR-positive isolates from herdsmen had pulsed-field gel electrophoresis patterns similar to isolates from yaks. In addition to documenting the sul and floR genes in E. coli isolated from yaks and herdsmen in the Tibetan pasture, we demonstrated the potential risk that antimicrobial-resistant E. coli could spread among herdsmen and yaks.

  15. Infrared thermography as a tool to evaluate body surface temperature and its relationship with feed efficiency in Bos indicus cattle in tropical conditions.

    Science.gov (United States)

    Martello, Luciane Silva; da Luz E Silva, Saulo; da Costa Gomes, Rodrigo; da Silva Corte, Rosana Ruegger Pereira; Leme, Paulo Roberto

    2016-01-01

    The aims of this study were to evaluate the use of infrared thermography (IRT) images as a tool for monitoring body surface temperature and to study its relationship with residual feed intake (RFI) in Nellore cattle. We also evaluated IRT as an indicator of feed efficiency in Bos indicus cattle. In this study, 144 Nellore steers were fed high-concentrate diets for 70 days to evaluate feedlot performance. We examined nine animals classified as high RFI and nine animals classified as low RFI by measuring rectal temperature (RT), respiratory frequency (RF), and IRT in the front, eye, ocular area, cheek, flank, ribs, rump, and front feet. The measurements were taken at 0700, 1200, and 1600 hours. The IRT temperatures measured at the eye, cheek, flank, ribs, rump, and front feet were positively associated with RF and RT. These results indicate that increases in the temperatures are associated with increased RF and RT. There was an effect in the RFI group in the front region where IRT correlates with RT. The front IRT for high-RFI cattle was lower (P < 0.01) than that for low-RFI cattle. The higher skin temperature measured by IRT for animals in the RFI group may be related to improved efficiency of thermoregulatory mechanisms because the RT remained lower in the low-RFI group. IRT can be used in the head for studies related to RFI in beef cattle.

  16. Ultrasonographic and macroscopic anatomy of the enucleated eyes of the buffalo (Bos bubalis) and the one-humped camel (Camelus dromedarius) of different ages.

    Science.gov (United States)

    Kassab, A

    2012-02-01

    The ultrasonographic appearance and measurements of the normal buffalo and camel eye globes were described in 60 buffaloes (Bos bubalis) aged 1 year (28 eyes) and 10 years (32 eyes), and in 51 humped camels (Camelus dromedarius) aged 1 year (26 eyes) and 10 years (24 eyes). Ocular measurements were recorded by A- and B-scan ultrasonographic examination of 40 buffalo eyes (18 young and 22 adult eyes) and 34 camel eyes (14 young and 20 adult eyes) using a KANGH ultrasound scanner equipped with 10 MHz probe. For gross measurements, 20 buffalo and 16 camel eye globes were frozen and dissected and the same measurements were made using fine callipers macroscopically. The aqueous and vitreous humour of the buffalo and camel eyes appeared anechoic. The cornea, anterior and posterior lens capsule and iris appeared hyperechoic. The ocular measurements for the axial length, vitreous chamber depth (VCD), corneal thickness, lens thickness and scleroretinal rim thickness increase with the advance of age in both buffaloes and camels. Except for the anterior chamber depth, VCD and lens thickness, which were larger in adult camels than in adult buffaloes, no other differences between ocular dimensions were observed in both species. The results of this study are valuable for comparative ocular anatomy and will be useful for ultrasonographic evaluation of ocular diseases in buffaloes and camels. © 2011 Blackwell Verlag GmbH.

  17. Serological survey of Neospora caninum and Toxoplasma gondii in cattle (Bos indicus) and water buffaloes (Bubalus bubalis) in ten provinces of Brazil.

    Science.gov (United States)

    da Silva, Jenevaldo Barbosa; Nicolino, Rafael Romero; Fagundes, Gisele Maria; Dos Anjos Bomjardim, Henrique; Dos Santos Belo Reis, Alessandra; da Silva Lima, Danillo Henrique; Oliveira, Carlos Magno Chaves; Barbosa, José Diomedes; da Fonseca, Adivaldo Henrique

    2017-06-01

    The objective of this study was to determine the prevalence of antibodies to Neospora caninum and Toxoplasma gondii among 500 cattle (Bos indicus) and 500 buffaloes (Bubalus bubalis) using the indirect fluorescent antibody test (IFAT) technique. Blood samples from were collected from water buffalo and cattle in 10 municipalities in the northern region of Brazil. The frequency of cattle and water buffaloes seropositive for Neospora caninum in Pará state, Brazil, was 55% and 44%, respectively, and the frequency of cattle and water buffaloes seropositive for Toxoplasma gondii was 52% and 39%, respectively. Seropositivity for both N. caninum and T. gondii was detected in 10.6% of the cattle samples and 14.8% of the buffalo samples. The frequency of cattle positive for N. caninum and T. gondii was significantly (p<0.05) higher than that of buffalo in two and three provinces, respectively. Buffaloes had a lower seroprevalence for N. caninum or T. gondii in all of the provinces studied. These results suggest that both species, when exposed to the same risks for N. caninum and T. gondii infection, have a high serological prevalence. Cattle showed a higher probability of being seropositive when exposed to the same risks for N. caninum and T. gondii. Our study, which included an extensive number of blood samples, provides important epidemiological information pertinent to buffalo production in tropical countries that can be used as a basis for disease-management practices in Latin America. Copyright © 2017 Elsevier Ltd. All rights reserved.

  18. Random regression models using Legendre polynomials or linear splines for test-day milk yield of dairy Gyr (Bos indicus) cattle.

    Science.gov (United States)

    Pereira, R J; Bignardi, A B; El Faro, L; Verneque, R S; Vercesi Filho, A E; Albuquerque, L G

    2013-01-01

    Studies investigating the use of random regression models for genetic evaluation of milk production in Zebu cattle are scarce. In this study, 59,744 test-day milk yield records from 7,810 first lactations of purebred dairy Gyr (Bos indicus) and crossbred (dairy Gyr × Holstein) cows were used to compare random regression models in which additive genetic and permanent environmental effects were modeled using orthogonal Legendre polynomials or linear spline functions. Residual variances were modeled considering 1, 5, or 10 classes of days in milk. Five classes fitted the changes in residual variances over the lactation adequately and were used for model comparison. The model that fitted linear spline functions with 6 knots provided the lowest sum of residual variances across lactation. On the other hand, according to the deviance information criterion (DIC) and bayesian information criterion (BIC), a model using third-order and fourth-order Legendre polynomials for additive genetic and permanent environmental effects, respectively, provided the best fit. However, the high rank correlation (0.998) between this model and that applying third-order Legendre polynomials for additive genetic and permanent environmental effects, indicates that, in practice, the same bulls would be selected by both models. The last model, which is less parameterized, is a parsimonious option for fitting dairy Gyr breed test-day milk yield records. Copyright © 2013 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.

  19. Isolation, identification and retrospective study of foot-and-mouth disease virus from affected Mithun (Bos frontalis) in north-eastern India.

    Science.gov (United States)

    Borah, B; Deka, P; Sharma, K; Baro, S; Hazarika, A K; Das, C; Garam, G B; Boro, P; Ltu, K

    2018-02-01

    Foot-and-mouth disease (FMD) is a contagious disease of cloven-hoofed animals that causes substantial and perpetual economic loss. Apart from the contagious nature of the disease, the FMD virus can establish in a "carrier state" among all cloven-hoofed animals. The Mithun (Bos frontalis), popularly called the "Cattle of Mountain," is found in the geographically isolated, hilly region of north-east India: Arunachal Pradesh, Nagaland, Manipur and Mizoram. Despite the geographical inaccessibility, infection by FMD virus has emerged as the single most devastating disease among Mithun after the eradication of rinderpest from this region. Samples from outbreaks of FMD in Mithun were analysed by sandwich ELISA, multiplex RT-PCR (MRT-PCR) and liquid-phase blocking enzyme-linked immunosorbent assay and isolated in the BHK-21 cell line. The results indicate the presence of FMDV serotype "O." The sequencing and molecular phylogenies have revealed close relationships in the lineage of type "O" isolates from Bangladesh. The findings will provide useful information for further research and development of a sustainable programme for the progressive control of FMD in the Mithun population. © 2017 Blackwell Verlag GmbH.

  20. Prioritizing fodder species based on traditional knowledge: a case study of mithun (Bos frontalis) in Dulongjiang area, Yunnan Province, Southwest China.

    Science.gov (United States)

    Geng, Yanfei; Hu, Guoxiong; Ranjitkar, Sailesh; Wang, Yuhua; Bu, Dengpan; Pei, Shengji; Ou, Xiaokun; Lu, Yang; Ma, Xuelan; Xu, Jianchu

    2017-05-04

    Livestock rearing is one of the oldest and most important types of smallholder farming worldwide. The sustainability of livestock production depends on the efficient utilization of locally available resources. Some traditional methods of raising livestock may offer valuable lessons in this regard. This study documented and evaluated local knowledge of wild forage plants in the Dulongjiang area in Southwest China in the context of rearing mithun (Bos frontalis) in order to provide a sound evidence base for tree fodder selection and the establishment of integrated tree-crop-livestock systems. The snowball technique was used to identify key informants with specific knowledge about the topic. Free listing and semi-structured interviews were conducted with 58 households. Participatory investigation and transit walks were used to investigate potential fodder species. Ethnobotanical information was collected, documented and organized. Overall, 142 wild forage plants from 58 families and 117 genera were identified. Species of the Poaceae, Rosaceae and Urticaceae families were most abundant, with 16, 14 and 11 species respectively identified as fodder plants. Our results indicated that tree/shrub forage plays a major role in the diet of mithun, unlike that of other ruminants. Mithun prefers to browse and move around the forest in search of food, particularly rough and even barbed leaves. Tree species like Debregeasia orientalis, Saurauia polyneura and Rubus species were identified as being important fodder sources. Farmers in this area have traditionally relied on common property resources such as community-managed forests and grasslands to feed their livestock. Farmers have strong incentive to raise mithuns rather than other livestock species due to Dulong people's cultural preferences. The wide variety of plants cited by the informants demonstrate the importance of traditional knowledge in gathering information about forage resources. This diversity also offers the

  1. Food and Feeding Habits of Gaur (Bos gaurus) in Highlands of Central India: A Case Study at Pench Tiger Reserve, Madhya Pradesh (India).

    Science.gov (United States)

    Haleem, Abdul; Ilyas, Orus

    2018-02-01

    Indian gaur (Bos gaurus) is one of nine species of wild oxen found in the world. They are largely confined to evergreen, semi-evergreen, and moist deciduous forests, but also occur in dry deciduous forest areas at the periphery of their range. According to the IUCN Red List ( 2017 ), the estimated population of gaur in India is between 15,000 and 35,000 individuals, and probably due to this, despite the gaur's vast range of distribution, they are listed as a vulnerable species by IUCN and listed as schedule-I of the Indian Wildlife Protection Act ( 1972 ) as well as in appendix-I in CITES ( 2003 ). Gaur is not a well studied species, and baseline data are thus needed to support conservation efforts. We studied the feeding habits of gaur in Pench Tiger Reserve. Pench Tiger Reserve is the 19th tiger reserve in India, situated in the Seoni and Chhindwara districts of MP, India (21°41'35″N 79°14'54″E). Diet composition of gaur was studied by micro-histological examination of 32 dung piles collected from different sampling plots in different seasons. For this purpose, 169 sampling plots were established at an interval of 200 m. To locate gaur faecal matter, a circular plot of 10 m radius was laid within each sampling plot. Eighty-eight permanent reference slides of available plants were prepared and used for plant fragment identification from the dung piles. A total of 29 plant species were identified from dung piles of gaur. On average, 44.51% of grass-fragments were detected in the diet of gaur, suggesting that gaurs are primarily grazers in the Pench Tiger Reserve.

  2. Effects of eCG are more pronounced in primiparous than multiparous Bos indicus cows submitted to a timed artificial insemination protocol.

    Science.gov (United States)

    Sales, J N S; Bottino, M P; Silva, L A C L; Girotto, R W; Massoneto, J P M; Souza, J C; Baruselli, P S

    2016-12-01

    The effects of eCG on follicular growth, ovulation, and pregnancy per artificial insemination (P/AI) in multiparous and primiparous Bos indicus beef cows submitted to timed artificial insemination (TAI) were evaluated in three experiments. In experiments 1 (follicular responses; n = 64), 2 (follicular growth and ovulation rate; n = 662), and 3 (P/AI; n = 2092), cows submitted to TAI were assigned to receive one of two treatments on Day 8 of the synchronization protocol: control (no additional treatment) or eCG (300-IU of eCG intramuscularly). In experiment 1, largest follicle (LF) diameter on Day 8 (P = 0.56) and the interval from progesterone (P4)-device removal to ovulation (P = 0.79) did not differ between treatments. However, the maximum diameter of the LF (P = 0.05) and ovulation rate (P = 0.03) were greater in cows that received eCG. In experiment 2, the diameter of the LF on Day 10, follicular growth, and ovulation rate were greater in eCG-treated cows (P < 0.01). However, CL diameter was similar between treatments (P = 0.11). In experiment 3, there was a treatment-by-parity interaction (P = 0.003) on P/AI, such that treatment with eCG was more effective in primiparous cows. In conclusion, eCG treatment resulted in increased final follicular growth, ovulation rate, and fertility in B indicus cows submitted to TAI protocols, especially in primiparous cows. Copyright © 2016 Elsevier Inc. All rights reserved.

  3. Chemical and sensory meat characteristics of Nellore cattle (Bos indicus finished with different levels of backfat thickness in the longissimus thoracis muscle

    Directory of Open Access Journals (Sweden)

    Jéssica Moraes Malheiros

    2016-01-01

    Full Text Available The objective of this study was to evaluate the effect of backfat thickness (BFT on the meat quality of feedlot-finished Nellore bulls (Bos indicus. Seventy-two animals were feedlot finished for about 100 days. For this study, 24 animals were sampled according to BFT in the longissimus thoracis muscle after slaughter: 12 animals with BFT up to 3.0 mm (class BFT-3 and 12 animals with BFT > 6.0 mm (class BFT-6. Chemical (myofibrillar fragmentation index, intramuscular fat content, and unsaturated and saturated fatty acids and physical (cold carcass weight, rib eye area, and marbling score characteristics of the meat were evaluated. Additionally, shear force and sensory characteristics (aroma, flavor, tenderness, chewiness, and juiciness were analyzed. Marbling score and intramuscular fat content were considered low for the two BFT classes. The mean values of the characteristics studied did not differ (P>0.05 between BFT classes, except for fatty acids, with the observation of higher unsaturated fatty acid levels in the BFT-6 class. There was no difference (P>0.05 in sensory characteristics between BFT classes. The most consistent relationship was observed between the myofibrillar fragmentation index and tenderness, measured as shear force, in animals with greater BFT (BFT-6 class compared to animals with lower BFT (BFT-3 class, suggesting possible tenderness problems in animals with a leaner carcass. The observation of a higher concentration of unsaturated fatty acids in animals with greater BFT suggests an increase in the sensory perception of meat, especially flavor.

  4. Bos primigenius in Ancient Egyptian art – historical evidence for the continuity of occurrence and ecology of an extinct key species

    Directory of Open Access Journals (Sweden)

    Carl Beierkuhnlein

    2015-11-01

    Full Text Available Knowledge of the habitat requirements and temporal stability of populations of extinct aurochs (Bos primigenius is surprisingly scarce. Reliable reports of this species, which by its domestication remains tremendously important for humans, are rare. As the species became extinct about 400 years ago and regionally disappeared much earlier, its behaviour and morphology are also under debate. Aurochs is also a crucial component of the mega-herbivore theory in nature conservation, but in fact its natural habitat and behaviour are unknown. Here, I report records of aurochs for the time period of Ancient Egypt. They are found in archaeological sites and literature, and in collections. Records of the species continue through all the periods of Ancient Egypt. In particular, hunting scenes illustrating the merits of high-ranking persons, in their graves (mastabas and temples, provide insights into the behaviour and ecology of the depicted game. Here, special attention is given to one outstanding hunting scene that is documented in a relief at the mortuary temple of Ramesses III (1175 BC, Medinet Habu, Egypt. Assisted by a group of hunters, the pharaoh kills three specimens of aurochs. The whole scene is stunningly realistic.  The adult specimen is fleeing towards the reed belt of the River Nile, suggesting that the species’ habitat was probably in large valley bottoms, where open grassland is regularly created by flooding. Endemic species of fish and game confirm that this scene took place in Lower Egypt. The regional populations of the North-African subspecies of aurochs probably went extinct shortly after this piece of art was produced. Records of species in ancient art can be very informative in terms of ecology and behaviour of species, especially when extinct species are addressed. In addition, the dating of old pieces of art containing biological information can be very precise, for instance when these refer to a historic personage. 

  5. Comparison of 37 months global net radiation flux derived from PICARD-BOS over the same period observations of CERES and ARGO

    Science.gov (United States)

    Zhu, Ping; Wild, Martin

    2016-04-01

    The absolute level of the global net radiation flux (NRF) is fixed at the level of [0.5-1.0] Wm-2 based on the ocean heat content measurements [1]. The space derived global NRF is at the same order of magnitude than the ocean [2]. Considering the atmosphere has a negligible effects on the global NRF determination, the surface global NRF is consistent with the values determined from space [3]. Instead of studying the absolute level of the global NRF, we focus on the interannual variation of global net radiation flux, which were derived from the PICARD-BOS experiment and its comparison with values over the same period but obtained from the NASA-CERES system and inferred from the ocean heat content survey by ARGO network. [1] Allan, Richard P., Chunlei Liu, Norman G. Loeb, Matthew D. Palmer, Malcolm Roberts, Doug Smith, and Pier-Luigi Vidale (2014), Changes in global net radiative imbalance 1985-2012, Geophysical Research Letters, 41 (no.15), 5588-5597. [2] Loeb, Norman G., John M. Lyman, Gregory C. Johnson, Richard P. Allan, David R. Doelling, Takmeng Wong, Brian J. Soden, and Graeme L. Stephens (2012), Observed changes in top-of-the-atmosphere radiation and upper-ocean heating consistent within uncertainty, Nature Geoscience, 5 (no.2), 110-113. [3] Wild, Martin, Doris Folini, Maria Z. Hakuba, Christoph Schar, Sonia I. Seneviratne, Seiji Kato, David Rutan, Christof Ammann, Eric F. Wood, and Gert Konig-Langlo (2015), the energy balance over land and oceans: an assessment based on direct observations and CMIP5 climate models, Climate Dynamics, 44 (no.11-12), 3393-3429.

  6. Incidence and transplacental transmission of Neospora caninum in primiparous females from Bos indicus slaughtered in Presidente Prudente, São Paulo, Brazil / Incidência e transmissão transplacentária de Neospora caninum em fêmeas primíparas da raça Bos indicus abatidos em Presidente Prudente, São Paulo, Brasil

    Directory of Open Access Journals (Sweden)

    Sergio do Nascimento Kronka

    2008-08-01

    Full Text Available To produce an epidemiological map of neosporosis in Brazil and identify the types of transmission of this disease, the present study evaluated the occurrence of Neospora caninum in Nelore cattle (Bos indicus in Presidente Prudent, west region of Sao Paulo state; its vertical transmission; and the early stage in which fetuses are infected. To achieve this, serum samples from 518 slaughtered pregnant heifers and their fetuses were tested by ELISA technique and fetal brain tissues subjected to PCR. One hundred and three heifers (19.88% had antibodies to N. caninum, as well as 38 (36.8% of fetuses from 4 months of gestation. The conventional PCR failed to detect N. caninum DNA. These findings show that neosporosis occurs in the area studied and that it may be transmitted the transplacental route, althought N. caninum had not detected in brain tissue from non-aborted fetuses. The use of nested PCR it would be applied to increase the sensitivy of test.Para produzir um mapa epidemiológico da neosporose no Brasil e identificar os tipos de transmissão dessa doença, o presente estudo avaliou a ocorrência de Neospora caninum em fêmea Nelore (Bos Indicus em Presidente Prudente, região oeste do Estado de São Paulo e o risco de infecção fetal nos estágios iniciais da gestação. Para a realização deste estudo, amostras de soro de 518 novilhas prenhas abatidas e seus fetos foram testadas pela técnica de ELISA e para avaliação de transmissão vertical, tecido cerebral fetal foi submetido à reação da polimerase em cadeia (PCR. Dessas novilhas, 103 (19,88% tinham anticorpos para N. caninum dos quais 38 (36,8% estavam no 4 mês de gestação. Esses achados mostram que a Neosporose ocorre na área estudada e que pode ser transmitido pela via placentária, embora o N. caninum não tenha sido detectado em tecido cerebral de fetos não abortado. O uso de nested PCR poderia ser aplicado como forma de aumentar a sensibilidade do teste.

  7. Influência da raça do touro (Bos indicus x Bos taurus na tolerância ao estresse térmico calórico de embriões bovinos produzidos in vitro

    Directory of Open Access Journals (Sweden)

    Thaís Nabhan

    2011-08-01

    Full Text Available Para melhor compreender as diferenças entre zebuínos e taurinos em relação à resistência ao ETC, objetivou-se verificar se a resistência ao ETC é resultado da contribuição genética do oócito, do espermatozoide ou de ambos. Oócitos de vacas das raças Nelore e mestiças com fenótipo predominante da raça Holandesa preto e branco (mHPB foram coletados, maturados e fertilizados com espermatozoide de touros das raças Nelore (N, Angus (An, Brahman (Bra e Gir (Gir. Noventa e seis horas pós-inseminação (hpi, embriões > 16 células foram separados ao acaso em dois grupos: controle e ETC. Embriões do grupo controle foram cultivados a 39 ºC continuamente e do grupo ETC expostos a 41 ºC por 12 horas, retornando a seguir para 39 ºC. Não foi observado efeito do ETC nas raças estudadas, sem redução nas taxas de blastocisto e blastocisto eclodido. As taxas de clivagem e mórula dos embriões mHPB x Gir foram inferiores (p < 0,05 às das demais raças. As raças mHPB x N apresentaram taxas de blastocisto superiores as raças mHPB x An e mHPB x Gir (p < 0,05. Concluiu-se que a contribuição genética do oócito é mais importante do que a do espermatozoide, uma vez que a raça do touro não influenciou a resistência embrionária ao ETC.

  8. Comparison of the pregnancy rates and costs per calf born after fixed-time artificial insemination or artificial insemination after estrus detection in Bos indicus heifers.

    Science.gov (United States)

    Edwards, S A A; Bo, G A; Chandra, K A; Atkinson, P C; McGowan, M R

    2015-01-01

    This study compared pregnancy rates (PRs) and costs per calf born after fixed-time artificial insemination (FTAI) or AI after estrus detection (i.e., estrus detection and AI, EDAI), before and after a single PGF2α treatment in Bos indicus (Brahman-cross) heifers. On Day 0, the body weight, body condition score, and presence of a CL (46% of heifers) were determined. The heifers were then alternately allocated to one of two FTAI groups (FTAI-1, n = 139) and (FTAI-2, n = 141) and an EDAI group (n = 273). Heifers in the FTAI groups received an intravaginal progesterone-releasing device (IPRD; 0.78 g of progesterone) and 1 mg of estradiol benzoate intramuscularly (im) on Day 0. Eight days later, the IPRD was removed and heifers received 500 μg of PGF2α and 300 IU of eCG im; 24 hours later, they received 1 mg estradiol benzoate im and were submitted to FTAI 30 to 34 hours later (54 and 58 hours after IPRD removal). Heifers in the FTAI-2 group started treatment 8 days after those in the FTAI-1 group. Heifers in the EDAI group were inseminated approximately 12 hours after the detection of estrus between Days 4 and 9 at which time the heifers that had not been detected in estrus received 500 μg of PGF2α im and EDAI continued until Day 13. Heifers in the FTAI groups had a higher overall PR (proportion pregnant as per the entire group) than the EDAI group (34.6% vs. 23.2%; P = 0.003), however, conception rate (PR of heifers submitted for AI) tended to favor the estrus detection group (34.6% vs. 44.1%; P = 0.059). The cost per AI calf born was estimated to be $267.67 and $291.37 for the FTAI and EDAI groups, respectively. It was concluded that in Brahman heifers typical of those annually mated in northern Australia FTAI compared with EDAI increases the number of heifers pregnant and reduces the cost per calf born. Copyright © 2015 Elsevier Inc. All rights reserved.

  9. Impact of Equine Chorionic Gonadotropin Associated with Temporary Weaning, Estradiol Benzoate, or Estradiol Cypionate on Timed Artificial Insemination in Primiparous Bos Indicus Cows

    Directory of Open Access Journals (Sweden)

    Andre Luis Bastos Souza

    Full Text Available The study aimed to determine the impact of equine chorionic gonadotropin (eCG associated with different timed artificial insemination (TAI protocols on the pregnancy rate (PR in Bos indicus cows previously treated with progesterone. Five hundred and fifty-seven primiparous cows were subjected to the following treatments: on day 0 (d0, GeCGTW (group equine Chorionic Gonadotropin+Temporary Weaning;n=178 received 0,558 g intravaginal progesterone (P4+1.0 mg of estradiol benzoate (EB (IM; on d8 (P4 removal+0,075 mg D-cloprostenol + 400 IU eCG + TW for 48 h; on d10, TAI + calves return to dam; GeCGEB (group equine Chorionic Gonadotropin+Estradiol benzoate; n=176 the same as GeCGTW without TW + application of 1.0 mg of EB on d9; GeCGEC (group equine Chorionic Gonadotropin+Estradiol Cypionate; n=203, the same as GeCGTW without TW+1.5 mg EC (IM. On d35, post TAI, pregnancy diagnosis (PD was performed. Non-pregnant animals remained under clean-up bulls for 90 days. After this period, the animals were subjected to PD using ultrasound. The PR of TAI was 51.1%, 47.1%, and 47.8% for GeCGTW, GeCGEB24, and GeCGEC (P>0.05 respectively. The PR under clean-up bulls was 88.3%, 47.3%, and 31.1% (P<0.05. The final PR (TAI+clean-up bulls of the groups was 94.4%, 72.1%, and 64.0%, respectively (P<0.05. It was concluded that no differences in PR among the protocols related to TAI were detected; PR in the GeCGTW protocol under clean-up bulls was higher compared to others (P<0.05; the overall PR of cows subjected to TAI+clean-up bulls was significantly higher in GeCGTW than in the other groups.

  10. Evaluation of pregnancy rates of Bos indicus cows subjected to different synchronization ovulation protocols using injectable progesterone or an intravaginal device

    Directory of Open Access Journals (Sweden)

    Jefferson Tadeu Campos

    2016-12-01

    Full Text Available This study evaluated the pregnancy rate in Nelore cows (Bos indicus that were subjected to fixed-time artificial insemination (FTAI using different protocols consisting of injectable progesterone (P4 or an intravaginal device (impregnated with P4. Multiparous cows 72-84 months in age, 30-45 days postpartum, were selected on the basis of the absence of a corpus luteum (CL and follicles < 8 mm after transrectal palpation and ultrasound examinations. On a random day of the estrus cycle (D0, the selected animals (n = 135 were randomly assigned to one of three experimental groups (n = 45 each. Group I (injectable P4/FTAI 36 hours received 250 mg of injectable P4 and 2 mg EB on D0; on D7, they received 500 µg of cloprostenol; on D8, 300 IU of eCG and 1 mg of EB were administered; and finally, FTAI was performed 36 hours after the application of EB. Group II (injectable P4/FTAI 48 hours received the same protocol as Group I, except that the FTAI was performed 48 hours after ovulation induction. The animals of Group III (Control/CIDR received a conventional protocol for FTAI using an intravaginal device (D0: P4 and 2 mg EB; D8: device removal, 500 µg cloprostenol, 300 IU eCG, 1 mg EB; and FTAI performed 48 hours after removal of the device. The results showed that cows synchronized with the conventional protocol for FTAI (Control/CIDR had a higher pregnancy rate (60 %, 27/45 than those synchronized with an injectable P4/FTAI 36 hours (33.33 %; 15/45, P = 0.010. However, the group receiving injectable P4 group/FTAI 48 hours had a similar pregnancy rate (48.9 %; 22/45; P = 0.290 when compared to both the group receiving the conventional protocol and that receiving injectable P4/FTAI 36 hours (P = 0.134. Although the injectable P4 may affect pregnancy rate with the FTAI performed in 36 hours, we found similar pregnancy rates from cows inseminated 48 hours after induction ovulation, considering injectable or intravaginal P4. Therefore, we suggest that

  11. Severe diarrhea outbreak in beef calves (Bos indicus caused by G6P[11], an emergent genotype of bovine rotavirus group A

    Directory of Open Access Journals (Sweden)

    Thais N.S. Medeiros

    2014-08-01

    Full Text Available The episodes of diarrhea caused by neonatal bovine rotavirus group A (BoRVA constitute one of the major health problems in the calf rearing worldwide. The main G (VP7 and P (VP4 genotypes of BoRVA strains involved in the etiology of diarrhea in calves are G6P[1], G10P[11], G6P[5], and G8P[1]. However, less frequently, other G and P genotypes have been described in BoRVA strains identified in diarrheic fecal samples of calves. This study describes the identification and molecular characterization of an emerging genotype (G6P[11] in BoRVA strains involved in the etiology of a diarrhea outbreak in beef calves in a cattle herd of high production in extensive management system. The diarrhea outbreak, which showed high morbidity (60% and lethality (7% rates, occurred in calves (n= 384 Nelore (Bos indicus up to 30-day-old from the State of Mato Grosso do Sul, Brazil. BoRVA was identified in 80% (16/20 of the fecal samples analyzed by polyacrylamide gel electrophoresis (PAGE technique. In all PAGE-positive fecal samples were amplified products with 1,062-bp and 876-bp in the RT-PCR assays for VP7 (G type and VP4 (VP8* (P type of BoRVA, respectively. The nucleotide sequence analysis of VP7 and VP4 genes of four wild-type BoRVA strains showed G6-III P[11]-III genotype/lineage. The G6P[11] genotype has been described in RVA strains of human and animal hosts, however, in calves this genotype was only identified in some cross-sectional studies and not as a single cause of diarrhea outbreaks in calves with high morbidity and lethality rates as described in this study. The monitoring of the G and P genotypes of BoRVA strains involved in diarrhea outbreaks in calves is important for both animal and public health by allowing the identification of the most frequent genotypes, the characterization of novel genotypes and to identify reassortments with genotypes described in animal and human hosts. The results of this study show the importance of the monitoring of

  12. Effect of circulating progesterone concentration during synchronization for fixed-time artificial insemination on ovulation and fertility in Bos indicus (Nelore) beef cows.

    Science.gov (United States)

    Sales, J N S; Carvalho, J B P; Crepaldi, G A; Soares, J G; Girotto, R W; Maio, J R G; Souza, J C; Baruselli, P S

    2015-04-01

    Four experiments were designed to evaluate the effect of different circulating progesterone (P4) concentrations during a synchronization of ovulation protocol for the timed artificial insemination (TAI) of Bos indicus (Nelore) beef cattle. In the first trial, 13 ovariectomized Nelore heifers were randomly allocated into one of three groups using new P4 devices (New; 1.0 g P4), previously used P4 devices for 8 days (Used1x), and previously used P4 devices for 16 days (Used2x), in a crossover experimental design. The circulating P4 concentrations during the P4 device treatment were lower for Used1x (2.3 ± 0.1 ng/mL) and Used2x (2.0 ± 0.1 ng/mL) than those for New (3.8 ± 0.2 ng/mL; P = 0.001). In the second trial, the ovarian follicular dynamics of 60 anestrous cows were evaluated after the cows received the treatments described previously (New [n = 20], Used1x [n = 20], and Used2x [n = 20]). During the insertion of the P4 device, the cows were administered 2.0-mg estradiol benzoate. Eight days later, the P4 device was removed, and the cows were administered 0.53-mg sodium cloprostenol, 300 IU eCG, and 1-mg estradiol cypionate. There were no differences among the groups during the interval from P4 device removal to ovulation (73.7 ± 2.9 vs. 69.8 ± 2.4 vs. 68.4 ± 2.3 hours) or regarding the ovulation rate (70.0% vs. 80.0% vs. 85.0%). However, the maximum diameter of the largest follicle was greater (P = 0.06) in the Used2x (15.3 ± 0.4 mm) than that of New (13.5 ± 0.8 mm) and Used1x (14.9 ± 0.5 mm). In experiment 3, 443 anestrous cows were randomly assigned into one of the three treatments (New [n = 144] vs. Used1x [n = 167] vs. Used2x [n = 132]) and received a TAI 48 hours after the P4 device removal. The diameter of the largest follicle during the device removal (10.7 ± 0.3 vs. 11.2 ± 0.2 vs. 11.3 ± 0.3 mm) and the 30-day pregnancy rates (51.4% vs. 53.9% vs. 43.2%) did not differ among the experimental

  13. How to Implement Blue Ocean Strategy (BOS in B2B Sector Kaip įgyvendinti žydrųjų vandenynų strategiją (ŽVS sektoriuje „verslas – verslui“

    Directory of Open Access Journals (Sweden)

    Andrejs Čirjevskis

    2011-11-01

    Full Text Available The aim of research is to confirm the hypothesis that BOS is viable in the B2B sectors. The objects of research are two business entities: world’s lead­ing suppliers of construction chemicals and manufacturer of purification equip­ment. Authors posed first research question is BOS a suitable within construction chemicals and purification equipment manufacturers’ industries? Second research question was about how to evaluate acceptability of new strategic choice on BOS? Third research question was how to diagnosis organisational hurdles on BOS implementation? Research has confirmed the hypothesis and suggested application of innovation value chain to diagnosing company’s ability to implement value in­novation.

    Tyrimo tikslas patvirtina hipotezę, kad ŽVS yra gyvybinga B2B sektoriuose. Tyrimo objektai yra du verslo subjektai: pasaulyje pirmaujantys statybos chemikalų tiekėjai ir valymo įrenginių gamintojai. Autorių keliamas pirmasis mokslinių tyrimų klausimas – ar ŽVS yra tinkama statybos chemikalų ir valymo įrenginių gamintojų pramonei? Antrasis mokslinių tyrimų klausimas – apie tai, kaip įvertinti naujo strateginio pasirinkimo

  14. INFLUÊNCIA DO GENÓTIPO BOS INDICUS NA ATIVIDADE DE CALPASTATINA E NA TEXTURA DA CARNE DE NOVILHOS ABATIDOS NO SUL DO BRASIL EFFECTS OF THE BOS INDICUS GENOTYPE ON CALPASTATIN ACTIVITIY AND TEXTURE OF BEEF FROM STEERS SLAUGHTERED IN THE SOUTH OF BRAZIL

    Directory of Open Access Journals (Sweden)

    Jane M. RUBENSAM

    1998-10-01

    Full Text Available Amostras de contrafilé (músculo L. dorsi provenientes de 26 bovinos, sendo 14 Polled Hereford (HH, sete 3/4Hereford 1/4Nelore (3/4H1/4N e cinco 5/8Hereford 3/8Nelore (5/8H3/8N, machos castrados, abatidos aos dois anos de idade, foram coletadas 24 h após o abate e analisadas quanto à atividade de calpastatina e textura, tanto no 1o dia post mortem quanto após um período de maturação de 10 dias a 2o C. A atividade de calpastatina foi determinada pelo ensaio de inibição da m-calpaína e a textura através da força de cisalhamento (Warner-Bratzler. A carne de novilhos 5/8H3/8N apresentou, no 1o dia, maiores (p0,05 entre os grupos HH e 3/4H1/4N para as mesmas características. Após 10 dias, houve uma diferença na atividade de calpastatina, porém não significativa (p>0,05, entre o grupo 5/8H3/8N (1,57U/g e os demais (HH=1,23U/g; 3/4H1/4N=1,35U/g, e diferença significativa entre os grupos HH e 5/8H3/8N para força de cisalhamento (3,67 e 5,00kg, respectivamente. Conclui-se que a atividade de calpastatina determinada 24 h post mortem pode ser útil para a previsão da textura da carne, maturada ou não, em programas de melhoramento genético, e que a participação crescente do genótipo Bos indicus nos rebanhos da Região Sul, a par das conhecidas vantagens zootécnicas, poderá resultar em carne de pior textura.Boneless rib steaks (L. dorsi muscle from 26 two years old steers, 14 Polled Hereford, seven 3/4Hereford 1/4Nelore (3/4H1/4N and five 5/8Hereford 3/8Nelore (5/8H3/8N, were collected 24 hs after slaughter and analysed for calpastatin activity and texture at the 1st day post mortem and at the 10th day of aging at 2o C. Calpastatin activity was determined by m-calpain inhibition assay and texture by shear force (Warner-Bratzler. Beef from 5/8H3/8N steers showed higher (p0.05 were detected in the same traits between groups HH and 3/4H1/4N. After 10 days of aging, there was a difference in calpastatin activity, although non

  15. Pengaruh Pengadukan Dan Variasi Feeding Terhadap Pembentukan Biogas Dari Sampah Dapur Rumah Makan Pada Reaktor Batch Dengan Aktivator Feses Sapi (Bos Taurus)

    OpenAIRE

    Tri Utomo, Doron; Hadiwidodo, Mochtar; Sudarno, Sudarno

    2014-01-01

    Food waste is organic waste that is quite lot and have not good treatment now. Food waste in anaerobic treatment have potential to produce biogas with addition cow feces as an activator. Stirring is one effort to increase the production of biogas. Research has been conducted in a batch system but the results have not been produced an optimal biogas. This research use two big reactors (19 liter) and 16 small reactors (600 ml dan 500 ml). There are four parameters that were observed the biogas...

  16. Digital infrared thermography of the scrotum, semen quality, serum testosterone levels in Nellore bulls (Bos taurus indicus and their correlation with climatic factors

    Directory of Open Access Journals (Sweden)

    Felipe Rydygier de Ruediger

    2016-02-01

    Full Text Available The objective was to study the relationship of climatic conditions with the temperature of the scrotum surface and sperm quality through digital infrared thermography in Nellore bulls, raised extensively. In six bulls held with scrotal thermography Flir E40® cameras, blood samples for serum testosterone and semen collection were taken by electroejaculation every 10 days, with six replications. Climatic factors: ambient temperature, relative humidity, dry globe temperature and temperature of the wet globe were recorded using a globe thermometer (InstruTemp®, ITWTG-2000. Thermal images of the scrotum were analyzed with the Flir Tools® software for the temperatures of scrotal surface, the right and left sides of the scrotum lap thirds: dorsal, middle and ventral testicles; and tails of the epididymis. The semen data and thermograms were submitted to ANOVA and Tukey’s test at 5%. Pearson correlation was used for the surface temperatures of the scrotum, rectal temperature, quantitative and qualitative characteristics of semen and climatic factors. There was a positive correlation (P<0.05 for sperm motility x scrotal temperatures; sperm concentration x scrotal temperatures; climatic factors x rectal temperature. There was a negative correlation (P<0.05 between ambient temperature x sperm concentration. It was concluded that the temperature of the scrotum surface and climatic factors, temperature and humidity, influence the quality of semen. Thermography is recommended as a supplementary examination for reproductive evaluation of bulls.

  17. Molecular characterisation of Sarcocystis bovifelis, Sarcocystis bovini n. sp., Sarcocystis hirsuta and Sarcocystis cruzi from cattle (Bos taurus) and Sarcocystis sinensis from water buffaloes (Bubalus bubalis).

    Science.gov (United States)

    Gjerde, Bjørn

    2016-04-01

    About 200 individual sarcocysts were excised from 12 samples of cattle beef from five countries (Argentina, Brazil, Germany, New Zealand, Uruguay) and tentatively identified to species or cyst type on the basis of their size and shape and cyst wall morphology. Genomic DNA was extracted from 147 of these sarcocysts and used initially for PCR amplification and sequencing of the partial mitochondrial cytochrome c oxidase subunit I gene (cox1) in order to identify the sarcocysts to species and/or sequence type. In addition, seven Sarcocystis sinensis-like sarcocysts collected from the oesophagus of water buffaloes in Egypt were examined at cox1 for comparative purposes. Based on the results from the cox1 marker, selected sarcocyst isolates from both hosts were further characterised at one to three regions of the nuclear ribosomal (r) DNA unit, i.e. the complete 18S rRNA gene, the complete internal transcribed spacer 1 (ITS1) region and the partial 28S rRNA gene. This was done in order to compare the results with previous molecular identifications based on 18S rRNA gene sequences and to evaluate the utility of these regions for species delimitations and phylogenetic inferences. On the basis of sarcocyst morphology and molecular data, primarily the cox1 sequences, four Sarcocystis spp. were identified in the samples of cattle beef. Twenty-two microscopic sarcocysts (1 × 0.1 mm) with hair-like protrusions were assigned to Sarcocystis cruzi, 56 macroscopic sarcocysts (3-8 × 0.5 mm) with finger-like protrusions were assigned to Sarcocystis hirsuta and 45 and 24 microscopic sarcocysts (1-3 × 0.1-0.2 mm) with finger-like protrusions were assigned to Sarcocystis bovifelis and Sarcocystis bovini n. sp., respectively. Sarcocysts of S. cruzi were identified in samples of beef from Argentina and Uruguay; sarcocysts of S. hirsuta in samples from Argentina, Brazil, Germany and New Zealand; sarcocysts of S. bovifelis in samples from Argentina and Germany; and sarcocysts of S. bovini in samples from Argentina and New Zealand. The microscopic sarcocysts from water buffaloes were confirmed to belong to S. sinensis. The cox1 sequences of S. bovifelis and S. bovini, respectively, shared an identity of 93-94 % with each other, and these sequences shared an identity of 89-90 % with cox1 of S. sinensis. In contrast, the intraspecific sequence identity was 98.4-100 % (n = 45), 99.3-100 % (n = 24) and 99.5-100 % (n = 7) for sequences of S. bovifelis, S. bovini and S. sinensis, respectively. In each of the latter three species, an aberrant type of cox1 sequences was also identified, which was only 91-92 % identical with the predominant cox1 type of the same species and about 98 % identical with the aberrant types of the two other species. These aberrant cox1 sequences are believed to represent non-functional nuclear copies of the mitochondrial genes (numts or pseudogenes). They might be used as additional markers to separate the three species from each other. Sequencing of a considerable number of clones of S. bovifelis, S. bovini and S. sinensis from each of the three regions of the rDNA unit revealed intraspecific sequence variation in all loci in all species and particularly in the ITS1 locus (78-100 % identity). As regards the 18S rRNA gene, it was possible to separate the three species from each other on the basis of a few consistent nucleotide differences in the less variable 3' end half of the gene. A comparison of the new sequences with GenBank sequences obtained from S. sinensis-like sarcocysts in cattle in other studies indicated that previous sequences derived from cattle in Germany and Austria belonged to S. bovifelis, whereas those derived from cattle in China belonged to S. bovini. On the basis of the new 28S rRNA sequences, it was possible to separate S. sinensis from S. bovifelis and S. bovini, whereas the latter two species could not be separated from each other. Based on ITS1 sequences, the three species were indistinguishable. Phylogenetic analysis using maximum parsimony placed with fairly high support cox1 sequences of S. bovifelis, S. bovini and S. sinensis, respectively, into three monophyletic clusters, with S. bovifelis and S. bovini being a sister group to S. sinensis. In contrast, phylogenies based on each of the three regions of the rDNA unit did not separate sequences of the three species completely from each other. Characterisation of cox1 of 56 isolates of S. hirsuta from four countries revealed only 13 haplotypes and an intraspecific sequence identity of 99.3-100 %. In the three regions of the rDNA unit, there was more extensive sequence variation, particularly in the ITS1 region. The 22 cox1 sequences of S. cruzi displayed a moderate intraspecific variation (98.6-100 %), whereas there was no variation at the 18S rRNA gene among 10 sequenced isolates. Sequencing of 16 clones of the partial 28S rRNA gene of S. cruzi yielded two markedly different sequence types, having an overall sequence identity of 95-100 %.

  18. Morfologia e grânulos citoplasmáticos do corpo lúteo de vacas aneloradas (Bos taurus indicus gestantes e não gestantes

    Directory of Open Access Journals (Sweden)

    L.R. Vargas

    2015-04-01

    Full Text Available Avaliaram-se a proporção volumétrica dos constituintes do corpo lúteo e a distribuição de células lúteas com grânulos citoplasmáticos no corpo lúteo de animais Nelore ao longo da gestação e em animais não gestantes. Foram coletados ovários com corpos lúteos de 24 animais abatidos em frigorífico. Os animais foram distribuídos em dois grupos: gestantes e não gestantes. A idade gestacional foi determinada pela medição do comprimento apicocaudal do feto. Os ovários foram distribuídos segundo o trimestre gestacional: primeiro - gestação de até 90 dias; segundo - de 91 a 180 dias; e terceiro - de 181 a 270 dias. Os corpos lúteos, processados para inclusão em paraplast, foram avaliados em microscópio de luz. Na proporção volumétrica do corpo lúteo, os constituintes avaliados foram citoplasma e núcleo de células lúteas, tecido conjuntivo e fibroblastos, células endoteliais e pericitos e vasos sanguíneos. A proporção volumétrica de citoplasma de células lúteas reduziu de 46,1±2,8% para 37,9±3,5% e a de núcleo de células lúteas reduziu de 9,2±1,0% para 6,2±1,0%, do primeiro para o segundo trimestre. A proporção de tecido conjuntivo e fibroblastos aumentou de 20,9±5,4%, no primeiro trimestre, para 34,0±4,2%, no segundo trimestre. Grânulos citoplasmáticos foram evidenciados pelas técnicas histoquímicas xylidine ponceau e azul de bromofenol, que indicam sua provável composição proteica. A quantidade de células maiores com grânulos aumentou significativamente de 2,3±1,9%, no primeiro trimestre, para 25,5±20,3%, no segundo. A proporção volumétrica de citoplasma e núcleo de células lúteas diminuiu ao longo da gestação, e a de tecido conjuntivo aumentou. A quantidade de células lúteas maiores contendo grânulos também aumentou ao longo da gestação.

  19. An original SERPINA3 gene cluster: Elucidation of genomic organization and gene expression in the Bos taurus 21q24 region

    Directory of Open Access Journals (Sweden)

    Ouali Ahmed

    2008-04-01

    Full Text Available Abstract Background The superfamily of serine proteinase inhibitors (serpins is involved in numerous fundamental biological processes as inflammation, blood coagulation and apoptosis. Our interest is focused on the SERPINA3 sub-family. The major human plasma protease inhibitor, α1-antichymotrypsin, encoded by the SERPINA3 gene, is homologous to genes organized in clusters in several mammalian species. However, although there is a similar genic organization with a high degree of sequence conservation, the reactive-centre-loop domains, which are responsible for the protease specificity, show significant divergences. Results We provide additional information by analyzing the situation of SERPINA3 in the bovine genome. A cluster of eight genes and one pseudogene sharing a high degree of identity and the same structural organization was characterized. Bovine SERPINA3 genes were localized by radiation hybrid mapping on 21q24 and only spanned over 235 Kilobases. For all these genes, we propose a new nomenclature from SERPINA3-1 to SERPINA3-8. They share approximately 70% of identity with the human SERPINA3 homologue. In the cluster, we described an original sub-group of six members with an unexpected high degree of conservation for the reactive-centre-loop domain, suggesting a similar peptidase inhibitory pattern. Preliminary expression analyses of these bovSERPINA3s showed different tissue-specific patterns and diverse states of glycosylation and phosphorylation. Finally, in the context of phylogenetic analyses, we improved our knowledge on mammalian SERPINAs evolution. Conclusion Our experimental results update data of the bovine genome sequencing, substantially increase the bovSERPINA3 sub-family and enrich the phylogenetic tree of serpins. We provide new opportunities for future investigations to approach the biological functions of this unusual subset of serine proteinase inhibitors.

  20. The prey pathway: a regional history of cattle (Bos taurus and pig (Sus scrofa domestication in the northern Jordan Valley, Israel.

    Directory of Open Access Journals (Sweden)

    Nimrod Marom

    Full Text Available The faunal assemblage from the 9(th-8(th millennium BP site at Sha'ar Hagolan, Israel, is used to study human interaction with wild suids and cattle in a time period just before the appearance of domesticated animals of these species in the Jordan Valley. Our results, based on demographic and osteometric data, indicate that full domestication of both cattle and suids occurred at the site during the 8(th millennium. Importantly, domestication was preceded in both taxa by demographic and metric population parameters indicating severe overhunting. The possible role of overhunting in shaping the characteristics of domesticated animals and the social infrastructure to ownership of herds is then explored.

  1. Effects of Bos taurus autosome 9-located quantitative trait loci haplotypes on enzymatic mastitis indicators of milk from dairy cows experimentally inoculated with Escherichia coli

    DEFF Research Database (Denmark)

    Sørensen, Lars Peter; Engberg, Ricarda Greuel; Løvendahl, Peter

    2015-01-01

    The aim of this study was to investigate the effect of a quantitative trait locus associated with mastitis caused by Escherichia coli, with one haplotype being more susceptible (HH) and another being more resistant (HL) to E. coli mastitis, on the activity of 4 inflammatory related milk enzymes. ...

  2. Genetic variations in insulin-like growth factor binding protein acid labile subunit gene associated with growth traits in beef cattle (Bos taurus) in China.

    Science.gov (United States)

    Liu, Yu; Duan, Xiaoyan; Liu, Xiaolin; Guo, Jiazhong; Wang, Hongliang; Li, Zhixiong; Yang, Jing

    2014-05-01

    The insulin-like growth factor binding protein acid labile subunit (IGFALS) gene encodes a serum protein that binds to IGFs and regulates growth, development, and other physiological processes. We have found that sequencing of the IGFALS gene in Chinese Qinchuan beef cattle (n=300) revealed four SNP loci in exon two of the gene (g1219: T>C, g1893: T>C, g2612: G>A, and g2696: A>G). The SNP g2696: A>G resulted in a change from asparagine to aspartic acid (p. N574D) in the leucine-rich repeat region in the carboxyl-terminal domain of IGFALS. Four SNPs were in low linkage disequilibrium, and 12 different haplotypes were identified in the population. Association analysis suggested that SNP g1219: T>C had a significant association with hip width (PG displayed a significant association with stature (Pgrowth traits of bovine, and may serve as a genetic marker for selection of beef cattle for growth traits, including stature. Copyright © 2014 Elsevier B.V. All rights reserved.

  3. Influence of different concentrations of the glycol in the number of granulosa cells and morphometry of the preantral ovarian follicles of Bos taurus indicus, Linnaeus, 1758

    OpenAIRE

    Luna, Hélder Silva e; Lijeron, Luciana Alves; Costa, Rafaela Nelson da

    2010-01-01

    A criopreservação de folículos ovarianos pré-antrais pode ajudar na conservação de muitas espécies domésticas e selvagens. Neste trabalho, objetivou-se verificar o efeito do etileno glicol, em diferentes concentrações, na morfometria e número de células da granulosa de folículos pré-antrais inclusos em tecido ovariano bovino. O teste de toxicidade foi realizado com fragmentos ovarianos expostos ao etileno glicol em concentrações de 10, 20 ou 40%. O tecido foi analisado por técnica histológica...

  4. Studies on the food and feeding habits of Gaur Bos taurus H. Smith (Mammalia: Artiodactyla: Bovidae in two protected areas of Goa

    Directory of Open Access Journals (Sweden)

    S.D. Gad

    2009-02-01

    Full Text Available Feeding habits and diet composition of gaur were studied at Bhagvan Mahaveer Wildlife Sanctuary and Mollem National Park, Goa. Altogether, 32 species of plants belonging to 17 families constitute the gaur diet. The fruits, leaves, young shoots, bark and flowers are consumed, with a preference for leaves (87%. In summer gaur also consumed the bark of cashew (Anacardium occidentale and teak (Tectona grandis trees. Strong association was observed between food preference and season (chi-square=12.94; p=0.001. Peak feeding activity was observed early in the morning (0630 to 0830 hr and in the evening (1730 to 1845 hr. During hot hours of the day (1330 to 1530 hr, animals were found resting in the shade of large trees.

  5. Metal exposure and accumulation patterns in free-range cows (Bos taurus) in a contaminated natural area: Influence of spatial and social behavior

    NARCIS (Netherlands)

    Roggeman, S.; Brink, van den N.W.; Praet, van N.; Blust, R.; Bervoets, L.

    2013-01-01

    Possible effects of spatial metal distribution, seasonal-, ecological- and ethological parameters, on the metal exposure of cows were investigated. Therefore the habitat use, vegetation selection and foraging behavior of two free ranging Galloway herds in a metal polluted nature reserve were

  6. Metal exposure and accumulation patterns in free-range cows (Bos taurus) in a contaminated natural area: Influence of spatial and social behavior

    International Nuclear Information System (INIS)

    Roggeman, Saskia; Brink, Nico van den; Van Praet, Nander; Blust, Ronny; Bervoets, Lieven

    2013-01-01

    Possible effects of spatial metal distribution, seasonal-, ecological- and ethological parameters, on the metal exposure of cows were investigated. Therefore the habitat use, vegetation selection and foraging behavior of two free ranging Galloway herds in a metal polluted nature reserve were observed. Metal concentrations in soil, vegetation, hair, blood and feces were measured. Although both herds lived in the same reserve, their metal exposure differed significantly. A high consumption of soft rush by herd 1 during winter for instance was responsible for a large increase in daily Cd intake. The results of this study suggest that the exposure and health risks of large grazers can probably not only be predicted by a general monitoring of soil and vegetation pollution. Also detailed information about the occurring vegetation types, spatial habitat use together with the social- and foraging behavior and diet selection of the species need to be studied. - Highlights: ► Vegetation selection, social behavior, and seasonal variation determine exposure. ► Soft rush consumption highly increased daily Cd intake during winter. ► Most Cd and Pb levels in vegetation exceeded the maximum tolerable feed levels. - This study reveals that spatial heterogeneity and foraging behavior play a more important role in the metal exposure pattern of large grazers than generally is presumed.

  7. The Behavioural Responses of Beef Cattle (Bos taurus to Declining Pasture Availability and the Use of GNSS Technology to Determine Grazing Preference

    Directory of Open Access Journals (Sweden)

    Jaime Manning

    2017-05-01

    Full Text Available Combining technologies for monitoring spatial behaviour of livestock with technologies that monitor pasture availability, offers the opportunity to improve the management and welfare of extensively produced beef cattle. The aims of the study were to investigate changes to beef cattle behaviour as pasture availability changed, and to determine whether Global Navigation Satellite System (GNSS technology could determine livestock grazing preference and hence improve pasture management and paddock utilisation. Data derived from GNSS collars included distance travelled and location in the paddock. The latter enabled investigation of individual animal interactions with the underlying Normalised Difference Vegetation Index (NDVI and pasture biomass of the paddock. As expected, there was a significant temporal decrease in NDVI during the study and an increase in distance travelled by cattle (P < 0.001; r2 = 0.88. The proportion of time budget occupied in grazing behaviour also increased (P < 0.001; r2 = 0.71. Cattle showed a partial preference for areas of higher pasture biomass/NDVI, although there was a large amount of variation over the course of the study. In conclusion, cattle behaviour changed in response to declining NDVI, highlighting how technologies that monitor these two variables may be used in the future as management tools to assist producers better manage cattle, to manipulate grazing intensity and paddock utilisation.

  8. Taxonomy Icon Data: cattle [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available rus_L.png Bos_taurus_NL.png Bos_taurus_S.png Bos_taurus_NS.png http://biosciencedbc.jp/taxonomy_icon/icon.cg...i?i=Bos+taurus&t=L http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Bos+taurus&t=NL http://biosciencedbc.jp/taxonom...y_icon/icon.cgi?i=Bos+taurus&t=S http://biosciencedbc.jp/taxonomy_icon/ico...n.cgi?i=Bos+taurus&t=NS http://togodb.biosciencedbc.jp/togodb/view/taxonomy_icon_comment_en?species_id=28 ...

  9. AVALIAÇÕES DA PARASITEMIA, DO HEMATÓCRITO E DOS NÍVEIS BIOQUÍMICOS SÉRICOS, DE BEZERROS NELORE (Bos indicus, INOCULADOS COM ISOLADOS DE Babesia bigemina (Smith & Kilborne, 1893 DAS REGIÕES SUL, SUDESTE, CENTRO-OESTE, NORDESTE E NORTE DO BRASIL

    Directory of Open Access Journals (Sweden)

    Maria Aparecida Schenki

    2006-10-01

    Full Text Available Avaliaram-se a parasitemia, o hematócrito e os níveis séricos de bilirrubina total, creatinina, uréia e colesterol de bezerros Nelore (Bos indicus inoculados com isolados de Babesia bigemina das cinco regiões fisiográficas do Brasil. Constatou-se que os diferentes isolados desenvolveram baixa parasitemia, nos animais experimentalmente inoculados, diminuição do colesterol sérico, e que não houve variações nos níveis de bilirrubina, creatinina e uréia sérica. PALAVRAS-CHAVE: Bos indicus, Babesia bigemina, parasitemia, bioquímica sérica.

  10. Etniske minoriteters bosætning

    DEFF Research Database (Denmark)

    Børresen, Sølvi Karin

    Etniske minoriteter synes at samles i bestemte dele af boligbestanden og i bestemte boligområder. Hvorfor forholder det sig sådan? Forskningen viser, at forklaringerne er sammensatte. I denne rapport gøres rede for udvalgte danske og udenlandske undersøgelser vedrørende etniske minoriteters...

  11. PREWEANING GROWTH OF BRTTISH. BOS INDICUS ...

    African Journals Online (AJOL)

    Lrrr-rcd r dam typc, stre-brecd x ycar. srrt'-breed x scir$on and darrr-typc \\ year S4intlicant regrcsslon on day ol'birth within thc carlving scason. rndicatcd that brrth rna\\\\. avorage darly garn and adjustcd 210 day nla{\\ lncreased as thc calvmg season progressed. Meaningful relationships between preweaning growth and.

  12. (obese) gene of mithun (Bos frontalis)

    African Journals Online (AJOL)

    Nishant-3

    The present study was undertaken with the objectives of sequencing, characterization and single nucleotide polymorphisms (SNPs) identification of mithun leptin gene. The mithun leptin gene (3420 bp) was sequenced, compared with other species and phylogenetic tree were constructed. Single-strand conformation ...

  13. ORF Alignment: NT_033779 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available rEMBL::g2674107:GUANINE NUCLEOTIDE-EXCHANGE ... PROTEIN. organism:BOS TAURUS (BOVINE). dbxref:GenBank...; ... AF023451; g2674107; -.'', species:''BOS TAURUS ... Length = 185 ... Query: 586 METGIELFNRKP

  14. Efeito do flunixin meglumine, da somatotropina recombinante bovina e/ou da gonadotrofina coriônica humana na redução da mortalidade embrionária em vacas nelore (Bos taurus indicus)

    OpenAIRE

    Rossetti, Rita Cristina [UNESP

    2010-01-01

    Estratégias farmacológicas são empregadas para reduzir a mortalidade embrionária em fêmeas bovinas. Objetivou se comparar o efeito do Flunixin Meglumine (FM), Somatotropina Recombinante Bovina (bST) e/ou Gonadotrofina Coriônica Humana (hCG) na redução da mortalidade embrionária em vacas Nelore no período compreendido entre o 15º e 19º dias da gestação, baseando se na taxa de concepção aos 40 dias de gestação. A hipótese é que vacas tratadas com FM, bST e/ou hCG, apresentam menor mortalidade e...

  15. Determinación de las condiciones de crecimiento in vitro de una cepa probiótica (Lactobacillus delbruekii subsp. bulgaricus aislada del tracto intestinal de terneros (Bos taurus

    Directory of Open Access Journals (Sweden)

    José Ávila

    2010-07-01

    Full Text Available El objetivo de este estudio fue conocer el efecto de la temperatura, pH y la concentración de inóculo sobre el crecimiento in vitro de una cepa probiótica (Lactobacillus delbruekii subsp. bulgaricus aislada del intestino delgado de terneros. Para ello se utilizó en el primer caso, el método de superficie de respuesta para determinar las condiciones de pH y temperatura óptimas de la cepa, y en el segundo, un diseño experimental completamente aleatorizado considerando el factor concentración de inóculo inicial a seis niveles, donde el crecimiento (en medio De Man, Rogosa y Sharpe expresado en unidades de Absorbancia, constituyó la variable respuesta; presentándose una máxima respuesta (0,806 uA para 5 % de concentración inicial de inóculo. Los valores de pH y temperatura utilizados permitieron el establecimiento de una zona óptima de crecimiento in vitro en los siguientes intervalos, pH entre 5,1 y 5,6; y temperatura entre 38,0 y 41,5 °C, donde el máximo crecimiento se obtuvo a pH 5,31 y a 39,38 °C. Por otro lado se encontraron incrementos significativos del crecimiento in vitro (p < 0,05 a medida que se utiliza menor concentración de inóculo inicial. Con la información obtenida se espera incrementar los rendimientos de la cepa y así promover la producción de productos probióticos para el consumo animal en Venezuela.

  16. Determinación de las condiciones de crecimiento in vitro de una cepa probiótica (Lactobacillus delbruekii subsp. bulgaricus aislada del tracto intestinal de terneros (Bos taurus

    Directory of Open Access Journals (Sweden)

    José Ávila

    2010-06-01

    Full Text Available El objetivo de este estudio fue conocer el efecto de la temperatura, pH y la concentración de inóculo sobre el crecimiento in vitro de una cepa probiótica (Lactobacillus delbruekii subsp. bulgaricus aislada del intestino delgado de terneros. Para ello se utilizó en el primer caso, el método de superficie de respuesta para determinar las condiciones de pH y temperatura óptimas de la cepa, y en el segundo, un diseño experimental completamente aleatorizado considerando el factor concentración de inóculo inicial a seis niveles, donde el crecimiento (en medio De Man, Rogosa y Sharpe expresado en unidades de Absorbancia, constituyó la variable respuesta; presentándose una máxima respuesta (0,806 uA para 5 % de concentración inicial de inóculo. Los valores de pH y temperatura utilizados permitieron el establecimiento de una zona óptima de crecimiento in vitroen los siguientes intervalos, pH entre 5,1 y 5,6; y temperatura entre 38,0 y 41,5 °C, donde el máximo crecimiento se obtuvo a pH 5,31 y a 39,38 °C. Por otro lado se encontraron incrementos significativos del crecimiento in vitro (p < 0,05 a medida que se utiliza menor concentración de inóculo inicial. Con la información obtenida se espera incrementar los rendimientos de la cepa y así promover la producción de productos probióticos para el consumo animal en Venezuela.

  17. Isolation and biological and molecular characterization of Neospora caninum (NC-SP1) from a naturally infected adult asymptomatic cattle (Bos taurus) in the state of São Paulo, Brazil.

    Science.gov (United States)

    Oliveira, Solange; Soares, Rodrigo Martins; Aizawa, Juliana; Soares, Herbert Sousa; Chiebao, Daniela Pontes; Ortega-Mora, Luis Miguel; Regidor-Cerrillo, Javier; Silva, Natália Quadros Bressa; Gennari, Solange Maria; Pena, Hilda Fátima Jesus

    2017-05-01

    The biological and genetic diversity of Neospora caninum is very limited because of availability of only a few viable isolates worldwide. This study describes the isolation and biological and molecular characterization of a new viable isolate of N. caninum (NC-SP1), from a cattle in Brazil. Approximately 400 g of brain from a naturally infected adult male cattle from an abattoir was fed to a 2-month-old dog. Neospora-like oocysts were observed on day 7 post-inoculation (PI) and the duration of oocyst shedding was 14 days. The DNA obtained from oocysts was characterized molecularly and the final sequence was 99% identical to homologous sequences of N. caninum available in GenBank®. For bioassay, gerbils (Meriones unguiculatus) were orally inoculated with 10 100 and 1000 oocysts; all gerbils remained clinically normal but developed N. caninum antibodies 14 days PI. Cell culture isolation was successful using the brain homogenate from one of the gerbils and tachyzoites were observed 24 days PI. Microsatellite genotyping revealed a unique genetic profile for this new reference isolate.

  18. Influência de diferentes concentrações de etileno glicol nO número de células da granulosa e morfometria de folículos pré-antrais inclusos em tecido ovariano de Bos taurus indicus, Linnaeus, 1758 Influence of different concentrations of the glycol in the number of granulosa cells and morphometry of the preantral ovarian follicles of Bos taurus indicus, Linnaeus, 1758

    OpenAIRE

    Hélder Silva e Luna; Luciana Alves Lijeron; Rafaela Nelson da Costa

    2010-01-01

    A criopreservação de folículos ovarianos pré-antrais pode ajudar na conservação de muitas espécies domésticas e selvagens. Neste trabalho, objetivou-se verificar o efeito do etileno glicol, em diferentes concentrações, na morfometria e número de células da granulosa de folículos pré-antrais inclusos em tecido ovariano bovino. O teste de toxicidade foi realizado com fragmentos ovarianos expostos ao etileno glicol em concentrações de 10, 20 ou 40%. O tecido foi analisado por técnica histológica...

  19. Genome-wide identification of breed-informative single-nucleotide ...

    African Journals Online (AJOL)

    Avhashoni AA. Zwane

    2016-09-20

    Sep 20, 2016 ... Sanga cattle, which belong to the subspecies Bos taurus africanus. Sanga cattle breeds originated from eastern and northern Africa, the home of Sanga and Zenga cattle. Sanga are possibly crossbreds between the indigenous humpless cattle (Bos taurus) and Zebu (Bos indicus), whereas Zenga are ...

  20. Genetic diversity in selected stud and commercial herds of the ...

    African Journals Online (AJOL)

    Martina

    2014-08-29

    Aug 29, 2014 ... The Afrikaner cattle breed (Bos taurus africanus) is an indigenous South African breed of the “Sanga” type. Sanga cattle are generally found in Southern Africa and are a mixture of the Bos indicus and Bos taurus breeds (Payne & Wilson, 1999). Sanga cattle therefore contain genetic material that has been.

  1. Growth and efficiency of young Brahman, Bonsmara and ...

    African Journals Online (AJOL)

    Frisch & Vercoe (1977) found that Brahman-cross steers had a lower voluntary food intake per kilogram live mass, as well as a lower fasting metabolism per kilogram live mass, com- pare:d to Bos taurus steers. Furthermore, Bos indicus breeds show a better growth rate on roughage than Bos taurus breeds. (Fri:>eh, 1976).

  2. Dicty_cDB: Contig-U16181-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s taurus Y Chr NOVECTOR CH240-507F20 (Children'... 48 0.79 1 ( AC232941 ) Bos taurus Y Chr NOVECTOR CH240-255J15 (Children...'... 48 0.79 1 ( AC232940 ) Bos taurus Y Chr NOVECTOR CH240-62I11 (Children's... 48 0.79 1 ( A...C232929 ) Bos taurus Y Chr NOVECTOR CH240-291F15 (Children'... 48 0.79 1 ( AC232768 ) Bos taurus Y Chr NOVECTOR CH240-460C15 (Childre...n'... 48 0.79 1 ( AC232755 ) Bos taurus Y Chr NOVECTOR CH240-409J7 (Children...'s... 48 0.79 1 ( AC232753 ) Bos taurus Y Chr NOVECTOR CH240-45P20 (Children's... 48 0.7

  3. NCBI nr-aa BLAST: CBRC-MMUR-01-1320 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-1320 ref|XP_001250098.1| PREDICTED: similar to olfactory receptor 586 (predict...ed) [Bos taurus] ref|XP_001787946.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos t...aurus] ref|XP_001788047.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001250098.1 1e-131 73% ...

  4. NCBI nr-aa BLAST: CBRC-GGOR-01-0397 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0397 ref|XP_001250098.1| PREDICTED: similar to olfactory receptor 586 (predict...ed) [Bos taurus] ref|XP_001787946.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos t...aurus] ref|XP_001788047.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001250098.1 1e-151 85% ...

  5. NCBI nr-aa BLAST: CBRC-MMUR-01-1132 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-1132 ref|XP_001250098.1| PREDICTED: similar to olfactory receptor 586 (predict...ed) [Bos taurus] ref|XP_001787946.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos t...aurus] ref|XP_001788047.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001250098.1 3e-53 70% ...

  6. NCBI nr-aa BLAST: CBRC-MLUC-01-0520 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0520 ref|XP_001250098.1| PREDICTED: similar to olfactory receptor 586 (predict...ed) [Bos taurus] ref|XP_001787946.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos t...aurus] ref|XP_001788047.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001250098.1 6e-62 69% ...

  7. NCBI nr-aa BLAST: CBRC-STRI-01-2372 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2372 ref|XP_001250098.1| PREDICTED: similar to olfactory receptor 586 (predict...ed) [Bos taurus] ref|XP_001787946.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos t...aurus] ref|XP_001788047.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001250098.1 1e-127 71% ...

  8. NCBI nr-aa BLAST: CBRC-MMUR-01-0605 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-0605 ref|XP_001250098.1| PREDICTED: similar to olfactory receptor 586 (predict...ed) [Bos taurus] ref|XP_001787946.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos t...aurus] ref|XP_001788047.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001250098.1 1e-135 74% ...

  9. NCBI nr-aa BLAST: CBRC-PHAM-01-0010 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0010 ref|XP_001250098.1| PREDICTED: similar to olfactory receptor 586 (predict...ed) [Bos taurus] ref|XP_001787946.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos t...aurus] ref|XP_001788047.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001250098.1 6e-65 81% ...

  10. NCBI nr-aa BLAST: CBRC-OPRI-01-0130 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0130 ref|XP_001250098.1| PREDICTED: similar to olfactory receptor 586 (predict...ed) [Bos taurus] ref|XP_001787946.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos t...aurus] ref|XP_001788047.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001250098.1 1e-149 83% ...

  11. NCBI nr-aa BLAST: CBRC-PVAM-01-1099 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-1099 ref|XP_001250098.1| PREDICTED: similar to olfactory receptor 586 (predict...ed) [Bos taurus] ref|XP_001787946.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos t...aurus] ref|XP_001788047.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001250098.1 9e-88 57% ...

  12. NCBI nr-aa BLAST: CBRC-STRI-01-2166 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2166 ref|XP_001250098.1| PREDICTED: similar to olfactory receptor 586 (predict...ed) [Bos taurus] ref|XP_001787946.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos t...aurus] ref|XP_001788047.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001250098.1 1e-140 84% ...

  13. NCBI nr-aa BLAST: CBRC-MEUG-01-0695 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-0695 ref|XP_001250098.1| PREDICTED: similar to olfactory receptor 586 (predict...ed) [Bos taurus] ref|XP_001787946.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos t...aurus] ref|XP_001788047.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001250098.1 2e-85 72% ...

  14. NCBI nr-aa BLAST: CBRC-PCAP-01-0275 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-0275 ref|XP_001250098.1| PREDICTED: similar to olfactory receptor 586 (predict...ed) [Bos taurus] ref|XP_001787946.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos t...aurus] ref|XP_001788047.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001250098.1 1e-101 71% ...

  15. NCBI nr-aa BLAST: CBRC-STRI-01-2300 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2300 ref|XP_001250098.1| PREDICTED: similar to olfactory receptor 586 (predict...ed) [Bos taurus] ref|XP_001787946.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos t...aurus] ref|XP_001788047.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001250098.1 8e-44 81% ...

  16. NCBI nr-aa BLAST: CBRC-PVAM-01-0460 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0460 ref|XP_001250098.1| PREDICTED: similar to olfactory receptor 586 (predict...ed) [Bos taurus] ref|XP_001787946.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos t...aurus] ref|XP_001788047.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001250098.1 1e-149 84% ...

  17. NCBI nr-aa BLAST: CBRC-MDOM-04-0282 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-04-0282 ref|XP_001250098.1| PREDICTED: similar to olfactory receptor 586 (predict...ed) [Bos taurus] ref|XP_001787946.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos t...aurus] ref|XP_001788047.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001250098.1 1e-125 69% ...

  18. NCBI nr-aa BLAST: CBRC-VPAC-01-1445 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1445 ref|XP_001250098.1| PREDICTED: similar to olfactory receptor 586 (predict...ed) [Bos taurus] ref|XP_001787946.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos t...aurus] ref|XP_001788047.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001250098.1 1e-116 76% ...

  19. NCBI nr-aa BLAST: CBRC-PCAP-01-0607 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-0607 ref|XP_001250098.1| PREDICTED: similar to olfactory receptor 586 (predict...ed) [Bos taurus] ref|XP_001787946.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos t...aurus] ref|XP_001788047.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001250098.1 1e-108 65% ...

  20. Gene : CBRC-TTRU-01-1304 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 1| PREDICTED: similar to vomeronasal 1 receptor, K1 [Bos taurus] 2e-45 50% MILMHLTLANIMTILFRGIQDAMSSFGIWPIMG...DIGCKSLLYIHRVTQGISLCTISVLNTFQAIRISPRNSKRAWLKPQISTCILPSFLFFWVINMLIYFWIITNNKAVTNASAAQPGYSLAYCTTKQGGYRVSAVFQSAMLI*NFLCINLMIWTSGYMVMLLYNHHKTVQNLRGNNFSPRLSPETKLPTPFCS ...

  1. Revisiting AFLP fingerprinting for an unbiased assessment of genetic structure and differentiation of taurine and zebu cattle

    NARCIS (Netherlands)

    Utsunomiya, Yuri T.; Bomba, Lorenzo; Lucente, Giordana; Colli, Licia; Negrini, Riccardo; Lenstra, Johannes A.; Erhardt, Georg; Garcia, José F.; Ajmone-Marsan, Paolo; Moazami-Goudarzi, K.; Williams, J.; Wiener, P.; Olsaker, I.; Kantanen, J.; Dunner, S.; Cañón, J.; Rodellar, C.; Martín-Burriel, I.; Valentini, A.; Zanotti, M.; Holm, L. E.; Eythorsdottir, E.; Mommens, G.; Polygen, Van Haeringen; Nijman, I. J.; Dolf, G.; Bradley, D. G.

    2014-01-01

    Background: Descendants from the extinct aurochs (Bos primigenius), taurine (Bos taurus) and zebu cattle (Bos indicus) were domesticated 10,000 years ago in Southwestern and Southern Asia, respectively, and colonized the world undergoing complex events of admixture and selection. Molecular data, in

  2. BLUE OCEAN STRATEGY (BOS SEBAGAI PARADIGMA BARU MANAJEMEN PENDIDIKAN ISLAM

    Directory of Open Access Journals (Sweden)

    Ikhwan Fuad

    2016-08-01

    Full Text Available The focus of this article is to describe the Blue Ocean Strategy as a new paradigm of Islamic education management. the author seeks to elaborate on how the adoption of the Blue Ocean strategy of the business world to the world of education and answered the principles of what is accepted and rejected away from the theory. Adoption of blue ocean strategy is done by applying the universal principles are : among others reconstruct market boundaries, focus on the big picture rather than numbers, reach beyond existing demand, perform a series of strategies with appropriate, efforts to overcome organizational constraints and integrate execution into strategy. The principles of Blue Ocean Strategy Indicators that can be absorbed is an indicator that focuses gave excellent service and were not absorbed is a strong indicator of economic motivation. Generally, Blue Ocean Strategy quite well applied as a management paradigm of Islamic education.

  3. Genetic diversity and bottleneck analysis of Yunnan mithun ( Bos ...

    African Journals Online (AJOL)

    Despite the smaller population size, the normal L-shaped distribution of allelic frequencies without any mode-shift indicate the absence of genetic bottleneck in Yunnan mithun population, suggesting that Yunnan mithun population might moderately have underwent gene introgression from zebu and yellow cattle.

  4. Broad-band BOS (BBYB) development and calibration in Taiwan

    Science.gov (United States)

    Lin, C. R.; Wang, C. C.; Kuo, B. Y.; Chen, P.; Jang, J. P.; Chang, H.; Laio, Y. C.; Chang, K. H.; Lin, F. S.

    2016-12-01

    Since 2009, combine with Academia Sinica, National Applied Research Laboratories and National Sun Yat-sen University formed ocean bottom seismograph (OBS) development team to develop sub-broadband OBS (called Yardbird OBS). Through a series deploy experiment at seafloor offshore Taiwan that got a lot of data can be used to study plate tectonics, seismic activity, source characteristics. Nowadays they have pretty good results already. Due to bandwidth limitations of the Yardbird OBS that inadequate to use for analyze global-scale earthquake. Therefor developing broadband ocean bottom seismograph is an important goal for the development team. Currently the broadband OBS (called BBYB) design and construction have completed the initial experiment phase. Due to underwater instruments always got high risk. Something accidentally making equipment sank in the sea cannot be recovery. Even recovery of equipment may also be causing poor performance because there is no data record. It cannot be to accomplish the experiment mission. In order to improve the OBS performance, avoid OBS dis-recovery or data collection is incomplete, must be sure all OBS's each component (such as seismic data recording device, balanced body, sonar dashboard, instruments and internal wiring ...) with well-done quality before assembly. Each component could go through very rigorous testing, strict and pick out the good components in the assembly process. Be sure all of produce the OBS under the water after a long deployment could successful recovery and got valuable data. In this presentation we will show a serial testing procedure and results for quality each BBYB component. Such as: Data logger: digitizer sensitivity, sampling rate, clock timing. Acoustic controller: function of Enable, Disable, Range, Release 1, Release 2, Option 1(Release disable). Air pressure gauge for glass ball: accuracy. A check lists of connector wiring check for assembling instrument. Design deploy and recovery procedure for operation on deck. We hope through repeated testing to ensure perfect performance of BBYB and apply the testing concept to another equipment for improve instruments performance. Keywords: ocean bottom seismograph (OBS); Data logger; Acoustic controller; Air pressure gauge.

  5. Hvor bosætter folk sig i Kumasi, Ghana?

    DEFF Research Database (Denmark)

    Eskemose Andersen, Jørgen; Andreasen, Jørgen

    2002-01-01

    overklassen. Det forunderlige og besynderlige er fraværet af store slumråder som ellers ses overalt i den 3 Verdens storbyer. Der er en del slum i den indre del af byen og der bor mange fattige folk i de såkaldte gårdhuse som er så karakterisek for regionen, men det store spørgsmål er hvor den stadige vækst...

  6. Culture-independent analysis of microflora in Gayals (Bos frontalis ...

    African Journals Online (AJOL)

    STORAGESEVER

    2010-05-10

    May 10, 2010 ... environmental prokaryotic diversity, this molecular approach .... feeding higher termite, which indicated that they played .... Eukaryotic diversity. The analysis of eukaryotic diversity of the Gayal feces was operated as in the case of bacteria analysis. The clone sequences, obtained from the 18S rDNA library,.

  7. ANALISA AKUNTABILITAS DAN TRANSPARANSI TENTANG IMPLEMENTASI KEBIJAKAN PENGELOLAAN BOS

    Directory of Open Access Journals (Sweden)

    Nurul Hariswati

    2015-01-01

    Full Text Available This research was conducted with the aim to analyse the implementation of the accountability and transparency financial management which the source stemming from government. The approach used is a case study of indepth interview from financial manager, head master, and stakeholders. The results of this research show that first appeared as constraints and not regulated and obligations of private schools in terms of taxation. Second, the scale of priority importance of accountability between the financial manager and head master has different values so as conflicts of interest. Third, the implementation of transparency development from the publication such as via the website, call center, facebook. The fourth, the Government has n ot set a standard policy to use of the grant allocations.

  8. Serological evidence for brucellosis in Bos indicus in Nigeria

    NARCIS (Netherlands)

    Bertu, Wilson J.; Gusi, Amahyel M.; Hassan, Moses; Mwankon, Esther; Ocholi, Reuben A.; Ior, Daniel D.; Husseini, Bakari A.; Ibrahim, Gideon; Abdoel, Theresia H.; Smits, Henk L.

    2012-01-01

    Purpose Nigeria is the largest cattle-rearing nation in Africa with most animals kept under traditional husbandry practices. While bovine brucellosis does not receive much attention, a relatively high seroprevalence is found in samples submitted for laboratory testing. The aim of the study was to

  9. Bovine gene polymorphisms related to fat deposition and meat tenderness

    Directory of Open Access Journals (Sweden)

    Marina R.S. Fortes

    2009-01-01

    Full Text Available Leptin, thyroglobulin and diacylglycerol O-acyltransferase play important roles in fat metabolism. Fat deposition has an influence on meat quality and consumers' choice. The aim of this study was to determine allele and genotype frequencies of polymorphisms of the bovine genes, which encode leptin (LEP, thyroglobulin (TG and diacylglycerol O-acyltransferase (DGAT1. A further objective was to establish the effects of these polymorphisms on meat characteristics. We genotyped 147 animals belonging to the Nelore (Bos indicus, Canchim (5/8 Bos taurus + 3/8 Bos indicus, Rubia Gallega X Nelore (1/2 Bos taurus + 1/2 Bos indicus, Brangus Three-way cross (9/16 Bos taurus + 7/16 Bos indicus and Braunvieh Three-way cross (3/4 Bos taurus + 1/4 Bos indicus breeds. Backfat thickness, total lipids, marbling score, ribeye area and shear force were fitted, using the General Linear Model (GLM procedure of the SAS software. The least square means of genotypes and genetic groups were compared using Tukey's test. Allele frequencies vary among the genetic groups, depending on Bos indicus versus Bos taurus influence. The LEP polymorphism segregates in pure Bos indicus Nelore animals, which is a new finding. The T allele of TG is fixed in Nelore, and DGAT1 segregates in all groups, but the frequency of allele A is lower in Nelore animals. The results showed no association between the genotypes and traits studied, but a genetic group effect on these traits was found. So, the genetic background remains relevant for fat deposition and meat tenderness, but the gene markers developed for Bos taurus may be insufficient for Bos indicus.

  10. NCBI nr-aa BLAST: CBRC-MDOM-11-0021 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-11-0021 ref|NP_851363.1| growth hormone releasing hormone receptor [Bos t...aurus] dbj|BAA84960.1| growth hormone-releasing hormone receptor long form [Bos taurus] NP_851363.1 1e-127 59% ...

  11. NCBI nr-aa BLAST: CBRC-BTAU-01-2615 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-2615 ref|NP_851363.1| growth hormone releasing hormone receptor [Bos t...aurus] dbj|BAA84960.1| growth hormone-releasing hormone receptor long form [Bos taurus] NP_851363.1 0.0 94% ...

  12. NCBI nr-aa BLAST: CBRC-TTRU-01-1314 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-1314 ref|NP_851363.1| growth hormone releasing hormone receptor [Bos t...aurus] dbj|BAA84960.1| growth hormone-releasing hormone receptor long form [Bos taurus] NP_851363.1 0.0 90% ...

  13. NCBI nr-aa BLAST: CBRC-PVAM-01-1440 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-1440 ref|NP_851363.1| growth hormone releasing hormone receptor [Bos t...aurus] dbj|BAA84960.1| growth hormone-releasing hormone receptor long form [Bos taurus] NP_851363.1 1e-148 72% ...

  14. Detection of quantitative trait loci in Danish Holstein cattle affecting clinical mastitis, somatic cell score, udder conformation traits, and assessment of associated effects on milk yield

    DEFF Research Database (Denmark)

    Lund, M S; Guldbrandtsen, B; Buitenhuis, A J

    2008-01-01

    either a pleiotropic QTL affecting 2 traits or 2 QTL each affecting 1 trait gave some evidence to distinguish between these models. For Bos taurus autosome 5, the most likely models were a pleiotropic QTL affecting CM2, CM3, and SCS, and a linked QTL affecting fat yield index. For Bos taurus autosome 9...

  15. NCBI nr-aa BLAST: CBRC-GACU-03-0016 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GACU-03-0016 ref|NP_776543.2| myocilin, trabecular meshwork inducible glucocor...ticoid response [Bos taurus] gb|AAI04572.1| Myocilin, trabecular meshwork inducible glucocorticoid response [Bos taurus] NP_776543.2 1e-115 50% ...

  16. NCBI nr-aa BLAST: CBRC-FRUB-02-0631 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0631 ref|NP_776543.2| myocilin, trabecular meshwork inducible glucocor...ticoid response [Bos taurus] gb|AAI04572.1| Myocilin, trabecular meshwork inducible glucocorticoid response [Bos taurus] NP_776543.2 1e-102 53% ...

  17. NCBI nr-aa BLAST: CBRC-OLAT-17-0016 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OLAT-17-0016 ref|NP_776543.2| myocilin, trabecular meshwork inducible glucocor...ticoid response [Bos taurus] gb|AAI04572.1| Myocilin, trabecular meshwork inducible glucocorticoid response [Bos taurus] NP_776543.2 1e-99 58% ...

  18. NCBI nr-aa BLAST: CBRC-PHAM-01-1454 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1454 ref|XP_875347.3| PREDICTED: similar to olfactory receptor 561 (predict...ed) [Bos taurus] ref|XP_001788816.1| PREDICTED: similar to olfactory receptor 561 (predicted) [Bos taurus] XP_875347.3 1e-146 84% ...

  19. NCBI nr-aa BLAST: CBRC-MMUR-01-1320 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-1320 ref|XP_001255625.1| PREDICTED: similar to olfactory receptor 586 (predict...ed) [Bos taurus] ref|XP_001252523.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001255625.1 1e-131 73% ...

  20. NCBI nr-aa BLAST: CBRC-PCAP-01-0275 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-0275 ref|XP_001255625.1| PREDICTED: similar to olfactory receptor 586 (predict...ed) [Bos taurus] ref|XP_001252523.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001255625.1 1e-101 71% ...

  1. NCBI nr-aa BLAST: CBRC-PVAM-01-0549 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0549 ref|XP_875347.3| PREDICTED: similar to olfactory receptor 561 (predict...ed) [Bos taurus] ref|XP_001788816.1| PREDICTED: similar to olfactory receptor 561 (predicted) [Bos taurus] XP_875347.3 1e-163 91% ...

  2. NCBI nr-aa BLAST: CBRC-MLUC-01-0520 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0520 ref|XP_001255625.1| PREDICTED: similar to olfactory receptor 586 (predict...ed) [Bos taurus] ref|XP_001252523.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001255625.1 6e-62 69% ...

  3. NCBI nr-aa BLAST: CBRC-VPAC-01-1001 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1001 ref|XP_595585.2| PREDICTED: similar to olfactory receptor Olr60 (predict...ed) [Bos taurus] ref|XP_001253182.1| PREDICTED: similar to olfactory receptor Olr60 (predicted) [Bos taurus] XP_595585.2 1e-159 90% ...

  4. NCBI nr-aa BLAST: CBRC-PHAM-01-0010 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0010 ref|XP_001255625.1| PREDICTED: similar to olfactory receptor 586 (predict...ed) [Bos taurus] ref|XP_001252523.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001255625.1 6e-65 81% ...

  5. NCBI nr-aa BLAST: CBRC-MDOM-05-0267 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-05-0267 ref|XP_589319.3| PREDICTED: similar to olfactory receptor 601 (predict...ed) [Bos taurus] ref|XP_001256154.2| PREDICTED: similar to olfactory receptor 601 (predicted) [Bos taurus] XP_589319.3 1e-130 74% ...

  6. NCBI nr-aa BLAST: CBRC-PVAM-01-0460 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0460 ref|XP_001255625.1| PREDICTED: similar to olfactory receptor 586 (predict...ed) [Bos taurus] ref|XP_001252523.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001255625.1 1e-149 84% ...

  7. NCBI nr-aa BLAST: CBRC-PVAM-01-0947 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0947 ref|XP_595062.2| PREDICTED: similar to olfactory receptor 564 (predict...ed) [Bos taurus] ref|XP_001256907.1| PREDICTED: similar to olfactory receptor 564 (predicted) [Bos taurus] XP_595062.2 3e-55 88% ...

  8. NCBI nr-aa BLAST: CBRC-MLUC-01-0034 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0034 ref|XP_875347.3| PREDICTED: similar to olfactory receptor 561 (predict...ed) [Bos taurus] ref|XP_001788816.1| PREDICTED: similar to olfactory receptor 561 (predicted) [Bos taurus] XP_875347.3 1e-41 92% ...

  9. NCBI nr-aa BLAST: CBRC-PHAM-01-1507 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1507 ref|XP_595062.2| PREDICTED: similar to olfactory receptor 564 (predict...ed) [Bos taurus] ref|XP_001256907.1| PREDICTED: similar to olfactory receptor 564 (predicted) [Bos taurus] XP_595062.2 1e-148 84% ...

  10. NCBI nr-aa BLAST: CBRC-MEUG-01-2070 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-2070 ref|XP_595585.2| PREDICTED: similar to olfactory receptor Olr60 (predict...ed) [Bos taurus] ref|XP_001253182.1| PREDICTED: similar to olfactory receptor Olr60 (predicted) [Bos taurus] XP_595585.2 1e-144 81% ...

  11. NCBI nr-aa BLAST: CBRC-MLUC-01-0986 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0986 ref|XP_589319.3| PREDICTED: similar to olfactory receptor 601 (predict...ed) [Bos taurus] ref|XP_001256154.2| PREDICTED: similar to olfactory receptor 601 (predicted) [Bos taurus] XP_589319.3 1e-146 83% ...

  12. NCBI nr-aa BLAST: CBRC-TTRU-01-0126 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0126 ref|XP_875347.3| PREDICTED: similar to olfactory receptor 561 (predict...ed) [Bos taurus] ref|XP_001788816.1| PREDICTED: similar to olfactory receptor 561 (predicted) [Bos taurus] XP_875347.3 1e-158 88% ...

  13. NCBI nr-aa BLAST: CBRC-VPAC-01-1007 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1007 ref|XP_875347.3| PREDICTED: similar to olfactory receptor 561 (predict...ed) [Bos taurus] ref|XP_001788816.1| PREDICTED: similar to olfactory receptor 561 (predicted) [Bos taurus] XP_875347.3 5e-98 56% ...

  14. NCBI nr-aa BLAST: CBRC-PCAP-01-0169 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-0169 ref|XP_589319.3| PREDICTED: similar to olfactory receptor 601 (predict...ed) [Bos taurus] ref|XP_001256154.2| PREDICTED: similar to olfactory receptor 601 (predicted) [Bos taurus] XP_589319.3 1e-134 76% ...

  15. NCBI nr-aa BLAST: CBRC-TTRU-01-0358 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0358 ref|XP_595585.2| PREDICTED: similar to olfactory receptor Olr60 (predict...ed) [Bos taurus] ref|XP_001253182.1| PREDICTED: similar to olfactory receptor Olr60 (predicted) [Bos taurus] XP_595585.2 1e-73 59% ...

  16. NCBI nr-aa BLAST: CBRC-MMUR-01-1184 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-1184 ref|XP_595062.2| PREDICTED: similar to olfactory receptor 564 (predict...ed) [Bos taurus] ref|XP_001256907.1| PREDICTED: similar to olfactory receptor 564 (predicted) [Bos taurus] XP_595062.2 1e-135 90% ...

  17. NCBI nr-aa BLAST: CBRC-MLUC-01-0432 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0432 ref|XP_589319.3| PREDICTED: similar to olfactory receptor 601 (predict...ed) [Bos taurus] ref|XP_001256154.2| PREDICTED: similar to olfactory receptor 601 (predicted) [Bos taurus] XP_589319.3 1e-139 80% ...

  18. NCBI nr-aa BLAST: CBRC-VPAC-01-1177 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1177 ref|XP_875347.3| PREDICTED: similar to olfactory receptor 561 (predict...ed) [Bos taurus] ref|XP_001788816.1| PREDICTED: similar to olfactory receptor 561 (predicted) [Bos taurus] XP_875347.3 6e-36 79% ...

  19. NCBI nr-aa BLAST: CBRC-STRI-01-2306 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2306 ref|XP_595062.2| PREDICTED: similar to olfactory receptor 564 (predict...ed) [Bos taurus] ref|XP_001256907.1| PREDICTED: similar to olfactory receptor 564 (predicted) [Bos taurus] XP_595062.2 1e-110 86% ...

  20. NCBI nr-aa BLAST: CBRC-PVAM-01-1251 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-1251 ref|XP_595585.2| PREDICTED: similar to olfactory receptor Olr60 (predict...ed) [Bos taurus] ref|XP_001253182.1| PREDICTED: similar to olfactory receptor Olr60 (predicted) [Bos taurus] XP_595585.2 1e-158 88% ...

  1. NCBI nr-aa BLAST: CBRC-MEUG-01-1697 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1697 ref|XP_875347.3| PREDICTED: similar to olfactory receptor 561 (predict...ed) [Bos taurus] ref|XP_001788816.1| PREDICTED: similar to olfactory receptor 561 (predicted) [Bos taurus] XP_875347.3 5e-96 55% ...

  2. NCBI nr-aa BLAST: CBRC-TSYR-01-1421 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-1421 ref|XP_595062.2| PREDICTED: similar to olfactory receptor 564 (predict...ed) [Bos taurus] ref|XP_001256907.1| PREDICTED: similar to olfactory receptor 564 (predicted) [Bos taurus] XP_595062.2 1e-155 87% ...

  3. NCBI nr-aa BLAST: CBRC-MMUR-01-0453 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-0453 ref|XP_875347.3| PREDICTED: similar to olfactory receptor 561 (predict...ed) [Bos taurus] ref|XP_001788816.1| PREDICTED: similar to olfactory receptor 561 (predicted) [Bos taurus] XP_875347.3 1e-157 89% ...

  4. NCBI nr-aa BLAST: CBRC-PHAM-01-1390 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1390 ref|XP_874556.1| PREDICTED: similar to olfactory receptor 49 (predict...ed) [Bos taurus] ref|XP_001255792.1| PREDICTED: similar to olfactory receptor 49 (predicted) [Bos taurus] XP_874556.1 1e-151 83% ...

  5. NCBI nr-aa BLAST: CBRC-MEUG-01-0695 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-0695 ref|XP_001255625.1| PREDICTED: similar to olfactory receptor 586 (predict...ed) [Bos taurus] ref|XP_001252523.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001255625.1 2e-85 72% ...

  6. NCBI nr-aa BLAST: CBRC-MDOM-05-0266 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-05-0266 ref|XP_589319.3| PREDICTED: similar to olfactory receptor 601 (predict...ed) [Bos taurus] ref|XP_001256154.2| PREDICTED: similar to olfactory receptor 601 (predicted) [Bos taurus] XP_589319.3 1e-130 74% ...

  7. NCBI nr-aa BLAST: CBRC-MLUC-01-0797 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0797 ref|XP_874556.1| PREDICTED: similar to olfactory receptor 49 (predict...ed) [Bos taurus] ref|XP_001255792.1| PREDICTED: similar to olfactory receptor 49 (predicted) [Bos taurus] XP_874556.1 1e-156 85% ...

  8. NCBI nr-aa BLAST: CBRC-OPRI-01-1172 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-1172 ref|XP_875347.3| PREDICTED: similar to olfactory receptor 561 (predict...ed) [Bos taurus] ref|XP_001788816.1| PREDICTED: similar to olfactory receptor 561 (predicted) [Bos taurus] XP_875347.3 1e-42 89% ...

  9. NCBI nr-aa BLAST: CBRC-MMUR-01-0509 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-0509 ref|XP_875347.3| PREDICTED: similar to olfactory receptor 561 (predict...ed) [Bos taurus] ref|XP_001788816.1| PREDICTED: similar to olfactory receptor 561 (predicted) [Bos taurus] XP_875347.3 1e-95 56% ...

  10. NCBI nr-aa BLAST: CBRC-MLUC-01-0366 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0366 ref|XP_589319.3| PREDICTED: similar to olfactory receptor 601 (predict...ed) [Bos taurus] ref|XP_001256154.2| PREDICTED: similar to olfactory receptor 601 (predicted) [Bos taurus] XP_589319.3 1e-145 83% ...

  11. NCBI nr-aa BLAST: CBRC-VPAC-01-0218 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-0218 ref|XP_609523.4| PREDICTED: similar to olfactory receptor 694 (predict...ed) [Bos taurus] ref|XP_001256288.2| PREDICTED: similar to olfactory receptor 694 (predicted) [Bos taurus] XP_609523.4 6e-61 49% ...

  12. NCBI nr-aa BLAST: CBRC-OPRI-01-1169 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-1169 ref|XP_875347.3| PREDICTED: similar to olfactory receptor 561 (predict...ed) [Bos taurus] ref|XP_001788816.1| PREDICTED: similar to olfactory receptor 561 (predicted) [Bos taurus] XP_875347.3 8e-50 71% ...

  13. NCBI nr-aa BLAST: CBRC-MEUG-01-2113 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-2113 ref|XP_589319.3| PREDICTED: similar to olfactory receptor 601 (predict...ed) [Bos taurus] ref|XP_001256154.2| PREDICTED: similar to olfactory receptor 601 (predicted) [Bos taurus] XP_589319.3 1e-128 72% ...

  14. NCBI nr-aa BLAST: CBRC-STRI-01-0147 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-0147 ref|XP_875347.3| PREDICTED: similar to olfactory receptor 561 (predict...ed) [Bos taurus] ref|XP_001788816.1| PREDICTED: similar to olfactory receptor 561 (predicted) [Bos taurus] XP_875347.3 3e-56 86% ...

  15. NCBI nr-aa BLAST: CBRC-OPRI-01-0797 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0797 ref|XP_589319.3| PREDICTED: similar to olfactory receptor 601 (predict...ed) [Bos taurus] ref|XP_001256154.2| PREDICTED: similar to olfactory receptor 601 (predicted) [Bos taurus] XP_589319.3 3e-62 66% ...

  16. NCBI nr-aa BLAST: CBRC-MEUG-01-1941 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1941 ref|XP_595585.2| PREDICTED: similar to olfactory receptor Olr60 (predict...ed) [Bos taurus] ref|XP_001253182.1| PREDICTED: similar to olfactory receptor Olr60 (predicted) [Bos taurus] XP_595585.2 1e-144 81% ...

  17. NCBI nr-aa BLAST: CBRC-TSYR-01-0987 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-0987 ref|XP_595585.2| PREDICTED: similar to olfactory receptor Olr60 (predict...ed) [Bos taurus] ref|XP_001253182.1| PREDICTED: similar to olfactory receptor Olr60 (predicted) [Bos taurus] XP_595585.2 1e-128 78% ...

  18. NCBI nr-aa BLAST: CBRC-MMUR-01-0630 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-0630 ref|XP_595585.2| PREDICTED: similar to olfactory receptor Olr60 (predict...ed) [Bos taurus] ref|XP_001253182.1| PREDICTED: similar to olfactory receptor Olr60 (predicted) [Bos taurus] XP_595585.2 1e-149 84% ...

  19. NCBI nr-aa BLAST: CBRC-PVAM-01-0746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0746 ref|XP_595062.2| PREDICTED: similar to olfactory receptor 564 (predict...ed) [Bos taurus] ref|XP_001256907.1| PREDICTED: similar to olfactory receptor 564 (predicted) [Bos taurus] XP_595062.2 1e-156 87% ...

  20. NCBI nr-aa BLAST: CBRC-MMUR-01-1137 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-1137 ref|XP_595585.2| PREDICTED: similar to olfactory receptor Olr60 (predict...ed) [Bos taurus] ref|XP_001253182.1| PREDICTED: similar to olfactory receptor Olr60 (predicted) [Bos taurus] XP_595585.2 1e-147 84% ...

  1. NCBI nr-aa BLAST: CBRC-MEUG-01-0990 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-0990 ref|XP_595585.2| PREDICTED: similar to olfactory receptor Olr60 (predict...ed) [Bos taurus] ref|XP_001253182.1| PREDICTED: similar to olfactory receptor Olr60 (predicted) [Bos taurus] XP_595585.2 1e-150 86% ...

  2. NCBI nr-aa BLAST: CBRC-TSYR-01-1380 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-1380 ref|XP_875347.3| PREDICTED: similar to olfactory receptor 561 (predict...ed) [Bos taurus] ref|XP_001788816.1| PREDICTED: similar to olfactory receptor 561 (predicted) [Bos taurus] XP_875347.3 1e-158 88% ...

  3. NCBI nr-aa BLAST: CBRC-PVAM-01-0007 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0007 ref|XP_589319.3| PREDICTED: similar to olfactory receptor 601 (predict...ed) [Bos taurus] ref|XP_001256154.2| PREDICTED: similar to olfactory receptor 601 (predicted) [Bos taurus] XP_589319.3 1e-131 80% ...

  4. NCBI nr-aa BLAST: CBRC-STRI-01-2300 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2300 ref|XP_001255625.1| PREDICTED: similar to olfactory receptor 586 (predict...ed) [Bos taurus] ref|XP_001252523.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001255625.1 8e-44 81% ...

  5. NCBI nr-aa BLAST: CBRC-MMUR-01-0605 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-0605 ref|XP_001255625.1| PREDICTED: similar to olfactory receptor 586 (predict...ed) [Bos taurus] ref|XP_001252523.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001255625.1 1e-135 74% ...

  6. NCBI nr-aa BLAST: CBRC-MLUC-01-0682 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0682 ref|XP_595062.2| PREDICTED: similar to olfactory receptor 564 (predict...ed) [Bos taurus] ref|XP_001256907.1| PREDICTED: similar to olfactory receptor 564 (predicted) [Bos taurus] XP_595062.2 1e-134 90% ...

  7. NCBI nr-aa BLAST: CBRC-STRI-01-2166 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2166 ref|XP_001255625.1| PREDICTED: similar to olfactory receptor 586 (predict...ed) [Bos taurus] ref|XP_001252523.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001255625.1 1e-140 84% ...

  8. NCBI nr-aa BLAST: CBRC-VPAC-01-0115 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-0115 ref|XP_595062.2| PREDICTED: similar to olfactory receptor 564 (predict...ed) [Bos taurus] ref|XP_001256907.1| PREDICTED: similar to olfactory receptor 564 (predicted) [Bos taurus] XP_595062.2 5e-96 89% ...

  9. NCBI nr-aa BLAST: CBRC-MDOM-04-0253 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-04-0253 ref|XP_595585.2| PREDICTED: similar to olfactory receptor Olr60 (predict...ed) [Bos taurus] ref|XP_001253182.1| PREDICTED: similar to olfactory receptor Olr60 (predicted) [Bos taurus] XP_595585.2 1e-143 81% ...

  10. NCBI nr-aa BLAST: CBRC-TSYR-01-1100 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-1100 ref|XP_589319.3| PREDICTED: similar to olfactory receptor 601 (predict...ed) [Bos taurus] ref|XP_001256154.2| PREDICTED: similar to olfactory receptor 601 (predicted) [Bos taurus] XP_589319.3 1e-104 76% ...

  11. NCBI nr-aa BLAST: CBRC-PVAM-01-0013 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0013 ref|XP_589319.3| PREDICTED: similar to olfactory receptor 601 (predict...ed) [Bos taurus] ref|XP_001256154.2| PREDICTED: similar to olfactory receptor 601 (predicted) [Bos taurus] XP_589319.3 2e-93 80% ...

  12. NCBI nr-aa BLAST: CBRC-MMUR-01-1132 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-1132 ref|XP_001255625.1| PREDICTED: similar to olfactory receptor 586 (predict...ed) [Bos taurus] ref|XP_001252523.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001255625.1 3e-53 70% ...

  13. NCBI nr-aa BLAST: CBRC-VPAC-01-0651 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-0651 ref|XP_609523.4| PREDICTED: similar to olfactory receptor 694 (predict...ed) [Bos taurus] ref|XP_001256288.2| PREDICTED: similar to olfactory receptor 694 (predicted) [Bos taurus] XP_609523.4 1e-141 82% ...

  14. NCBI nr-aa BLAST: CBRC-MEUG-01-2855 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-2855 ref|XP_589319.3| PREDICTED: similar to olfactory receptor 601 (predict...ed) [Bos taurus] ref|XP_001256154.2| PREDICTED: similar to olfactory receptor 601 (predicted) [Bos taurus] XP_589319.3 1e-104 69% ...

  15. NCBI nr-aa BLAST: CBRC-OPRI-01-0130 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0130 ref|XP_001255625.1| PREDICTED: similar to olfactory receptor 586 (predict...ed) [Bos taurus] ref|XP_001252523.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001255625.1 1e-149 83% ...

  16. NCBI nr-aa BLAST: CBRC-PVAM-01-0503 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0503 ref|XP_589319.3| PREDICTED: similar to olfactory receptor 601 (predict...ed) [Bos taurus] ref|XP_001256154.2| PREDICTED: similar to olfactory receptor 601 (predicted) [Bos taurus] XP_589319.3 1e-139 80% ...

  17. NCBI nr-aa BLAST: CBRC-MLUC-01-0373 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0373 ref|XP_589319.3| PREDICTED: similar to olfactory receptor 601 (predict...ed) [Bos taurus] ref|XP_001256154.2| PREDICTED: similar to olfactory receptor 601 (predicted) [Bos taurus] XP_589319.3 1e-125 82% ...

  18. NCBI nr-aa BLAST: CBRC-STRI-01-2179 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2179 ref|XP_589319.3| PREDICTED: similar to olfactory receptor 601 (predict...ed) [Bos taurus] ref|XP_001256154.2| PREDICTED: similar to olfactory receptor 601 (predicted) [Bos taurus] XP_589319.3 4e-84 75% ...

  19. NCBI nr-aa BLAST: CBRC-VPAC-01-1531 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1531 ref|XP_609523.4| PREDICTED: similar to olfactory receptor 694 (predict...ed) [Bos taurus] ref|XP_001256288.2| PREDICTED: similar to olfactory receptor 694 (predicted) [Bos taurus] XP_609523.4 1e-120 74% ...

  20. NCBI nr-aa BLAST: CBRC-GGOR-01-0397 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0397 ref|XP_001255625.1| PREDICTED: similar to olfactory receptor 586 (predict...ed) [Bos taurus] ref|XP_001252523.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001255625.1 1e-151 85% ...

  1. NCBI nr-aa BLAST: CBRC-MEUG-01-1902 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1902 ref|XP_589319.3| PREDICTED: similar to olfactory receptor 601 (predict...ed) [Bos taurus] ref|XP_001256154.2| PREDICTED: similar to olfactory receptor 601 (predicted) [Bos taurus] XP_589319.3 1e-62 43% ...

  2. NCBI nr-aa BLAST: CBRC-VPAC-01-1333 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1333 ref|XP_589319.3| PREDICTED: similar to olfactory receptor 601 (predict...ed) [Bos taurus] ref|XP_001256154.2| PREDICTED: similar to olfactory receptor 601 (predicted) [Bos taurus] XP_589319.3 1e-140 81% ...

  3. NCBI nr-aa BLAST: CBRC-MDOM-04-0254 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-04-0254 ref|XP_595585.2| PREDICTED: similar to olfactory receptor Olr60 (predict...ed) [Bos taurus] ref|XP_001253182.1| PREDICTED: similar to olfactory receptor Olr60 (predicted) [Bos taurus] XP_595585.2 1e-146 82% ...

  4. NCBI nr-aa BLAST: CBRC-PVAM-01-1099 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-1099 ref|XP_001255625.1| PREDICTED: similar to olfactory receptor 586 (predict...ed) [Bos taurus] ref|XP_001252523.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001255625.1 9e-88 57% ...

  5. NCBI nr-aa BLAST: CBRC-VPAC-01-0876 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-0876 ref|XP_609523.4| PREDICTED: similar to olfactory receptor 694 (predict...ed) [Bos taurus] ref|XP_001256288.2| PREDICTED: similar to olfactory receptor 694 (predicted) [Bos taurus] XP_609523.4 4e-45 76% ...

  6. NCBI nr-aa BLAST: CBRC-MLUC-01-0866 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0866 ref|XP_595585.2| PREDICTED: similar to olfactory receptor Olr60 (predict...ed) [Bos taurus] ref|XP_001253182.1| PREDICTED: similar to olfactory receptor Olr60 (predicted) [Bos taurus] XP_595585.2 1e-157 88% ...

  7. NCBI nr-aa BLAST: CBRC-VPAC-01-0256 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-0256 ref|XP_609523.4| PREDICTED: similar to olfactory receptor 694 (predict...ed) [Bos taurus] ref|XP_001256288.2| PREDICTED: similar to olfactory receptor 694 (predicted) [Bos taurus] XP_609523.4 1e-130 80% ...

  8. NCBI nr-aa BLAST: CBRC-VPAC-01-1445 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1445 ref|XP_001255625.1| PREDICTED: similar to olfactory receptor 586 (predict...ed) [Bos taurus] ref|XP_001252523.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001255625.1 1e-116 76% ...

  9. NCBI nr-aa BLAST: CBRC-MLUC-01-0609 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0609 ref|XP_875347.3| PREDICTED: similar to olfactory receptor 561 (predict...ed) [Bos taurus] ref|XP_001788816.1| PREDICTED: similar to olfactory receptor 561 (predicted) [Bos taurus] XP_875347.3 1e-161 88% ...

  10. NCBI nr-aa BLAST: CBRC-PCAP-01-0607 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-0607 ref|XP_001255625.1| PREDICTED: similar to olfactory receptor 586 (predict...ed) [Bos taurus] ref|XP_001252523.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001255625.1 1e-108 65% ...

  11. NCBI nr-aa BLAST: CBRC-STRI-01-2372 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2372 ref|XP_001255625.1| PREDICTED: similar to olfactory receptor 586 (predict...ed) [Bos taurus] ref|XP_001252523.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001255625.1 1e-127 71% ...

  12. NCBI nr-aa BLAST: CBRC-MDOM-04-0282 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-04-0282 ref|XP_001255625.1| PREDICTED: similar to olfactory receptor 586 (predict...ed) [Bos taurus] ref|XP_001252523.1| PREDICTED: similar to olfactory receptor 586 (predicted) [Bos taurus] XP_001255625.1 1e-125 69% ...

  13. NCBI nr-aa BLAST: CBRC-TTRU-01-0107 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0107 ref|XP_595585.2| PREDICTED: similar to olfactory receptor Olr60 (predict...ed) [Bos taurus] ref|XP_001253182.1| PREDICTED: similar to olfactory receptor Olr60 (predicted) [Bos taurus] XP_595585.2 1e-125 77% ...

  14. NCBI nr-aa BLAST: CBRC-VPAC-01-1210 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1210 ref|XP_595062.2| PREDICTED: similar to olfactory receptor 564 (predict...ed) [Bos taurus] ref|XP_001256907.1| PREDICTED: similar to olfactory receptor 564 (predicted) [Bos taurus] XP_595062.2 1e-158 89% ...

  15. NCBI nr-aa BLAST: CBRC-OPRI-01-1224 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-1224 ref|XP_595585.2| PREDICTED: similar to olfactory receptor Olr60 (predict...ed) [Bos taurus] ref|XP_001253182.1| PREDICTED: similar to olfactory receptor Olr60 (predicted) [Bos taurus] XP_595585.2 1e-153 85% ...

  16. NCBI nr-aa BLAST: CBRC-PCAP-01-0356 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-0356 ref|XP_875347.3| PREDICTED: similar to olfactory receptor 561 (predict...ed) [Bos taurus] ref|XP_001788816.1| PREDICTED: similar to olfactory receptor 561 (predicted) [Bos taurus] XP_875347.3 3e-66 84% ...

  17. NCBI nr-aa BLAST: CBRC-VPAC-01-1344 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1344 ref|XP_874556.1| PREDICTED: similar to olfactory receptor 49 (predict...ed) [Bos taurus] ref|XP_001255792.1| PREDICTED: similar to olfactory receptor 49 (predicted) [Bos taurus] XP_874556.1 3e-26 80% ...

  18. NCBI nr-aa BLAST: CBRC-PVAM-01-0268 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0268 ref|NP_001068720.1| myeloid-associated differentiation marker [Bo...s taurus] gb|AAI20131.1| Myeloid-associated differentiation marker [Bos taurus] NP_001068720.1 1e-123 81% ...

  19. NCBI nr-aa BLAST: CBRC-OPRI-01-0353 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0353 ref|NP_001068720.1| myeloid-associated differentiation marker [Bo...s taurus] gb|AAI20131.1| Myeloid-associated differentiation marker [Bos taurus] NP_001068720.1 1e-128 83% ...

  20. NCBI nr-aa BLAST: CBRC-STRI-01-2324 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2324 ref|NP_001068720.1| myeloid-associated differentiation marker [Bo...s taurus] gb|AAI20131.1| Myeloid-associated differentiation marker [Bos taurus] NP_001068720.1 1e-161 86% ...

  1. NCBI nr-aa BLAST: CBRC-OLAT-15-0022 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OLAT-15-0022 ref|NP_001073692.1| solute carrier family 29 (nucleoside transporters...), member 3 [Bos taurus] gb|AAI26742.1| Solute carrier family 29 (nucleoside transporters), member 3 [Bos taurus] NP_001073692.1 9e-68 49% ...

  2. NCBI nr-aa BLAST: CBRC-MMUS-15-0051 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-15-0051 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 82% ...

  3. NCBI nr-aa BLAST: CBRC-PVAM-01-1419 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-1419 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 1e-156 73% ...

  4. NCBI nr-aa BLAST: CBRC-RNOR-07-0387 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RNOR-07-0387 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 82% ...

  5. NCBI nr-aa BLAST: CBRC-MEUG-01-0121 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-0121 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 1e-131 72% ...

  6. NCBI nr-aa BLAST: CBRC-CJAC-01-1501 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-1501 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 89% ...

  7. NCBI nr-aa BLAST: CBRC-OPRI-01-0778 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0778 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 8e-63 89% ...

  8. NCBI nr-aa BLAST: CBRC-GACU-23-0004 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GACU-23-0004 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 1e-108 51% ...

  9. NCBI nr-aa BLAST: CBRC-EEUR-01-1395 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-EEUR-01-1395 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 1e-132 85% ...

  10. NCBI nr-aa BLAST: CBRC-GGOR-01-0838 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0838 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 1e-92 84% ...

  11. NCBI nr-aa BLAST: CBRC-FCAT-01-1221 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FCAT-01-1221 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 85% ...

  12. NCBI nr-aa BLAST: CBRC-PCAP-01-1579 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-1579 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 84% ...

  13. NCBI nr-aa BLAST: CBRC-STRI-01-2762 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2762 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 1e-110 85% ...

  14. NCBI nr-aa BLAST: CBRC-OANA-01-0848 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-0848 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 1e-135 64% ...

  15. NCBI nr-aa BLAST: CBRC-OCUN-01-1169 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-1169 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 1e-167 79% ...

  16. NCBI nr-aa BLAST: CBRC-MLUC-01-0607 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0607 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 86% ...

  17. NCBI nr-aa BLAST: CBRC-PHAM-01-1399 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1399 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 86% ...

  18. NCBI nr-aa BLAST: CBRC-OGAR-01-1283 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OGAR-01-1283 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 89% ...

  19. NCBI nr-aa BLAST: CBRC-PABE-13-0047 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PABE-13-0047 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 89% ...

  20. NCBI nr-aa BLAST: CBRC-FRUB-02-0486 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0486 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 1e-105 52% ...

  1. NCBI nr-aa BLAST: CBRC-MMUR-01-1175 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-1175 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 89% ...

  2. NCBI nr-aa BLAST: CBRC-RMAC-11-0047 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RMAC-11-0047 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 86% ...

  3. NCBI nr-aa BLAST: CBRC-HSAP-12-0048 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-12-0048 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 89% ...

  4. NCBI nr-aa BLAST: CBRC-TBEL-01-1351 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TBEL-01-1351 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 85% ...

  5. NCBI nr-aa BLAST: CBRC-PTRO-13-0056 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PTRO-13-0056 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 89% ...

  6. NCBI nr-aa BLAST: CBRC-CFAM-27-0019 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-27-0019 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 83% ...

  7. NCBI nr-aa BLAST: CBRC-TNIG-11-0018 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TNIG-11-0018 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 1e-105 51% ...

  8. NCBI nr-aa BLAST: CBRC-ACAR-01-1013 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-1013 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 1e-129 59% ...

  9. NCBI nr-aa BLAST: CBRC-TTRU-01-0439 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0439 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 91% ...

  10. NCBI nr-aa BLAST: CBRC-BTAU-01-1883 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-1883 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 99% ...

  11. NCBI nr-aa BLAST: CBRC-ETEL-01-0242 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ETEL-01-0242 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 85% ...

  12. Morphological Dimorphism In The Y Chromosome Of 'pe-duro' Cattle In The Brazilian State Of Piauf

    OpenAIRE

    Britto C.M.C.; Mello M.L.S.

    1999-01-01

    'Pe-duro' (hard foot) is a rare breed of beef cattle of European (Bos taurus taurus) origin, originated in northern and northeastern Brazil. Y chromosome morphology, outer genital elements and other phenotypic characteristics were examined in 75 'pe-duro' bulls from the Empresa Brasileira de Pesquisa Agropecuaria (Embrapa) herd in the Brazilian State of Piauf. The purpose was to investigate possible racial contamination with Zebu animals (Bos taurus indicus) in a cattle that has been consider...

  13. Influência do desenvolvimento etário e da suplementação com vitamina E (acetato de DL-alfa-tocoferol no metabolismo oxidativo dos neutrófilos de bovinos da raça Holandesa (Bos taurus

    Directory of Open Access Journals (Sweden)

    Joselito Nunes Costa

    2004-10-01

    Full Text Available O presente trabalho teve por objetivo analisar a influência do desenvolvimento etário e da suplementação com acetato de DL-alfa-tocoferol sobre o metabolismo oxidativo de neutrófilos, em bovinos da raça holandesa, no período do nascimento até os 150 dias de idade. Foram utilizados 20 bezerros divididos em dois grupos de dez animais. Os animais do grupo Tratamento receberam 2000UI de acetato de DL-alfa-tocoferol, por via intramuscular, ao nascimento, aos 15, 30, 60, 90 e 120 dias de idade, sendo o outro o grupo Controle, que não recebeu qualquer suplementação. Em ambos os grupos, o metabolismo oxidativo dos neutrófilos demonstrou pouca atividade durante os primeiros 60 dias de vida, sendo indicativo da ineficiência deste importante mecanismo bactericida. Não foi observado efeito significativo da administração do acetato de DL-alfa-tocoferol sobre o metabolismo oxidativo de neutrófilos.

  14. Influência de diferentes concentrações de etileno glicol nO número de células da granulosa e morfometria de folículos pré-antrais inclusos em tecido ovariano de Bos taurus indicus, Linnaeus, 1758

    OpenAIRE

    Luna,Hélder Silva e; Lijeron,Luciana Alves; Costa,Rafaela Nelson da

    2010-01-01

    A criopreservação de folículos ovarianos pré-antrais pode ajudar na conservação de muitas espécies domésticas e selvagens. Neste trabalho, objetivou-se verificar o efeito do etileno glicol, em diferentes concentrações, na morfometria e número de células da granulosa de folículos pré-antrais inclusos em tecido ovariano bovino. O teste de toxicidade foi realizado com fragmentos ovarianos expostos ao etileno glicol em concentrações de 10, 20 ou 40%. O tecido foi analisado por técnica histológica...

  15. Influência do desenvolvimento etário e da suplementação com vitamina E (acetato de DL-alfa-tocoferol) no metabolismo oxidativo dos neutrófilos de bovinos da raça Holandesa (Bos taurus)

    OpenAIRE

    Costa, Joselito Nunes; Peixoto, Ana Paula Cardoso; Kohayagawa, Aguemi; Ferreira, Anna Fernanda Machado Sales da Cruz; Cassetari, Maria Luiza; Crocci, Adalberto José

    2004-01-01

    p.293-298 O presente trabalho teve por objetivo analisar a influência do desenvolvimento etário e da suplementação com acetato de DL-alfa-tocoferol sobre o metabolismo oxidativo de neutrófilos, em bovinos da raça holandesa, no período do nascimento até os 150 dias de idade. Foram utilizados 20 bezerros divididos em dois grupos de dez animais. Os animais do grupo Tratamento receberam 2000UI de acetato de DL-alfa-tocoferol, por via intramuscular, ao nascimento, aos 15, 30, 60, 90 e 120 dias ...

  16. Eficiência da produção de embriões in vitro através de aspiração folicular transvaginal em bovinos das raças Girolando, Brangus e Nelore

    OpenAIRE

    Renato Zanin

    2013-01-01

    O presente estudo foi realizado no Laboratório de Reprodução Animal da Empresa Agropecuária Laffranchi Com. Ind. LTDA, localizada no município de Tamarana - Paraná. O experimento se refere aos resultados obtidos na produção in vitro de embriões através da aspiração folicular transvaginal em bovinos das raças Nelore (não CEIP, Bos indicus, n = 34), Nelore (CEIP, Bos indicus, n = 22). Brangus (5/8 Bos taurus x 3/8 Bos indicus, n = 64) e Girolando (5/8 Bos taurus x 3/8 Bos indicus, n = 52) t...

  17. NCBI nr-aa BLAST: CBRC-VPAC-01-1432 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1432 ref|NP_776992.1| opsin 1 (cone pigments), short-wave-sensitive [B...os taurus] sp|P51490|OPSB_BOVIN RecName: Full=Blue-sensitive opsin; Short=BOP; AltName: Full=Blue cone photoreceptor pigment... gb|AAA93189.1| visual pigment [Bos taurus] gb|AAB50158.1| blue cone pigment protein [Bos taurus] NP_776992.1 0.0 92% ...

  18. NCBI nr-aa BLAST: CBRC-TTRU-01-0695 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0695 ref|NP_776992.1| opsin 1 (cone pigments), short-wave-sensitive [B...os taurus] sp|P51490|OPSB_BOVIN RecName: Full=Blue-sensitive opsin; Short=BOP; AltName: Full=Blue cone photoreceptor pigment... gb|AAA93189.1| visual pigment [Bos taurus] gb|AAB50158.1| blue cone pigment protein [Bos taurus] NP_776992.1 1e-155 88% ...

  19. NCBI nr-aa BLAST: CBRC-PVAM-01-1068 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-1068 ref|NP_776992.1| opsin 1 (cone pigments), short-wave-sensitive [B...os taurus] sp|P51490|OPSB_BOVIN RecName: Full=Blue-sensitive opsin; Short=BOP; AltName: Full=Blue cone photoreceptor pigment... gb|AAA93189.1| visual pigment [Bos taurus] gb|AAB50158.1| blue cone pigment protein [Bos taurus] NP_776992.1 0.0 92% ...

  20. NCBI nr-aa BLAST: CBRC-OPRI-01-1437 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-1437 ref|NP_776992.1| opsin 1 (cone pigments), short-wave-sensitive [B...os taurus] sp|P51490|OPSB_BOVIN RecName: Full=Blue-sensitive opsin; Short=BOP; AltName: Full=Blue cone photoreceptor pigment... gb|AAA93189.1| visual pigment [Bos taurus] gb|AAB50158.1| blue cone pigment protein [Bos taurus] NP_776992.1 1e-162 80% ...

  1. Evaluation of Response to Super-Ovulation, Estrous ...

    African Journals Online (AJOL)

    Bos taurus indicus) com inseminac¸a˜o artificial em tempo fixo. Acta Sci Vet;31; 244–245. Baruselli P S, MF. de Sa´ Filho, CM Martins, L F Nasser, MFG NogueiraCM Barros and GA Bo. 2006. Superovulation and embryo transfer in Bos indicus ...

  2. stress and adaptation in beef heifers: 1. effect of pen conditions on ...

    African Journals Online (AJOL)

    Bonsmaraverse veroorsaak nie. Daarenteen het ingekraalde Korthoringverse veral gedurende die laaste 2 weke, hoer waardes as verse op die veld getoon. SUMMARY.. L:ighteen beef heifers, representing the Bos taurus (Shorthorn), Bos indicus (Afrikaner) and intermediate (Bonsmara) types, were con- t'ined to a pen with ...

  3. Genomic study and Medical Subject Headings enrichment analysis of early pregnancy rate and antral follicle numbers in Nelore heifers

    DEFF Research Database (Denmark)

    Oliveira Junior, G. A.; Perez, B. C.; Cole, J. B.

    2017-01-01

    Zebu animals (Bos indicus) are known to take longer to reach puberty compared with taurine animals (Bos taurus), limiting the supply of animals for harvest or breeding and impacting profitability. Genomic information can be a helpful tool to better understand complex traits and improve genetic...

  4. crossbreeding wit}i africander dam as basis . 3. post-weaning ...

    African Journals Online (AJOL)

    'n stelsel van rntensiewe vetmesting, het laasgenoemde drie 8os taurus vaarras nageslaggroepe opvallend beter presteer as eersgenoemde twee Bos indicus vaarras nageslaggroepe. Onder ekstensiewe veldtoestande het alle krusgeteelde groepe egter die Afrikanerkontroles geklop. Die nageslag van beide Bos indicus ...

  5. Effect of Concentrate Supplementation on Reproductive ...

    African Journals Online (AJOL)

    A study was conducted in Rungwe district in Tanzania, to assess the effect of concentrate supplementation on reproductive performance of smallholder dairy cattle. Cattle used were crossbreds, mainly between Friesian (Bos taurus) and indigenous Tanzania Short Horn Zebu (Bos indicus). All animals were managed under ...

  6. The effect of dietary rations on the gut morphology of Zebu Cattle ...

    African Journals Online (AJOL)

    Studies in the Bos taurus cattle have shown the gut morphology to be affected by diet, but there is a paucity of such information in the Bos indicus cattle. A study was conducted to evaluate the morphology of digestive tract of the Tanzanian Short Horn Zebu (TSHZ) cattle under different dietary treatments. A total of 54 TSHZ ...

  7. The diversity of leptin gene in Iranian native, Holstein and Brown ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-08-04

    Aug 4, 2008 ... This study describes genetic variability in the leptin in Iranian native, Brown Swiss and Holstein cattle. (Bos Indicus and Bos Taurus). This is the first study of genetic polymorphism of the leptin gene in. Iranian native cattle. We examined exon 2 of the leptin gene from 587 individuals in six different.

  8. Association analysis of CAPN1 gene variants with carcass and meat ...

    African Journals Online (AJOL)

    ajl yemi

    2011-11-28

    Nov 28, 2011 ... the cattle industry. Key words: Bovine, CAPN1 gene, Carcass and meat quality traits, SNPs. INTRODUCTION. Carcass and meat quality traits, which are influenced by multiple ... value assessment of beef cattle industry. Selection of ..... tenderness marker test to include cattle of Bos indicus, Bos taurus,.

  9. The yak genome and adaptation to life at high altitude

    DEFF Research Database (Denmark)

    Qiu, Qiang; Zhang, Guojie; Ma, Tao

    2012-01-01

    Domestic yaks (Bos grunniens) provide meat and other necessities for Tibetans living at high altitude on the Qinghai-Tibetan Plateau and in adjacent regions. Comparison between yak and the closely related low-altitude cattle (Bos taurus) is informative in studying animal adaptation to high altitude...

  10. Genomic divergence of indicine and taurine cattle identified through high-density SNP genotyping

    Science.gov (United States)

    At an arguable date of around 330,000 years ago there were already at least two different types of cattle that became ancestors of nearly all modern cattle, the Bos primigenius taurus more adapted to temperate climates and the tropically adapted Bos primigenius indicus. Human selection exponentially...

  11. Assessment of genetic variation among four populations of Small ...

    African Journals Online (AJOL)

    Username

    2017-11-22

    Nov 22, 2017 ... 4 College of Animal Science and Technology, Chongqing Key Laboratory of Forage & Herbivore, Chongqing. Engineering Research Centre for Herbivores ...... evolution, domestication and phylogeography of taurine and zebu cattle (Bos taurus and Bos indicus). Genetics. 146, 1071-1086. Maletsanake, D.

  12. Gene study within the 5' flanking regions of growth hormone gene of ...

    African Journals Online (AJOL)

    user

    2011-01-17

    Jan 17, 2011 ... replacements and one addition, for GH 2.3 allele, as compared to Bos taurus Genome (Btau_4.0 ) and two earlier ... Key words: Bos indicus, growth hormone gene, silent mutation, growth hormone (GH) gene, allele. INTRODUCTION ..... Sami AJ (2007). Structure-function relation of somatotropin with.

  13. The power and pain of market-based carbon policies

    NARCIS (Netherlands)

    Henderson, B.; Golub, A.; Pambudi, D.; Hertel, T.; Godde, C.; Herrero, M.; Cacho, O.; Gerber, P.

    2018-01-01

    The objectives of this research are to assess the greenhouse gas mitigation potential of carbon policies applied to the ruminant livestock sector [inclusive of the major ruminant species—cattle (Bos Taurus and Bos indicus), sheep (Ovis aries), and goats (Capra hircus)]—with particular emphasis on

  14. Factors influencing recalving rate in lactating beef cows in the sweet ...

    African Journals Online (AJOL)

    goups the majority was also late calving. Recalving rate was high in all other breeding groups and was not influenced by date of calving. In general, Bos taurus type cows calve significantly earlier in the calving season than Bos indicus types (Bonsma &. Skinner, 1969; Holroyd et al., 1979; Gotti el a/., 1985). This is to some ...

  15. Marginal costs of abating greenhouse gases in the global ruminant livestock sector

    NARCIS (Netherlands)

    Henderson, B.; Falcucci, A.; Early, L.; Gerber, P.J.

    2017-01-01

    Livestock [inclusive of ruminant species, namely cattle (Bos Taurus and Bos indicus), sheep (Ovis aries), goats (Capra hircus), and buffaloes (Bubalus bubalis), and non-ruminant species, namely pigs (Sus scrofa domesticus) and chickens (Gallus domesticus)] are both affected by climate change and

  16. Zvířecí kosterní pozůstatky z popraviště ve Vodňanech

    Czech Academy of Sciences Publication Activity Database

    Kyselý, René

    2006-01-01

    Roč. 58, č. 4 (2006), s. 813-814 ISSN 0323-1267 Institutional research plan: CEZ:AV0Z80020508 Keywords : scaffold * Bos taurus * burned bones * archaeozoology Subject RIV: AC - Archeology, Anthropology, Ethnology

  17. Nature conservation and grazing management. Free-ranging cattle as a driving force for cyclic vegetation seccession

    NARCIS (Netherlands)

    Bokdam, J.

    2003-01-01

    Key-words : biodiversity, herbivory, wilderness, non-linear dynamics, mosaic cycling, grassland, wood encroachment, forest, Bos taurus , Calluna vulgaris , Deschampsia flexuosa.This thesis examines the suitability of controlled and wilderness grazing as conservation management tool for open,

  18. Nigerian Journal of Animal Production - Vol 31 (2004)

    African Journals Online (AJOL)

    Nigerian Journal of Animal Production. ... Reproductive Performance And Superovulatory Response Of Endangered Cameroonian Namshi Breed (Bos taurus) · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT ... Phenotypic Relationships Between Gestation Length And Preweaning Litter Traits In Rabbits.

  19. Identification and isolation of gene differentially expressed on scrotal ...

    African Journals Online (AJOL)

    Results of BLAST with GenBank show that three genes or expressed sequence tag (ESTs) were unknown, and there were eight sequences highly identified to be Bos taurus mRNA for proline-rich protein P-B and other sequences were B. taurus ebd-P2 pseudogene, B. taurus similar to F-box only protein 21 isoform 2, ...

  20. Assessment of cow and farm level risk factors associated with Ureaplasma diversum in pasture-based dairy systems - A field study

    OpenAIRE

    NASCIMENTO-ROCHA, JOSEFA M.; OLIVEIRA FILHO, BENEDITO D. DE; ARNHOLD, EMANNUEL; PÔRTO, REGIANI N.G.; LIMA, SVETLANA F.; GAMBARINI, MARIA LUCIA

    2017-01-01

    ABSTRACT Potential risk factors for Ureaplasma diversum in the vaginal mucus of 1,238 dairy cows were included in a multivariate logistic regression model, based on the cow level (i.e., granular vulvovaginitis [+GVV], yearly milk production [4500 kg or more], pregnancy, predominance of Bos taurus [+Bos Taurus], score of corporal condition [at least 2.5], concomitant positivity for Escherichia coli [+E.coli]), and farm level i.e., milking room hygiene (-Milking room), dunghill location, and re...

  1. NCBI nr-aa BLAST: CBRC-MDOM-02-0173 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-02-0173 ref|NP_001070416.1| myeloid-associated differentiation marker-lik...e 2 [Bos taurus] sp|Q08DL4|MADL2_BOVIN RecName: Full=Myeloid-associated differentiation marker-like protein ...2 gb|AAI23682.1| Myeloid-associated differentiation marker-like [Bos taurus] NP_001070416.1 1e-150 83% ...

  2. NCBI nr-aa BLAST: CBRC-STRI-01-2303 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2303 ref|NP_001070416.1| myeloid-associated differentiation marker-lik...e 2 [Bos taurus] sp|Q08DL4|MADL2_BOVIN RecName: Full=Myeloid-associated differentiation marker-like protein ...2 gb|AAI23682.1| Myeloid-associated differentiation marker-like [Bos taurus] NP_001070416.1 1e-166 92% ...

  3. NCBI nr-aa BLAST: CBRC-PVAM-01-1367 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-1367 ref|NP_001070416.1| myeloid-associated differentiation marker-lik...e 2 [Bos taurus] sp|Q08DL4|MADL2_BOVIN RecName: Full=Myeloid-associated differentiation marker-like protein ...2 gb|AAI23682.1| Myeloid-associated differentiation marker-like [Bos taurus] NP_001070416.1 1e-132 93% ...

  4. NCBI nr-aa BLAST: CBRC-MEUG-01-1594 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1594 ref|NP_001070416.1| myeloid-associated differentiation marker-lik...e 2 [Bos taurus] sp|Q08DL4|MADL2_BOVIN RecName: Full=Myeloid-associated differentiation marker-like protein ...2 gb|AAI23682.1| Myeloid-associated differentiation marker-like [Bos taurus] NP_001070416.1 1e-152 84% ...

  5. NCBI nr-aa BLAST: CBRC-OPRI-01-0317 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0317 ref|NP_001070416.1| myeloid-associated differentiation marker-lik...e 2 [Bos taurus] sp|Q08DL4|MADL2_BOVIN RecName: Full=Myeloid-associated differentiation marker-like protein ...2 gb|AAI23682.1| Myeloid-associated differentiation marker-like [Bos taurus] NP_001070416.1 1e-155 86% ...

  6. NCBI nr-aa BLAST: CBRC-BTAU-01-2837 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-2837 ref|NP_776992.1| opsin 1 (cone pigments), short-wave-sensitive (c...olor blindness, tritan) [Bos taurus] sp|P51490|OPSB_BOVIN Blue-sensitive opsin (BOP) (Blue cone photoreceptor pigment...) gb|AAA93189.1| visual pigment gb|AAB50158.1| blue cone pigment protein [Bos taurus] NP_776992.1 0.0 100% ...

  7. NCBI nr-aa BLAST: CBRC-CFAM-14-0051 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-14-0051 ref|NP_776992.1| opsin 1 (cone pigments), short-wave-sensitive (c...olor blindness, tritan) [Bos taurus] sp|P51490|OPSB_BOVIN Blue-sensitive opsin (BOP) (Blue cone photoreceptor pigment...) gb|AAA93189.1| visual pigment gb|AAB50158.1| blue cone pigment protein [Bos taurus] NP_776992.1 0.0 91% ...

  8. NCBI nr-aa BLAST: CBRC-FCAT-01-1178 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FCAT-01-1178 ref|NP_776992.1| opsin 1 (cone pigments), short-wave-sensitive (c...olor blindness, tritan) [Bos taurus] sp|P51490|OPSB_BOVIN Blue-sensitive opsin (BOP) (Blue cone photoreceptor pigment...) gb|AAA93189.1| visual pigment gb|AAB50158.1| blue cone pigment protein [Bos taurus] NP_776992.1 0.0 89% ...

  9. NCBI nr-aa BLAST: CBRC-LAFR-01-3136 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-3136 ref|NP_776992.1| opsin 1 (cone pigments), short-wave-sensitive (c...olor blindness, tritan) [Bos taurus] sp|P51490|OPSB_BOVIN Blue-sensitive opsin (BOP) (Blue cone photoreceptor pigment...) gb|AAA93189.1| visual pigment gb|AAB50158.1| blue cone pigment protein [Bos taurus] NP_776992.1 1e-153 84% ...

  10. NCBI nr-aa BLAST: CBRC-OGAR-01-1096 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OGAR-01-1096 ref|NP_776992.1| opsin 1 (cone pigments), short-wave-sensitive (c...olor blindness, tritan) [Bos taurus] sp|P51490|OPSB_BOVIN Blue-sensitive opsin (BOP) (Blue cone photoreceptor pigment...) gb|AAA93189.1| visual pigment gb|AAB50158.1| blue cone pigment protein [Bos taurus] NP_776992.1 1e-104 63% ...

  11. NCBI nr-aa BLAST: CBRC-SARA-01-1750 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1750 ref|NP_776992.1| opsin 1 (cone pigments), short-wave-sensitive (c...olor blindness, tritan) [Bos taurus] sp|P51490|OPSB_BOVIN Blue-sensitive opsin (BOP) (Blue cone photoreceptor pigment...) gb|AAA93189.1| visual pigment gb|AAB50158.1| blue cone pigment protein [Bos taurus] NP_776992.1 0.0 88% ...

  12. NCBI nr-aa BLAST: CBRC-TBEL-01-1714 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TBEL-01-1714 ref|NP_776992.1| opsin 1 (cone pigments), short-wave-sensitive (c...olor blindness, tritan) [Bos taurus] sp|P51490|OPSB_BOVIN Blue-sensitive opsin (BOP) (Blue cone photoreceptor pigment...) gb|AAA93189.1| visual pigment gb|AAB50158.1| blue cone pigment protein [Bos taurus] NP_776992.1 1e-147 73% ...

  13. Antibiogram profile of pathogens isolated from processed cow meat

    African Journals Online (AJOL)

    2016-06-30

    Jun 30, 2016 ... Cow meat or beef is the culinary name for meat from bovines especially cattle. The generic name of cow meat is Bos taurus and the habitable weather of Bos taurus includes temperature of 101.50F (38.60C) and ability to live in a harsh terrains (Li et al., 2006). The processing of cow meat begins from ...

  14. Genetic variation in the β-lactoglobulin of Chinese yak ( Bos ...

    Indian Academy of Sciences (India)

    tains a higher percentage of protein, organic calcium, and conjugated linoleic acid (Wiener et al. 2003; Li et al. 2010). β-lactoglobulin (β-LG) is an important protein that con- stitutes approximately up to 65% of the total whey pro- tein of bovine milk. β-LG is coded by LGB gene, located on chromosome 11 of the bovine ...

  15. Proteome analysis of functionally differentiated bovine (Bos indicus) mammary epithelial cells isolated from milk

    KAUST Repository

    Janjanam, Jagadeesh

    2013-10-01

    Mammary gland is made up of a branching network of ducts that end in alveoli. Terminally differentiated mammary epithelial cells (MECs) constitute the innermost layer of aveoli. They are milk-secreting cuboidal cells that secrete milk proteins during lactation. Little is known about the expression profile of proteins in the metabolically active MECs during lactation or their functional role in the lactation process. In the present investigation, we have reported the proteome map of MECs in lactating cows using 2DE MALDI-TOF/TOF MS and 1D-Gel-LC-MS/MS. MECs were isolated from milk using immunomagnetic beads and confirmed by RT-PCR and Western blotting. The 1D-Gel-LC-MS/MS and 2DE-MS/MS based approaches led to identification of 431 and 134 proteins, respectively, with a total of 497 unique proteins. Proteins identified in this study were clustered into functional groups using bioinformatics tools. Pathway analysis of the identified proteins revealed 28 pathways (p < 0.05) providing evidence for involvement of various proteins in lactation function. This study further provides experimental evidence for the presence of many proteins that have been predicted in annotated bovine genome. The data generated further provide a set of bovine MEC-specific proteins that will help the researchers to understand the molecular events taking place during lactation. © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  16. Morphological and molecular characterization of Eurytrema cladorchis parasitizing cattle (Bos indicus) in Bangladesh.

    Science.gov (United States)

    Mohanta, Uday Kumar; Ichikawa-Seki, Madoka; Hayashi, Kei; Itagaki, Tadashi

    2015-06-01

    There is always controversy regarding identification of different species in the genus Eurytrema. Identification has been based mainly on morphology, which can be misleading and subject to differing interpretation among the scientists. Therefore, the aim of this study was to identify Eurytrema flukes both by morphology and molecular properties on the basis of 18-subunit ribosomal RNA (18S rRNA) gene as well as internal transcribed spacer 2 (ITS2) to clarify their phylogenetic status. Among six different agroecological areas of Bangladesh, 22 Eurytrema flukes were recovered from the bile ducts of 22 cattle in Bandarban, a hill district. The flukes were identified as Eurytrema cladorchis through morphometric and morphological studies. Phylogenetic analyses were conducted by neighbor-joining phylogram inferred from both 18S rRNA (1784 bp) gene and ITS2 (229 bp) sequences. A monophyletic clade was constructed by the E. cladorchis from Bangladesh; however, the clade was distinct from those formed by Eurytrema pancreaticum and Eurytrema coelomaticum. This study first described the existence of E. cladorchis from Bangladesh and may provide useful information for both morphological and molecular properties that may further help to clarify phylogenetic relationships within the genus Eurytrema and also for other digeneans.

  17. The Genetic Variation of Bali Cattle (Bos javanicus Based on Sex Related Y Chromosome Gene

    Directory of Open Access Journals (Sweden)

    A Winaya

    2011-09-01

    Full Text Available Bali cattle is very popular Indonesian local beef related to their status in community living process of farmers in Indonesia, especially as providers of meat and exotic animal. Bali cattle were able to adapt the limited environment and becoming local livestock that existed until recently.  In our early study by microsatellites showed that Bali cattle have specific allele. In this study we analyzed the variance of partly sex related Y (SRY gene sequence in Bali cattle bull as a source of cement for Artificial Insemination (AI.  Blood from 17 two location of AI center, Singosari, Malang and Baturiti, Bali was collected and then extracted to get the DNA genome.  PCR reaction was done to amplify partially of SRY gene segment and followed by sequencing PCR products to get the DNA sequence of SRY gene. The SRY gene sequence was used to determine the genetic variation and phylogenetic relationship.  We found that Bali cattle bull from Singosari has relatively closed genetic relationship with Baturiti. It is also supported that in early data some Bali bulls of Singosari were came from Baturiti. It has been known that Baturiti is the one source of Bali cattle bull with promising genetic potential. While, in general that Bali bull where came from two areas were not different on reproductive performances. It is important to understand about the genetic variation of Bali cattle in molecular level related to conservation effort and maintaining the genetic characters of the local cattle. So, it will not become extinct or even decreased the genetic quality of Indonesian indigenous cattle.   Key Words : Bali cattle, SRY gene, artificial insemination, phylogenetic, allele   Animal Production 13(3:150-155 (2011

  18. Pharmacodynamics of piroxicam from novel solid lipid microparticles formulated with homolipids from Bos indicus.

    Science.gov (United States)

    Nnamani, Petra O; Attama, Anthony A; Kenechukwu, Franklin C; Ibezim, Emmanuel C; Adikwu, Michael U

    2013-12-01

    The dissolution of piroxicam is a limiting step in its bioavailability on account of its hydrophobicity. The objective of this research was to formulate novel solid lipid microparticles (SLMs) based on homolipids (admixtures of tallow fat (TF) and Softisan(®) 142 (SFT) templated with Phospholipon(®) 90G (P90G), a heterolipid for the delivery of piroxicam. Lipid matrices consisting of TF and SFT in ratios of 1:1, 1:2 and 2:1 were templated with the heterolipid, P90G and characterized by differential scanning calorimetry (DSC). The SLMs produced by hot homogenization technique using the matrices were characterized in terms of thermal properties, particle size, morphology, drug encapsulation efficiency, stability studies and in vitro diffusion studies. In vivo pharmacodynamic study was performed using egg albumin- induced pedal edema in rats. The results showed that addition of Softisan(®) 142 improved the drug holding capacity of the micellar solution of 2:1 mixture of TF and SFT. The in vitro diffusion of piroxicam from this SLM showed maximum release of 87.53 % and followed non-Fickian diffusion kinetic mechanism. At dose equivalence of 10 mg, piroxicamloaded SLMs showed superior in vivo anti-inflammatory properties at 3 h than Feldene(®) and the pure drug sample. This study has shown that surface-modified SLMs could confer favourable properties with respect to drug release and antiinflammatory activity on SLMs for the delivery of piroxicam, thus encouraging further development of the formulations.

  19. Efficiency of utilization of dietary energy for milk production in lactating crossbred cattle (Bos Indicus

    Directory of Open Access Journals (Sweden)

    Debashis Saha

    2012-09-01

    Full Text Available The present study was conducted on efficiency of utilization of dietary energy for milk production in lactating crossbred cattle. 18 lactating crossbred cattle of early to mid-lactation, approximate body weight (375.39±23.43 kg, milk yield, parity and stage of lactation were divided into three groups of six animals each and were fed 0, 50 and 100% diammonium phosphate (DAP in the mineral mixture of concentrates for 120 days. The chaffed mixed roughage (berseem + wheat straw and concentrate mixture was fed to supply about nearly 18:82 concentrate to roughage ratio on dry matter basis. Tap water was available to the animals twice daily. A metabolism trial of seven days was conducted at the end of experiment to study digestibility of organic nutrients and balances of energy. DAP did not affect the nutrient intake, body weight changes, digestibility of Dry matter (DM, Crude protein (CP, Ether extract (EE, Crude fiber (CF, Nitrogen free extract (NFE and daily milk yield. It was concluded that the at 46.07 Mcal Gross energy intake level the losses in feces, urine, methane and heat production was 45.82%, 5.40%, 4.31% and 33.01%, respectively, and net energy retention for milk production was 11.43%. The gross efficiency of conversion of metabolic energy ME for milk production was 35.69% and the net efficiency of conversion of ME for milk production was 39.56%.

  20. Effect of high energy intake on carcass composition and hypothalamic gene expression in Bos indicus heifers

    Directory of Open Access Journals (Sweden)

    Juliane Diniz-Magalhães

    Full Text Available ABSTRACT The objective of this study was to evaluate the effect of high or low energy intake on carcass composition and expression of hypothalamic genes related to the onset of puberty. Twenty-four prepubertal Nellore heifers, 18-20- months-old, with 275.3±18.0 kg body weight (BW, and 4.9±0.2 (1-9 scale body condition score (BCS were randomly assigned to two treatments: high-energy diet (HE and low-energy diet (LE. Heifers were housed in two collective pens and fed diets formulated to promote average daily gain of 0.4 (LE or 1.2 kg (HE BW/day. Eight heifers from each treatment were slaughtered after the first corpus luteum detection - considered as age of puberty. The 9-10-11th rib section was taken and prepared for carcass composition analyses. Samples from hypothalamus were collected, frozen in liquid nitrogen, and stored at −80 °C. Specific primers for targets (NPY, NPY1R, NPY4R, SOCS3, OXT, ARRB1, and IGFPB2 and control (RPL19 and RN18S1 genes were designed for real-time PCR and then the relative quantification of target gene expression was performed. High-energy diets increased body condition score, cold carcass weight, and Longissimus lumborum muscle area and decreased age at slaughter. High-energy diets decreased the expression of NPY1R and ARRB1 at 4.4-fold and 1.5-fold, respectively. In conclusion, the hastening of puberty with high energy intake is related with greater body fatness and lesser hypothalamic expression of NPY1 receptor and of β-arrestin1, suggesting a less sensitive hypothalamus to the negative effects of NPY signaling.

  1. Aluminiumconcentraties in het freatische grondwater in de zandgebieden van Nederland onder bos en heidevelden

    NARCIS (Netherlands)

    Boumans LJM; van Grinsven JJM

    1991-01-01

    Deposition of NOx, SOx and NHx will affect the chemical composition of soil and groundwater. Deposition effects are strongest under natural and extensively managed vegetations on acid sandy soils with aluminium hydroxyde being the main acid buffering soil constituent. At 155 sites with forest and

  2. Age effect on post freezing sperm viability of Bali cattle (Bos javanicus)

    Science.gov (United States)

    Hapsari, R. D.; Khalifah, Y.; Widyas, N.; Pramono, A.; Prastowo, S.

    2018-03-01

    Post freezing sperm viability is one of factors which determine artificial insemination success. In the other side, bull’s or sire age influences the semen quality through sperm membrane constituent. It is known that freezing process change the sperm membrane during the processing stage. This research aims to know the effect of sire age on post freezing sperm viability of Bali cattle. The samples were collected in Singosari Artificial Insemination Centre, Malang, East Java, Indonesia on September - November 2016. Eight Bali cattle (4 and 7 y.o, 4 heads in each group) were used as semen source. Semen was collected using artificial vagina, 10 times spanning for 5 weeks (2 times per week, interval 3 and 4 days) in a row. The samples were then evaluated at fresh, chill and frozen stage. Fresh semen was diluted in Tris-citrate-egg yolk 20% (v/v) followed with chilling and freezing. Semen qualities were observed as sperm % motility (MOT), % live sperm using eosin-nigrosine staining (EOS) and % sperm membrane integrity using hypoosmotic swelling test (HOS). Variable comparisons between age groups were done using t-test. On the average, 4 y.o bulls showed higher semen quality at fresh, chill and frozen compared to 7 y.o in MOT (68.00±6.39 vs 65.9±7.62 56.40±3.71 vs 54.33±5.83 44.25±3.52 vs 40.40±7.06), EOS (72.08±6.63 vs 71.82±7.38 57.81±3.83 vs 57.41±6.32 53.16 ±8.41 vs 46.49±9.13) and HOS (60.85±13.91 vs 54.84±13.43 53.16 ±8.41 vs 46.49±9.13 44.6±9.39 vs 33.8±10.70) respectively. Statistical analysis results showed that age was significantly (P<0.05) affecting HOS at chill stage and MOT and HOS at frozen. In conclusion, younger Bali cattle (4 y.o) have more viable post freezing sperm compared to the older ones (7 y.o).

  3. Particle-in-a-bos model of one-dimensional excitons in conjugated polymers

    DEFF Research Database (Denmark)

    Pedersen, T.G.; Johansen, P.M.; Pedersen, H.C.

    2000-01-01

    A simple two-particle model of excitons in conjugated polymers is proposed as an alternative to usual highly computationally demanding quantum chemical methods. In the two-particle model, the exciton is described as an electron-hole pair interacting via Coulomb forces and confined to the polymer...... of these cases an approximate solution for the general case is obtained. As an application of the model the influence of a static electric field on the electron-hole overlap integral and exciton energy is considered....

  4. Touched by genius: on animal and madmen | ten Bos | South African ...

    African Journals Online (AJOL)

    It is argued that the idea that they cannot is widespread, not only in philosophy but also in biology or poetry. Animals are generally considered to be too honest for that. A second question is whether there are people who are too honest for feigning or acting. Foucault's famous discussion about madmen sheds some light on ...

  5. Onderzoek Sclerotinia in 2012 : Sclerotiën, sporen, BOS en spuittechniek

    NARCIS (Netherlands)

    Wanders, J.; Russchen, H.J.; Lamers, J.G.; Lange, de J.; Akker, van den H.; Roessel, van G.J.

    2014-01-01

    De problemen met Sclerotinia (rattenkeutelziekte), veroorzaakt door de schimmel Sclerotinia sclerotiorum, nemen de laatste jaren steeds meer toe. In diverse vollegrondsgroenten is Sclerotinia een van de belangrijkste ziekten. Om te komen tot een integrale aanpak van de problematiek is er door de

  6. Ovarian follicular population during estrous cycle in Gir breed (Bos indicus) cows

    OpenAIRE

    Ferreira, Ademir de Moraes; Viana, João Henrique Moreira; Camargo, Luiz Sérgio de Almeida; Sá, Wanderlei Ferreira de; Pereira, Pedro Augusto Carvalho

    2004-01-01

    A população folicular ovariana de 14 vacas da raça Gir foi monitorada diariamente, por ultra-sonografia, ao longo de um ciclo estral completo. Em cada avaliação, os folículos ovarianos foram identificados, mensurados e classificados por tamanho, em três categorias: de 3 a 5 mm (folículos pequenos), de 6 a 8 mm (folículos médios) e iguais ou superiores a 9 mm (folículos grandes). Foram observados ciclos com três (69,23%) e quatro (30,77%) ondas de crescimento folicular. O número médio de folíc...

  7. Genetic variation in the β-lactoglobulin of Chinese yak ( Bos ...

    Indian Academy of Sciences (India)

    570. Wiener G., Jianlin H. and Ruijun L. 2003 The yak. Bangkok,. Thailand, FAO regional office for Asia and the Pacific. Zhang G., Chen W., Xue M., Wang Z., Chang H., Han X. et al. 2008. Analysis of genetic diversity and population structure of ...

  8. Estimation of endogenous faecal calcium in buffalo (BOS bubalis) by isotope dilution technique

    International Nuclear Information System (INIS)

    Singh, S.; Sareen, V.K.; Marwaha, S.R.; Sekhon, B.; Bhatia, I.S.

    1973-01-01

    Detailed investigations on the isotope-dilution technique for the estimation of endogenous faecal calcium were conducted with buffalo calves fed on growing ration. The ration consisted of wheat straw, green lucerne and concentrate mix. The endogenous faecal calcium was 3.71 g/day, which is 17.8 percent of the total faecal calcium. The apparent and true digestibilities of Ca were calculated as 51 and 60 percent respectively. The endogenous faecal calcium can be estimated in buffalo calves by giving single subcutaneous injection of Ca 45 and collecting blood samples on 12th and 21st days only, and representative sample from the faeces collected from 13th through 22nd day after the injection. (author)

  9. Role of manganese and veratryl alcohol in the ligninolytic system of Bjerkandera sp. strain BOS55

    NARCIS (Netherlands)

    Mester, T.

    1998-01-01

    Introduction
    Lignin is a three dimensional hydrophobic plant polymer derived from the random coupling of phenylpropanoid precursors. The chemical and physical characteristics of lignin require a nonspecific, extracellular oxidative process for

  10. Translating culture: Matthee’s Kringe in ’n bos as a case in point

    Directory of Open Access Journals (Sweden)

    W. Cloete

    2007-07-01

    Full Text Available The translation of “cultural identity” in a novel such as “Kringe in ’n bos” contributes towards the definition of a uniquely South African representation of time and space in the global context. When translation is studied as a product of its socio-historical context, the translator is faced with problems of translating ideology and cultural identity in literature. Realia constitute a particular challenge to the translator because, according to the definition, precise equivalents of these words do not exist in other languages, which could cause shifts in the target language text. This article considers the concept of translatability and concludes that, despite the problems encountered, an adequate and satisfactory German translation from the Afrikaans original should be possible. The question of translatability assumes an interesting dimension as the Afrikaans novel was translated into English by the author herself. The privileged position of author-translator granted Matthee a near-perfect understanding of the different layers of meaning and intention of the source text and eliminated the gap between the author and translator. However, one gains the impression that the German translator (Stege resorted to transference as a strategy to avoid translation and it emerges that most instances of definite mistranslations are, indeed, attributable to Stege’s unfamiliarity with the South African context.

  11. Serological patterns of brucellosis, leptospirosis and Q fever in Bos indicus cattle in Cameroon.

    Science.gov (United States)

    Scolamacchia, Francesca; Handel, Ian G; Fèvre, Eric M; Morgan, Kenton L; Tanya, Vincent N; Bronsvoort, Barend M de C

    2010-01-21

    Brucellosis, leptospirosis and Q fever are important infections of livestock causing a range of clinical conditions including abortions and reduced fertility. In addition, they are all important zoonotic infections infecting those who work with livestock and those who consume livestock related products such as milk, producing non-specific symptoms including fever, that are often misdiagnosed and that can lead to severe chronic disease. This study used banked sera from the Adamawa Region of Cameroon to investigate the seroprevalences and distributions of seropositive animals and herds. A classical statistical and a multi-level prevalence modelling approach were compared. The unbiased estimates were 20% of herds were seropositive for Brucella spp. compared to 95% for Leptospira spp. and 68% for Q fever. The within-herd seroprevalences were 16%, 35% and 39% respectively. There was statistical evidence of clustering of seropositive brucellosis and Q fever herds. The modelling approach has the major advantage that estimates of seroprevalence can be adjusted for the sensitivity and specificity of the diagnostic test used and the multi-level structure of the sampling. The study found a low seroprevalence of brucellosis in the Adamawa Region compared to a high proportion of leptospirosis and Q fever seropositive herds. This represents a high risk to the human population as well as potentially having a major impact on animal health and productivity in the region.

  12. Seroprevalence of and risk factors for Neospora caninum infection in yaks (Bos grunniens) in China.

    Science.gov (United States)

    Meng, Qing-Feng; Yao, Gui-Zhe; Qin, Si-Yuan; Wu, Jian; Zhang, Xi-Chen; Bai, Ya-Duo; Cong, Wei; Wang, Wei-Li

    2017-08-15

    The aim of the present study was to detect the seroprevalence of Neospora caninum infection in yaks in Gansu province, China. Serum samples from 974 white yaks and 610 black yaks were tested by a commercial competitive-inhibition ELISA for the detection of specific anti-N. caninum antibodies.; N. caninum antibodies were detected in 10.4% of yaks with higher prevalence in black (11.5% of 610) than white yak (8.6% of 974). Age, regions and sampling times were considered as risk factors associated with N. caninum infection. These results revealed the seroprevalence of N. caninum in white yaks for the first time in China. Copyright © 2017 Elsevier B.V. All rights reserved.

  13. Detection of αS2-casein variants in Chinese yak (Bos grunniens) by ...

    Indian Academy of Sciences (India)

    TOYOBO). Positive clones were selected by colony PCR. Plasmid DNA was prepared and sequenced at least twice in both directions using an ABI. PRISM 377 DNA sequencer (Perkin-Elmer Cetus Instru- ments, Norwalk, USA). The sequences ...

  14. SURGICAL MANAGEMENT OF AN ARROW HIT DOMESTIC BULL (BOS INDICUS - A CASE REPORT

    Directory of Open Access Journals (Sweden)

    Deepak Sharma

    2017-12-01

    Full Text Available A free range bull was hit by an arrow. It was brought to the Veterinary Centre of Buxa Tiger Reserve Forest, Alipurduar, West Bengal, India. Immediate surgical intervention was started and the arrow was operated out. The animal was cured uneventfully.

  15. Ancient DNA extracted from Danish aurochs (Bos primigenius)

    DEFF Research Database (Denmark)

    Nielsen, Peter Gravlund; Aaris-Sørensen, Kim; Hofreiter, Michael

    2012-01-01

    in an archeological or geological context. We find that aurochs from southern Scandinavia display a star-shaped population genetic structure, that is indicative of a local and relatively recent diversification from a few ancestral haplotypes that may have originated in the ancestral Western European population before...... cattle in our aurochs suggests that introgression between these species must have been limited, if it occurred at all. We found that the successful recovery of genetic material for PCR amplification correlates with sample age and local geographic conditions. However, contrary to other studies, we found...

  16. Nellore cattle (Bos indicus) and ticks within the Brazilian Pantanal: ecological relationships.

    Science.gov (United States)

    Ramos, Vanessa N; Piovezan, Ubiratan; Franco, Ana Helena A; Rodrigues, Vinicius S; Nava, Santiago; Szabó, Matias P J

    2016-02-01

    Pantanal is a huge floodplain mostly in Brazil, and its main economic activity is extensive cattle raising, in farms characterized by an extremely wildlife-rich environment. We herein describe tick infestations of cattle and of the natural environment in Pantanal of Nhecolândia in Brazil, at areas with and without cattle during both dry and wet seasons. Environmental sampling resulted in three tick species: Amblyomma sculptum (423 nymphs and 518 adults), Amblyomma parvum (7 nymphs and 129 adults), Amblyomma ovale (3 adults) as well as three clusters and two individuals of Amblyomma sp. larvae. A significantly higher number of adult A. sculptum ticks was found in areas with cattle in the wet season. From 106 examinations of bovines 1710 ticks from three species were collected: Rhipicephalus microplus (55.7% of the total), A. sculptum (38%) and A. parvum (4.1%), as well as 32 Amblyomma sp. larvae. A significant similarity was found between Amblyomma tick fauna from environment and on cattle during both seasons. All A. sculptum females on bovines were flat whereas many of A. parvum females and A. sculptum nymphs were engorging. Although R. microplus was the most abundant tick species on cattle, overall highest tick prevalence on bovines in the dry season was of A. sculptum nymphs. Lack of R. microplus in environmental sampling, relationship between cattle and increase in adult A. sculptum numbers in the environment as well as suitability of bovine for the various tick species are discussed.

  17. Sequencing and phylogenetic analysis of partial CXCR2 gene of Murrah buffalo

    Directory of Open Access Journals (Sweden)

    S. A. Wani

    2014-05-01

    Full Text Available Aim: Present study was carried out to sequence and phylogenetic analysis of CXCR2 gene of Murrah buffalo. Materials and Methods: For the present investigation, from a group of forty eight Murrah buffaloes (Bubalus bubalis, blood samples were collected randomly from eight animals, out of which four were healthy and four were mastitic. Results: The amplification of Interleukin-8B (IL-8B receptor gene target sequence was carried out using the primer pair in an optimized polymerase chain reaction. Partial sequencing of IL-8B receptor gene of Bubalus bubalis (Murrah has been done successfully. The sequences of IL-8B receptor gene showed 99% homology to that of Bos indicus × Bos taurus, 98% to that of Bos taurus, 97% to that of Ovis aries, 93% to that of Sus scrofa, 92% to that of Equus caballus and 90% to that of Felis catus. Conclusion: From the present study it can be concluded that the PCR amplification procedure for target region of IL-8B receptor gene yielding 459 bp products has been standardized, which yielded consistent and specific amplification. Amplification of partial IL-8B receptor gene (exon 2- 459 bp using self designed primers specific for cattle ortholog sequence signifies that the locus is conserved in cattle and buffaloes. In phylogenetic tree, the target sequence of IL-8B receptor gene of Bubalus bubalis were found to be more closely related to Bos indicus × Bos Taurus and Bos taurus than to Ovis aries and Sus scrofa.

  18. Estudo genômico do nível de infecção por Babesia bovis em bovinos da raça angus

    OpenAIRE

    Santana, Clarissa Helena [UNESP

    2016-01-01

    A bovinocultura é um setor com importante destaque no agronegócio brasileiro. O carrapato Ripicephalus (Boophilus) microplus é responsável por perdas econômicas significativas aos pecuaristas e é vetor de hemoparasitoses como Anaplasma spp e Babesia spp. Sabe-se que os bovinos Bos taurus taurus são mais susceptíveis à infestação por carrapatos do que Bos taurus indicus. Acredita-se que o mesmo ocorra para a infecção por Babesia bovis. Neste trabalho, foram avaliados, em duas colheitas, 355 bo...

  19. Quantitative trait locus affecting birth weight on bovine chromosome 5 in a F2 Gyr x Holstein population

    Directory of Open Access Journals (Sweden)

    Gustavo Gasparin

    2005-12-01

    Full Text Available Segregation between a genetic marker and a locus influencing a quantitative trait in a well delineated population is the basis for success in mapping quantitative trait loci (QTL. To detect bovine chromosome 5 (BTA5 birth weight QTL we genotyped 294 F2 Gyr (Bos indicus x Holstein (Bos taurus crossbreed cattle for five microsatellite markers. A linkage map was constructed for the markers and an interval analysis for the presence of QTL was performed. The linkage map indicated differences in the order of two markers relative to the reference map (http://www.marc.usda.gov. Interval analysis detected a QTL controlling birth weight (p < 0.01 at 69 centimorgans (cM from the most centromeric marker with an effect of 0.32 phenotypic standard-error. These results support other studies with crossbred Bos taurus x Bos indicus populations.

  20. Composição lipídica de carne bovina de grupos genéticos taurinos e zebuínos terminados em confinamento Lipid composition of meat from zebu and taurine cattle finished in confinement

    Directory of Open Access Journals (Sweden)

    Lizandra Vercezi Rossato

    2009-09-01

    Full Text Available O objetivo neste trabalho foi avaliar a composição em lipídeos totais, colesterol e ácidos graxos do músculo longissimus dorsi de bovinos Bos taurus (n=40 e Bos indicus (n=40 com 30 a 36 meses de idade e peso de carcaça entre 240 e 270 kg terminados em confinamento por 90 dias. Os resultados de lipídeos totais foram semelhantes entre os dois grupos. O nível de colesterol foi mais elevado em Bos indicus (66,95 mg/100 g que em Bos taurus (37,37 mg/100 g. Os valores médios dos ácidos graxos saturados de C14:0 e C18:0 foram mais elevados nos Bos indicus (3,52 e 22,45% em comparação aos Bos taurus (3,08 e 18,67%. O C16:0 nos Bos taurus (26,14% foi maior que nos Bos indicus (24,77%. Na análise do perfil de ácidos graxos monoinsaturados (AGM, os Bos taurus apresentaram os percentuais mais elevados de C14:1 cis9, C16:1 cis9, C18:1 cis9, ΣAGM e os menores de C18:1 trans. Os animais Bos taurus apresentaram maiores percentuais de C18:3 n-3, C20:4 n-6 e C22:5 n-3 (ácidos graxos poliinsaturados. Os ácidos graxos C18:2 n-6, CLA, C20:5 n-3, C22:6 n-3, ΣAGP e Σn-6 foram semelhantes entre grupos de bovinos. A razão n-6/n-3 foi menor em Bos taurus (4,63 em comparação aos Bos indicus (5,70. Em geral, o grupo genético influencia o perfil de colesterol e ácidos graxos de bovinos e esse efeito é mais pronunciado nos ácidos graxos saturados e monoinsaturados.This study was carried out to evaluate total lipids (TL, cholesterol and fatty acids (FA in the longissimus dorsi muscle of Bos taurus (n=40 and Bos indicus (n=40 bulls, aged 30-36 months and 240-270 kg carcass weight, finished in the feedlot for 90 days. The total lipids content was similar in both groups. Cholesterol was higher in Bos indicus (66.95 mg/100 g than in Bos taurus (37.37 mg/100 g. For saturated fatty acids, the means for C14:0 and C18:0 were higher in Bos indicus (3.52 and 22.45%, than in Bos taurus (3.08 e 18.67%. The C16:0 was higher in Bos taurus (26.14%, as compared to

  1. (Re)Considering cattle farming in Southern Africa under a changing climate

    CSIR Research Space (South Africa)

    Archer van Garderen, ERM

    2011-10-01

    Full Text Available in more traditional extensive farming systems) are usually better adapted to higher temperatures. As one example, Bos taurus breeds tend to be more productive in temperate climates and tend to be used for their productivity, while Bos indicus (such...) Comfort threshold for high-producing dairy cows (Herna?ndez et al. 2002); higher for Bos indicus breeds (which are highly adapted to heat stress) 278C Upper limit of comfort zone for maximum milk production in India, which is 28C higher than...

  2. Breeding programs for the main economically important traits of zebu dairy cattle

    OpenAIRE

    Ariosto Ardila Silva

    2010-01-01

    In tropical regions, Gyr and Guzerat breeds (Bos indicus) are most explored for dairy industry and are much more adapted to climate. Gyr and Guzerat are Zebu breeds very common in Brazil and they are being used to generate Bos taurus x Bos indicus crosses in order to combine good production, heat and parasite tolerance on the tropics. Breeding programs for the main economically important traits of Zebu dairy cattle have been recently introduced in Brazil and is based on the use of genetically...

  3. Whole-genome sequencing reveals mutational landscape underlying phenotypic differences between two widespread Chinese cattle breeds

    OpenAIRE

    Xu, Yao; Jiang, Yu; Shi, Tao; Cai, Hanfang; Lan, Xianyong; Zhao, Xin; Plath, Martin; Chen, Hong

    2017-01-01

    Whole-genome sequencing provides a powerful tool to obtain more genetic variability that could produce a range of benefits for cattle breeding industry. Nanyang (Bos indicus) and Qinchuan (Bos taurus) are two important Chinese indigenous cattle breeds with distinct phenotypes. To identify the genetic characteristics responsible for variation in phenotypes between the two breeds, in the present study, we for the first time sequenced the genomes of four Nanyang and four Qinchuan cattle with 10 ...

  4. THE TAURUS SPITZER SURVEY: NEW CANDIDATE TAURUS MEMBERS SELECTED USING SENSITIVE MID-INFRARED PHOTOMETRY

    International Nuclear Information System (INIS)

    Rebull, L. M.; Padgett, D. L.; McCabe, C.-E.; Noriega-Crespo, A.; Carey, S. J.; Brooke, T.; Hillenbrand, L. A.; Stapelfeldt, K. R.; Angione, J. R.; Huard, T.; Terebey, S.; Audard, M.; Baldovin-Saavedra, C.; Monin, J.-L.; Menard, F.; Bouvier, J.; Fukagawa, M.; Guedel, M.; Knapp, G. R.; Allen, L. E.

    2010-01-01

    We report on the properties of pre-main-sequence objects in the Taurus molecular clouds as observed in seven mid- and far-infrared bands with the Spitzer Space Telescope. There are 215 previously identified members of the Taurus star-forming region in our ∼44 deg 2 map; these members exhibit a range of Spitzer colors that we take to define young stars still surrounded by circumstellar dust (noting that ∼20% of the bona fide Taurus members exhibit no detectable dust excesses). We looked for new objects in the survey field with similar Spitzer properties, aided by extensive optical, X-ray, and ultraviolet imaging, and found 148 new candidate members of Taurus. We have obtained follow-up spectroscopy for about half the candidate sample, thus far confirming 34 new members, three probable new members, and 10 possible new members, an increase of 15%-20% in Taurus members. Of the objects for which we have spectroscopy, seven are now confirmed extragalactic objects, and one is a background Be star. The remaining 93 candidate objects await additional analysis and/or data to be confirmed or rejected as Taurus members. Most of the new members are Class II M stars and are located along the same cloud filaments as the previously identified Taurus members. Among non-members with Spitzer colors similar to young, dusty stars are evolved Be stars, planetary nebulae, carbon stars, galaxies, and active galactic nuclei.

  5. SPECTROSCOPY OF PUTATIVE BROWN DWARFS IN TAURUS

    International Nuclear Information System (INIS)

    Luhman, K. L.; Mamajek, E. E.

    2010-01-01

    Quanz and coworkers have reported the discovery of the coolest known member of the Taurus star-forming complex (L2 ± 0.5), and Barrado and coworkers have identified a possible protostellar binary brown dwarf in the same region. We have performed infrared spectroscopy on the former and the brighter component of the latter to verify their substellar nature. The resulting spectra do not exhibit the strong steam absorption bands that are expected for cool objects, demonstrating that they are not young brown dwarfs. The optical magnitudes and colors for these sources are also indicative of background stars rather than members of Taurus. Although the fainter component of the candidate protostellar binary lacks spectroscopy, we conclude that it is a galaxy rather than a substellar member of Taurus based on its colors and the constraints on its proper motion.

  6. Solid CO in the Taurus dark clouds

    International Nuclear Information System (INIS)

    Whittet, D.C.B.; McFadzean, A.D.

    1985-01-01

    The infrared vibrational feature of solid state CO at 4.67 μm wavelength is detected towards five sources in or behind the dark cloud complex in Taurus. A comparison with millimetre-wave data suggests that a significant fraction (up to 40 per cent) of the CO may be depleted on to grains. The adjacent CN feature at 4.62 μm observed in W33A by previous authors is absent from the present spectra, suggesting that the grain mantles in Taurus are unannealed. (author)

  7. Photometric peculiarities of the RY Taurus

    International Nuclear Information System (INIS)

    Zajtseva, G.V.

    1982-01-01

    The results are presented of photoelectric UBV-observations of RY Taurus carried out in 1965-80 at the Crimean Station of the State Sternberg Astronomical Institute. Two components of brightness variations are observed: fast (days) and slow (years). During fast variations the colour indices U-B and B-V change independently of brightness, however, in particular time inter-- vals the rather strong correlation with the star brightness is observed, positive or negative. During the slow variations only the reverse dependence is observed; the brightness increase is followed by the increase of colour indices (reddening of the star). The comparison of the RY TAURUS intrinsic polarization variations has shown that the dependence of polarization degree on brightness is nonmonotonic. At minimum and maximum brightness the RY TAURUS intrinsic polarization is maximum and reaches 5-6 %. At the general amplitude of RY TAURUS brightness variations in V rays from 10.sup(m)1 to 11.sup(m)7 the V=11.sup(m)0 value is singled out. First a certain ''avoidance'' of this brightness value by the star is observed. Second, the fracture in the course of polarization dependence on brightness occurs as well in the V=11sup(m) region

  8. A Taurus Map on a Minoan Vase?

    Science.gov (United States)

    Banos, G.

    During the excavation of a shrine at Anemospilia on Crete in 1979, richly decorated vase was discovered, like that appearing on the sarcophagus of Aghia Triada to be used for the collection of the blood of the sacrifices bull. The vase was dated to the Middle Minoan period (around 1700 B.C.) The central motif of the decoration of the vase is a plastic bull painted off- white, with a pattern of red round spots scattered over its body. The whole decoration was considered by the excavators and other investigators, as a "speaking symbol" of a bull sacrifice. In this article we suggest that the pattern of round spots could be considered as a map of the Taurus constellation, the oldest one known in the Aegean moreover, that the whole decoration refers to Spring, when the vernal equinox was located in Taurus in Minoan Times. We also suggest that the beginning of the year would be fixed following this equinox.

  9. Genome variability in European and American bison detected using the BovineSNP50 BeadChip

    DEFF Research Database (Denmark)

    Pertoldi, C.; Wójcik, Jan M; Tokarska, Małgorzata

    2010-01-01

     The remaining wild populations of bison have all been through severe bottlenecks. The genomic consequences of these bottlenecks present an interesting area to study. Using a very large panel of SNPs developed in Bos taurus we have carried out a genome-wide screening on the European bison (Bison...... bonasus; EB) and on two subspecies of American bison: the plains bison (B. bison bison; PB) and the wood bison (B. bison athabascae; WB). One hundred bison samples were genotyped for 52,978 SNPs along with seven breeds of domestic bovine Bos taurus. Only 2,209 of the SNPs were polymorphic in the bison...

  10. Interstellar extinction in the Taurus dark clouds

    International Nuclear Information System (INIS)

    Meistas, E.; Straizys, V.

    1981-01-01

    The results of photoelectric photometry of 89 stars in the Vilnius seven-color system in the area of the Taurus dark clouds with corrdinates (1950) 4sup(h)16sup(m)-4sup(h)33sup(m), +16 0 -+20 0 are presented. Photometric spectral types, absolute magnitude, color excesses, interstellar extinctions and distances of the stars are determined. The distance of the dark nebula is found to be 140 pc and is in a good agreement with the distance determined for the dark nebula Khavtassi 286, 278. The average extinction Asub(v) in the investigated area is of the order of 1.4. (author)

  11. TAURUS - a wide field imaging Fabry-Perot spectrometer

    International Nuclear Information System (INIS)

    Atherton, P.D.; Taylor, K.

    1983-01-01

    TAURUS, an imaging Fabry-Perot system developed by the Royal Greenwich Observatory and Imperial College London, is described. The imaging process is explained and the technique is compared with grating spectrographs. It is argued that TAURUS is superior for obtaining field information from extended emission line sources. (Auth.)

  12. Imunoidentification of Albumin and Osteopontin in Seminal Plasma of Taurine and Zebuine Bulls/ Imunoidentificação de Albumina e Osteopontina no Plasma Seminal de Reprodutores Taurinos e Zebuínos

    Directory of Open Access Journals (Sweden)

    Rodrigo Costa Mattos

    2002-05-01

    Full Text Available Two dimensional polyacrylamide gel electrophoresis was performed in seminal plasma of seven Bos taurus taurus and seven Bos taurus indicus bulls with high semen freezability, from an artificialinsemination center. In a 8% polyacrylamide gels, three bands of 195, 66 and 55 kDa, present in 100% of the samples in both sub-species, were analyzed by their optical densities. In Bos taurus samples, the opticals densities of 55 kDa band, imunoidentified as osteopontin were superior (pAs proteínas do plasma seminal de 14 reprodutores (7 Bos taurus taurus e 7 Bos taurus indicus, foram analisadas por eletroforese bidimensional, em géis de poliacrilamida a 8%, corados por Comassie Blue. Três bandas protéicas, presentes em 100% das amostras de plasma seminal, foram quantificadas de acordo com a densidade óptica exibida: 195 kDa, pI 6,5-7,5 ; 66 kDa, pI 5,4 e 55 kDa, pI 4,5. As amostras de plasma seminal provenientes de taurinos apresentaram densidades ópticas significativamente superiores (p < 0,05 às dos zebuínos na banda de 55 kDa, que foi imunoidentificada como osteopontina. As demais proteínas analisadas não apresentaram variações significativas entre as subespécies. A banda protéica de 66 kDa, foi imunoidentificada como albumina. Nas amostras provenientes de taurinos, as densidades ópticas das três bandas protéicas quantificadas não evidenciaram variação significativa entre os reprodutores. Entretanto, nos zebuínos, as densidades ópticas da albumina apresentaram diferenças significativas entre os touros (p < 0,05.

  13. Molecular characterization and expression profile of the melatonin receptor MT1 in the ovary of Tianzhu white yak (Bos grunniens).

    Science.gov (United States)

    Hu, Jun Jie; Zhang, Xiao Yu; Zhang, Yong; Zhao, Xing Xu; Li, Fa Di; Tao, Jin Zhong

    2017-02-01

    Melatonin plays crucial roles in a wide range of ovarian physiological functions via the melatonin receptors (MRs). Structure and function of MRs have been well studied in sheep, cattle, and humans, but little information exists on the genetic characterization and function of these receptors in the ovary of the white yak. In the present study, the melatonin receptor MT1 was cloned by RT-PCR in the ovary of white yak; the MT1 cDNA fragment obtained (843bp) comprised an open reading frame (827bp) encoding a protein containing 275 residues, characterized by seven transmembrane regions and an NRY motif, two distinct amino acid replacements were found. The white yak MT1 had a 83.9-98.6% protein sequence identity with that of nine other mammals. Using RT-PCR, the expression levels of MT1, MT2, and LHR in the ovary of pregnant and non-pregnant white yaks were compared, revealing higher levels of all genes in pregnant yaks: 3.83-fold increase for MT1 (Pmelatonin and MT1 are associated with the corpus luteum function of pregnancy maintenance and follicular development during oocyte maturation in the white yak. Copyright © 2015 Elsevier Inc. All rights reserved.

  14. Comparison of a flow assay for brucellosis antibodies with the reference cELISA test in West African Bos indicus.

    Directory of Open Access Journals (Sweden)

    Barend M deC Bronsvoort

    Full Text Available Brucellosis is considered by the Food and Agricultural Organisation and the World Health Organisation as one of the most widespread zoonoses in the world. It is a major veterinary public health challenge as animals are almost exclusively the source of infection for people. It is often undiagnosed in both human patients and the animal sources and it is widely acknowledged that the epidemiology of brucellosis in humans and animals is poorly understood, particularly in sub-Saharan Africa. It is therefore important to develop better diagnostic tools in order to improve our understanding of the epidemiology and also for use in the field for disease control and eradication. As with any new diagnostic test, it is essential that it is validated in as many populations as possible in order to characterise its performance and improve the interpretation of its results. This paper describes a comparison between a new lateral flow assasy (LFA for bovine brucellosis and the widely used cELISA in a no gold standard analysis to estimate test performance in this West African cattle population. A Bayesian formulation of the Hui-Walter latent class model incorporated previous studies' data on sensitivity and specificity of the cELISA. The results indicate that the new LFA is very sensitive (approximately 87% and highly specific (approximately 97%. The analysis also suggests that the current cut-off of the cELSIA may not be optimal for this cattle population but alternative cut-offs did not significantly change the estimates of the LFA. This study demonstrates the potential usefulness of this simple to use test in field based surveillance and control which could be easily adopted for use in developing countries with only basic laboratory facilities.

  15. Recreatief gebruik van bos- en natuurgebieden in Brabant en Limburg 1988 [Visiting forests and nature reserves for recreational purposes 1988

    NARCIS (Netherlands)

    Peltzer, R.H.M.

    1995-01-01

    Visiting forests and nature reserves for recreational purposes Frequency and destination of holidays and short holidays / leisure outdoor activities in the Netherlands / having one or more dogs / other activities like visiting relatives and friends, going to the beach, visiting forests and other

  16. Epidemiological investigation and risk factors of Echinococcus granulosus in yaks (Bos grunniens), Tibetan pigs and Tibetans on Qinghai Tibetan plateau.

    Science.gov (United States)

    Li, Kun; Zhang, Lihong; Zhang, Hui; Lei, Zhixin; Luo, Houqiang; Mehmood, Khalid; Shahzad, Muhammad; Lan, Yanfang; Wang, Meng; Li, Jiakui

    2017-09-01

    Echinococcus granulosus (E. granulosus) is a diverse zoonotic parasite and causes Cystic echinococcosis (CE) disease in humans and livestock. However, scare information is available about the epidemic situation of E. granulosus infection in yaks, Tibetan pigs and native Tibetans on the Qinghai Tibetan plateau. Therefore, a study was carried out to find prevalence and risk factors of E. granulosus in yaks, Tibetan pigs and Tibetans. Serum samples from yaks (1371), Tibetan pigs (454) and Tibetans (600) were collected and assessed by commercial ELISA kits. Multivariable logistic regression model was performed to find the variables possibly associated with exposure of E. granulosus infection in yaks, Tibetan pigs and Tibetan. The overall prevalence of E. granulosus in yaks was 6.49%. In different regions, the prevalence were ranged from 3.43% to 11.79%. In male and female yaks, the prevalence was 5.67% and 7.04%, respectively. In different ages, the prevalence were ranged from 2.20% to 10.9%. While, in different years, the prevalence was 3.61% in 2014, 9.66% in 2015, and 6.33% in 2016. According to the conditional stepwise logistic regression, three factors (region, age and year) were demonstrated to be risk factors influencing the prevalence of E. granulosus in yaks significantly (PTibetan pigs were positive for E. granulosus with the distribution of 5.47, 5.70 and 13.27% prevalence in Gongbo'gvamda, Mainling, and Nyingchi region, respectively. In male and female Tibetan pigs, the prevalence was 7.12% and 7.49% respectively, while region was considered as a significant (PTibetan pigs. The total prevalence of E. granulosus infection in Tibetans was 1.83%, while in male and female Tibetans, the prevalence was 1.41% and 2.21%, respectively. In different ages, the prevalence were ranged from 0 to 3.21%. In Tibetans contacting animals or not was 2.41% and 0.54% respectively, and breeding dogs or not was 3.0% and 1.09%, respectively. Risk factors (gender age, contact animal and breed dog) were not significant (P>0.05). The present results reported the prevalence and associated risk factors of E. granulosus in yaks, Tibetan pigs and native Tibetans. These findings could have important epidemiological significance and a direct influence on the remote plateau. Copyright © 2017 Elsevier B.V. All rights reserved.

  17. Effect of Addition of Taurine on the Liquid Storage (5°C of Mithun (Bos frontalis Semen

    Directory of Open Access Journals (Sweden)

    P. Perumal

    2013-01-01

    Full Text Available The present study was undertaken to assess the effect of taurine on sperm motility, viability, total sperm abnormalities, acrosomal and plasma membrane integrity, enzymatic profiles such as reduced glutathione (GSH, glutathione peroxidase (GPX, superoxide dismutase (SOD, and catalase (CAT, and biochemical profiles such as cholesterol efflux and malondialdehyde (MDA production. A total of 50 ejaculates were collected twice a week from 8 mithun bulls, and semen was split into 4 equal aliquots and diluted with the TEYC extender. Group 1: semen was without additives (control; groups 2 to 4: semen was diluted with 25 mM, 50 mM, and 100 mM of taurine, respectively. Seminal parameters and enzymatic and biochemical profiles were assessed at 5°C. Inclusion of taurine into diluent resulted in significant ( decreases in percentages of dead spermatozoa, abnormal spermatozoa, and acrosomal abnormalities after liquid storage compared with the control group. Additionally, taurine at 50 mM has significant improvement in quality of mithun semen than taurine at 25 or 100 mM stored in in vitro at 5°C. It was concluded that the possible protective effects of taurine on sperm parameters are from enhancing the function of antioxidant enzymes, preventing efflux of cholesterol from cell membranes and decreased MDA production.

  18. Effect of age and season on the thyroid hormone activity of Mizoram strain female mithun (Bos frontalis)

    Science.gov (United States)

    Lalsangpuii; Ali, M. Ayub; Devi, L. Inaotombi; Behera, Parthasarathi; Ralte, Lalsanglura

    2015-01-01

    Aim: The aim of the present study was to generate baseline data on the normal values of the thyroidhormone (TH) activity as well as their correlation with age and season. Materials and Methods: Blood samples (10 ml) were collected from jugular vein of 30 female mithun’s of three different age groups viz. Calves (6 months to 1 year), heifer (1-3 years) and adult (above 3 years) during the three season’s viz. Monsoon, winter and spring of a year. The serum was analyzed for thyroid stimulating hormone (TSH), triiodothyronine (T3), and thyroxine (T4) activity. Result: The result showed a significantly (p<0.05) a higher T3 level in heifers followed by adults and calves and higher T4 level in adults followed by heifers and calves in all the seasons. The TSH level was higher in heifers in all the seasons. The winter season recorded higher level of T3, T4, and TSH as compared to the other seasons of a year. Conclusion: The TSH and T3 level were the highest for aheifer, whereas T4 level was the highest for adults inall the season. Furthermore, the higher level of TH was observed in winter season. The increased level of the TH during the winter season signifies their calorigenic effect. Similarly in heifers, the increased T3 concentrations show its importance in reproductive physiology and its association with ovarian activity. This indicates that age and season have aprofound effect on TH activity of Mizoram strain female mithun. PMID:27047046

  19. Bovine conceptus of Bos indicus produced by somatic cell nuclear transfer and parthenogenesis present morphological variations since the blastocyst stage

    Directory of Open Access Journals (Sweden)

    F.D. Oliveira

    2015-12-01

    Full Text Available In cattle, embryo development is characterized by the appearance of two distinct cell layers, the trophectoderm and the inner cell mass. The latter will undergo differentiation to form the embryonic disc consisting of the epiblast and hypoblast. The aim of this study was to ultrastructurally characterize the bovine embryo from different in vitro production techniques, with emphasis on trophectoderm and inner cell mass cells. Bovine embryos on day 7 (conception = D1 of pregnancy, derived via in vitro production techniques, were fixed for light and transmission electron microscopy processing. Results suggested that embryos produced by nuclear transfer of somatic cells and parthenogenesis showed significant changes in macroscopic and microscopic structure. Size was reduced, and the inner cell mass had no defined shape. Furthermore, organelles responsible for the absorption processes, communication, growth, and cellular metabolism were fewer and had changes in shape, when compared to results in embryos produced by in vitrofertilization. We concluded that embryos produced by parthenogenesis and SCNT exhibit morphological differences when compared with IVF embryos, such as undeveloped blastocoel, poorly defined distribution of ICM, and morphological differences in organelles.

  20. CH4 Emission Model from Bos Primigenius Waste in Fish-Water: Implications for Integrated Livestock-Fish Farming Systems

    Directory of Open Access Journals (Sweden)

    Joshua O. Okeniyi

    2013-07-01

    Full Text Available This paper studies a methane (CH4 emission model from the waste of cattle (B. primigenius based on trends in integrated livestock-fish farming adoption by farmers in Nigeria. Dung of B. primigenius was employed as substrate in fish-water, obtained from a fish-rearing farm, as a matrix medium for simulating a low-oxygen wastewater environment of an agriculture-aquaculture system. A substrate to fish-water mass ratio of 1:3 was used, developed in a laboratory-size digesting reactor system. Volumetric readings, at ambient temperature conditions and with a retention time of thirty-two days, were then subjected to the logistic probability density function, and tested against correlation coefficient and Nash-Sutcliffe coefficient of efficiency criteria. The readings show that a volume of CH4-containing gas as high as 65.3 x 10−3 dm3 was produced on the 13th day from the B. primigenius substrate. Also, production of 234.59 x 10−3 dm3/kg CH4-containing gas, totaling 703.76 x 10−3 dm3, was observed through the studied retention time. The 60% CH4 constituent model of the measured gas generation showed a potency of 2.0664 kg emission per animal, which is equivalent to 43.3944 CO2eq of global warming potential (GWP annually per animal. This bears environmental and climate change implications, and therefore alternative sustainable practices for integrated livestock-fish farming adoption are suggested.

  1. Climate change effects on the Dutch forests and forestry; Effecten van klimaatverandering op het Nederlandse bos en bosbeheer

    Energy Technology Data Exchange (ETDEWEB)

    Nabuurs, G.J.; Kramer, K.; Mohren, G.M.J. [IBN-DLO, Wageningen (Netherlands)

    1997-12-31

    The effects of climate change on Dutch forests and forestry will be very drastic when climate change occurs. Changes in the forest ecosystem will affect all functions that the forests provide now. This report presents an overview of the current knowledge of effects of climate change on forests at varying scales of time and space. Where possible the information focuses on the situation in The Netherlands. It also includes an overview of measures which forest management can take to anticipate climate change in order to reduce the effects. 35 refs.

  2. Ruđer Bošković and the Structure of the Experience of Scientific Discovery

    Directory of Open Access Journals (Sweden)

    Francis Brassard

    2016-05-01

    Full Text Available Ruđer Josip Bošković (1711-1787 was a Jesuit priest and a scientist from the former Republic of Dubrovnik in today’s Croatia. He published many works in such fields as mathematics, physics, astronomy and geodesy. According to Werner Heisenberg, Bošković’s “main work, Theoria Philosophiae Naturalis, contains numerous ideas which have reached full expression only in modern physics of the past fifty years.” The question that this paper seeks to elucidate is what enabled Bošković to anticipate the discoveries of modern physics.Because Bošković could not avail himself of the resources and instruments by which modern theories are validated, it is assumed that there exists a mechanism of subjective validation that allowed him to accept the truthfulness of his ideas. It will be argued that this mechanism of internal validation is very similar to the process of spiritual transformation. More specifically, using Polanyi’s notion of twofold awareness (subsidiary and focal, it will be shown that this mechanism is best explained by the fact that when an idea has been fully internalized by a person so that it has become an instrument by which that person makes sense of the world and interacts with it, it acquires by this process an enormous credibility.

  3. Morphological characterization of uterus and oviducts of Nelore bovine fetuses (Bos primigenius indicus at various gestation stages

    Directory of Open Access Journals (Sweden)

    Cristina Maria Rodrigues Monteiro

    2003-01-01

    Full Text Available Para a realização desta pesquisa, foram coletados vinte fetos fêmeas em diferentes fases de gestação da raça Nelore. Os cornos uterinos e as tubas uterinas foram dissecados, mensurados e os fragmentos fixados em paraformaldeído tamponado a 4,00%, processados e incluídos em paraplástico. Os cortes com 5 mm foram corados com hematoxilina e eosina, tricrômio de Masson (para fibras colágenas, Verhoeff (para fibras elásticas e com reticulina (para fibras reticulares. Os resultados mostraram que não há diferença significativa das mensurações entre os lados direito e esquerdo para os cornos uterinos e tubas uterinas, porém há correlação entre os valores obtidos das mensurações dos órgãos em função da idade dos fetos, ou seja, o crescimento dos órgãos acompanha o crescimento fetal. O epitélio de revestimento do útero não apresenta variações morfológicas evidentes no período analisado. A partir de 23 semanas de gestação, a mucosa uterina apresenta evolução marcante no desenvolvimento das projeções e não há aparecimento de glândulas endometriais na parede uterina no período analisado. A camada muscular apresenta a subcamada circular interna desenvolvida até 23 semanas de gestação e a partir de 24 semanas há presença das duas subcamadas. A camada serosa é típica e não mostra variabilidade no decorrer da gestação. As tubas uterinas apresentam diferenças de crescimento, principalmente dos pregueamentos que a partir de 23 semanas de gestação tornaram-se mais altos e ramificados, porém sem aparecimento de pregas terciárias. Com o desenvolvimento fetal, os cílios epiteliais do pregueamento tubárico são maiores em tamanho e em número. Até 32 semanas de gestação, a camada muscular das tubas uterinas apresenta apenas a subcamada circular interna. A camada serosa e o mesosalpinge são típicos e não apresentam variações importantes. As variações mais marcantes para os órgãos estudados ocorreram a partir de 23 semanas de gestação.

  4. Candidate gene expression in Bos indicus ovarian tissues: pre-pubertal and post-pubertal heifers in diestrus

    Directory of Open Access Journals (Sweden)

    Mayara Morena Del Cambre Amaral Weller

    2016-10-01

    Full Text Available Growth factors such as bone morphogenetic proteins 6, 7, 15 and two isoforms of transforming growth factor-beta (BMP6, BMP7, BMP15, TGFB1 and TGFB2 and insulin-like growth factor system act as local regulators of ovarian follicular development. To elucidate if these factors as well as others candidate genes such as estrogen receptor 1 (ESR1, growth differentiation factor 9 (GDF9, follicle stimulating hormone receptor (FSHR, luteinizing hormone receptor (LHR, bone morphogenetic protein receptor, type 2 (BMPR2, type 1 insulin-like growth factor receptor (IGFR1, and key steroidogenic enzymes cytochrome P450 aromatase and 3-β-hydroxysteroid dehydrogenase (CYP19A1 and HSD3B1 could modulate or influence diestrus on the onset of puberty in Brahman heifers, their ovarian mRNA expression was measured before and after puberty (luteal phase. Six post-pubertal (POST heifers were euthanized on the luteal phase of their second cycle, confirmed by corpus luteum observation, and six pre-pubertal (PRE heifers were euthanized in the same day. Quantitative real-time PCR analysis showed that the expression of FSHR, BMP7, CYP19A1, IGF1 and IGFR1 mRNA was greater in PRE heifers, when contrasted to POST heifers. The expression of LHR and HSD3B1 was lower in PRE heifers. Differential expression of ovarian genes could be associated with changes in follicular dynamics and different cell populations that have emerged as consequence of puberty and the luteal phase. The emerging hypothesis is that BMP7 and IGF1 are co-expressed and may modulate the expression of FSHR, LHR and IGFR1 and CYP19A1. BMP7 could influence the down-regulation of LHR and up-regulation of FSHR and CYP19A1, which mediates the follicular dynamics in heifer ovaries. Up-regulation of IGF1 expression pre-puberty, compared to post-puberty diestrus, correlates with increased levels FSHR and CYP19A1. Thus, BMP7 and IGF1 may play synergic roles and were predicted to interact, from the expression data (P = 0.07, r = 0.84. The role of these co-expressed genes in puberty and heifers luteal phase merits further research.

  5. Comparison of a Flow Assay for Brucellosis Antibodies with the Reference cELISA Test in West African Bos indicus

    Science.gov (United States)

    Bronsvoort, Barend M. deC.; Koterwas, Bronwyn; Land, Fiona; Handel, Ian G.; Tucker, James; Morgan, Kenton L.; Tanya, Vincent N.; Abdoel, Theresia H.; Smits, Henk L.

    2009-01-01

    Brucellosis is considered by the Food and Agricultural Organisation and the World Health Organisation as one of the most widespread zoonoses in the world. It is a major veterinary public health challenge as animals are almost exclusively the source of infection for people. It is often undiagnosed in both human patients and the animal sources and it is widely acknowledged that the epidemiology of brucellosis in humans and animals is poorly understood, particularly in sub-Saharan Africa. It is therefore important to develop better diagnostic tools in order to improve our understanding of the epidemiology and also for use in the field for disease control and eradication. As with any new diagnostic test, it is essential that it is validated in as many populations as possible in order to characterise its performance and improve the interpretation of its results. This paper describes a comparison between a new lateral flow assasy (LFA) for bovine brucellosis and the widely used cELISA in a no gold standard analysis to estimate test performance in this West African cattle population. A Bayesian formulation of the Hui-Walter latent class model incorporated previous studies' data on sensitivity and specificity of the cELISA. The results indicate that the new LFA is very sensitive (∼87%) and highly specific (∼97%). The analysis also suggests that the current cut-off of the cELSIA may not be optimal for this cattle population but alternative cut-offs did not significantly change the estimates of the LFA. This study demonstrates the potential usefulness of this simple to use test in field based surveillance and control which could be easily adopted for use in developing countries with only basic laboratory facilities. PMID:19381332

  6. Alternative genotyping method for the single nucleotide polymorphism A2959G (AF159246 of the bovine CAST gene Método alternativo de genotipagem do polimorfismo de nucleotídeo único A2959G (AF159246 do gene CAST bovino

    Directory of Open Access Journals (Sweden)

    Rogério Abdallah Curi

    2008-05-01

    Full Text Available The objective of this work was to genotype the single nucleotide polymorphism (SNP A2959G (AF159246 of bovine CAST gene by PCR-RFLP technique, and to report its use for the first time. For this, 147 Bos indicus and Bos taurus x Bos indicus animals were genotyped. The accuracy of the method was confirmed through the direct sequencing of PCR products of nine individuals. The lowest frequency of the meat tenderness favorable allele (A in Bos indicus was confirmed. The use of PCR-RFLP for the genotyping of the bovine CAST gene SNP was shown to be robust and inexpensive, which will greatly facilitate its analysis by laboratories with basic structure.O objetivo deste trabalho foi genotipar o polimorfismo de nucleotídeo único ("single nucleotide polymorphism" - SNP A2959G (AF159246 do gene CAST bovino, pela técnica de PCR-RFLP, e reportar a sua utilização pela primeira vez. Para tanto, 147 animais Bos indicus e Bos taurus x Bos indicus foram genotipados. A acurácia do método foi confirmada por meio do seqüenciamento direto de produtos de PCR de nove indivíduos. A menor freqüência do alelo A, favorável à maciez da carne, foi confirmada nos animais Bos indicus. O uso da PCR-RFLP, para a genotipagem do SNP do gene CAST bovino, mostrou-se consistente e de baixo custo, o que permite a sua análise por laboratórios dotados de estrutura básica.

  7. Circumstellar disks around binary stars in Taurus

    International Nuclear Information System (INIS)

    Akeson, R. L.; Jensen, E. L. N.

    2014-01-01

    We have conducted a survey of 17 wide (>100 AU) young binary systems in Taurus with the Atacama Large Millimeter Array (ALMA) at two wavelengths. The observations were designed to measure the masses of circumstellar disks in these systems as an aid to understanding the role of multiplicity in star and planet formation. The ALMA observations had sufficient resolution to localize emission within the binary system. Disk emission was detected around all primaries and 10 secondaries, with disk masses as low as 10 –4 M ☉ . We compare the properties of our sample to the population of known disks in Taurus and find that the disks from this binary sample match the scaling between stellar mass and millimeter flux of F mm ∝M ∗ 1.5--2.0 to within the scatter found in previous studies. We also compare the properties of the primaries to those of the secondaries and find that the secondary/primary stellar and disk mass ratios are not correlated; in three systems, the circumsecondary disk is more massive than the circumprimary disk, counter to some theoretical predictions.

  8. Circumstellar disks around binary stars in Taurus

    Energy Technology Data Exchange (ETDEWEB)

    Akeson, R. L. [NASA Exoplanet Science Institute, IPAC/Caltech, Pasadena, CA 91125 (United States); Jensen, E. L. N. [Swarthmore College, Department of Physics and Astronomy, Swarthmore, PA 19081 (United States)

    2014-03-20

    We have conducted a survey of 17 wide (>100 AU) young binary systems in Taurus with the Atacama Large Millimeter Array (ALMA) at two wavelengths. The observations were designed to measure the masses of circumstellar disks in these systems as an aid to understanding the role of multiplicity in star and planet formation. The ALMA observations had sufficient resolution to localize emission within the binary system. Disk emission was detected around all primaries and 10 secondaries, with disk masses as low as 10{sup –4} M {sub ☉}. We compare the properties of our sample to the population of known disks in Taurus and find that the disks from this binary sample match the scaling between stellar mass and millimeter flux of F{sub mm}∝M{sub ∗}{sup 1.5--2.0} to within the scatter found in previous studies. We also compare the properties of the primaries to those of the secondaries and find that the secondary/primary stellar and disk mass ratios are not correlated; in three systems, the circumsecondary disk is more massive than the circumprimary disk, counter to some theoretical predictions.

  9. TAURUS, Post-processor of 3-D Finite Elements Plots

    International Nuclear Information System (INIS)

    Brown, B.E.; Hallquist, J.O.; Kennedy, T.

    2002-01-01

    Description of program or function: TAURUS reads the binary plot files generated by the LLNL three-dimensional finite element analysis codes, NIKE3D (NESC 9725), DYNA3D (NESC 9909), TACO3D (NESC 9838), TOPAZ3D (NESC9599) and GEMINI and plots contours, time histories, and deformed shapes. Contours of a large number of quantities may be plotted on meshes consisting of plate, shell, and solid type elements. TAURUS can compute a variety of strain measures, reaction forces along constrained boundaries, and momentum. TAURUS has three phases: initialization, geometry display with contouring, and time history processing

  10. UniProt search blastx result: AK287891 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK287891 J065209I11 P47865|AQP1_BOVIN Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water c...hannel protein for red blood cells and kidney proximal tubule) (Water channel protein CHIP29) - Bos taurus (Bovine) 1.00E-19 ...

  11. Remarkable evolutionary conservation of SOX14 orthologues

    Indian Academy of Sciences (India)

    SOX14 Canis familiaris, 5. SOX14 Equus cabalus, 6. SOX14 Bos taurus, 7. SOX14 Mus musculus, 8. SOX14 Rattus norvegicus,. 9. SOX14 Monodelphis domestica, 10. SOX14 Ornithorinchus anatinus, 11. SOX14. Gallus gallus, 12. SOX14 Xenopus tropicalis, 13. SOX14 Danio rerio, 14. SOX14. Oreochromis aureus, 15.

  12. Spatial-temporal interactions of beef cattle and wolves on a western Idaho rangeland

    Science.gov (United States)

    The objective of this experiment was to detect and evaluate interactions between free-roaming beef cattle (Bos taurus) and wolves (Canis lupus) using GPS technology. Ten mature, lactating beef cows from a herd of about 450 cow-calf pairs and 1 wolf from a pack of 13 wolves were GPS collared and trac...

  13. Recent research into the production potential of indigenous cattle ...

    African Journals Online (AJOL)

    The former group is tax- onomically classified as Bos taurus and is exotic to. Southern Africa. ..... en uitdagings in die Landbou. Simposium, 27 Maart 1981. MUGGLI, N. & HOHENBOKEN,. W., 1983. Inheritance of maternal immunoglobin. G 1 concentration by the bovine neonate. Proc. 15th Int. Congr. Genet. (New Delhi), 1 ...

  14. NUTGRANJA 2.0

    NARCIS (Netherlands)

    Prado, del A.; Corré, W.J.; Gallejones, P.; Pardo, G.; Pinto, M.; Hierro, del O.; Oenema, O.

    2016-01-01

    Farm nutrient management has been identified as one of the most important factors determining the economic and environmental performance of dairy cattle (Bos taurus) farming systems. Given the environmental problems associated with dairy farms, such as emissions of greenhouse gases (GHG), and the

  15. Heat tolerance of Nelore, Senepol x Nelore and Angus x Nelore ...

    African Journals Online (AJOL)

    The Brazilian beef industry has experienced an increase in the utilization of adapted and non-adapted. Bos taurus breeds in crossbreeding systems. In spite of this, little is known about the adaptability of these groups and of their crossbred progeny when raised in a tropical climate. The aim of this study was to evaluate the ...

  16. The size of domestic cattle, sheep, goats and pigs in the Czech Neolithic and Eneolithic Periods: Temporal variations and their causes

    Czech Academy of Sciences Publication Activity Database

    Kyselý, René

    2016-01-01

    Roč. 25, Junio (2016), s. 33-78 ISSN 1132-6891 Institutional support: RVO:67985912 Keywords : osteometry * body mass * domestication * cross-breeding * Chalcolithic * Bos taurus * Ovis aries * Capra hircus * Sus domesticus * aurochs * wild boar * archaeozoology Subject RIV: AC - Archeology, Anthropology, Ethnology

  17. In situ rumen degradability characteristics of rice straw, soybean ...

    African Journals Online (AJOL)

    In situ rumen degradability characteristics of rice straw, soybean curd residue and peppermint (Mentha piperita) in Hanwoo steer (Bos Taurus coreanae). Byong Tae Jeon, KyoungHoon Kim, Sung Jin Kim, Na Yeon Kim, Jae Hyun Park, Dong Hyun Kim, Mi Rae Oh, Sang Ho Moon ...

  18. AcEST: DK950379 [AcEST

    Lifescience Database Archive (English)

    Full Text Available D Urocanate hydratase OS=Bacillus halodurans ... 31 2.6 sp|A5D7F6|MAML2_BOVIN Mastermind-like protein 2 OS=B...EAMLAFQRRGA 315 >sp|A5D7F6|MAML2_BOVIN Mastermind-like protein 2 OS=Bos taurus GN

  19. AcEST: BP919786 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sp|A5D7F6|MAML2_BOVIN Mastermind-like protein 2 OS=Bos taurus GN... 31 3.0 sp|P14412|KATG_BACST Catalase-pe...31 3.0 sp|A2AGH6|MED12_MOUSE Mediator of RNA polymerase II transcriptio... 31 3.0

  20. Download this PDF file

    African Journals Online (AJOL)

    Mike MacNeil

    Thus, an average index could be used for all six scenarios with little loss of selection efficiency. .... under South African conditions is arbitrary and taken to reflect differences in adaptation between Bos taurus .... natural selection to occur and also may offset response to imposed selection detrimental to improvements in.

  1. Genetic diversity in selected stud and commercial herds of the ...

    African Journals Online (AJOL)

    ... as being 2.67 - 7.78, with an average of 5.18 alleles per locus. It could be concluded that a moderate to high degree of variation is still present within the Afrikaner cattle breed, despite the recent decline in numbers of this indigenous breed. Keywords: Bos taurus africanus, heterozygosity, inbreeding, microsatellite markers ...

  2. Paleoproteomics and Polychromy

    DEFF Research Database (Denmark)

    Brandt, Luise Ørsted; Brøns, Cecilie; Olsen, Jesper V

    understanding of the original appearance of painted objects. In this pilot study we identify collagen alpha-1(I) and collagen alpha-2(I) from Bos Taurus in a sample from a polychrome layer from an architectural element from the Palace of Apries, Egypt, (around 589-568 BCE) using mass spectrometry-based peptide...

  3. Characterization and sequence analysis of cysteine and glycine-rich ...

    African Journals Online (AJOL)

    Primers specific for CSRP3 were designed using known cDNA sequences of Bos taurus published in database with different accession numbers. Polymerase chain reaction (PCR) was performed and products were purified and sequenced. Sequence analysis and alignment were carried out using CLUSTAL W (1.83).

  4. Interactions between soil texture and placement of dairy slurry application

    DEFF Research Database (Denmark)

    Glæsner, Nadia Andersen; Kjærgaard, Charlotte; Rubæk, Gitte Holton

    2011-01-01

    Land application of manure can exacerbate nutrient and contaminant transfers to the aquatic environment. This study examined the effect of injecting a dairy cattle (Bos taurus L.) manure slurry on mobilization and leaching of dissolved, nonreactive slurry components across a range of agricultural...

  5. Partial characterization of three β-defensin gene transcripts in river ...

    African Journals Online (AJOL)

    In this study, the tracheal tissues from Egyptian river buffalo and cattle were screened for the presence of three bovine β-defensin gene transcripts. Three primer pairs were designed on the basis of published Bos taurus sequences for partial amplification of β-defensin 4, β-defensin 10 and β-defensin 11 complementary DNA ...

  6. Towards the structure of yeast and mammalian P4-ATPases

    DEFF Research Database (Denmark)

    Lyons, Joseph; Laban, Milena; Mikkelsen, Stine

    2017-01-01

    and biochemical studies of yeast and mammalian P4-ATPases, in particular the phosphatidylserine (PS) transporting Drs2p/Cdc50p (Saccharomyces cerevisiae) and bATP8A2/CDC50A (Bos taurus). However, questions surrounding the mechanism of lipid translocation remain. To address this deficit in knowledge and to provide...

  7. Artificiat insemination vercus natural breeding in a multi.breed beef ...

    African Journals Online (AJOL)

    were the Bos taurus types. Cows bred naturally conceived earlier and thus calved earlier in the season leading to an increased calving-to-breeding period the following breeding season and a reduced intercalving interval. The higher conception rate of the naturally bred group resulted in a 35,6 7o greater total weaning.

  8. RPL37A

    African Journals Online (AJOL)

    use

    2011-12-05

    Dec 5, 2011 ... and Bos taurus. The amino acid sequence encoded by the RPL37A gene of giant panda shared a high homology with the four animals above. Topology prediction showed that there were one N-glycosylation site, three protein kinase C phosphorylation site and three N-myristoylation sites in the RPL37A ...

  9. Congenital bovine spinal dysmyelination is caused by a missense mutation in the SPAST gene

    DEFF Research Database (Denmark)

    Thomsen, Bo; Nissen, Peter H.; Agerholm, Jørgen S

    2010-01-01

     Bovine spinal dysmyelination (BSD) is a recessive congenital neurodegenerative disease in cattle (Bos taurus) characterized by pathological changes of the myelin sheaths in the spinal cord. The occurrence of BSD is a longstanding problem in the American Brown Swiss (ABS) breed and in several...

  10. Morphological assessment of Niger Kuri cattle using multivariate ...

    African Journals Online (AJOL)

    This work confirms that at type trait level Kuri cattle is a unique population within the West African taurine cattle group. The implementation of genetic analyses aiming at ascertaining the degree of uniqueness of the breed is advised. Keywords: Body measurements, Bos taurus, multivariate analyses, qualitative traits, West ...

  11. Antibiogram profile of pathogens isolated from processed cow meat ...

    African Journals Online (AJOL)

    ... the antibiotic resistance tests revealed varied, but interesting susceptibility patterns. Our findings does highlight the fact that there exist obvious vehicles for pathogenic bacteria proliferation within our abattoirs, and hence, the need for caution. Key words: Abattoirs, Bos taurus, Pathogenic bacteria, Antibiotics, Resistance ...

  12. Zvířecí skelet z laténského objektu v Nových Dvorech, okr. Kutná Hora

    Czech Academy of Sciences Publication Activity Database

    Kyselý, René

    2011-01-01

    Roč. 63, č. 2 (2011), s. 253-255 ISSN 0323-1267 Institutional research plan: CEZ:AV0Z80020508 Keywords : ritual * La Tène period * osteology * Bos taurus * cattle Subject RIV: AC - Archeology, Anthropology, Ethnology

  13. Sire breed and breed genotype of dam effects in crossbreeding beef ...

    African Journals Online (AJOL)

    Cows bred to Afrikaner bulls were less (P < 0.05) productive than cows bred to other Bos taurus sires. An increase in proportion Afrikaner breeding in dam resulted in longer calving intervals and a decline in cow productivity, but these differences were not always significant. A breeding strategy for the retainment of superior ...

  14. A novel polymorphism of resistin gene and its association with meat ...

    African Journals Online (AJOL)

    Jane

    2011-09-28

    Sep 28, 2011 ... Searching for candidate gene polymorphisms and their relationship with meat quality traits is an important issue for Bos taurus industry. In this study, we evaluated polymorphism of resistin (RETN) gene involved in energy metabolism. Using the polymerase chain reaction-single strand conformation.

  15. Reproductive Performance And Superovulatory Response Of ...

    African Journals Online (AJOL)

    This study was undertaken to determine the reproductive performance of the endangered Bos-taurus Namshi breed of Cameroon. Ovarian response to superovulatory treatment was also evaluated. The following observations were recorded. The average calf mortality rate was 25.71% while the average birth weight was ...

  16. In vitro induction of the acrosome reaction in bull sperm and the relationship to field fertility using low-dose inseminations

    DEFF Research Database (Denmark)

    Birck, A; Christensen, P; Labouriau, R

    2010-01-01

    . Furthermore, large-scale fertility trials using low-dose inseminations are pending. In the current study, the relationship between field fertility and the in vitro-induced AR was investigated using three ejaculates from each of 195 bulls, 156 Holstein and 39 Jersey bulls (Bos taurus), participating...

  17. Supplementary data: Table 1. Identification numbers of sequences ...

    Indian Academy of Sciences (India)

    Lenovo

    Supplementary data: Table 1. Identification numbers of sequences used in alignment and phylogenetic analysis. Species. Gene. Identification numbers. Alligator sinensis. Sox7. XP_006028221.1. Alligator mississippiensis. Sox18. XP_006273131.1. Bos taurus. Sox17. NP_001193180.1. Cyprinus carpio. Sox7. KY860088.

  18. Chopped or Long Roughage: What Do Calves Prefer? Using Cross Point Analysis of Double Demand Functions

    DEFF Research Database (Denmark)

    Webb, Laura E.; Jensen, Margit Bak; Engel, Bas

    2014-01-01

    The present study aimed to quantify calves'(Bos taurus) preference for long versus chopped hay and straw, and hay versus straw, using cross point analysis of double demand functions, in a context where energy intake was not a limiting factor. Nine calves, fed milk replacer and concentrate, were...

  19. Molecular characterization of leptin (obese) gene in domesticated ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-03-06

    Mar 6, 2009 ... indicus, Bos taurus, Bubalus bubalis, Capra hircus and Ovis aries, respectively. Also, 54 Yak samples from two geographically different regions of India were used for SNP identification in the coding regions of the gene. Both exon 2 and 3 was found to be highly conserved, the interestingly reported bovine ...

  20. Untitled

    African Journals Online (AJOL)

    ability in the crossbreeds. Despite these attempts, not much exist in the literature on the dairy Bos taurus breeds introduced into. Cameroon and the offspring resulting ..... Current quan- tity and costs of imported dairy products. A prelimi- nary investigation into feasibility of developing a do- mestic dairy industry in Cameroon.