ESTE EMO and ESTE EBO - emergency response system for NPP Mochovce and NPP Bohunice V-2
International Nuclear Information System (INIS)
Caeny, P.; Chyly, M.; Suchon, D.; Smejkalova, E.; Fabova, V.; Mancikova, M.; Muller, P.
2009-01-01
Programs ESTE EMO and ESTE EBO are emergency response systems that help the crisis staff of the NPP in assessing the source term (predicted possible release of radionuclides to the atmosphere ), in assessing the urgent protective measures and sectors under threat, in assessing real release (symptoms of release really detected and observed), in calculating radiological impacts of real release, averted or avertable doses, potential doses and doses during transport or evacuation on specified routes. Both systems serve as instruments in case of severe accident (DBA or BDBA) at NPP Mochovce or NPP Bohunice, accidents with threat of release of radioactivity to the atmosphere. Systems are implemented at emergency centre of Mochovce NPP and Bohunice NPP and connected online to the sources of technological and radiological data from the reactor, primary circuit, confinement, secondary circuit, ventilation stack, from the area of NPP (TDS 1) and from the emergency planning zone (TDS 11). Systems are connected online to the sources of meteorological data, too. (authors)
ESTE EMO and ESTE EBO - emergency response system for NPP Mochovce and NPP Bohunice V-2
International Nuclear Information System (INIS)
Caeny, P.; Chyly, M.; Suchon, D.; Smejkalova, E.; Fabova, V.; Mancikova, M.; Muller, P.
2008-01-01
Programs ESTE EMO and ESTE EBO are emergency response systems that help the crisis staff of the NPP in assessing the source term (predicted possible release of radionuclides to the atmosphere ), in assessing the urgent protective measures and sectors under threat, in assessing real release (symptoms of release really detected and observed), in calculating radiological impacts of real release, averted or avertable doses, potential doses and doses during transport or evacuation on specified routes. Both systems serve as instruments in case of severe accident (DBA or BDBA) at NPP Mochovce or NPP Bohunice, accidents with threat of release of radioactivity to the atmosphere. Systems are implemented at emergency centre of Mochovce NPP and Bohunice NPP and connected online to the sources of technological and radiological data from the reactor, primary circuit, confinement, secondary circuit, ventilation stack, from the area of NPP (TDS 1) and from the emergency planning zone (TDS 11). Systems are connected online to the sources of meteorological data, too. (authors)
Information about environmental effects of Bohunice NPPs V-1 and V-2 within February 2002
International Nuclear Information System (INIS)
2002-01-01
In this leaflet the results of monitoring of chemical gaseous and liquid effluents into the rivers Vah and Dudvah as well as of radiation monitoring of Bohunice V-1 and V-2 NPPs are presented. The radioactive effluents within a February 2002 (for NPP V-1 and NPP V-2, respectively) were: 0.571 TBq and 0.664 TBq of rare gases, 0.711 MBq and 0.244 MBq of aero-soles, 2.121 MBq and 0.138 MBq of iodine, 2.022 MBq and 0.564 MBq of corrosive and fission products, and 1.420 TBq and 1.643 TBq of tritium. For the period January - February 2002 these radioactive effluents represent for rare gases 1.286 TBq for NPP V-1 and 1.475 TBq for NPP V-2 (2.761 TBq (0.069% of annually limit (AL) for the locality Bohunice), for aerosols 2.645 MBq for NPP V-1 and 0.542 MBq for NPP V-2 (3.187 MBq (0.002% of AL for the locality Bohunice), for corrosive and fission products 3.848 MBq for NPP V-1 and 1.510 MBq for NPP V-2 (5.358 MBq (0.01% of AL) for the locality Bohunice), and for iodine 2.616 MBq for NPP V-1 and 0.279 MBq (2.894 MBq (0.002% of AL) for the locality Bohunice), and for tritium it is 2.395 TBq for NPP V-1 and 3.532 TBq for NPP V-2 (5.358 TBq (13.56% of AL) for the locality Bohunice
Bohunice V1 NPP upgrading programme
International Nuclear Information System (INIS)
Kerak, J.
2001-01-01
The paper describes whole process of Bohunice V1 NPP nuclear safety and operational reliability level increase which has been performed since units commissioning (1. unit in 1978, 2. unit in 1980), continued Small Reconstruction (1991 -1993) and finished Gradual Upgrading(1994 -2000). The main purpose is to last stage -Gradual upgrading of Bohunice V1 NPP. (author)
Modernization and safety improvement project of the NPP V-2 Jaslovske Bohunice
International Nuclear Information System (INIS)
Michal, V.; Losonsky, B.; Magdolen, J.
2000-01-01
This contribution deals with the form, present state, and results of the Nuclear Power Plants Research Institute (the Slovak acronym is VUJE - Vyskumny Ustav Jadrovych Elektrarni) participation in the NPP V-2 Jaslovske Bohunice Modernization and Safety Improvement Project. A short description of VUJE history, activity, and results is also presented as well as NPPs Jaslovske Bohunice characterization. VUJE was established in 1977 and deals with scientific and research needs of nuclear power plants, such as design, construction, commissioning and operation. The next fields of VUJE activity are, NPP reconstruction, NPP personnel training, radioactive waste management technology, and NPP decommissioning. The nuclear power plant, Jaslovske Bohunice, is situated approximately 15 km from the district town of Trnava in the southwestern region of the Slovak Republic. The construction of the first Czechoslovak NPP A-1 began on this site in 1957 .The construction of the double-unit NPP V-1 with WWER-440 (type V-230) reactor began in 1972. The first unit of NPP V-1 began operation in 1978 and the second in 1980. NPPs construction on the Bohunice site continued with NPP V-2, which has two units with WWER-440 (type V-213) reactors. Unit 1 and Unit 2 of NPP V-2 were commissioned in 1984 and 1985, respectively. Slovak electric utility Slovenske elektrarne (SE) is the owner/commissioner of NPP V-2. This NPP is responsible for more than 20% of the total electrical energy production of SE, making it an essential supporter of the Slovak economy. (authors)
Safety upgrading of Bohunice V1 NPP
International Nuclear Information System (INIS)
2001-01-01
This CD is multimedia presentation of programme safety upgrading of Bohunice V1 NPP. It consist of next chapters: (1) Introductory speeches; (2) Nuclear power plant WWER 440; (3) Safety improvement; (4) Bohunice Nuclear power plants subsidiary; (5) Siemens; (6) REKON; (7) VUJE Trnava, Inc. - Engineering, Design and Research Organisation; (8) Album
Backfitting of Nuclear Power Plant Bohunice V1 in Slovakia
International Nuclear Information System (INIS)
Ferenc, M.
1999-01-01
Nuclear power plants in the Slovak Republic generate almost 55 % of electricity. The operating organization and the Nuclear Regulatory Authority of the Slovak Republic pay a great attention to safe and reliable operation of four units with VVER 440 reactors at Bohunices site and one in Mochovce side. Engineering and design organizations in cooperation with well known international companies prepare evaluation of safety conditions, safety analyses and projects for the implementation of modifications to upgrade the nuclear safety of the units in operation. A gradual safety upgrading (reconstruction) of the V-1 Bohunice plant has been in progress, a modernization of the V-2 Bohunice plant is being prepared. Simultaneously the commissioning of Unit 2 at the Mochovce plant is being implemented.(author)
Main features of buildings and structures important to safety of units V1 and V2 of Bohunice NPP
International Nuclear Information System (INIS)
David, M.
1993-01-01
The program of seismic upgrading of Bohunice NPPs has been started in the year 1989 (after finishing of new seismic input). Since that time the seismic upgrading of Main building of NPP V1 has already been realized, structural as well as technological parts. Beside that the designs of seismic upgrading of other structures of NPP V1 and V2 have been completed. It has been proved that the seismic upgrading of NPPs with reactors WWER 440 is very complicated, but still possible, even in the case with high seismic intensity. It would be not possible to fulfill this complicated task without the help of IAEA Missions. The activities of IAEA experts in the program of Bohunice NPPs upgrading are appreciated very much
The Bohunice NPP V-1 units nuclear safety upgrading
International Nuclear Information System (INIS)
Mlcuch, M.
2000-01-01
Safety upgrading and operational reliability improvement was carried out by the Bohunice NPP V-1 staff continuously since the plant commissioning. By now, more than 1200 minor or major modifications have been implemented, either by the NPP maintenance staff or by the contractors. Based on findings of safety assessment missions invited by Bohunice NPP in 1990 - 1991, the Czecho-slovak Nuclear Regulatory Authority (CSKAE) issued the decision No. 5/91 of 81 safety upgrading measures to be taken in different areas. These improvements are referred to as the 'Small Reconstruction of the Bohunice V-1 NPP'. Realization of measures during Small reconstruction of the Bohunice NPP V-1 became a power plant, which further operation is acceptable from safety point of view, but it is also necessary further safety improvement. During the period of the Small Reconstruction the development of a Safety Report for the Gradual reconstruction has been completed. Based on this report the SR Nuclear Regulatory Authority issued the Decision No. 1/94, in which requires 59 upgrading measures in different areas to be addressed. The development of Basic Engineering of the Gradual Reconstruction has been contracted to the Siemens AG. Implementation of safety measures are provided through contract with the consortium REKON (which consists of Siemens AG company and Nuclear Power Plants Research Institute Trnava) and other Czech, Russian and Slovak companies. The Gradual Reconstruction of Bohunice NPP V-1 will be finished in 2000. By implementation of the measures carried out during Gradual Reconstruction achievement of an internationally acceptable nuclear safety level will be reached. (author)
The Modernization Program and Power Up-rate at NPP V2 Jaslovske Bohunice, Slovak Republic
International Nuclear Information System (INIS)
Reznik, Vladivoj; Krajmer, Imrich
2010-01-01
Slovenske Elektrarne, a.s. is a second largest utility company in the Central and Eastern Europe that owns an optimal production portfolio comprised of nuclear, thermal and hydroelectric power plants. There are two nuclear power plants Bohunice and Mochovce both operate with two units and another two units Mochovce 3 and 4 are currently under construction. Electricity at Nuclear power plant Bohunice V2 is generated by two 440 MW units that had gradually been connected to the power network over the period between 1984 and 1985. In the construction of the nuclear power plant V2 the concept of pressurized water reactors was adopted and the Soviet-era design WWER 440 used. The upgrading of Nuclear Power Plant Bohunice V2 is based on three main points: Modernization, Power up-rate, and Ageing monitoring program. The main targets of the modernization project were: Increasing of the Nuclear Safety and of the Nuclear operational reliability, and Seismic improvement. This modernization program is in full compliance with IAEA requirements and with the decisions from the Nuclear Regulatory Agency of the Slovak Republic (UJD) and achievement of the probabilistic safety criteria in accordance with IAEA recommendations. Except that is ensured a safe, reliable, economical and effective electricity and heat generation. Achieved results are based for further prolongation of the operation life time up to 60 years. (authors)
Bohunice Nuclear Power Plant Safety Upgrading Program
International Nuclear Information System (INIS)
Toth, A.; Fagula, L.
1996-01-01
Bohunice nuclear Power Plant generation represents almost 50% of the Slovak republic electric power production. Due to such high level of commitment to nuclear power in the power generation system, a special attention is given to safe and reliable operation of NPPs. Safety upgrading and operational reliability improvement of Bohunice V-1 NPP was carried out by the Bohunice staff continuously since the plant commissioning. In the 1990 - 1993 period extensive projects were realised. As a result of 'Small Reconstruction of the Bohunice V-1 NPP', the standards of both the nuclear safety and operational reliability have been significantly improved. The implementation of another modifications that will take place gradually during extended refuelling outages and overhauls in the course of 1996 through 1999, is referred to as the Gradual Reconstruction of the Bohunice V-1 Plant. The general goal of the V-1 NPP safety upgrading is the achievement of internationally acceptable level of nuclear safety. Extensive and financially demanding modification process of Bohunice V-2 NPP is likely to be implemented after a completion of the Gradual Reconstruction of the Bohunice V-1 NPP, since the year 1999. With this in mind, a first draft of the strategy of the Bohunice V-2 NPP upgrading program based on Probabilistic Safety assessment consideration was developed. A number of actions with a general effect on Bohunice site safety is evident. All these activities are aimed at reaching the essential objective of Bohunice NPP Management - to ensure a safe, reliable and effective electric energy and heat generation at the Bohunice site. (author)
Experience of Bohunice V-1 NPP
International Nuclear Information System (INIS)
Dobik, Dobroslav
2000-01-01
Slovakia remains significantly dependent on imports of primary energy sources, which represent as much as 80% of the demand. Of the total consumption of electricity in Slovakia, 40% was generated in nuclear power plant units in 1998. Slovakia operates 6 units with WWER 440 nuclear reactors. Slovakia is the signatory of all important international agreements and conventions in the field of nuclear energy, and its legislation is in an advanced stage of approximation to European Union law. This is a very important aspect, showing Slovakia's approach to nuclear safety. In 1993 Slovakia accepted the commitments of the UN Convention on Climate Changes, including a reduction of greenhouse gases to 1990 levels by the year 2000. Moreover, as an internal target Slovakia has set the reaching of the 'Toronto Objective', i.e. 20% reduction in CO x , emissions through the year 2005 as compared to 1988. In our opinion, this is not possible without nuclear energy. Time has shown, that the political aspects are more powerful, especially if you underestimate their importance over the than the technical ones. In the case of Bohunice V-1 NPP the political aspects were on the following levels: 1. Slovak republic (Czechoslovakia), political changes, decisions of the government; 2. European Union - Agenda 2000, Accession criteria, nuclear safety criteria, EBRD; 3. Austria as a neighbouring country. Starting with year 1990, 23 expert missions took place at Bohunice V-1 NPP by now. The only criteria for further operation should have been Nuclear safety, which is supervised by NRA SR. It was fully in compliance with EU policy, each country is solely responsible for its energy sector and for nuclear energy use. Our satisfaction lasted not too long. Following negotiation with EU on the highest political level, driven by willingness to be invited for negotiation of accession on the Helsinki Summit, the Slovak government decided on September 14th, on Bohunice V-1 Units shutdown in 2006 and 2008
Bohunice V-1 and V-2 approach for achieving high availability, reliability and safety
International Nuclear Information System (INIS)
Lipar, M.; Kerak, J.; Rohar, S.
1998-01-01
Long term operating experience of Bohunice units maintenance activities are overviewed in the paper. Based on common experience of WWER NPP operators, separate maintenance department was established at Bohunice NPP in very early stage of plant operation. Maintenance management, maintenance planning, outage management, diagnostics and monitoring, inspection technologies and backfitting activities are described particularly to demonstrate the capability of Bohunice maintenance department for most complex repairs and maintenance works of nuclear power plant components and equipment, including reactor and turbine itself. (author)
Commissioning tests at Bohunice NPP V1 unit 2 after reconstruction in 1998
International Nuclear Information System (INIS)
Pajtinka, A.; Tvaroska, V.; Wiening, K.-H.; Mueller, B.
2000-01-01
The last and the most extensive stage in the reconstruction project of the Bohunice NPP started in July 1998. The main activities performed during a 6-month scheduled unit 2 outage included: - Installation of a new emergency core cooling system with an increased capacity according to the defined broader break spectrum for LOCA; - Reconstruction of the existing confinement spray system and installation of a new confinement pressure suppression system; - Completion of upgrading measures to increase the reliability of emergency power supply systems (replacement of low voltage switchgear, installation of new cabling for all loads important to safety, installation of new motor-generators and rectifier sets); - Connection to the plant and commissioning of the new reactor protection system. Comprehensive tests and checks performed on completion of installation work on the modified mechanical, electrical and I and C systems were important reasons for the absence of major problems during restart of the unit after the several project implementation phases. Operating experience at unit 2 since its recommissioning in January 1999 has confirmed that the required safety standards have been met and that operational reliability has been substantially increased at the sometime. Periodic testing is being performed in accordance with the limits and conditions for safe operation of Bohunice NPP. To date all these tests were completed without significant problems. The functions implemented in the new technology met the test program criteria, which were approved with authority, in all essential areas. Through the close cooperation of the partners involved and through the combined efforts of the various engineering and operating disciplines, technical and scheduling problems could be immediately identified and quickly resolved. In general, these kinds of projects require optimum cooperation among the parties involved. Modernization of the NPP Bohunice V1 unit 2 has shown, that all
Bohunice V-1. Review of safety upgrading and operating experiences
International Nuclear Information System (INIS)
Korec, J.; Kuschel, D.
2000-01-01
The Bohunice site in the Slovak Republic has two Russian-designed twin-unit nuclear power plants, one equipped with reactors of the WWER 440/230 type, the other with type WWER 440/213 reactors. Two older units (V-1) started commercial operation in late 1978 and 1980 respectively and have been supplying electricity to the national grid since that time without any events that could have degraded plant safety level. In the period prior to 1990 the utility Slovenske Elektrarne (S.E.) performed extensive modifications and upgrades to the original design of the two older units V-1 NPP. Furthermore, significant steps in safety improvement for Bohunice NPP V-1 have been made since 1990. Following the political restructuring of the former Czechoslovakia and the country's new open-door policy towards western organizations, several international expert missions were focused on evaluation of Bohunice NPP safety status level and operational reliability, particularly targeting the two older units. Based on recommendations of individual expert missions and complementary deterministic and probabilistic safety analyses performed by S.E., the Czechoslovak Nuclear Regulatory Authority issued the Resolution No. 5/91 defining 81 measures concerning further safety and reliability improvement of Bohunice V1 .A range of short-term and long-term upgrades was prioritised in terms of importance to plant safety and work to implement these measures commenced in the early nineties. During the 'Small Reconstruction' from 1991 to 1993 some of the short term upgrading measures were realized to eliminate the most serious safety deficits, thus to achieve a significant reduction in core damage frequency and a major improvement in confinement integrity. In this paper and presentation the goals of the gradual reconstruction project, basic engineering, detailed engineering and realization, last major stage of Unit 2 upgrade, as well as final stage of Unit 1 upgrade in early 2000 are presented
Seismic re-evaluation criteria for Bohunice V1 reconstruction
International Nuclear Information System (INIS)
Campbell, R.; Schlund, H.; Warnken, L.
2001-01-01
Bohunice V1 in Slovakia is a Russian designed two unit WWER 440, Model 230 Pressurized Water Reactor. The plant was not originally designed for earthquake. Subsequent and ongoing reassessments now confirm that the seismic hazard at the site is significant. EBO, the plant owner has contracted with a consortium lead by Siemens AG (REKON) to do major reconstruction of the plant to significantly enhance its safety systems by the addition of new systems and the upgrading of existing systems. As part of the reconstruction, a complete seismic assessment and upgrading is required for existing safety relevant structures, systems and components. It is not practical to conduct this reassessment and upgrading using criteria applied to new design of nuclear power plants. Alternate criteria may be used to achieve adequate safety goals. Utilities in the U.S. have faced several seismic issues with operating NPPs and to resolve these issues, alternate criteria have been developed which are much more cost effective than use of criteria for new design. These alternate criteria incorporate the knowledge obtained from investigation of the performance of equipment in major earthquakes and include provisions for structures and passive equipment to deform beyond the yield point, yet still provide their essential function. IAEA has incorporated features of these alternate criteria into draft Technical Guidelines for application to Bohunice V1 and V2. REKON has developed plant specific criteria and procedures for the Bohunice V1 reconstruction that incorporate major features of the U.S. developed alternate criteria, comply to local codes and which envelop the draft IAEA Technical Guidelines. Included in these criteria and procedures are comprehensive walkdown screening criteria for equipment, piping, HVAC and cable raceways, analytical criteria which include inelastic energy absorption factors defined on an element basis and testing criteria which include specific guidance on interpretation
Slovak power stations, Nuclear power plants Jaslovske Bohunice. (Annual report 1997)
International Nuclear Information System (INIS)
1998-01-01
A brief account of activities carried out by the Nuclear power plants Jaslovske Bohunice in 1997 is presented. These activities are reported under the headings: (1) Foreword by the director of Bohunice NPPs; (2) Management of Bohunice NPPs Subsidiary Plant; (3) The most significant events of the year 1997; (4) Electricity and heat production; (5) Safety; (6) Bohunice NPPs operation impact on environment; (7) The V-1 NPP and V-2 NPP upgrading; (8) Maintenance; (9) Capital construction; (10) Economic balance; (11) International co-operation; (12) Human sources; (12) Public relations
Bituminization plant Jaslovske Bohunice
International Nuclear Information System (INIS)
1999-01-01
In this leaflet the principle of the bituminization plant for radioactive concentrate (the intermediate liquid radioactive waste generated during the NPP A1, V-1, V-2 operations) solidification used in the Bohunice Radwaste Treatment Centre (BSC RAO) is presented
Design of fuel loading for Bohunice V-1 Unit 2 reaktor for fuel cycle No.19
International Nuclear Information System (INIS)
Majercik, J.
1998-01-01
The report contains description of the design of fuel loading for the fuel cycle No. 19 in the V-1 Bohunice Unit 2 reactor. Input data and computer codes used for the development of the design are shown. The fuel loading is characterized by the assortment of the fuel loaded and by the scheme of re shuffling of assemblies in the core. An evaluation of basic neutronic core parameters as relates to the compliance with safety criteria is a part of the report as well
Preliminary results of scoop samples analysis from reactor pressure vessels of Bohunice V-1 NPP
International Nuclear Information System (INIS)
Kupca, L.
1997-01-01
In the paper are presented the main goals and results from the scoop specimen analysis performed on the both RPVs WWER-440/230 in Jaslovske Bohunice V-1 NPPs. Main tasks of this complex activity were: model experiments for analysis procedures optimisation; chemical analysis; hardness measurements on the RPV and bulk samples; microstructure analysis; scanning electron microscope and microprobe analysis; gamma spectrometry; brittle fracture temperature evaluation; trends of brittle fracture temperature growth after annealing procedure. In conclusions and recommendations are discussed the planned activities in the field of both RPVs integrity evaluation for the future operation of the NPP Jaslovske Bohunice V-1. (author)
Risk-informed decision making during Bohunice NPP safety upgrading
International Nuclear Information System (INIS)
Lipar, M.; Muzikova, E.; Kubanyi, J.
2001-01-01
The paper summarizes some facts of risk-informed regulation developments within UJD regulatory environment. Based on national as well as international operating experience and indications resulted from PSA, Nuclear Regulatory Authority of the Slovak Republic (UJD) since its constituting in 1993 has devoted an effort to use PSA technology to support the regulatory policy in Slovakia. The PSA is considered a complement, not a substitute, to the deterministic approach. Suchlike integrated approach is used in decision making processes and the final decision on scope and priorities is based on it. The paper outlines risk insights used in the decision making process concerning Bohunice NPP safety upgrading and focuses on the role of PSA results in Gradual Reconstruction of Bohunice VI NPP. Besides, two other examples of the PSA results application to the decision making process are provided: the assessment of proposal of modifications to the main power supply diagram (incorporation of generator switches) and the assessment of licensee request for motor generator AOT (Allowable Outage Time) extension. As an example of improving support of Bohunice V-2 risk-informed operations, concept of AOT calculations and Bohunice V-2 Risk Monitor Project are briefly described. (author)
Safety improvement programme of WWER 440/230 units in Jaslovske Bohunice
International Nuclear Information System (INIS)
Tomek, J.
2000-01-01
A brief overview is given of the power sources in Slovakia which include 6 operational reactor units (4 at Jaslovske Bohunice and 2 at Mochovce) and 2 units under construction (at Mochovce). The efforts undertaken in the past 10 years and aimed at upgrading the nuclear safety of the two older (V-230 Soviet type) units at Bohunice are highlighted. The relevant regulatory decisions are dealt with and the measures already carried out are listed. Also characterized are several IAEA international safety assessment missions and safety-aimed meetings which took place in 1998 and 1999 and are of concern to the older Bohunice units. (A.K.)
Radwaste Treatment Centre Jaslovske Bohunice
International Nuclear Information System (INIS)
2000-01-01
In this leaflet the Bohunice Radwaste Treatment Centre (BSC RAO) is presented. BSC RAO is designed to process and treat liquid and solid radwaste, arising from the NPP A-1 decommissioning, from NPPs V-1, V-2, and Mochovce operations, as well as institutional radwaste of diverse institutional (hospitals, research institutes) in the Slovak Republic. Transport, sorting, incineration, compacting, concentration and cementation of radwaste as well as monitoring of emission are described
International Nuclear Information System (INIS)
1998-01-01
The nuclear power plant Bohunice V -2 is briefly described. This NPP consists from two reactor units. Their main time characteristics are (Reactor Unit 1, Reactor Unit 2): beginning of construction - December 1976; first controlled reactor power - 7 August 1984, 2 August 1985; connection to the grid - 20 August 1984, 9 August 1985; commercial operation - 14 February 1985, 18 December 1985. This leaflet contains: NPP V-2 construction; Major technological equipment [WWER 440 V230 type reactor; Nuclear Power plant operation safety (Safety barriers; Safety systems [Active safety systems, Passive safety systems]); Centralized heat supply system; Scheme of Bohunice V-2 NPP and technical data
The results of the surveillance specimen program performed in the RPVs NPP V-2 in Jaslovske Bohunice
Energy Technology Data Exchange (ETDEWEB)
Kupca, L; Beno, P [Vyskumny Ustav Jadrovych Elektrarni, Trnava (Slovakia); Cepeek, S [Atomova Elektraren Bohunice, Jaslovske Bohunice (Slovakia); Tomasich, M [Slovak Nuclear Society, Bratislava (Slovakia)
1994-12-31
After a description of the mechanical and chemical characteristics of the materials (steels, welded joints) used in the pressure vessels of the WWER-440 V-213 type, the present status of the Bohunice NPP Unit 3 and 4 pressure vessel embrittlement assessment programme is presented: neutron flux monitoring and calculations, detector accuracy, irradiation temperature monitoring, reactor core fuel loading calculation, materials, number and types of surveillance specimens, specimen testing. Results are given for 5 years of irradiation: mechanical properties, transition temperatures, lifetime evaluation. 4 refs., 13 figs., 6 tabs.
REKO - Bohunice V-1. Experience with instrumentation and control system
International Nuclear Information System (INIS)
Arbet, L.; Ziska, D.; Golan, P.; Karaba, P.; Krupa, S.; Wiening, K.-H.
2000-01-01
In this paper and in presentation some results of upgrading of the NPP Bohunice V-1 are presented. For the first time, extensive upgrades are performed in all safety-related areas of both units with VVER 440/230 reactors. These upgrades focused on: - Expansion and upgrading of the process safety systems; - Replacement of the safety I and C system with a TELEPERM XS-based system; - Spatial separation of safety equipment; - Modernisation of the electrical auxiliary power systems; - Seismic upgrading and fire protection; - Improvement of the man-machine interface. This upgrade is considered exemplary around the world. The most extensive stage of gradual reconstruction of Unit 2 was completed according to the schedule in January 1999. For the first time, a reactor which incorporates state-of-the-art digital I and C in its reactor protection system is on-line. (author)
International Nuclear Information System (INIS)
1999-01-01
In this leaflet the short history of commissioning of Bohunice V-2 NPP is reviewed (beginning of construction December 1976; First controlled reactor power, Reactor Unit 1 (RU1): 7 August 1984, Reactor Unit 2 (RU2): 2 August 1985; Connection to the grid: RU1 20 August 1984, RU2 9 August 1985; Commercial operation: RU1 14 February 1985, RU2 18 December 1985. The scheme of the nuclear reactor WWER 440/V213 is depicted. The major technological equipment are described. Principles of nuclear power plant operation safety (safety barriers, active and passive safety systems, centralized heat supply system, as well as technical data of the Bohunice V-2 NPP are presented
International Nuclear Information System (INIS)
2005-03-01
In this leaflet results of exploitation of four units of the Bohunice V-1 and V-2 NPPs are presented. The electricity and heat production in February 2005 are reviewed. Within a February 2005 the electricity was produced: 217 GWh (block 1), 281 GWh (block 2), 277 GWh (block 3), 282 GWh (block 4), totally 1057 GWh, and 2271 GWh within a January - February 2005. The heat production in February 2005 was 266 506 GJ, and within a January - February 2005 it was produced 531 849 GJ of heat. On February 17 Slovak minister of economy Pavol Rusko and general director of ENEL Paolo Scaroni signed the agreement on acquisition of 66 per cent of Slovenske elektrarne (SE) by Italian ENEL for 840 million Eur. SE has capacity of around 7 GW (83 per cent of total Slovakian capacity). In 2004 SE generated 26 TWh of electricity. Processing and storage of radioactive wastes in Decommissioning of Nuclear Installations and Spent Fuel and Rad-waste Management (SE-VYZ) is presented. Since beginning of this year 58 fibre-concrete containers have been filled up in Bohunice processing centre of radioactive wastes. Twenty-three pieces of fibre-concrete containers were processed into fibre-concrete containers in Bohunice processing centre of radioactive wastes (BSC RAO) in February 2005. Twenty fibre-concrete containers were stored into Republic storage of radioactive wastes (RU RAO). Total number in RU RAO reached 830 pieces of fibre-concrete containers, which represent 11.53 per cent of storage capacity (7200 containers). Bohunice processing centre of radioactive wastes was put into active operation just before five years
Twenty years of operation of WWER 440/230 units in Jaslovske Bohunice
International Nuclear Information System (INIS)
Tomek, J.
1998-01-01
It is twenty years this year since the first unit WWER 440 of Slovak Nuclear Power Plant Jaslovske Bohunice was commissioned. There are four units WWER 440 in operation Jaslovske Bohunice site. First two units of older soviet PWR design V-230 (also known as V-1) and other two units of newer V-213 type (also known as V-2). The goal of this presentation is to summarize and evaluate the operation of Unit 1 and 2 for this period of time and mainly to describe what has been done and what is planned to be done to increase the nuclear safety and operational reliability of both units. The operating organization and regulatory authority assume that an internationally acceptable level of safety will be reached by accomplishing of the upgrading program.(author)
Fuel leak testing performance at NPP Jaslovske Bohunice
International Nuclear Information System (INIS)
Slugen, V.; Krnac, S.; Smiesko, I.
1995-01-01
The NPP Bohunice VVER-440 fuel leak testing experience are relatively extensive in comparison with other VVER-440 users. As the first Europe NPP was adapted Siemens (KWU) in core-sipping equipment to VVER-440 units and since this time were have done these tests also for NPP Paks (Hungary) and NPP Dukovany (Czech Republic). The occurrence of leaking fuel assemblies in NPP is in the last 5 years relatively stabilised and low. A significant difference can be observed between type V-230 (31 leaks) and type V-213 (1 leak). None of of the indicated leaking fuel assemblies has been investigated in the hot cell. Therefore cannot be confirm the effective causes of leak occurrence. Nevertheless, the fuel failure rate and the performance of leak testing in NPP Bohunice are comparable to the world standard at PWR's. 1 tab., 2 figs., 3 refs
Fuel leak testing performance at NPP Jaslovske Bohunice
Energy Technology Data Exchange (ETDEWEB)
Slugen, V; Krnac, S [Slovak Technical Univ., Bratislava (Slovakia); Smiesko, I [Nuclear Powr Plant EBO, Jaslovske Bohuce (Slovakia)
1996-12-31
The NPP Bohunice VVER-440 fuel leak testing experience are relatively extensive in comparison with other VVER-440 users. As the first Europe NPP was adapted Siemens (KWU) in core-sipping equipment to VVER-440 units and since this time were have done these tests also for NPP Paks (Hungary) and NPP Dukovany (Czech Republic). The occurrence of leaking fuel assemblies in NPP is in the last 5 years relatively stabilised and low. A significant difference can be observed between type V-230 (31 leaks) and type V-213 (1 leak). None of of the indicated leaking fuel assemblies has been investigated in the hot cell. Therefore cannot be confirm the effective causes of leak occurrence. Nevertheless, the fuel failure rate and the performance of leak testing in NPP Bohunice are comparable to the world standard at PWR`s. 1 tab., 2 figs., 3 refs.
Project Management Unit for decommissioning of NPP Bohunice VI (2003-2014)
International Nuclear Information System (INIS)
Gonzalez Fernandez-conde, A.; Brochet, I.; Ferreira, A.
2015-01-01
From October 2003 until december 2014 the Consortium consisting of Iberdrola Engineering and Construction (leader). Empresarios Agrupados Internacional, and Indra Sistemas has carried out the project Project Management Unit ((PMU) for the decommissioning of Bohunice V1 NPP (units 1 and 2), type VVER-440/V-230 in Slovakia. during the first phase (2003-2007) EdF was also part of the Consortium. The project is funded by the Bohunice International Decommissioning Support Fund (BIDSF) administered by the RBRD. The main objective of the project is to provide the necessary engineering and resources of project management for planning, execution, management, coordination and monitoring of all tasks in support of the decommissioning. (Author)
Metamorphosis of NPP A1, V1, V2
International Nuclear Information System (INIS)
Dobak, D.; Moncekova, M.
2005-01-01
In this book the history of construction, commissioning and exploitation of NPP A1, NPP V1 and NPP V2 in Jaslovske Bohunice is presented on documentary photos. Vicinity around of these NPPs is presented, too
Seismic strengthening of nuclear power plants V1-V2 structures in Slovak Republic
International Nuclear Information System (INIS)
David, M.
1993-01-01
The structural upgrading of main buildings of Bohunice NPP units V1 and V2 is described in this presentation. Design criteria for structural upgrading are included. Since the seismic upgrading of the existing NPP is usually very complicated and expensive task, designer is obliged to find the optimal solution between the economics and reliability of the upgrading. The assistance of IAEA missions during the process of Bohunice seismic upgrading is considered very fruitful
Energy Technology Data Exchange (ETDEWEB)
Kupca, L; Brezina, M; Beno, P [Vyskumny Ustav Jadrovych Elektrarni, Trnava (Slovakia)
1994-12-31
Samples of weld and base metal above and below the weld were taken from RPV material in the V-230 type NPP V-1 in Bohunice; hardness measurements were carried out across the weld on the external surface of the RPV under the thermal shielding, before and after annealing. Results are presented and the annealing procedure efficiency is discussed. (authors). 13 refs., 5 figs.
Radiation protection in Bohunice NPP. Description of present status
International Nuclear Information System (INIS)
Dobis, L.
2001-01-01
Radiation protection (RP) at Bohunice NPP has reached the high international standard. The fact was approved by several independent international missions (OSART , WANO, WENRA, ...). A lot of modifications have been done in order to improve the standard of radiation protection. All the BSS requirements have been implemented into the plant regulations before the State Law No 290/1996 and 470/2000 came into the force. Internal audits are regularly performed at NPP in order to reveal potential deficiencies. In 2001 there were 4 such audits focused on quality assurance, software operation, LBB concept and limits and condition of safe operation. State Health Institute, the regulatory body in the radiation protection, performs the inspection at least ones a month. Good relationship with the inspectors of State Health Institute also contributes to the safe operation of the NPP. There were not any radiation accident. All anomalies or radiation events are investigated at a plant level. The results of root cause analysis and proposal of corrective actions are provided to IAEA and WANO databases for the distribution. The Radiation protection department of Bohunice NPP cooperates with the other Czech and Slovak NPPs. Regular meetings on radiation protection and lately also on emergency preparedness are organized. The cooperation is excellent. Occupational exposure is reviewed also with respect of ISOE data. Bohunice NPP (even with high dose burden caused by reconstruction of V1 NPP) can be found in the first half of world PWR speaking about the collective exposure per reactor. V2 NPP itself reaches the lowest collective exposure in the world. All doses are below the limits and kept ALARA. ALARA system has been established already in 1997 at Bohunice NPP and its results are obvious for example looking at dose results during the reconstruction works at V1 NPP. The operation of Bohunice NPP has negligible influence to its surroundings. The values of gas and liquid effluents move
New Emergency control center of Slovenske Elektrarne Bohunice NPP
International Nuclear Information System (INIS)
Pecko, E.
2012-01-01
Emergency preparedness of nuclear power plant and operation assurance in case of a possible emergency calls to have devices for emergency response with equipment for rapid detection and continuous evaluation of anticipated events. Chief executive body designated to manage a nuclear power plant during major events is the emergency committee (EC). Emergency Committee is a part of the Emergency Response Organization (ERO). The following centers are on alert to ensure the activities of the ERO - Emergency Response office: - control room (CR) and emergency control room (ECR); - emergency management center (EMC); - Monitoring Centre (MC); - emergency backup control center (EBCC); - congregations of civil protection (CP) and CP shelters; - communications with warning and notification system (VARVYR). From a historical and practical point of view in the vicinity of Jaslovske Bohunice has been set up a joint emergency control center. The center was located on the territory of the former already inoperative V1 NPP. V1 NPP is currently integrated into the organizational structure of JAVYS. Operating Bohunice V2 NPP plant is a designated part of the Slovenske Elektrarne, a. s., whose majority owner is an Italian operator ENEL. In terms of various relevant factors, it was decided to build a new emergency management center on the territory of operating V2 NPP, meet the current standards.
Foreword by the director of Bohunice NPPs
International Nuclear Information System (INIS)
1998-01-01
In this foreword the director briefly describes activities of the NPP Bohunice in 1997. Main activities were: electric and heat production , the V-1 NPP Gradual Reconstruction Programme, nuclear safety programmes, environment protection, international co-operation as well as national and international public information
Fire fighting precautions at Bohunice Atomic Power Plants
International Nuclear Information System (INIS)
Anon.
1984-01-01
Some shortcomings are discussed of the project design of fire protection at the V-1 and V-2 nuclear power plants. The basic shortcoming of the system is insufficient division of the units for fire protection. Fire fighting measures are described for cable areas, switch houses and outside transformers, primary and secondary circuits and auxiliary units. Measures are presented for increasing fire safety in Jaslovske Bohunice proceedi.ng from experience gained with a fire which had occurred at a nuclear power plant in Armenia. (E.S.)
Resin intrusion into the primary circuit of NPP Jaslovske Bohunice V-1
International Nuclear Information System (INIS)
Grezdo, O.; Mraz, V.
2005-01-01
During the refueling at the first unit of Bohunice NPP in 2005 a lot of sediment was found on the upper storage rack. This sediment was identification as a filter resin. Resin was found in most of the fuel assemblies, pipes and tanks of the primary circuit and his auxiliary systems. Resin producer and WANO network was contacted in order to get information about similar events. Management of Bohunice NPP made a decision that primary circuit, fuel assemblies and auxiliary systems have to be cleaned. Subsequent cleaning extended outage by 31 days. This paper summarizes causes, existing consequences and corrective actions. Accent was put on the hydraulic characteristics of the primary circuit measurement, power distribution core monitoring and the primary circuit water quality verification (Authors)
Experience in modernization of safety I and C in VVER 440 nuclear power plants Bohunice V1 and Paks
International Nuclear Information System (INIS)
Martin, M.
2000-01-01
For nuclear power plants which have been in operation for more than 15 years, backfitting or even complete replacement of the instrumentation and control (I and C) equipment becomes an increasingly attractive option, motivated not only by the objective to reduce the cost of I and C system maintenance and repair but also to prolong or at least to safeguard the plant life-time: optimized spare-part management through use of standard equipment; reduction of number and variety of different items of equipment by implementing functions stepwise in application software; adding new functionality in the application software which was not possible in the old technology due to lack of space; safeguarding of long-term After-Sales-Service. Some years ago Bohunice V1 NPP, Slovak Republic and Paks NPP, Hungary intended to replace parts of their Safety I and C, mainly the Reactor Trip System, the Reactor Limitation System and the Neutron Flux Excore Instrumentation and Monitoring Systems. After a Basic Engineering Phase in Bohunice V1 and a Feasibility Study in Paks both plants decided to use the Siemens' Digital Safety I and C System TELEPERM XS to modernize their plants. Both Bohunice, Unit 2 and Paks, Unit 1 have been back on line for over six months with the new Digital Safety I and C. At the present time Bohunice, Unit 1 and within the next few months Paks, Unit 2 will be replaced. Trouble-free start-ups and no major problems under operation in the first two plants were based on: thorough understanding of the VVER 440 technology; comprehensive planning together with the plant operators and authorities; the possibility to adapt TELEPERM XS to every plant type; the execution of extensive pre-operational tests. Regarding these modernization measures Siemens, as well as the above Operators, have gained considerable experience in the field of I and C Modernization in VVER 440 NPPs. Important aspects of this experience are: how to transfer the VVER technology to TELEPERM XS; how to
International Nuclear Information System (INIS)
Slanina, M.; Stanc, J.
2001-01-01
Replacement of thermocouples in the protection tube blocks was a key phase of the reconstruction of in-reactor temperature measurements at Bohunice V-1 with regard to the success, reliability and impact on safety of unit operation. The replacement consisted of reliable and safe withdrawal of 216 old thermocouples, their disposal and installation of new thermocouples into dry channels. In the material presented, this phase of reconstruction is described in details, with focus on the evaluation of replacement quality and check activities carried out at the new installed thermocouples. (Authors)
Lifetime evaluation of Bohunice NPP components
International Nuclear Information System (INIS)
Kupca, L.
2001-01-01
The paper discuss some aspects of the main primary components lifetime evaluation program in Bohunice NPP which is performed by Nuclear Power Plant Research Institute (NPPRI) Trnava in cooperation with Bohunice and other organizations involved. Facts presented here are based on the NPPRI research report which is regularly issued after each reactor fuel campaign under conditions of project resulted from the contract between NPPRI and Bohunice NPP. For the calculations, there has been used some computer codes adapted (or made) by NPPRI and the results are just the conclusive and very brief, presented here in Tables (Figures). (authors)
Reuse of discharged fuel in Bohunice-1,2 units
International Nuclear Information System (INIS)
Chrapciak, V.; Majercik, J.; Kacmar, M.
2003-01-01
During the reconstruction of Bohunice-1,2 units (1997 - 2001), their cycle lengths dropped to very short values. Because of 4-year limit to fuel residence time, refuelling with fresh 2.4 % enriched assemblies seemed to be a solution of the problem. The paper describes the implementation of a final decision to reuse 3.6 % enriched fuel discharged after 3-year irradiation in previous cycles. This decision led to a large-scale moving of discharged assemblies from spent fuel pools back to reactors (Authors)
Safety enhancement in NPP Bohunice
International Nuclear Information System (INIS)
Lipar, M.; Mihalik, M.
1997-01-01
The upgrading and safety enhancement of both the Bohunice V-1 and V-2 reactors is described in detail. The total estimated cost of the gradual reconstruction of these two units during 1996 to 1999 is 180 mil. US dollars. For the 1995 to 1997 period, the actions common for both units include a quality assurance programme, a personnel training programme, installation of a multifunction simulator, implementation of symptom-oriented operation procedures, installation of diagnostic systems, of a site security system, and of a teledosimetric system. At present, the main maintenance tasks are: to carry out major repair of units, to remedy service interruptions, to enhance equipment service availability, to enhance the technical level of corrective actions at equipment. Investment into maintenance level upgrade has grown from 7.5 mil. Slovak crowns in 1994 to estimated 32 mil. in 2000. The partners of international cooperation are mentioned. (M.D.)
Optimization of radiation protection at Bohunice NPP
International Nuclear Information System (INIS)
Dobis, L.; Svitek, J.
2003-01-01
Bohunice Nuclear Power Plant is situated in south - western part of Slovakia about 50 km away from Bratislava. There are four PWR reactors 440 MW e each - two units with reactors WWER - 230 (V1 NPP) and two units with WWER - 213 (V2 NPP). requirements for the optimization process are given in the mentioned Code No.12 of Ministry of Health. Code 12 stipulates the technical and organizational requirements for proving the Rational Achievable Level (RAL) of radiation protection. This level can be proved by means of the comparison of the dose distribution to the costs of protection. An example of two figures of dose constraints is: collective dose 20 man mSv for the specific task; individual exposure 1 mSv per day. The values of the financial equivalents of personal exposure - so called the alpha coefficients - are used for the calculation of the benefit of proposed measures. Impact of legislative changes into Bohunice NPP and optimization process are presented. Apparently the new law and the associate code created a base of transparent and understandable policy of radiation protection and optimization in Slovak Republic. The radiation protection legislative was implemented into the praxis and persons became familiar with it. Defining clear and unambiguous terms facilitated the communication between users and the regulatory body - State Health Institute. Optimization was generally accepted by the workers and managers and began to be a part of safety culture of operation at nuclear power plants. (authors)
International Nuclear Information System (INIS)
Ferenc, M.
2001-01-01
The gradual reconstruction of the Bohunice V1 nuclear power plant (Slovakia) represents the most extensive reconstruction of a nuclear power plant in operation as implemented worldwide up to now. Extensive reconstruction works in both civil construction and process parts, in instrumentation and control part, and in electric part enhanced both nuclear safety and operational reliability of Bohunice V1 in a significant way.(author)
International Nuclear Information System (INIS)
2007-01-01
In this leaflet results of exploitation of four units of the Bohunice V1 and V2 NPPs are presented. The electricity and heat production in December 2006 are reviewed. Within a December 2006 the electricity was produced in NPP V1: 301.221 GWh (block 1), 281.125 GWh (block 2), totally 582.346 GWh, and 6179.205 GWh within a January - December 2006. Within a November 2006 the NPP V2: the block 3 and block 4 has worked in stabile regime according to needs of regulation. Processing and storage of radioactive wastes in Jadrova vyradovacia spolocnost (JAVYS) is presented. Twenty pieces of fibre-concrete containers were processed into fibre-concrete containers in Bohunice processing centre of radioactive wastes (BSC RAO) in December 2006. Eight fibre-concrete containers were stored into Republic storage of radioactive wastes (RU RAO). Total number in RU RAO reached 1260 pieces of fibre-concrete containers, which represent 17.50 per cent of storage capacity (7200 containers)
International Nuclear Information System (INIS)
2006-11-01
In this leaflet results of exploitation of four units of the Bohunice V1 and V2 NPPs are presented. The electricity and heat production in October 2006 are reviewed. Within a October 2006 the electricity was produced in NPP V1: 313.778 GWh (block 1), 209.838 GWh (block 2), totally 523.616 GWh, and 5125.651 GWh within a January - October 2006. Within a October 2006 the NPP V2: blocks 3 and 4 has worked on nominal power. Processing and storage of radioactive wastes in Jadrova vyradovacia spolocnost (JAVYS) is presented. Seventeen pieces of fibre-concrete containers were processed into fibre-concrete containers in Bohunice processing centre of radioactive wastes (BSC RAO) in October 2006. Thirty-eight fibre-concrete containers were stored into Republic storage of radioactive wastes (RU RAO). Total number in RU RAO reached 1234 pieces of fibre-concrete containers, which represent 17.14 percent of storage capacity (7200 containers)
Heat delivery from Bohunice NPP, Slovakia
International Nuclear Information System (INIS)
Paley, I.
1998-01-01
Experience with nuclear district heating in the Slovak Republic is reported. The heating system of the town of Trnava is supplied by the Bohunice NPP and conventional sources. Construction of the hot water heating system from the Bohunice NPP began in 1983. Commercial operation began on 10 December 1987. Heat delivery has gradually increased from 478 TJ in 1988, to 1,104 TJ in 1995. The heat cost is low, resulting in an increasing number of consumers. (author)
International Nuclear Information System (INIS)
1995-01-01
This report presents the results of the IAEA International Peer Review Services (IPERS) review of the probabilistic safety assessment (PSA) for the Bohunice-V2 NPP. The review was based on the PSA documentation available and on intensive communications with the analysis team and representatives from the utility and the plant operator. The results presented herein reflect the views of the international experts carrying out the review. They are provided for consideration by the responsible authorities of the Slovak Republic. 12 refs, 4 tabs
Internal communication at Bohunice NPPs
International Nuclear Information System (INIS)
Dobdk, Dobroslav
1999-01-01
Communication is the base of everyday existence of a modern person and every company. It is not easy to work in this area in a changing 'eastern' country. Many tools, which are used are in the mind of people connected with 'propaganda'. I would like to share our experience with you. The goal of an internal communication is to spread and provide continuous current of objective information between the management of Bohunice NPPs and its personnel and between the personnel itself. Communication with the Bohunice NPPs employees helps to get acquainted with their opinions and ideas concerning the subsidiary and nuclear power industry
Bohunice Simulator Data Collection Project
International Nuclear Information System (INIS)
Cillik, Ivan; Prochaska, Jan
2002-01-01
The paper describes the way and results of human reliability data analysis collected as a part of the Bohunice Simulator Data Collection Project (BSDCP), which was performed by VUJE Trnava, Inc. with funding support from the U.S. DOE, National Nuclear Security Administration. The goal of the project was to create a methodology for simulator data collection and analysis to support activities in probabilistic safety assessment (PSA) and human reliability assessment for Jaslovske Bohunice nuclear power plant consisting of two sets of twin units: two VVER 440/V-230 (V1) and two VVER 440/V-213 (V2) reactors. During the project training of V-2 control room crews was performed at VUJE-Trnava simulator. The simulator training and the data collection were done in parallel. The main goal of BSDCP was to collect suitable data of human errors under simulated conditions requiring the use of symptom-based emergency operating procedures (SBEOPs). The subjects of the data collection were scenario progress time data, operator errors, and real-time technological parameters. The paper contains three main parts. The first part presents preparatory work and semi-automatic computer-based methods used to collect data and to check technological parameters in order to find hidden errors of operators, to be able to retrace the course of each scenario for purposes of further analysis, and to document the whole training process. The first part gives also an overview of collected data scope, human error taxonomy, and state classifications for SBEOP instructions coding. The second part describes analytical work undertaken to describe time distribution necessary for execution of various kinds of instructions performed by operators according to the classification for coding of SBEOP instructions. It also presents the methods used for determination of probability distribution for different operator errors. Results from the data evaluation are presented in the last part of the paper. An overview of
Bohunice Simulator Data Collection Project
International Nuclear Information System (INIS)
Cillik, I.; Prochaska, J.
2002-01-01
The paper describes the way and results of human reliability data analysis collected as a part of the Bohunice Simulator Data Collection Project (BSDCP), which was performed by VUJE Trnava, Inc. with funding support from the U.S. DOE, National Nuclear Security Administration. The goal of the project was to create a methodology for simulator data collection and analysis to support activities in probabilistic safety assessment (PSA) and human reliability assessment for Jaslovske Bohunice nuclear power plant consisting of two sets of twin units: two VVER 440/V-230 (V1) and two VVER 440/V-213 (V2) reactors. During the project, training of V-2 control room crews was performed at VUJE Trnava simulator. The simulator training and the data collection were done in parallel. The main goal of BSDCP was to collect suitable data of human errors under simulated conditions requiring the use of symptom-based emergency operating procedures (SBEOPs). The subjects of the data collection were scenario progress time data, operator errors, and real-time technological parameters. The paper contains three main parts. The first part presents preparatory work and semi-automatic computer-based methods used to collect data and to check technological parameters in order to find hidden errors of operators, to be able to retrace the course of each scenario for purposes of further analysis, and to document the whole training process. The first part gives also an overview of collected data scope, human error taxonomy, and state classifications for SBEOP instructions coding. The second part describes analytical work undertaken to describe time distribution necessary for execution of various kinds of instructions performed by operators according to the classification for coding of SBEOP instructions. It also presents the methods used for determination of probability distribution for various operator errors. Results from the data evaluation are presented in the last part of the paper. An overview of
International Nuclear Information System (INIS)
2006-02-01
In this leaflet results of exploitation of four units of the Bohunice V-1 and V-2 NPPs are presented. The electricity and heat production in January 2006 are reviewed. Within a January 2006 the electricity was produced: 249.149 GWh (block 1), 293.272 GWh (block 2), 305.479 GWh (block 3), 308.378 GWh (block 4), totally 1156 GWh. The heat production in January 2006 was 354 397 GJ. Processing and storage of radioactive wastes in Decommissioning of Nuclear Installations and Spent Fuel and Rad-waste Management (SE-VYZ) is presented. Twenty-two pieces of fibre-concrete containers were processed into fibre-concrete containers in Bohunice processing centre of radioactive wastes (BSC RAO) in January 2006. Sixteen fibre-concrete containers were stored into Republic storage of radioactive wastes (RU RAO). Total number in RU RAO reached 1048 pieces of fibre-concrete containers, which represent 14.55 per cent of storage capacity (7200 containers)
Radiation supervision - NPPs A-1, V-1, V-2
International Nuclear Information System (INIS)
2000-01-01
In this leaflet the radiation supervision of the nuclear power plants A-1, V-1, V-2 is presented. Off-site radiation supervision laboratory is a part of monitoring scheme of the NPPs. More than 1150 samples are taken from the environment annually. The tele-dosimetric system was constructed to improve the quality of the Bohunice NPPs operation impacts supervision. It has been running in a continuous operation from 1992 and providing supervision of the nuclear power plant off-site area within 25 kilometres. The tele-dosimetric system is described
Slovak Electric, plc, Bohunice Nuclear Power Plant
International Nuclear Information System (INIS)
1999-01-01
A brief account of activities carried out by the Bohunice Nuclear Power Plant in 1998 is presented. These activities are reported under the headings: (1) Operation and electric power generation; (2) Nuclear and radiation safety; (3) Maintenance and scheduled refuelling out-gages; (4) Investment and WWER units upgrading; (5) Power Plants Personnel; (6) Public relations
Analysis of events significant with regard to safety of Bohunice V-1 nuclear power plant
International Nuclear Information System (INIS)
Suchomel, J.; Maron, V.; Kmosena, J.
1986-01-01
An analysis was made of operating safety of the V-1 nuclear power plant in Jaslovske Bohunice for the years 1980 - 1983. Of the total number of 676 reported failures only three were events with special safety significance, namely a complete loss of power supply for own consumption from the power grid, a failure of pins on the collectors of steam generators, and a failure of the heads of heat technology inspection channels. The failures were categorized according to the systems used in the USSR and in the USA and compared with data on failures in nuclear power plants in the two countries. The conclusions show that the operation of the V-1 nuclear power plant achieves results which are fully comparable with those recorded in 9 WWER-440 power plants operating in various countries. The average coefficient of availability is 0.72 and ranks the power plant in the fourth place among the said 9 plants. A comparison of the individual power plant units showed that of the total number of 22, the first unit of the V-1 plant ranks fifth with a coefficient of 0.78 and the second unit with a coefficient of 0.69 ranks 15th. (Z.M.)
The NPPR Trnava participation in the NPP V-2 modernisation and safety improvement project
International Nuclear Information System (INIS)
Michal, V.; Losonsky, B.; Magdolen, J.
1999-01-01
The presented contribution deals with form, present state and results of Nuclear Power Plants Research Inst.e participation in the NPP V-2 Jaslovske Bohunice Modernization and Safety Improvement Project.(author)
International Nuclear Information System (INIS)
2006-04-01
In this leaflet results of exploitation of four units of the Bohunice V-1 and V-2 NPPs are presented. The electricity and heat production in March 2006 are reviewed. Within a March 2006 the electricity was produced: 294.020 GWh (block 1), 287.684 GWh (block 2), 292.636 GWh (block 3), 237.806 GWh (block 4), totally 1112 GWh, and 3330 GWh within a January - March 2005. The heat production in January 2006 was 253 057 GJ, and within a January - March 2006 it was produced 896 226 GJ of heat. Processing and storage of radioactive wastes in Decommissioning of Nuclear Installations and Spent Fuel and Rad-waste Management (SE-VYZ) is presented. Twenty-one pieces of fibre-concrete containers were processed into fibre-concrete containers in Bohunice processing centre of radioactive wastes (BSC RAO) in March 2006. Sixteen fibre-concrete containers were stored into Republic storage of radioactive wastes (RU RAO). Total number in RU RAO reached 1080 pieces of fibre-concrete containers, which represent 15.00 per cent of storage capacity (7200 containers). Celebration of ten years operation of SE-VYZ is described
Energy Technology Data Exchange (ETDEWEB)
Kupca, L.; Beno, P. [Nuclear Power Plants Research Institute Inc., Trnava (Slovakia)
1997-04-01
A very brief summary is provided of a primary circuit piping material properties analysis. The analysis was performed for the Bohunice V-1 reactor and the Kola-1 and -2 reactors. Assessment was performed on Bohunice V-1 archive materials and primary piping material cut from the Kola units after 100,000 hours of operation. Main research program tasks included analysis of mechanical properties, corrosion stability, and microstructural properties. Analysis results are not provided.
International Nuclear Information System (INIS)
1999-01-01
In this leaflet the short history of commissioning of Bohunice V-1 NPP is reviewed (beginning of construction 24 April 1972; First controlled reactor power, Reactor Unit 1 (RU1): 27 November 1978, Reactor Unit 2 (RU2): 15 March 1980; Connection to the grid: RU1 17 December 1978, RU2 26 March 1980; Commercial operation: RU1 1 April 1980, RU2 7 January 1981. The scheme of the nuclear reactor WWER 440/V230 is depicted. The major technological equipment (primary circuit, nuclear reactor, steam generators, reactor coolant pumps, primary circuit auxiliary systems, secondary circuit, turbine generators, NPP electrical equipment, and power plant control) are described. Technical data of the Bohunice V-1 NPP are presented
International Nuclear Information System (INIS)
Kupca, L.; Brezina, M.; Beno, P.; Kniz, I.
1994-01-01
The base informations of all activities concerning the material properties recovery performed before and after annealing procedure on the first two units V-230 type in NPP V-1, are the topic of this paper. The samples of weld and base metal from both RPVs NPP V-1 were prepared by special apparatus in the very narrow gap between the outside surface of the RPV and the reactor thermal shielding in the reactor cavity, from the critical circumferential weld joint no.4. The chemical composition of the samples was analyzed in Nuclear Power Plants Research Institute (VUJE) laboratories. Except these results achieved from the analysis of the irradiated samples are presented the evaluation results of the chemical composition influence on the RPVs materials brittle fracture temperatures. All these results which served as input data for the irradiation embrittlement recovery evaluation of the both RPV NPP V-1 in Jaslovske Bohunice, are presented in the form of the trend curves for both RPVs. (author). 10 refs, 7 figs, 1 tab
Forty years of atmospheric radiocarbon monitoring around Bohunice nuclear power plant, Slovakia
International Nuclear Information System (INIS)
Povinec, P.P.; Chudy, M.; Sivo, A.; Simon, J.; Holy, K.; Richtarikova, M.
2009-01-01
Radiocarbon variations in the atmospheric CO 2 with attenuating amplitudes and decreasing mean values with typical maxima in summer and minima in winter have been observed since 1967 in two localities of Slovakia, in Bratislava and Zlkovce, situated about 60 km NE from Bratislava, only 5 km from the Bohunice Nuclear Power Plant (NPP). The 14 C record in Bratislava has been influenced mainly by fossil CO 2 emissions, in contrast to the Zlkovce record which has been more variable, as it has clearly been affected by operation of the Bohunice NPP. However, during specific meteorological conditions with NE transport of air masses to Bratislava, the effect of the Bohunice NPP has been visible in Bratislava as well. Maximum 14 C concentrations (up to 120% above a natural background) were observed around A1 NPP which used CO 2 with admixture of air as a cooling agent. The 14 C concentrations around four pressurized light water reactors were up to 30% above the background. The Δ 14 C values in the heavily polluted atmosphere of Bratislava were up to 10% and at Zlkovce up to 5% lower than the European clean air represented by the Jungfraujoch Δ 14 C data. Later the Δ 14 C values were similar at both sites, and from 2003 they were close to the European clean air levels. The observed Δ 14 C behaviour in the atmosphere provides a unique evidence of decreased fossil fuel CO 2 emissions in the region, as well as the long-term effect of the Bohunice NPP on the Bratislava and Zlkovce stations. The estimated annual radiation doses to the local public due to digestion of radiocarbon contaminated food have been estimated to be around 3 μSv
Post-reconstruction full power and shut down level 2 PSA study for Unit 1 of Bohunice V1 NPP
International Nuclear Information System (INIS)
Kovacs, Z.
2003-01-01
The level 2 PSA model of the J. Bohunice V1 NPP was developed in the RISK SPECTRUM Professional code with the following objectives: to identify the ways in which radioactive releases from the plant can occur following the core damage; to calculate the magnitudes and frequency of the release; to provide insights into the plant behaviour during a severe accident; to provide a framework for understanding containment failure modes; the impact of the phenomena that could occur during and following core damage and have the potential to challenge the integrity of the confinement; to support the severe accident management and development of SAMGs. The magnitudes of release categories are calculated using: the MAAP4/VVER for reactor operation and shutdown mode with closed reactor vessel and the MELCOR code for shutdown mode with open reactor vessel. In this paper an overview of the Level 2 PSA methodology; description of the confinement; the interface between the level 1 and 2 PSA and accident progression analyses are presented. An evaluation of the confinement failure modes and construction of the confinement event trees as well as definition of release categories, source term analysis and sensitivity analyses are also discussed. The presented results indicate that: 1)for the full power operation - there is an 25% probability that the confinement will successfully maintain its integrity and prevent an uncontrolled fission product release; the most likely mode of release from the confinement is a confinement bypass after SGTM with conditional probability of 30%; the conditional probability for the confinement isolation failure probability without spray is 5%, for early confinement failure at the vessel failure is 4%, for other categories 1% or less; 2) for the shutdown operating modes - the shutdown risk is high for the open reactor vessel and open confinement; important severe accident sequences exists for release categories: RC5.1, RC5.2 and RC6.2
International Nuclear Information System (INIS)
2006-07-01
In this leaflet results of exploitation of four units of the Bohunice V-1 and V-2 NPPs are presented. The electricity and heat production in June 2006 are reviewed. Within a June 2006 the electricity was produced in GovCo, a.s.: 289.150 GWh (block 1), 262.103 GWh (block 2), totally 551.253 GWh, and 321.515 GWh within a January - June 2006 and in SE-EBO, NPP V2: 278.896 GWh (block 3), 0 GWh (block 4), totally 278.896 GWh, and 2778.249 GWh within a January - June 2006. The heat production in June 2006 was 38 212 GJ, and within a January - June 2006 it was produced 1 098 605 GJ of heat. Processing and storage of radioactive wastes in GovCo, a.s. - Decommissioning of Nuclear Installations and Spent Fuel and Rad-waste Management (VYZ) is presented. Thirty-two pieces of fibre-concrete containers were processed into fibre-concrete containers in Bohunice processing centre of radioactive wastes (BSC RAO) in January 2006. Sixteen fibre-concrete containers were stored into Republic storage of radioactive wastes (RU RAO). Total number in RU RAO reached 1132 pieces of fibre-concrete containers, which represent 15.72 per cent of storage capacity (7200 containers). The technique of SE-VYZ in decommissioning of A1 NPP is described
NPP Bohunice experience with ASSET services
Energy Technology Data Exchange (ETDEWEB)
Klimo, J [Bohunice NPP (Slovakia)
1997-12-31
The general description of Bohunice NPP ASSET experience history was given at the last annual workshop in 1995. In my short presentation I would like to pay attention to the progress in this area which was achieved at our NPP during the last year. (author).
NPP Bohunice experience with ASSET services
International Nuclear Information System (INIS)
Klimo, J.
1996-01-01
The general description of Bohunice NPP ASSET experience history was given at the last annual workshop in 1995. In my short presentation I would like to pay attention to the progress in this area which was achieved at our NPP during the last year. (author)
Evaluation of seismic resistance of low voltage switchgear, NPP V1 Jaslovske Bohunice, Slovakia
International Nuclear Information System (INIS)
Zeman, P.
1999-01-01
During this year, company Stevenson and Associates took part in the project of evaluation of seismic resistance of NPP V-1 Jaslovske Bohunice in Slovakia. It was responsible for a part of electrical equipment, mainly for the evaluation of low voltage switchgears. There were four steps of the evaluation: Detailed Walkdown; Application of GIP-WWER Methodology; Developing, of In Cabinet Response Spectra; and Evaluation of Acceptance of Formerly Performed Relay Tests According to the Russian Standard OEG l-330.00-3). Tests performed according to the Russian Standard OAG are acceptable only if the tested subject shows just one dominant natural frequency in the significant energy frequency range. If there is no knowledge of modal properties of the tested subject (that is a frequent situation because test reports usually contain only generalized Fourier loading spectrum) the enveloping of In Cabinet Response Spectra (ICRS) in all significant energy frequency ranges by Response Spectra (RS) of harmonic signal on one arbitrary frequency. This criteria is usually not satisfied because the shake tables used for the tests are not able to produce the sufficient level of excitation in the low frequency range. It may lead to the demand for test repeating
International Nuclear Information System (INIS)
Bahna, J.; Jaros, I.; Oksa, G.
1990-01-01
The state of the art of the materials basis, the diagnostics methods used, organization of data collection and processing, and some results of routine and specific investigations concerned with diagnosis of the reactor coolant pump in the Jaslovske Bohunice NPP V-1 are presented. Some information is given about the reactor coolant pump monitor developed in the VUJE. (author)
Operational experiences feedback in Bohunice NPP
Energy Technology Data Exchange (ETDEWEB)
Betak, A [NPP Bohunice (Slovakia)
1997-10-01
The presentation reviews the following issues: OEF team in Bohunice NPP - structure; training and qualification: ASSET seminars on Prevention of incidents - INES manual handling, NRA-NRC the training on event investigation methods, NU - the training on HPES; legislation - documentation prepared in the frame of QA programme; results of OEF team activities; ASSET mission Dukovany - Experiences; the perspective activities.
Planning for environmental restoration of the contaminated banks near NPP Bohunice
Energy Technology Data Exchange (ETDEWEB)
Slavik, O; Moravek, J [Nuclear Power Plants Research Institute, a.s., Trnava (Slovakia); Vladar, M [Inst. of Preventive and Clinical Medicine, Bratislava (Slovakia)
1996-12-31
The 18 km long banks of the Bohunice NPP waste water recipient are contaminated by cesium-137 as a result of two accidents on the CO{sub 2} cooled NPP A{sub 1} unit in 1976 and 1977. Since 1992, all he contaminated waste waters dumping from NPP Bohunice has been carried out directly to the Vah River through a specially constructed 15 km long pipeline. The final extent of contamination in the Bohunice site is represented. The overall contaminated area in this site with cesium-137 activity above 1 Bq/g of soil is about 67000 m{sup 2} and thus, the corresponding volume of top 20 cm thick soil layer is about 13000 m{sup 3}. For optimizing less costly remedial measures (warning signs...) an agreed scenario with a pre-estimated factor factor collective dose 2.10{sup -7} man.Sv.y{sup -1}/(m{sup 2}.Bq{sup 137}Cs.g{sup -1}) was applied. Limitation of individual effective doses according to a site specific stay scenario was also considered for this purposes with a limiting value of 0.25 mSv/y. Cost analysis of available remedial techniques were carried out, too. Two techniques have been selected for the contaminated banks restoration project: 1) removing/disposal of 20 cm soil top layer from steep and unengineered banks, and 2) mechanical dilution/fixation of contamination by clean 15 cm soil cover for the contaminated flat areas. Two-fold reduction of anticipated potential radiation risk were accepted, maximally, for the lastly mentioned technique, however cost saving is considerable (about 10-time lower the cost comparing to removing/disposal technique one). The basic acceptance limits AL for {sup 137}Cs in soil and criteria size of continuously contaminated bank areas were derived as: AL{sub 200} = 6.0 Bq/g and 800 m{sup 2} (300 m) or AL{sub 50} 8.0 Bq/g and 200 m{sup 2} (80 m) for removing/disposal of the soil on steep unengineered banks. For clean soil covering technique the resulting limits are in an interval AL{sub 50C} = 8 up to 16 Bq/g. (Abstract Truncated)
International Nuclear Information System (INIS)
2016-03-01
In this leaflet the results of monitoring of chemical gaseous and liquid effluents into the rivers Vah and Dudvah as well as of radiation monitoring of Bohunice V1 NPP, Interim Spent Fuel Storage (MSVP), Bohunice Radioactive Waste Processing Centre (VK808 - BSC), The Main Production Unit (VK 46A - HVB) and Bitumenation Lines (VK 46B - BL) are presented. The alpha radioactive effluents into atmosphere within January - February 2016 (for NPP V1, MSVP, BSC, HVB and BL, respectively) were: 0.100 MBq (0.001 of AL) for V1, 0.013 MBq (0.004% of AL) for MSVP, 0.017 MBq (0.012% of AL) for BSC, 0.048 MBq (0.007% of AL) for HVB and 0.005 MBq (0.003% of AL) for BL of aero-soles. The radioactive effluents into atmosphere and hydrosphere within a February 2016 for NPP V1, MSVP, and VK 808 BSC, respectively, were: 0.049 MBq (V1), 0.007 MBq (VK MSVP), 0.011 MBq (VK 808 BSC), 0.020 MBq (VK 46A) and 0.002 MBq (VK 46B) of aero-soles into atmosphere; 0.706 MBq (V1 and MSVP) and 0.738 MBq (TSU RAO and NPP A1) of corrosive and fission products, and 0.419 GBq (V1 and MSVP) and 7.479 GBq (TSU RAO and NPP A1) of tritium into the Vah River and 0.000 GBq (V1 and MSVP) and 0.000 MBq (TSU RAO and NPP A1) of corrosive and fission products and 0.000 GBq of tritium (V1) and 0.000 GBq of tritium (TSU RAO and NPP A1) into the Dudvah River). For the period January - February 2016 these radioactive effluents into recipient of Vah River represent for corrosive and fission products 0.898 MBq (0.0069% of AL for V1 and MSVP) and 1.084 MBq (0.009% of AL for TSU RAO and MSVP); and for tritium it is 0.420 GBq (0.02098% of AL) for V1 and MSVP, and 18.470 GBq (0.185% of AL) for TSU RAO and NPP A1 (into the Vah River) and for corrosive and fission products 0.000 MBq (V1 and MSVP) and 0.000 MBq (TSU RAO and NPP A1) (0.0000 of AL) of tritium (into the Dudvah River). Chemical effluents are reported, too.
Planning for environmental restoration of the contaminated banks near NPP Bohunice
International Nuclear Information System (INIS)
Slavik, O.; Moravek, J.; Vladar, M.
1995-01-01
The 18 km long banks of the Bohunice NPP waste water recipient are contaminated by cesium-137 as a result of two accidents on the CO 2 cooled NPP A 1 unit in 1976 and 1977. Since 1992, all he contaminated waste waters dumping from NPP Bohunice has been carried out directly to the Vah River through a specially constructed 15 km long pipeline. The final extent of contamination in the Bohunice site is represented. The overall contaminated area in this site with cesium-137 activity above 1 Bq/g of soil is about 67000 m 2 and thus, the corresponding volume of top 20 cm thick soil layer is about 13000 m 3 . For optimizing less costly remedial measures (warning signs...) an agreed scenario with a pre-estimated factor factor collective dose 2.10 -7 man.Sv.y -1 /(m 2 .Bq 137 Cs.g -1 ) was applied. Limitation of individual effective doses according to a site specific stay scenario was also considered for this purposes with a limiting value of 0.25 mSv/y. Cost analysis of available remedial techniques were carried out, too. Two techniques have been selected for the contaminated banks restoration project: 1) removing/disposal of 20 cm soil top layer from steep and unengineered banks, and 2) mechanical dilution/fixation of contamination by clean 15 cm soil cover for the contaminated flat areas. Two-fold reduction of anticipated potential radiation risk were accepted, maximally, for the lastly mentioned technique, however cost saving is considerable (about 10-time lower the cost comparing to removing/disposal technique one). The basic acceptance limits AL for 137 Cs in soil and criteria size of continuously contaminated bank areas were derived as: AL 200 = 6.0 Bq/g and 800 m 2 (300 m) or AL 50 8.0 Bq/g and 200 m 2 (80 m) for removing/disposal of the soil on steep unengineered banks. For clean soil covering technique the resulting limits are in an interval AL 50C = 8 up to 16 Bq/g. According to the criteria developed, it is necessary to subject to restoration about 11000 m 2 of
Energy Technology Data Exchange (ETDEWEB)
Rulik, P; Beckova, V; Bucina, I; Foltanova, S; Poliak, R [National Radiation Protection Institute, Prague (Czech Republic)
1996-12-31
The study was apart of investigation of the size distribution of aerosol in air effluents from NPP V1 Jaslovske Bohunice. The evaluation the possible relationship between aerodynamic diameter of aerosol particles and chemical forms of radionuclides attached to the discharged aerosol was tried. Selective leaching was used for speciation of radionuclides present in the aerosol particles and for the estimation of their behaviour in the environment and absorption in gastro-intestinal tract. Activity concentrations of the radionuclides in the air, collected on collection substrates taken from individual impact stages and on back-up filter, were determined by sensitive gamma-spectrometric analysis using high purity Ge detectors. For the individual groups seven leaching steps were used. Following 12 radionuclides: silver-110m, cobalt-58, cobalt-60, cesium-134, cesium-137, manganese-54, ruthenium-103, antimony-124, antimony-125, tin-113, zinc-65, zirconium-95. Result shows that the leached fraction of the of the activity concentration does not depend on the size of the aerosol particles. (J.K.) 3 tabs., 3 figs.
International Nuclear Information System (INIS)
Letkovicova, M.; Durov, M.; Stehlikova, B.
2001-01-01
We pursue the vicinity of Bohunice NPP. The vicinity has cyclic form with radius of 30 km, what represents an area approximately 2 800 km 2 . This area of pursued vicinity is requisite by the security report of Bohunice NPP. To the presumptive calculations we used the complete databases of Register of death, Register of municipalities and of Register of age structure of the inhabitants of the Slovak republic from 1993 to 1999, fully-fashioned in Statistical authority of the Slovak republic. We work with databases, which don't contain personal identifications. We pursue the evolution of the mortality by the indicators of the mortality, calculated by the WHO. By the literary sources and by our experience is necessary the sum at least of three years to calculation of stable demographic and epidemiological parameters. Therefore we work with the method of short time series. The basic observed unit, which is represented by one value of the indicator, is one municipality. All our assessing analyses are calculated from triennial sums of all indicators, so we work with man-years. Advanced report is the adjusted extract from Complex report on situation of environment and health of the inhabitants in vicinity of Bohunice NPP in 1999, which was advanced by our society in March 2001. (authors)
Personnel education and training at Bohunice NPP
International Nuclear Information System (INIS)
Malovec, J.
1998-01-01
Procedure for education and training of all the personnel employed at Bohunice Nuclear power plant is presented in detail describing the training system structure, kinds of training, staff members qualification development, short term and long term tasks needed to assure attaining the training objectives. The proposed Staff Members Lifetime education implementation project contains basic starting points, measures to be implemented by 1998. It was prepared on the basis of a primary analysis which confirmed the existing need for implementing the lifetime education system
Bohunice NPPs - Part of the Slovak's economy (sustainable) development
International Nuclear Information System (INIS)
Dobak, Dobroslav
2001-01-01
Of the total consumption of electricity in Slovakia, 42% was generated in nuclear power plant units in 1999. Slovakia operates 6 units with a WWER 440 nuclear reactors, 4 of them are at Bohunice site and 2 at Mochovce. The Nuclear Regulatory Authority of SR is not the only regulatory body controlling nuclear activity. Both - the system of nuclear activities regulation in Slovakia as well as the approach to Nuclear Safety enhancement of the operator were positively judged by IAEA and WENRA. In 1993 -Slovakia has accepted the commitments of the UN Convention on Climate Changes, including a reduction of greenhouse gases to 1990 levels by the year 2000. Moreover, as an internal target Slovakia has set the reaching of the ,'Toronto Objective', i.e. 20% reduction in CO x emissions through the year 2005 as compared to 1988. Taking into account the actual situation as well as natural conditions for some renewable sources utilisation, the target won't be reached without nuclear energy. The nuclear energy is free of emissions, does not burn oxygen, and with the share of production in Slovakia will remain significant contributor. To the environment protection it contributes also by replacing fossil heat plants with heat delivery for the region. In case of radiological wastes the environment protection is ensured by very strict system of control, evidence, treatment and repository. To conclude, Bohunice NPPs were, are and will remain very important part of the Slovak's economy, creating conditions for its (sustainable) development
Computer modelling the potential benefits of amines in NPP Bohunice secondary circuit
International Nuclear Information System (INIS)
Fountain, M.J.; Smiesko, I.
1998-01-01
The use of computer modelling of PWR and WWER secondary circuit chemistry was already demonstrated in the past. The model was used to illustrate the technical and economic advantages, compared with ammonia, of using an 'advanced', high basicity, low volatility amines to raise the liquid phase pH(T) in the moisture separator and other areas swept by wet steam. Since the 1995, this technique has been successfully applied to a number of power plants and the computer model has been progressively developed. This paper describes the preliminary results of an ongoing assessment being carried out for the VVER 440 plants at Bohunice. The work for Bohunice is being funded by the 'Know How Fund', a department in the British Government's Foreign and Commonwealth Office. (J.P.N.)
International Nuclear Information System (INIS)
Polakovic, F.
2015-01-01
There are presented main features of the fuel and the list of experimental neutron-physical characteristics measured during physics start-up tests.All together there were carried out 14 physics start-ups at Bohunice and Mochovce Units with the new type of fuel. Differences between theoretical and experimental neutron-physical characteristics were statistically processed and compared with the tests acceptance criteria. There are summarized results of reactor physics start-ups with 2-nd generation Gd fuel usage [ru
Seismic evaluation and strengthening of Bohunice nuclear power plant structures
International Nuclear Information System (INIS)
Shipp, J.G.; Short, S.A.; Grief, T.; Borov, V.; Kuzma, J.
2001-01-01
A seismic assessment and strengthening investigation is being performed for selected structures at the Bohunice V1 Nuclear Power Plant in Slovakia. Structures covered in this paper include the reactor building complex and the emergency generator station. The emergency generator station is emphasized in the paper as work is nearly complete while work on the reactor building complex is ongoing at this time. Seismic evaluation and strengthening work is being performed by a cooperative effort of Siemens and EQE along with local contractors. Seismic input is the interim Review Level Earthquake (horizontal peak ground acceleration of 0.3 g). The Bohunice V1 reactor building complex is a WWER 4401230 nuclear power plant that was originally built in the mid-1970s but had extensive seismic upgrades in 1991. Siemens has performed three dimensional dynamic analyses of the reactor building complex to develop seismic demand in structural elements. EQE is assessing seismic capacities of structural elements and developing strengthening schemes, where needed. Based on recent seismic response analyses for the interim Review Level Earthquake which account for soil-structure interaction in a rigorous manner, the 1991 seismic upgrade has been found to be inadequate in both member/connection strength and in providing complete load paths to the foundation. Additional strengthening is being developed. The emergency generator station was built in the 1970s and is a two-story unreinforced brick masonry (URM) shear wall building above grade with a one story reinforced concrete shear wall basement below grade. Seismic analyses and testing of the URM walls has been performed to assess the need for building strengthening. Required structural strengthening for in-plane forces consists of revised and additional vertical steel framing and connections, stiffening of horizontal roof bracing, and steel connections between the roof and supporting walls and pointing of two interior transverse URM
EST2Prot: Mapping EST sequences to proteins
Directory of Open Access Journals (Sweden)
Lin David M
2006-03-01
Full Text Available Abstract Background EST libraries are used in various biological studies, from microarray experiments to proteomic and genetic screens. These libraries usually contain many uncharacterized ESTs that are typically ignored since they cannot be mapped to known genes. Consequently, new discoveries are possibly overlooked. Results We describe a system (EST2Prot that uses multiple elements to map EST sequences to their corresponding protein products. EST2Prot uses UniGene clusters, substring analysis, information about protein coding regions in existing DNA sequences and protein database searches to detect protein products related to a query EST sequence. Gene Ontology terms, Swiss-Prot keywords, and protein similarity data are used to map the ESTs to functional descriptors. Conclusion EST2Prot extends and significantly enriches the popular UniGene mapping by utilizing multiple relations between known biological entities. It produces a mapping between ESTs and proteins in real-time through a simple web-interface. The system is part of the Biozon database and is accessible at http://biozon.org/tools/est/.
The V-1 NPP and V-2 NPP upgrading
International Nuclear Information System (INIS)
1998-01-01
A brief account of activities in the V-1 NPP and V-2 NPP upgrading as well as maintenance carried out by the Nuclear power plants Jaslovske Bohunice in 1997 is presented. The V-1 NPP applied the so called 'Small Backfitting Programme'covering 81 points of the Czechoslovak Atomic energy Commission Decree No 5/91. Continual upgrading continued after the Backfitting Programme completion with the Safety Report and following Nuclear Regulatory Authority of Slovak Republic (NRA SR) Decrees No 1/94 and 110/94 setting spheres and procedure for adopting and implementation of measures enabling the units to operate further on. Results of expert missions, analyses and assessments of components identified by Basic Engineering became the basis for the development of the Gradual Reconstruction Programme. The Programme outputs underwent economic and probabilistic assessing their contribution to nuclear safety. This process resulted in finalizing the Gradual Reconstruction Programme which started to be implemented in 1996 and will be completed in 1999. It is implemented by the REKON consortium and covers 17 areas including Instrumentation and Control, self-consumption emergency supply, leakage monitoring, emergency core cooling system, seismic reinforcement and radioactivity localisation. Both units will reach internationally acceptable safety standards for the remaining life-time period. The V-2 NPP Upgrading and Safety Enhancement Programme includes results of activities performed in the course of last years to define all important activities leading to enhancement of nuclear safety and performance reliability and effectiveness within the plant life-time period and to establish conditions for extending the life-time of these units for 40 years. The V-2 NPP Upgrading and Safety Enhancement Programme aims to assure safe operation with a probability of the core damages less than 10 -4 /reactor · year
Liquid concrete mixes for V-2 nuclear power plant at Jaslovske Bohunice
International Nuclear Information System (INIS)
Valenta, D.; Oravec, J.
1983-01-01
The liquid concrete mixes consist of aggregates, cement, water and plastifiers. The main component of aggregates is redeposited dolomite from the Dolinka locality and sand. Cement of the SPC-325 type is used while mixing water is taken from the service water pump station for the V-1 nuclear power plant. All concretes used for the V-2 nuclear power plant construction are treated using plastifier Plastifikator S. In concrete mix development, care was primarily taken to select sand with sufficient amounts of grain of a size up to 0.25 mm. Granularity curves of the sands and the resulting curve of the aggregates granularity of the concrete mix are shown graphically. The method of manufacture and conveying of concrete mixes are briefly described. The mathematical statistical analysis of the quality of the concrete mixes produced showed that the proposed concrete mixes meet the requirements for homogeneity in the controlled parameters and that they can be manufactured in the situation of building production provided suitable components are selected, suitable aggregates are available and the quality of production is systematically checked. (J.P.)
Monitoring of activity of the persons and vehicles at the exit from the NPP Bohunice
International Nuclear Information System (INIS)
Dobis, L.; Kaizer, J.; Svitek, J.
1998-01-01
In this paper the technical description of the monitoring of activity of the persons and vehicles at the exit from the NPP Bohunice as well as the results of monitoring during last six months are described
International Nuclear Information System (INIS)
2016-05-01
In this leaflet the results of monitoring of chemical gaseous and liquid effluents into the rivers Vah and Dudvah as well as of radiation monitoring of Bohunice V1 NPP, Interim Spent Fuel Storage (MSVP), Bohunice Radioactive Waste Processing Centre (VK808 - BSC), The Main Production Unit (VK 46A - HVB) and Bitumenation Lines (VK 46B - BL) are presented. The alpha radioactive effluents into atmosphere within January - April 2016 (for NPP V1, MSVP, BSC, HVB and BL, respectively) were: 0.141 MBq (0.0002 of AL) for V1, 0.027 MBq (0.006% of AL) for MSVP, 0.029 MBq (0.016% of AL) for BSC, 0.127 MBq (0.015% of AL) for HVB and 0.009 MBq (0.006% of AL) for BL of aero-soles. The radioactive effluents into atmosphere and hydrosphere within a April 2016 for NPP V1, MSVP, and VK 808 BSC, respectively, were: 0.017 MBq (V1), 0.008 MBq (VK MSVP), 0.006 MBq (VK 808 BSC), 0.029 MBq (VK 46A) and 0.003 MBq (VK 46B) of aero-soles into atmosphere; 0.880 MBq (V1 and MSVP) and 0.397 MBq (TSU RAO and NPP A1) of corrosive and fission products, and 0.315 GBq (V1 and MSVP) and 7.163 GBq (TSU RAO and NPP A1) of tritium into the Vah River and 0.000 GBq (V1 and MSVP) and 0.000 MBq (TSU RAO and NPP A1) of corrosive and fission products and 0.000 GBq of tritium (V1) and 0.000 GBq of tritium (TSU RAO and NPP A1) into the Dudvah River). For the period January - April 2016 these radioactive effluents into recipient of Vah River represent for corrosive and fission products 2.658 MBq (0.0204% of AL for V1 and MSVP) and 1.744 MBq (0.015% of AL for TSU RAO and MSVP); and for tritium it is 0.736 GBq (0.03679% of AL) for V1 and MSVP, and 31.833 GBq (0.318% of AL) for TSU RAO and NPP A1 (into the Vah River) and for corrosive and fission products 0.000 MBq (V1 and MSVP) and 0.000 MBq (TSU RAO and NPP A1) (0.0000 of AL) of tritium (into the Dudvah River). Chemical effluents are reported, too.
District heating by the Bohunice nuclear power plant
International Nuclear Information System (INIS)
Metke, E.; Skvarka, P.
1984-01-01
Technical and economical aspects of district heating by the electricity generating nuclear plants in Czechoslovakia are discussed. As a first stage of the project, 240 MW thermal power will be supplied using bleeding lines steam from the B-2 nuclear power plant at Jaslovske Bohunice to heat up water at a central station to 130 grad C. The maximal thermal power that can be produced for district heating by WWER type reactors with regular condensation turbines is estimated to be: 465 MW for a WWER-440 reactor with two 220 MWe turbines and 950 MW for a WWER-1000 reactor with a Skoda made 1000 MWe turbine using a three-stage scheme to heat up water from 60 grad C to 150 grad C. The use of satelite heating turbines connected to the steam collector is expected to improve the efficiency. District heating needs will de taken into account for siting of the new power plants
International Nuclear Information System (INIS)
Ferenc, M.
2004-01-01
In this presentation author deals with participation of VUJE Trnava, Inc. on the reconstruction of the Bohunice V1 NPP, on modernisation of the Bohunice V2 NPP, and on of the projects in nuclear energy industry including of decommissioning of the Bohunice A1 NPP
International Nuclear Information System (INIS)
1998-01-01
The nuclear power plant Bohunice V -1 is briefly described. This NPP consists from two reactor units. Their main time characteristics are (Reactor Unit 1, Reactor Unit 2): beginning of construction - 24 April 1972; first controlled reactor power - 27 November 1978, 15 March 1980; connection to the grid - 17 December 1978, 26 March 1980; commercial operation - 1 April 1980, 7 January 1981. This leaflet contains: NPP V-1 construction; Major technological equipment (Primary circuit: Nuclear reactor [WWER 440 V230 type reactor];Steam generator; Reactor Coolant Pumps; Primary Circuit Auxiliary Systems. Secondary circuit: Turbine generators, Nuclear power plant electrical equipment; power plant control) and technical data
Programmes design for Bohunice NPP personnel other than control room operators
International Nuclear Information System (INIS)
Kalincik, L.
2002-01-01
This paper deals with project development of training programmes for non-licenced NPP personnel-masters, field operators, maintenance and technical supporting personnel. The programme development focuses on the part stage and on the job training at NPP. Bohunice NPP belongs to plants with higher specific number of personnel per installed power capacity. This factor also influenced the choice of programmes design. Undermentioned procedure is one of various approaches to SAT exploitation for training programmes design. (author)
Practical experience with the leaky-fuel monitoring at Bohunice NPP
International Nuclear Information System (INIS)
Kacmar, M.; Cizek, J.
2001-01-01
The first part of this paper describes practical experience with the fuel monitoring in operating reactors from point of view possible leakages. Summarized in the paper are numbers leaky fuel assemblies both for NPP and for particular units. Some failure causes are discussed for operational conditions of Bohunice NPP. In the second part of paper critical power ramps on hot fuel rod of leaky fuel assemblies are analysed to eliminate failures from PCI. The main aim of the paper is the need to understand the mechanism and causes of failures (Authors)
International Nuclear Information System (INIS)
Lipar, M.
2001-01-01
Power production in Slovak Republic is presented. The safety at the NPPs Bohunice V-1, V-2 and Mochovce is discussed. The events - Automatic Reactor Scram at Bohunice 1 and Power Reduction - Home Load at Bohunice 2 due to short circuit in the external grid on 22 May 2001 and Manual Reactor Scram at Mochovce 2 NPP due to Loss of Offsite Power on 30 May 2001 are described
IAEA Operational Safety Team Review Bohunice Nuclear Power Plant, Slovak Republic
International Nuclear Information System (INIS)
2010-01-01
Full text: An international team of nuclear installation safety experts, led by the International Atomic Energy Agency (IAEA), has reviewed Slovakia's Bohunice Nuclear Power Plant (BNPP) for its safety practices and has noted a series of good practices as well as recommendations to reinforce them. The IAEA assembled an international team of experts at the request of the Government of Slovak Republic to conduct an Operational Safety Review (OSART) of Bohunice NPP. Under the leadership of the IAEA's Division of Nuclear Installation Safety, the OSART team performed an in-depth operational safety review from 1 to 18 November 2010. The team was made up of experts from Belgium, Canada, China, the Czech Republic, France, Sweden, the United Kingdom and the IAEA. An OSART mission is designed as a review of programmes and activities essential to operational safety. It is not a regulatory inspection, nor is it a design review or a substitute for an exhaustive assessment of the plant's overall safety status. The team at BNPP conducted an in-depth review of the aspects essential to the safe operation of the NPP, which largely is under the control of the site management. The conclusions of the review are based on the IAEA's Safety Standards and proven good international practices. The review covered the areas of Management, Organization and Administration; Operations; Maintenance; Technical Support; Operating Experience; Radiation Protection; Chemistry and Emergency Planning and Preparedness. Long Term Operation assessment has been requested by the plant in addition to the standard OSART program. The OSART team has identified good plant practices which will be shared with the rest of the nuclear industry for consideration of their application. Examples include: BNPP has implemented a comprehensive set of technical and organizational measures which have significantly reduced the production of liquid radioactive waste; BNPP has developed an automatic transfer of dosimetry data
Increasing of leak-tightness of hermetic zone and other important components in NPPs
International Nuclear Information System (INIS)
Murani, J.
2001-01-01
The performed by VUEZ resealing works in the hermetic compartments/containment of WWER 440 and WWER 1000 NPPs in Slovakia (Jaslovske Bohunice V-1 NPP, Jaslovske Bohunice V-2 NPP, Mochovce NPP), the Czech Republic (Dukovany NPP, Temelin NPP) and Hungary (Pask NPP) are presented. The leakage rate from hermetic compartments at individual NPP reactor units are shown.The VUEZ activities in field of resealing of weld joints in pools and tanks in the Jaslovske Bohunice V-1 NPP and innovation of the seal of reactor pit protective hood (kolpak) are described. The principle of operation and practical experience of the SMU-V system implemented in the Jaslovske Bohunice V-1 NPP (WWER 440 - V 230) for NPP primary circuit leakage monitoring are also given
Chapter No.3. Assessment and inspection of nuclear installations
International Nuclear Information System (INIS)
2002-01-01
The assessment activity of UJD in relation to nuclear installation lies in assessment of safety documentation for constructions realised as nuclear installations, or construction through which changes on nuclear installations are realised. The assessment activity of UJD in 2001 was focused on National Repository of Radwaste in Mochovce, on Radwaste conditioning and treatment technology in Jaslovske Bohunice and on the assessment of documentation for the project of modernisation of Bohunice V-2 NPPs which is under preparation. The assessment of the technical condition of equipment, important in terms of nuclear safety, primarily based on results of in-service inspections and surveillance testing of safety related components and systems, is also a part of the safety assessment of nuclear installation operation. The inspectors take part in training courses and participate in other technical meetings and workshops organised by the IAEA and also take part in special training courses organised by the Nuclear Authorities of European countries, USA and Japan. Bohunice V-1 NPP is equipped with two reactors of WWER 440 type V-230 and was put into operation in 1978-1980 as one of the last nuclear power plants with this type of reactor. Both units of NPP V-1 Bohunice operated in 2001 according to the requirements of energy dispatching at nominal power, or in a regime of tertiary regulation. November 2000, a mission of experts invited by UJD and delegated by IAEA took place at the Bohunice NPPs. The mission members together with experts of the plant operator assessed the safety of the units of WWER-440/V-230 of Bohunice V-1 NPP after the reconstruction. The members of the mission prepared the report on the current status of safety of these units for the IAEA. In 2001, UJD by its decision, issued the approval for further operation of both reactor units of Bohunice V-1 NPP. In sense of the relevant decree on operational events, 20 events have been recorded, at Bohunice V-1 NPP in
Principles and criteria for environmental restoration of the contaminated banks near NPP Bohunice
International Nuclear Information System (INIS)
Slavik, O.; Moravek, J.
1995-01-01
The 18 km long banks of the Bohunice NPP waste water recipient are contaminated by 137 Cs as a result of two accidents on the CO 2 cooled NPP-A1 unit in 1976 and 1977. Contamination acceptance limits 6 or 8 Bq 137 Cslg of soil, depending on contaminated area size, were derived on the basis of developed principles, and approved by the authorities. Removing and safe burial of 1,100 m 3 of contaminated soil from steep area and 15 cm thick clean soil covering on about 1ha of flat area of the contaminated banks is planned in frame of the re-considered restoration project implementation in 1995/96. (author)
International Nuclear Information System (INIS)
Letkovicova, M.; Rehak, R.; Stehlikova, B.; Celko, M.; Hraska, S.; Klocok, L.; Kostial, J.; Prikazsky, V.; Vidovic, J.; Zirko, M.; Beno, T.; Mitosinka, J.
1998-01-01
The report contents final environment evaluation and selected characteristic of residents health physics of nuclear power plant Bohunice region. Evaluated data were elaborated during analytical period 1993-1997.Task solving which results are documented in this final report was going on between 1996- 1998. The report deals in individual stages with the following: Information obtaining and completing which characterize demographic situation of the area for the 1993-1997 period; Datum obtaining and completing which contain selected health physics characteristics of the area residents; Database structures for individual data archiving from monitoring and collection; Brief description of geographic information system for graphic presentation of evaluation results based on topographic base; Digital mapping structure description; Results and evaluation of radionuclide monitoring in environment performed by Environmental radiation measurements laboratory by the nuclear power plant Bohunice for the 1993-1997 period. Demographic situation evaluation and selected health physics characteristics of the area of nuclear power plant residents for the 1993-1997 period are summarized in the final part of the document. Monitoring results and their evaluation is processed in graph, table, text description and map output forms. Map outputs are processed in the geographic information system Arc View GIS 3.0a environment
International Nuclear Information System (INIS)
2014-10-01
In this leaflet the results of monitoring of chemical gaseous and liquid effluents into the rivers Vah and Dudvah as well as of radiation monitoring of Bohunice V1 NPP, Interim Spent Fuel Storage (MSVP), Bohunice Radioactive Waste Processing Centre (VK808 - BSC), The Main Production Unit (VK 46A - HVB) and Bitumenation Lines (VK 46B - BL) are presented. The radioactive effluents into atmosphere within January - September 2014 (for NPP V1, MSVP, BSC, HVB and BL, respectively) were: 1.483 MBq (0.002 of AL) for V1, 0.087 MBq (0.029% of AL) for MSVP, 0.084 MBq (0.060% of AL) for BSC, 0.400 MBq (0.061% of AL) for HVB and 0.028 MBq (0.020% of AL) for BL of aero-soles. The radioactive effluents into atmosphere and hydrosphere within a September 2014 for NPP V1, MSVP, and VK 808 BSC, respectively, were: 0.258 MBq (V1), 0.007 MBq (VK MSVP), 0.018 MBq (VK 808 BSC), 0.005 MBq (VK 46A) and 0.002 MBq (VK 46B) of aero-soles into atmosphere; 1.169 MBq (V1 and MSVP) and 0.522 MBq (TSU RAO and NPP A1) of corrosive and fission products, and 0.002 GBq (V1 and MSVP) and 16.740 GBq (TSU RAO and NPP A1) of tritium into the Vah River and 0.000 GBq (V1 and MSVP) and 0.000 MBq (TSU RAO and NPP A1) of corrosive and fission products and 0.000 GBq of tritium (V1) and 0.000 GBq of tritium (TSU RAO and NPP A1) into the Dudvah River). For the period January - September 2014 these radioactive effluents into recipient of Vah River represent for corrosive and fission products 12.402 MBq (0.095% of AL for V1 and MSVP) and 5.010 MBq (0.042% of AL for TSU RAO and MSVP); and for tritium it is 8.382 GBq (0.419% of AL) for V1 and MSVP, and 98.415 GBq (0.984% of AL) for TSU RAO and NPP A1 (into the Vah River) and for corrosive and fission products 0.000 MBq (V1 and MSVP) and 0.000 MBq (TSU RAO and NPP A1) (0.0000 of AL) of tritium (into the Dudvah River). Chemical effluents are reported, too.
International Nuclear Information System (INIS)
2016-02-01
In this leaflet the results of monitoring of chemical gaseous and liquid effluents into the rivers Vah and Dudvah as well as of radiation monitoring of Bohunice V1 NPP, Interim Spent Fuel Storage (MSVP), Bohunice Radioactive Waste Processing Centre (VK808 - BSC), The Main Production Unit (VK 46A - HVB) and Bitumenation Lines (VK 46B - BL) are presented. The alpha radioactive effluents into atmosphere within January 2016 (for NPP V1, MSVP, BSC, HVB and BL, respectively) were: 0.051 MBq (0.0001 of AL) for V1, 0.006 MBq (0.002% of AL) for MSVP, 0.007 MBq (0.005% of AL) for BSC, 0.027 MBq (0.004% of AL) for HVB and 0.003 MBq (0.002% of AL) for BL of aero-soles. The radioactive effluents into atmosphere and hydrosphere within a January 2016 for NPP V1, MSVP, and VK 808 BSC, respectively, were: 0.051 MBq (V1), 0.006 MBq (VK MSVP), 0.007 MBq (VK 808 BSC), 0.027 MBq (VK 46A) and 0.003 MBq (VK 46B) of aero-soles into atmosphere; 0.192 MBq (V1 and MSVP) and 0.346 MBq (TSU RAO and NPP A1) of corrosive and fission products, and 0.001 GBq (V1 and MSVP) and 10.991 GBq (TSU RAO and NPP A1) of tritium into the Vah River and 0.000 GBq (V1 and MSVP) and 0.000 MBq (TSU RAO and NPP A1) of corrosive and fission products and 0.000 GBq of tritium (V1) and 0.000 GBq of tritium (TSU RAO and NPP A1) into the Dudvah River). For the period January - January 2016 these radioactive effluents into recipient of Vah River represent for corrosive and fission products 0.192 MBq (0.0015% of AL for V1 and MSVP) and 0.346 MBq (0.003% of AL for TSU RAO and MSVP); and for tritium it is 0.001 GBq (0.00003% of AL) for V1 and MSVP, and 10.991 GBq (0.110% of AL) for TSU RAO and NPP A1 (into the Vah River) and for corrosive and fission products 0.000 MBq (V1 and MSVP) and 0.000 MBq (TSU RAO and NPP A1) (0.0000 of AL) of tritium (into the Dudvah River). Chemical effluents are reported, too.
Production of iron-serpentinite concrete and mortar for Jaslovske Bohunice V-2 nuclear power plant
International Nuclear Information System (INIS)
Valenta, D.; Oravec, J.
1982-01-01
The ideas behind the research and the results of the research of serpentinite concrete with a discontinuous granulometric curve are given. Concrete mixes were experimentally tested; a formula is given for the manufacture of 1 m 3 of fresh concrete. Serpentinite concrete of a density of 2,240 kg/m 3 is satisfactory as shielding material. Time dependence of workability was also tested. It was found that the concrete was well workable as late as 2 hours after manufacture. Serpentinite concrete and mortar were made and used for the biological shielding construction in the shaft of Unit I of the V-2 nuclear power plant. (J.P.)
VUJE Trnava, Inc. - Engineering, Design and Research Organisation
International Nuclear Information System (INIS)
2001-01-01
This CD is multimedia presentation of programme safety upgrading of Bohunice V1 NPP. This chapter contains information about VUJE: It consists of next parts: (1) From VUJE history (1977-2001); (2) Human resources (Development of staff; Structure of employees 1999); (3) VUJE activities: (Diagnostics; Nuclear safety; Radiation safety; Commissioning and operation; Personnel training; Information technology; Electric grids; Conventional power); (4) Significant projects of VUJE are presented: Gradual reconstruction with safety upgrading of the V1 Bohunice nuclear power plant; Modernization of the V2 Bohunice NPP; Completion of the Republic Repository of Radioactive Wastes in Mochovce; Decommissioning of the A1 NPP Bohunice; Development of simulators; Physical and power commissioning of NPPs; Construction of high voltage line Varin - Sucany
International Nuclear Information System (INIS)
Jaroslav, H.; Pavol, B.
2003-01-01
Described is the common project for completion of bubbler condenser qualification for nuclear power plants in Bohunice, Mochovice, Dukovany and Paks. Functionality of the bubbler condenser was elaborated during the simulation of the main steam line brake, medium break and small break LOCA. On this basis the appropriate operation of bubbler condenser containment under accident conditions can be positively confirmed
Treatment and conditioning of solid and liquid raw
International Nuclear Information System (INIS)
Jakubec, R.
2015-01-01
Jadrova a vyradovacia spolocnost, a.s. (JAVYS) implements activities within the processes of treatment and conditioning of radioactive waste (RAW) at two nuclear facilities, one of them located in Bohunice - Technologies for treatment and conditioning of RAW. This nuclear facility includes: Bohunice RAW treatment centre, bituminization lines, waste water purification station and technologies for sorting, fragmentation and decontamination of metallic RAW. The Bohunice RAW treatment centre (BRTC) in Bohunice processes and conditions liquid and solid radioactive waste produced during the A1 NPP and V1 NPP decommissioning, waste from the operation of V2 NPP in Bohunice as well as from the operation of NPP EMO 1,2 in Mochovce. The BRTC includes the following technological facilities: sorting, high-pressure compaction, incineration, concentration and cementation. Treatment of radioactive wastes in the BRTC is described. (authors)
Current status of LTO licensing programme for Bohunice nuclear power plant
International Nuclear Information System (INIS)
Borak, J.; Kupca, L.
2012-01-01
The objective of long term operation (LTO) licensing programme for Bohunice nuclear power plant is to demonstrate that the relevant structures and components shall perform their functions throughout the entire LTO period during which they shall meet all the relevant safety requirements. All the activities-which should result in utility's request to obtain the licence for LTO-must be performed in line with the relevant legal basis. As of May 2012, the anticipated duration of currently running programme is thirteen months. All relevant documentation, required by the established legal basis, shall be submitted to the licensing authority one year before the Unit 3 design life expiry. (author)
Lorsque la recherche locale est source de changements véritables ...
International Development Research Centre (IDRC) Digital Library (Canada)
18 févr. 2011 ... Les think tanks africains se penchent sur certaines des difficultés les plus ... Lorsque la recherche locale est source de changements véritables en Afrique ... De quel type d'information les acteurs de la sphère politique ont-ils ...
International Nuclear Information System (INIS)
Carny, P.; Suchon, D.; Smejkalova, E.; Fabova, V.
2009-01-01
ESTE AI is a program for calculation of radiation doses caused by effluents in routine releases to the atmosphere and to the hydrosphere. Doses to the members of critical groups of inhabitants in the vicinity of NPP are calculated and as a result, critical group is determined. The program enables to calculate collective doses as well. Collective doses to the inhabitants living in the vicinity of the NPP are calculated. ESTE AI calculates doses to the whole population of Slovakia from the effluents of the specific plant. In this calculation, global nuclides are included and assumed, as well. The program enables to calculate and to document beyond-border radiological impacts of effluents caused by routine operation of NPP. ESTE AI was approved by the 'Public Health Authority of the Slovak Republic' and is used as legal instrument by Slovenske elektrarne a.s., NPP Bohunice. (authors)
International Nuclear Information System (INIS)
Carny, P.; Suchon, D.; Smejkalova, E.; Fabova, V.
2008-01-01
ESTE AI is a program for calculation of radiation doses caused by effluents in routine releases to the atmosphere and to the hydrosphere. Doses to the members of critical groups of inhabitants in the vicinity of NPP are calculated and as a result, critical group is determined. The program enables to calculate collective doses as well. Collective doses to the inhabitants living in the vicinity of the NPP are calculated. ESTE AI calculates doses to the whole population of Slovakia from the effluents of the specific plant. In this calculation, global nuclides are included and assumed, as well. The program enables to calculate and to document beyond-border radiological impacts of effluents caused by routine operation of NPP. ESTE AI was approved by the 'Public Health Authority of the Slovak Republic' and is used as legal instrument by Slovenske elektrarne a.s., NPP Bohunice. (authors)
The most extensive reconstruction of nuclear power plant with VVER 440/V230 reactor
International Nuclear Information System (INIS)
Ferenc, M.
2000-01-01
The nuclear power plant V-1 Bohunice consists of two VVER-440 units with V-230 reactors. Unit 1 was commissioned in 1978 and Unit 2 in 1980. Large experience and knowledge from the operation of previous units with V-230 reactors were incorporated into the V-1 design, which resulted in a higher level of safety and operational reliability of these units. The Siemens company which won an international bidding process developed these basic goals for the Gradual Upgrading into the so called Basic Engineering (BE). For the implementation of the Gradual Upgrading in line with the BE, Rekon consortium was established consisting of Siemens and VUJE. The implementation of the Gradual Upgrading is scheduled for the time period of 1996 - 2000. Siemens was responsible for the upgrading strategy - based on the approved results of the basic engineering phase and the PSAR, the engineering and realization of all I and C improvements, and also for the seismic upgrade. VUJE's responsibility covered the detailed engineering and implementation of mechanical, electrical and civil part of upgrading measures as well as overall organisation and evaluation of verification tests. The consortium awarded contracts for final planning and design, installation services and commissioning to other Slovakian subcontractors in order to ensure the largest possible local content. The gradual reconstruction of the V-1 Bohunice with V230 reactors represents a comprehensive reconstruction of safety-related systems and equipment. Following its completion, the units will be operated with a safety level accepted internationally. (author)
Monitoring of Persons at the Exit from Bohunice NPP
International Nuclear Information System (INIS)
Kaizer, J.; Svitek, J.
2001-01-01
Full text: IAEA defines the principal requirement 'defence in depth' as a multilayer system in its authorised document - International Basic Safety Standards for Protection against Ionising Radiation, Safety Series No. 115. The principle of the multilayer system is: a failure at one zone is compensated or corrected at subsequent zones. The main argument why Bohunice NPP modernised its monitoring system at the exit from NPP was the implementation of the principle 'defence in depth'. Several instruments PM7 (Eberline) equipped with the plastic scintillation detectors had been bought because of the modernisation. The instruments had to be integrated into overall security system NPP without any restriction to the number of passing people. The supplier had to modify the basic instrument operation. NPP required a 'dynamic' monitoring version, this means the operation without stopping of a person within the instrument. After the modification the value of the RDA (Reliable Detectable Activity) of the instruments PM7 was within the interval 9.25-10.4 kBq for 137 Cs (dotted source in the middle of the instrument). RDA for the mix of activation products was 2-3 times lower. In conclusion of our paper the results of the monitoring are presented within tree years as well as a discussion about these results. Maximum values of contaminations measured were very low (several kBq) that represented very low risk from potential exposure. (author)
Experience with construction and assembly of V-1 nuclear power plant
International Nuclear Information System (INIS)
Prochazka, J.; Stepanek, S.; Drahy, J.
1981-01-01
The model is discussed of the constructions of the V-1 nuclear power plant at Jaslovske Bohunice with SKODA Trust fulfilling the role of the general supplier of the secondary part technology and the chief and special assembly contractor. The SKODA Trust mediated the Soviet supplies of technology, Soviet assembly and special assembly, and the mounting of the primary part according to Soviet projects. Plant start-up was safeguarded by the investor through Bohunice power plant staff and Soviet experts. The assembly of the primary circuit and the test assembly of reactor parts are described and the experience gained is discussed. The technological requirements are illustrated by the most important characteristics of the individual parts of the primary circuit. Also described are the design specifications of the 220 MW saturated steam turbine and the experience with its assembly and start-up. (B.S.)
Irradiation Embrittlement Monitoring Programs of RPV's in the Slovak Republic NPP's
International Nuclear Information System (INIS)
Kupca, Ludovik
2006-01-01
Four types of surveillance programs were (are) realized in Slovak NPP's: 'Standard Surveillance Specimen Program' (SSSP) was finished in Jaslovske Bohunice V-2 Nuclear Power Plant (NPP) Units 3 and 4, 'Extended Surveillance Specimen Program' (ESSP), was prepared for Jaslovske Bohunice NPP V-2 with aim to validate the SSSP results, For the Mochovce NPP Unit 1 and 2 was prepared completely new surveillance program 'Modern Surveillance Specimen Program' (MSSP), based on the philosophy that the results of MSSP must be available during all NPP service life, For the Bohunice V-1 NPP was finished 'New Surveillance Specimen Program' (NSSP) coordinated by IAEA, which gave arguments for prolongation of service life these units for minimum 20 years, New Advanced Surveillance Specimen Program (ASSP) for Bohunice V-2 NPP (units 3 and 4) and Mochovce NPP (units 1, 2) is approved now. ASSP is dealing with the irradiation embrittlement of heat affected zone (HAZ) and RPV's austenitic cladding, which were not evaluated till this time in surveillance programs. SSSP started in 1979 and was finished in 1990. ESSP program started in 1995 and will be finished in 2007, was prepared with aim of: increasing of neutron fluence measurement accuracy, substantial improvement the irradiation temperature measurement, fixed orientation of samples to the centre of the reactor core, minimum differences of neutron dose for all the Charpy-V notch and COD specimens, the dose rate effect evaluation. In the year 1996 was started the new surveillance specimen program for the Mochovce RPV's unit-1 and 2, based on the fundamental postulate - to provide the irradiation embrittlement monitoring till the end of units operation. The 'New Surveillance Specimen Program' (NSSP) prepared in the year 1999 for the Bohunice V-1 NPP was finished in the year 2004. Main goal of this program was to evaluate the weld material properties degradation due to the irradiation and recovery efficiency by annealing too. The
Chemistry monitoring and diagnostic system at NPP Jaslovske Bohunice
International Nuclear Information System (INIS)
Smiesko, Ivan; Figedy, Stefan
2012-09-01
This paper provides a description of water chemistry monitoring and diagnostic system installed at Slovak NPP Jaslovske Bohunice. System has complex architecture and covers laboratory data, chemistry and radiochemistry on-line monitoring data, process data acquisition and processing and diagnostics. Pre-filtered data from process computer and chemistry on-line monitors are recorded together with laboratory data in the ORACLE-based information system CHEMIS with many presentation and processing features. Brief information is given about the basic features of a newly developed diagnostic system for early detection and identification of anomalies incoming in the water chemistry regime of the primary and secondary circuit of VVER-440 type unit. This system, called SACHER (System of Analysis of Chemical Regime) has been installed within the major modernization project at the NPP Bohunice in the Slovak Republic. System SACHER has been developed fully in MATLAB environment. Diagnostic system works exclusively with available on-line data as an operation personnel support application allowing effective response to adverse chemistry events/trends. The availability of prompt information about the chemical conditions of the primary and secondary circuit is very important in order to prevent the undue corrosion and deposit build-up processes within the plant systems. The typical chemical information systems that exist and work at the NPPs give the user values of the measured quantities together with their time trends and other derived values. It is then the experienced user's role to recognize the situation the monitored process is in and make the subsequent decisions and take the measures. The SACHER system, based on the computational intelligence techniques, inserts the elements of intelligence into the overall chemical information system. It has the modular structure with the following most important modules: - normality module- its aim is to recognize that the process
Nuclear installations in Slovakia accords to the convention definition
International Nuclear Information System (INIS)
1998-01-01
In this part the nuclear power plants Bohunice - Units V-1 and V-2 and NPP Mochovce (description of units, safety reports and safety improvement programs) are described. Description of Bohunice A-1, history and current status of the NPP A-1 and NPP decommissioning program are included. In next parts interim spent fuel storage, technologies of Raw processing and treatment, and treated and solid Raw storage sites are described
Mitsubishi nuclear technologies and construction of new Bohunice
International Nuclear Information System (INIS)
Yoshizu, T.
2009-01-01
Mitsubishi Heavy Industries (MHI) has setup Generation III+ category power plant technologies both in large and middle size reactors as a key player in the global market of nuclear plant suppliers. MHI has developed 1,700 MWe class Advanced Pressurized Water Reactor for European utilities, EU-APWR, utilizing the APWR technology in Japan. The plant configuration is based on the proven technologies from MHI's ample experiences, but various advanced technologies are adopted to achieve enhanced safety, reliability, and economy. For the regions without large grid capacity, middle-sized nuclear power plant will be an attractive option for the utilities. Joint Venture ATMEA with AREVA NP will serve ATMEA1. The ATMEA1 will offer 1,100 MWe output with superior operation performance based on reliable and proven technologies. Mitsubishi has experience of half century for all of 26 PWR plants in Japan. The latest plant is Tomari Unit 3 of 1,000 MWe, which has completed the construction work and now in the final commissioning test. Tomari Unit 3 applies some advanced technologies such as all digital I and C, which are to be implemented in the EU-APWR. Based on this construction experience, Mitsubishi can contribute any kind of demands for New Bohunice 5 th unit project with the total engineering capability. (author)
International Nuclear Information System (INIS)
Slimak, A.; Hrncir, T.; Necas, V.
2012-01-01
The paper briefly describes current state of radioactive waste management as well as radioactive waste treatment and conditioning technologies used in Bohunice Radioactive Waste Treatment Centre. Radioactive Waste management includes pretreatment, treatment, conditioning, storage, transport and disposal of radioactive waste. Presented paper deals with the evaluation of an external exposure of a worker during manipulation with fibre-reinforced concrete container stored under shelter object. The external exposure of a worker was evaluated using VISIPLAN 3D ALARA code. (Authors)
Vilppunen, Suvi
2016-01-01
Tämän opinnäytetyön tavoitteena oli saada tietoa tekijöistä, jotka edistävät ja estävät matalapalkkaisten naisten osallistumista terveyden edistämisen hankkeisiin sekä kuvata ja arvioida terveyden edistämisen ohjauksen työvälineitä ja niiden toimivuutta. Opinnäytetyö toteutettiin integroivan kirjallisuuskatsauksen menetelmällä ja sen aineiston hakuun käytettiin useaa eri tietokantaa. Aineiston muodostivat 12 tieteellistä artikkelia sekä yksi väitöskirja. Aineisto analysoitiin käyttäen indukti...
Upgrading of the radiation protection system at the V1 NPP
International Nuclear Information System (INIS)
Dobis, L.; Kaizer, J.; Svitek, J.
2003-01-01
The original radiation protection system at Bohunice V1 NPP from the 1970s was upgraded so as to meet current national as well as international standards. The article describes the upgrading of the radiation control system (teledosimetry, emergency measurement in the hermetic zone, liquid discharges, gaseous discharges, service water, remote measurement, hygiene loop, contamination monitoring at the controlled zone exit and activity monitoring at the NPP exit, special laundry, instrument calibration), dosimetry, software, and personnel contamination inspection/measurement. (author)
Termination of exploitation of V 1 NPP - BIDSF projects
International Nuclear Information System (INIS)
Pnackova, L.
2004-01-01
In this paper the interview with engineer Peter Hlbocky, director of division of the Project of decommissioning of V 1 Nuclear Power Plant in Jaslovske Bohunice is presented. Project Manager Unit (PMU) was formed on the basis of directive of the General Director of the Slovenske elektrarne, a.s. The Director of the Division of decommissioning of the V 1 NPP and at the same time the Main manager of the PMU is engineer Peter Hlbocky. On this project participate 19 employees of the Slovenske elektrarne, a. s. (SE), 6 abroad employees of the consortium IBERINCO, 15 employees of the VUEZ and 25 abroad employees on the detached place of work in the Spain and France
International Nuclear Information System (INIS)
2001-01-01
This CD is multimedia presentation of programme safety upgrading of Bohunice V1 NPP. This chapter contains information about Siemens and it participation on reconstruction of Bohunice V1 and V1 NPPs. It consists of next parts: (1) FRAMATOME ANP - worldwide activities of the FRAMATOME are presented; (2) Nuclear power engineering - present activities focus on: Upgrading and Backfitting (Siemens WWER activities since 1971); Electrical instrumentation and control systems; Fuel assemblies and related services; Reactor development and construction of new plants; (3) Safety improvement; (4) Siemens in Slovakia (activities of Siemens in Slovakia during 1993-2000 are presented); (5) More than 150-year history
Radiological characterisation of V1 NPP technological systems and buildings - Activation
International Nuclear Information System (INIS)
Kristofova, Kristina; Rapant, Tibor; Svitek, Jaroslav
2012-01-01
V1 NPP at Jaslovske Bohunice site has been finally shutdown after 28 years of successful operation in 2006 (Unit 1) and 2008 (Unit 2). At present, both units are finally shutdown and since July 2011 under decommissioning license. The preparation of V1 NPP decommissioning has been supported and partly financed by the Bohunice International Decommissioning Support Fund (BIDSF), under the administration of the European Bank for Reconstruction and Development. From 06/2008 to 12/2011 AMEC Nuclear Slovakia, together with partners STM Power and EWN GmbH, carried out BIDSF B6.4 project - Decommissioning database development (DDB). The main purpose of the B6.4 project was to develop a physical and radiological inventory database to support V1 NPP decommissioning process planning and performance. One of the specific deliverable tasks within the B6.4 project was deliverable D12 - Characterization of activated equipment and civil structures based on measurement, sampling and analyses performed on the samples. The scope of deliverable services within D12 task consisted of: 1. Categorization of activated components ; 2. Development of single working programs for their radiological monitoring and sampling ; 3. Preparation of sampling device and revision of all handling equipment; 4. Dose rate monitoring and sampling of: - Civil structures from reactors shaft on both units ; - Components placed in HLW storage, (so called 'Mogilnik') - connection rods, absorbers ; of control rod assemblies and neutron flux measurement channels ; - Reactor pressure vessel and shielding assemblies at both units of V1 NPP, reactor; internals from Unit 2 of V1 NPP; 5. Analysis of samples ; 6. Determination of radiological inventory ; 7. Import of radiological data for activated components into DDB. During sampling, mainly remotely controlled sampling device and radiation resistant camera with LED lightening for visual checking of all performed activities was used. In total, 125 samples have been taken
International Nuclear Information System (INIS)
2000-01-01
Scientific conference deals with problems of reactor safety upgrading, mainly of two blocks of the NPP V-1 Bohunice as well as decomissioning of the NPP A-1 Bohunice. Other problems of the nuclear engineering were discussed. Totally, 201 participants from the Slovak Republic, Czech Republic and Germany and from other countries took part in the conference. The Conference included the following sessions: (i): Survey on the situation of nuclear power in the partner countries; (ii) Mochovce design safety enhacement and operational experience; (iii) Bohunice V-1 safety upgrading and operational experience; (iv) Decomissioning, spent fuel and radwaste management; (v) Young Generation Presentation. Proceedings contains thirty one papers dealing with the scope of INIS
Energy Technology Data Exchange (ETDEWEB)
Byun, Jung-Sue [Department of Biology, Yonsei University, Seoul 120-749 (Korea, Republic of); Protein Network Research Center, Yonsei University, Seoul 120-749 (Korea, Republic of); Rhee, Jin-Kyu [Department of Biotechnology, Yonsei University, Seoul 120-749 (Korea, Republic of); Kim, Dong-Uk [Department of Biology, Yonsei University, Seoul 120-749 (Korea, Republic of); Oh, Jong-Won [Department of Biotechnology, Yonsei University, Seoul 120-749 (Korea, Republic of); Cho, Hyun-Soo, E-mail: hscho8@yonsei.ac.kr [Department of Biology, Yonsei University, Seoul 120-749 (Korea, Republic of); Protein Network Research Center, Yonsei University, Seoul 120-749 (Korea, Republic of)
2006-02-01
Recombinant EstE1 protein with a histidine tag at the C-terminus was overexpressed in Escherichia coli strain BL21(DE3) and then purified by affinity chromatography. The protein was then crystallized at 290 K by the hanging-drop vapour-diffusion method. EstE1, a new thermostable esterase, was isolated by functional screening of a metagenomic DNA library from thermal environment samples. This enzyme showed activity towards short-chain acyl derivatives of length C4–C6 at a temperature of 303–363 K and displayed a high thermostability above 353 K. EstE1 has 64 and 57% amino-acid sequence similarity to est{sub pc}-encoded carboxylesterase from Pyrobaculum calidifontis and AFEST from Archaeoglobus fulgidus, respectively. The recombinant protein with a histidine tag at the C-terminus was overexpressed in Escherichia coli strain BL21(DE3) and then purified by affinity chromatography. The protein was crystallized at 290 K by the hanging-drop vapour-diffusion method. X-ray diffraction data were collected to 2.3 Å resolution from an EstE1 crystal; the crystal belongs to space group P4{sub 1}2{sub 1}2, with unit-cell parameters a = b = 73.71, c = 234.23 Å. Assuming the presence of four molecules in the asymmetric unit, the Matthews coefficient V{sub M} is calculated to be 2.2 Å{sup 3} Da{sup −1} and the solvent content is 44.1%.
Nuclear safety in Slovak Republic. Safety analysis reports for WWER 440 reactors
International Nuclear Information System (INIS)
Rohar, S.
1999-01-01
Implementation of nuclear power program is connected to establishment of regulatory body for safe regulation of siting, construction, operation and decommissioning of nuclear installations. Licensing being one of the most important regulatory surveillance activity is based on independent regulatory review and assessment of information on nuclear safety for particular nuclear facility. Documents required to be submitted to the regulatory body by the licensee in Slovakia for the review and assessment usually named Safety Analysis Report (SAR) are presented in detail in this paper. Current status of Safety Analysis Reports for Bohunice V-1, Bohunice V-2 and Mochovce NPP is shown
Thirtieth anniversary of reactor accident in A-1 Nuclear Power Plant Jaslovske Bohunice
International Nuclear Information System (INIS)
Kuruc, J.; Matel, L.
2007-01-01
The facts about reactor accidents in A-1 Nuclear Power Plant Jaslovske Bohunice, Slovakia are presented. There was the reactor KS150 (HWGCR) cooled with carbon dioxide and moderated with heavy water. A-1 NPP was commissioned on December 25, 1972. The first reactor accident happened on January 5, 1976 during fuel loading. This accident has not been evaluated according to the INES scale up to the present time. The second serious accident in A-1 NPP occurred on February 22, 1977 also during fuel loading. This INES level 4 of reactor accident resulted in damaged fuel integrity with extensive corrosion damage of fuel cladding and release of radioactivity into the plant area. The A-1 NPP was consecutively shut down and is being decommissioned in the present time. Both reactor accidents are described briefly. Some radioecological and radiobiological consequences of accidents and contamination of area of A-1 NPP as well as of Manivier Canal and Dudvah River as result of flooding during the decommissioning are presented (authors)
International Nuclear Information System (INIS)
Macko, O.
1996-01-01
Within the paper a brief technical description of SMU-V system is presented including algorithms for measured data evaluation, assessment of experience acquired the system operation and prospective VUEZ activities aimed at the developed of systems for NPP primary circuit leak detection based on humidity monitoring. System SMU-V is used to diagnose dangerous conditions during which integrity of the pipeline could be impaired resulting in absolute humidity increase in the monitored volume. (author)
Preparation for and building of V-1 nuclear power plant
International Nuclear Information System (INIS)
Smatlak, S.; Spirko, M.
1981-01-01
Some findings and problems encountered during the construction of the V-1 nuclear power plant at Jaslovske Bohunice are discussed from the point of view of the investor, mainly problems associated with project preparation and relations between suppliers and the customer. The progress of construction is described and the dates are shown of the main stages of construction and tests. The construction proceeded according to a net diagram and was controlled by the construction management and a coordination group headed by the investor. An international start-up commission was established for the start-up stage. The fields are outlined of the participation and co-operation of Soviet organizations during project preparation, supplies, assembly, start-up, and fuel supplies for the V-1 nuclear power plant. (B.S.)
Complex nuclear safety evaluation of the Bohunice V-1 nuclear power plant
International Nuclear Information System (INIS)
Kriz, Z.
1991-01-01
The safety concept of V-230 type reactor units dates back to the late 1960s. The units fail to be sufficiently dimensioned for emergency cooling of the reactor core and are fitted with no containment. So far, operating experience is good. The availability factor is 71.5% for unit 1 and 77.8% for unit 2. There occur 1 to 3 unscheduled shutdowns annually. The quality of steam generator tubes is very good. A complex safety assessment of the plant was accomplished in 1990. It concerned the concept and criteria of safety assessment, the earthquake situation, the condition of the primary coolant circuit equipment, the control system, the effect of the human factor, and preparedness of emergency plans. OSART and ASSET missions were accomplished at the plant. Based on the results of the missions as well as of inspections by the State Surveillance over Nuclear Safety, the decision has been adopted to operate the plant not longer than till 1995; the further fate of the plant will be decided on according to a future technical and economic analysis. (M.D.)
International Nuclear Information System (INIS)
Kupca, L.; Stanc, S.; Simor, S.
2001-01-01
The information's about the special system of irradiation temperature measurement, used for reactor pressure vessel surveillance specimen, which are placed in reactor thermal shielding canals are presented in the paper. The system was designed and realized in the frame of Extended Surveillance Specimen Programme for NPP V-2 Jaslovske Bohunice and Modern Surveillance Specimen Programme for NPP Mochovce. Base design aspects, technical parameters of realization and results of measurement on the two units in Bohunice and Mochovce NPPs are presented too. (Authors)
Reconstruction of instrumentation and control system (SKR)
International Nuclear Information System (INIS)
Wiening, K.-H.
2001-01-01
For the first time extensive upgrades have been performed in all safety related areas of units with WWER 440/230 reactors. One of the most important actions was the replacement of the safety and safety related instrumentation and control. The state of the art digital safety instrumentation and control system TELEPERM XS has been implemented in units 1 and 2 of the Bohunice V1 power plant. The requirements as deduced from safety assessments conducted by commissions of international experts have been fulfilled, so that Bohunice V1 after this gradual reconstruction has been upgraded to an internationally accepted safety level for the remainder of its service life. (author)
SEJV2 software package for radiation monitoring system of WWER 440 NPP
International Nuclear Information System (INIS)
Kapisovsky, V.; Jancik, O.; Kubik, I.; Bena, J.
1993-01-01
The main part of the radiation monitoring system at a WWER-440 (213 reactor type) nuclear power plant is the centralized 400-channel monitoring system 'SEJVAL' servicing twin reactor units. The SEJV2 software package is described developed to run on a PC with an IFS2 interface to the SEJVAL radiation monitoring system. It provides enhanced data presentation, record keeping and report generation, thus improving the efficiency of the health physics shift. The system was for the first time implemented at the Jaslovske Bohunice V-2 nuclear power plant with encouraging results. (Z.S.) 3 refs
Jevgenij V. Doc: We do not want to build a monument at Mochovce
International Nuclear Information System (INIS)
Janoska, J.
2004-01-01
In this paper the interview with the General Manager of Inter RAO JES - Jevgenij V. Doc is published. Inter RAO JES applies for the privatisation of Slovenske elektrarne (Slovak Electric - SE). According to the General Manager of Inter RAO JES, the company does not need a foreign partner to provide financial support after the privatisation of SE, but rather it requires a political support. Plans about Bohunice NPP and of completion of the Mochovce NPP as well as of privatisation of the SE by the Inter RAO JES are presented
Alicyclobacillus acidocaldarius Thermophilic Esterase EST2's Activity in Milk and Cheese Models
Mandrich, L.; Manco, M.; Rossie, M.; Floris, E.; Jansen-van den Bosch, T.; Smit, G.; Wouters, J.A.
2006-01-01
The aim of this work was to investigate the behavior of thermophilic esterase EST2 from Alicyclobacillus acidocaldarius in milk and cheese models. The pure enzyme was used to compare the EST2 hydrolytic activity to the activity of endogenous esterase EstA from Lactococcus lactis. The results
International Nuclear Information System (INIS)
2001-01-01
This CD is multimedia presentation of programme safety upgrading of Bohunice V1 NPP. This chapter consist of introductory commentary and 4 introductory speeches (video records): (1) Introductory speech of Vincent Pillar, Board chairman and director general of Slovak electric, Plc. (SE); (2) Introductory speech of Stefan Schmidt, director of SE - Bohunice Nuclear power plants; (3) Introductory speech of Jan Korec, Board chairman and director general of VUJE Trnava, Inc. - Engineering, Design and Research Organisation, Trnava; Introductory speech of Dietrich Kuschel, Senior vice-president of FRAMATOME ANP Project and Engineering
Energy Technology Data Exchange (ETDEWEB)
Patenyi, V [Nuclear Regulatory Authority, Bratislava (Slovakia); Darilek, P; Majercik, J [Vyskumny Ustav Jadrovych Elektrarni, Trnava (Slovakia)
1994-12-31
The experience gained in fuel utilization and the basic requirements for fuel licensing in the Slovak NPPs is described. The original project of WWER-440 reactors supposes 3-year fuel cycle with cycle length of about 320 full power days (FPD). Since 1984 it was reduced to 290 FPD. Based on the experience of other countries, a 4-year fuel cycle utilization started in 1987. It is illustrated with data from the Bohunice NPP units. Among 504 fuel assemblies left for the fourth burnup cycle no leakage was observed. The mean burnup achieved in the different units varied from 33.1 to 38.5 Mwd/kg U. The new fuel assemblies used are different from the recent ones in construction, thermohydraulics, water-uranium ratio, enrichment and material design. To meet the safety criteria, regulatory requirements for exploitation of new fuel in WWER-440 were formulated by the Nuclear Regulatory Authority of Slovak Republic. 1 tab., 5 refs.
Accident localization system with jet condensers for VVER 440-V 230 NPP at Jaslovske Bohunice
International Nuclear Information System (INIS)
Murani, J.
1995-01-01
The operational safety of the V1 nuclear power plant (NPP) is unsatisfactory and does not correspond to present requirements as to nuclear safety. Further NPP operation after 1995 is conditional on nuclear safety enhancement to a level comparable with that in West European countries. This aim should be achieved by a principal reconstruction involving in addition to others also backfitting the V1 NPP with technical facilities aimed at coping with a design basis accident (DBA).To cope with such an accident the Power Equipment Research Institute (VUEZ) designed an accident localization system with jet condensers. This system consists of (a) an air trap (one for each unit, mutually interconnected) with an expansion bell enclosed within, placed on a plate with 200 pipes of jet condensers passing through, and (b) a connecting duct between the hermetic zone and the air trap. The vertical jet condenser is an essential element of the system designed for steam condensation. Apart from condensation it serves as a water seal separating units 1 and 2.Demonstration tests of the jet condenser (model 1:1) condensing function were carried out at the testing unit of the All-Union Research Institute for NPP Operation (VNIIAES), Moscow in Kashir, 11-22 September 1992. These experiments proved the jet condenser ability to ensure complete condensation of the steam produced. Experimental verification of the sealing function (model 1:1) was carried out at the testing unit of the VUEZ Tlmace. These experiments concerning the dynamics and overpressure in the free space above the pool were close to the conditions in the air trap during DBA. The jet condenser height was proved to be sufficient to ensure the sealing function. Design and experimental work has been implemented in close cooperation with Russian experts Mr. V.N. Bulynin from the VNIIAES, Moscow, and Mr. M.V. Kuznecov from the Scientific and Engineering Center for Nuclear and Radiological Safety, Moscow. (orig.)
Sensing Traffic Density Combining V2V and V2I Wireless Communications
Directory of Open Access Journals (Sweden)
Julio A. Sanguesa
2015-12-01
Full Text Available Wireless technologies are making the development of new applications and services in vehicular environments possible since they enable mobile communication between vehicles (V2V, as well as communication between vehicles and infrastructure nodes (V2I. Usually, V2V communications are dedicated to the transmission of small messages mainly focused on improving traffic safety. Instead, V2I communications allow users to access the Internet and benefit from higher level applications. The combination of both V2V and V2I, known as V2X communications, can increase the benefits even further, thereby making intelligent transportation systems (ITS a reality. In this paper, we introduce V2X-d, a novel architecture specially designed to estimate traffic density on the road. In particular, V2X-d exploits the combination of V2V and V2I communications. Our approach is based on the information gathered by sensors (i.e., vehicles and road side units (RSUs and the characteristics of the roadmap topology to accurately make an estimation of the instant vehicle density. The combination of both mechanisms improves the accuracy and coverage area of the data gathered, while increasing the robustness and fault tolerance of the overall approach, e.g., using the information offered by V2V communications to provide additional density information in areas where RSUs are scarce or malfunctioning. By using our collaborative sensing scheme, future ITS solutions will be able to establish adequate dissemination protocols or to apply more efficient traffic congestion reduction policies, since they will be aware of the instantaneous density of vehicles.
Sensing Traffic Density Combining V2V and V2I Wireless Communications.
Sanguesa, Julio A; Barrachina, Javier; Fogue, Manuel; Garrido, Piedad; Martinez, Francisco J; Cano, Juan-Carlos; Calafate, Carlos T; Manzoni, Pietro
2015-12-16
Wireless technologies are making the development of new applications and services in vehicular environments possible since they enable mobile communication between vehicles (V2V), as well as communication between vehicles and infrastructure nodes (V2I). Usually, V2V communications are dedicated to the transmission of small messages mainly focused on improving traffic safety. Instead, V2I communications allow users to access the Internet and benefit from higher level applications. The combination of both V2V and V2I, known as V2X communications, can increase the benefits even further, thereby making intelligent transportation systems (ITS) a reality. In this paper, we introduce V2X-d, a novel architecture specially designed to estimate traffic density on the road. In particular, V2X-d exploits the combination of V2V and V2I communications. Our approach is based on the information gathered by sensors (i.e., vehicles and road side units (RSUs)) and the characteristics of the roadmap topology to accurately make an estimation of the instant vehicle density. The combination of both mechanisms improves the accuracy and coverage area of the data gathered, while increasing the robustness and fault tolerance of the overall approach, e.g., using the information offered by V2V communications to provide additional density information in areas where RSUs are scarce or malfunctioning. By using our collaborative sensing scheme, future ITS solutions will be able to establish adequate dissemination protocols or to apply more efficient traffic congestion reduction policies, since they will be aware of the instantaneous density of vehicles.
Lithiases vésicales géantes: A propos de 2 cas
Directory of Open Access Journals (Sweden)
S. Ouedraogo
2016-12-01
Full Text Available Les lithiases vésicales sont fréquentes. Généralement, les calculs vésicaux sont de petite taille et leur traitement est relativement aisé. Les macro-lithiases vésicales sont rares. Nous présentons deux cas de macro-lithiase vésicale diagnostiqués dans un contexte social particulier. Il s’agit de deux patients de sexe masculin, l’un âgé de 47 ans et l’autre de 66 ans, reçus en consultation pour dysurie et douleur hypogastrique. Cette symptomatologie évoluait depuis plusieurs années. Les patients n’ont consulté que lorsque cette symptomatologie est devenue très gênante. L’examen physique a noté une masse hypogastrique. L’imagerie médicale a permis d’aboutir au diagnostic de macro-lithiase vésicale occupant quasiment toute l’aire vésicale. Une extraction par cystotomie sus-pubienne a été réalisée dans les 2 cas. Les suites opératoires furent simples. Ces observations mettent en lumière une consultation tardive dans une société où les questions touchant à la sphère uro-génitale restent un tabou.
V-1 nuclear power plant standby RPP-16S computer software
International Nuclear Information System (INIS)
Suchy, R.
1988-01-01
The software structure of the function of program modules of the RPP-16S standby computer which is part of the information system of the V-1 Bohunice nuclear power plant are described. The multitasking AMOS operational system is used for the organization of programs in the computer. The program modules are classified in five groups by function, i.e., in modules for the periodical collection of values and for the measurement of process quantities for both nuclear power plant units; for the primary processing of the values; for the monitoring of exceedance of preset limits; for unit operators' communication with the computer. The fifth group consists of users program modules. The standby computer software was tested in the actual operating conditions of the V-1 power plant. The results showed it operated correctly; minor shortcomings were removed. (Z.M.). 1 fig
Kohvik-restoran C'est La Vie = Cafe-restaurant C'est La Vie
2008-01-01
Kohvik-restorani C'est La Vie (Suur-Karja 5, Tallinn) sisekujundusest. Sisearhitekt: Maile Grünberg, kes kavandas ka valdavalt mööbli. Laevalgusti disainis Tõnis Vellama. Skulptuuride (koopiad) autor on keraamik Ülle Rajasalu. Maile Grünbergist, tema viimased tööd. Keldrikorruse ja I korruse plaan, 8 värv. vaadet, foto M. Grünbergist
Estilo y estética en el vídeo musical : creando una tipología clip
Rodríguez López, Jennifer; Aguaded Gómez, José Ignacio
2016-01-01
Se define la estética del vídeo musical en relación con el concepto de estilo como formato audiovisual autónomo e independiente de lenguajes afines, como el cinematográfico y el publicitario, creando una tipología para la clasificación y el análisis del videoclip. This article defines the aesthetic of music videos in relation to the concept of style as an autonomous and independent audiovisual format of similar languages, as the cinematographic or the advertising one, creating a typology f...
S1-luokan elementtiväestönsuojan käyttö asuinkerrostalossa
Uski, Reijo
2012-01-01
Opinnäytetyössä on laadittu ajanmukainen ja tiivis ohje elementtirakenteisen väestönsuojan käytöstä uudisrakentamisessa. Työssä selvitetään kahden erilaisen elementtiväestönsuojan tyypin rakenneperiaatteita sekä käyttöä talonrakentamisessa. Samalla vertaillaan elementtirakenteisen ja perinteisen massiivirakenteisen paikallavaletun väestönsuojan hyviä ja huonoja ominaisuuksia erityisesti työmaan näkökulmasta. Opinnäytetyössä käsitellään lyhyesti väestönsuojan elementtitekniikan ongelmakohtia....
Decommissioning and radioactive waste management. The European Commission overview
International Nuclear Information System (INIS)
Rehak, M
2010-01-01
In this lecture author deals with the European Commission overview on the decommissioning and radioactive waste management. Financial support of European Commission of decommissioning of the Ignalina NPP, Bohunice V1 NPP and Kozloduy Units 1 and 2 is presented.
EST-PAC a web package for EST annotation and protein sequence prediction
Directory of Open Access Journals (Sweden)
Strahm Yvan
2006-10-01
Full Text Available Abstract With the decreasing cost of DNA sequencing technology and the vast diversity of biological resources, researchers increasingly face the basic challenge of annotating a larger number of expressed sequences tags (EST from a variety of species. This typically consists of a series of repetitive tasks, which should be automated and easy to use. The results of these annotation tasks need to be stored and organized in a consistent way. All these operations should be self-installing, platform independent, easy to customize and amenable to using distributed bioinformatics resources available on the Internet. In order to address these issues, we present EST-PAC a web oriented multi-platform software package for expressed sequences tag (EST annotation. EST-PAC provides a solution for the administration of EST and protein sequence annotations accessible through a web interface. Three aspects of EST annotation are automated: 1 searching local or remote biological databases for sequence similarities using Blast services, 2 predicting protein coding sequence from EST data and, 3 annotating predicted protein sequences with functional domain predictions. In practice, EST-PAC integrates the BLASTALL suite, EST-Scan2 and HMMER in a relational database system accessible through a simple web interface. EST-PAC also takes advantage of the relational database to allow consistent storage, powerful queries of results and, management of the annotation process. The system allows users to customize annotation strategies and provides an open-source data-management environment for research and education in bioinformatics.
Phase diagrams of systems of Sr2V2O7-M2V2O7 and of Ba2V2O7-M2V2O7 (M=Ca,Cd)
International Nuclear Information System (INIS)
Fotiev, A.A.; Zhuravlev, V.D.; Zhukov, V.P.
1982-01-01
Using the methods of X-ray phase and differential thermal anlyses phase equilibria in the systems Sr 2 V 2 O 7 -M 2 V 2 O 7 and Ba 2 V 2 O 7 -M 2 V 2 O 7 , where M--Ca, Cd, are studied, their phase diagrams being built. New double pyrovanadates Mosub(0.5)Srsub(1.5)Vsub(2)Osub(7) and MBaV 2 O 7 are found [ru
Lifescience Database Archive (English)
Full Text Available 2V5|A5H2V5_9BILA Ahn-4 OS=Steinernema carpocapsae PE=4 SV=1 37 0.65 tr|Q5M7R7|Q5M...DHHHDHDHHHH 373 >tr|A5H2V5|A5H2V5_9BILA Ahn-4 OS=Steinernema carpocapsae PE=4 SV=1 Length = 61 Score = 36.6
Radiological characterisation on V1 NPP technological systems and buildings - Contamination
International Nuclear Information System (INIS)
Hanzel, Richard; Rapant, Tibor; Svitek, Jaroslav
2012-01-01
Since 2001, the preparation of V1 NPP practical decommissioning has been supported and partly financed by the Bohunice International Decommissioning Support Fund, under the administration of the European bank for Reconstruction and development. AMEC Nuclear Slovakia, together with partners STM Power and EWN GmbH, performed BIDSF B.4 project - Decommissioning database development. The main purpose of the B6.4 project was to develop a comprehensive physical and radiological inventory database to support RAW management development of the decommissioning studies and decommissioning project of Bohunice V1 NPP. AMEC Nuclear Slovakia was responsible mainly for DDB design, planning documents and physical and radiological characterization including sampling and analyses of the plant controlled area. The objective of V1 NPP radiological characterization was summarisation of sampling and analyses results, description of methodology used for radiological characterization and determination of the V1 NPP radiological inventory. Results of the characterization survey included the identification and distribution of contamination in buildings, structures, and other site facilities or other impacted media. The characterization survey clearly identified those portions of the site that have been affected by site activities and are contaminated. The survey also identified the portions of the site that have not been affected by these activities and can be marked as 'not impacted'. Radiological data have been presented also on the basis of index RAI level, where 5 radiological classes have been defined. On the basis of sampling and analyses results following radiological parameters have been assigned to all impacted components and civil structures included in DDB: dose rate in contact, dose rate in distance 1 m, external surface contamination, internal surface contamination and volume/mass contamination. Each room in controlled area has been described by following radiological parameters
Analytical and experimental verification of confinement upgrading for Bohunice NPP V1
International Nuclear Information System (INIS)
Tkac, A.
2000-01-01
The scope of this paper is to provide a brief description of confinement improvement for NPP V-1 and supporting thermal-hydraulic analyses and experimental results. Series of analyses are performed in the process of the designing of an improved confinement system. Based on the analytical results obtained in the PHARE Project NS01/91 'Confinement and Improved ECCS Evaluation' as well as on additional activities performed after its finishing, additional modifications have been proposed during the designing. It is required to minimize the construction works EWST ceiling, while final solution shall fulfil acceptance criteria set forth in Decision 1/94 of Slovak Regulatory Authority (UJD). The technical requirement of the UJD is related to confinement. IAEA recommendations are taken into account. Due to new definitions of DBA and BDBA first considerations were connected and oriented on possible value of pressure peak increasing. As a result of the structural analysis limiting values for hermetic zone are determined. Some design modifications of the hermetic zone are proposed
International Nuclear Information System (INIS)
1996-01-01
In 1998, Nuclear Regulatory Authority of the Slovak Republic (NRA SR) performed 38 inspections, 25 of them were performed in co-operation with IAEA inspectors. There is no fresh nuclear fuel at Bohunice A-1 NPP at present. Fresh fuel of Bohunice V-1 and V-2 NPPs is inspected in the fresh fuel storage.There are 327 fresh fuel assemblies in Mochovce NPP fresh fuel storage. In addition to that, are also 71 small users of nuclear materials in Slovakia. In most cases they use: covers made of depleted uranium for non-destructive works, detection of level in production plants, covers for therapeutical sources at medical facilities. In. 1995, NRA SR issued 4 new licences for nuclear material withdrawal. In the next part manipulation with nuclear materials, spent fuel stores and illegal trafficking in nuclear materials are reported
International Nuclear Information System (INIS)
Hermansky, Jozef; Zavodsky, Martin
2014-01-01
A coolant flow through the reactor is usually determined after annual outages at Slovak NPP (VVER 440) in two distinct ways. First method is determination on the basis of the secondary system parameters - measurement of thermal balances. The value achieved by this method is used as the input parameter in the Table of allowed reactor operation modes. The second method draws from the primary system parameters - measurement of primary system hydraulic characteristics. Flow nozzles used for the measurement of feed water flow behind high pressure heaters were replaced at both Bohunice Units during outages in 2008. The feed water flow behind high pressure heaters is one of the main parameters used for the determination of coolant flow through the reactor by the first method. Compared to the measurement executed during previous fuel cycles, the calculated coolant flow through the reactor decreased considerably after the change of flow nozzles. The imaginary change of coolant flow through the reactor at Unit 3 was -1,6 %; and at Unit 4 -2,6 %. This change was not proved by the parallel measurement of primary system hydraulic characteristics. Later it was found out that the original flow nozzles used for 25 years were substantially deposited (original inner diameter of the nozzles was reduced by about 0,6-0,9 mm). Therefore feed water flow measurement was untrustworthy within the recent years. On the findings stated above, Bohunice NPP has decided to increase coolant flow through the reactor by changing the reactor coolant pumps impeller wheels. The modification of impellers wheels is planned within years 2012 to 2014. During the outages in 2013 two impeller wheels were replaced at both units. Nowadays Unit 4 is operated with all 6 new impeller wheels and Unit 3 with four new impeller wheels. Modification of last two impeller wheels at Unit 3 will be performed during the outage in 2014. On account of impeller wheels modification, non-standard measurement of PS hydraulic
Chapter 9. Personnel qualification and training
International Nuclear Information System (INIS)
2000-01-01
In 1999 the Nuclear Regulatory Authority of the Slovak Republic (UJD) focused on the overall training system and on developing programmes for individual categories for NPP V-1 Bohunice, NPP V-2 Bohunice, NPP Mochovce and SE-VYZ. The fundamental theoretical and periodical training for both Bohunice and Mochovce NPPs personnel, simulator training for NPP Bohunice, and periodical simulator training for Bohunice personnel is carried out by the VUJE Training center in Trnava, whereas the simulator training and periodical training for NPP Mochovce is carried at Mochovce plant. Based on a successful passing of examination before the examining committee, UJD issues, a certificate on special professional skills of selected staff of nuclear installations for specific activity for the given type of nuclear installation and for the following positions: (a)Shift manager for scientific start up with the right of manipulation; (b) Shift supervisor; (c) Unit supervisor; (d) Primary circuit operator; (e) Secondary circuit operator; (f) Reactor physicist; (g) Shift manager for scientific start up without the right of manipulation. Examination of selected personnel is described. Last year the examining committee held twelve session for oral theoretical examination. The number of licenses issued in 1999 and the total number of valid licenses is given.Conclusions from inspections carried out by UJD and inspections and tests carried out by the NPP operators in 1999, as well as results from operation and start up of nuclear units confirm that the standard of professional skills of the staff at nuclear installations a high standard of operational safety is being achieved on a permanent basis. Increasing the qualification of UJD staff was done in a form of training and courses scheduled in the plan of training for the staff for 1999. These training, composed of specialized qualification study, functional study, as well as study aimed at maintaining qualification. Training courses organized
Lifescience Database Archive (English)
Full Text Available Result : Swiss-Prot sp_hit_id P32926 Definition sp|P32926|DSG3_HUMAN Desmoglein-...nt alignments: (bits) Value sp|P32926|DSG3_HUMAN Desmoglein-3 OS=Homo sapiens GN=....3 >sp|P32926|DSG3_HUMAN Desmoglein-3 OS=Homo sapiens GN=DSG3 PE=1 SV=1 Length = ...d A8K2V2 Definition tr|A8K2V2|A8K2V2_HUMAN cDNA FLJ75630, highly similar to Homo sapiens desmoglein 3 (pemph... similar to Homo sapiens desmoglein 3 (pemphigus vulgaris antigen) (DSG3), mRNA O
Energy Technology Data Exchange (ETDEWEB)
Kulsrud, R. M. [Princeton University, Princeton, N.J. (United States)
1966-04-15
dispositifs a V'' negatif ont une stabilite intrinseque plus grande que les dispositifs stabilises par croisement de lignes de champ, car ils ne sont pas sujets a l'instabilite d'interchange pure. Toutefois, ils peuvent presenter une instabilite en mode de ballonnement qui est essentiellement un interchange limite qui est localise sur une partie de ligne de force ayant une courbure defavorable. Lorsque la conductivite est infinie, ce mode fournit une valeur critique {beta}{sub c} de {beta} qui est le rapport de la pression de plasma a la pression magnetique, en dessous de laquelle le plasma est stable. Une expression approchee qui comporte la variation relative {Delta}/U de U = Integral d Script-Small-L /B, ou l'integration est faite sur la longueur L de la region decourbure opposee, et cette longueur L elle- meme fournissent cette valeur de {beta}{sub c} La variation est calculee depuis l'axe du plasma jusqu'ala limite pourunrayona. Sous sa forme la lus simple, {beta}{sub c} s'exprime par la formule g(U/{Delta}U)({pi}{sup 2}a{sup 2}/L{sup 2}), ou g est une constante de l'ordre de l'unite. Une analyse correcte de la stabilite pour les dispositifs a V'' negatif de Johnson a permis de justifier cette relation. Lorsque la resistance du plasma n'est pas nulle, la tendance a une limitation de l'interchange par les regions de courbure favorable est attenuee et le mode de ballonnement devient resistif. Ce mode est toujours instable et, pour {beta} < {beta}{sub c} son taux de croissance est de o{sub R} = m{sup 2}/{beta}{sub c} {tau}{sub class}, ou m est le nombre de mode azimutal et {tau}{sub class} est. le temps de diffusion classique. Lorsque les dispostifs a V'' negatif possedent egalement un champ magnetique a lignes croisees, la valeur de o{sub R} diminue pour de grandes valeurs de m. Les effets causes par le rayon de giration fini pour des valeurs elevees de m limitent probablement celle de o{sub R}. En se fondant sur ces considerations, l'auteur estime que la valeur effective
Lifescience Database Archive (English)
Full Text Available DROER GG24967 OS=Drosophila erecta GN=GG24967 P... 33 9.2 tr|A4V047|A4V047_DROME Brother of odd with entrails...SFLGSIPMRKRILPAPTLDLMDPHHHP 673 >tr|A4V047|A4V047_DROME Brother of odd with entrails
Development of Czechoslovak nuclear power engineering
International Nuclear Information System (INIS)
Keher, J.
1985-01-01
The output of Czechoslovak nuclear power plants is envisaged at 2200 MW by 1985, 4400 MW by 1990 and 10,280 MW by the year 2000. The operation so far is assessed of Bohunice V-1 and Bohunice V-2 power plants as is the construction of the Dukovany nuclear power plant. International cooperation in the fulfilment of the nuclear power programme is based on the General Agreement on Cooperation in the Prospective Development and Interlinkage of CMEA Power Systems to the year 1990, the Agreement on Multilateral International Specialization and Cooperation of Production and on Mutual Deliveries of Nuclear Power Plant Equipment. The most important factor in international cooperation is the Programme of Cooperation between the CSSR and the USSR. The primary target in the coming period is the Temelin nuclear power plant project and the establishment of unified control of the nuclear power complex. (M.D.)
Chapter 2. The production units
International Nuclear Information System (INIS)
1998-01-01
In the second chapter of this CD ROM the production units of the Slovak Electric, Plc. (Slovenske elektrarne, a.s.), are presented. It consist of next paragraphs: (1) Nuclear power plants (A-1 Nuclear Power Plant (History, Technological scheme, basic data are presented); V-1, V-2 Bohunice Nuclear Power Plant (History 1972-1985, technological scheme; nuclear safety, radiation protection, heat supply, international co-operation and basic data are presented); Mochovce Nuclear Power Plant (History 1980-1998, technological scheme, construction completion, milestones of commissioning, safety and environmental protection as well as basic data are included). (2) Conventional sources of energy (Vojany fossil power plant (History 1959-1992, Technological units of power plant, Impact of operation on the environment, Plant of Vojany FPP Renewal and Reconstruction, Basic data are listed), Novaky fossil power plant (History 1949-1998, Technological scheme, current investment construction, basic data, Handlova heating plant). Kosice Combined Heat Power Plant (History 1960-1995, technological scheme, State metrology centre, acredited chemical laboratory, basic data). (3) Hydroelectric power plants (Trencin HPPs: Cierny Vah pumped storage HPP, Liptovska Mara HPP, Orava HPP, Sucany HPP, Miksova HPP, Nosice HPP, Velke Kozmalovce HPP, Gabcikovo HPP, Dubnica HPP, Nove Mesto n/V HPP, Madunice HPP, Kralova HPP) and Dobsina HPPs: (Dobsina HPP, Ruzin HPP, Domasa HPP, small HPPs) are presented
Feasibility studies for decommissioning
International Nuclear Information System (INIS)
Hladky, E.
2000-01-01
In this presentation author deals with planning of decommission of the NPPs A1, V1 and V2 Bohunice and Mochovce. It was concluded that: Used model for decommissioning parameters assessment has been suitable for elaboration of initial decommissioning plans (feasibility studies); Basic assessment of main decommissioning parameters and basic comparison of various decommissioning options have been possible; Improvement of the model and corresponding software is desirable and works on software improvement began one year ago; V1-NPP initial decommissioning plan should be actualized, because initial decommissioning plan does not correspond by its content and structure to requirements of Act No. 130/98 and Nuclear Regulatory Authority Degree No. 246/99; Strategy of radioactive wastes treatment and conditioning together with technical provisions at Jaslovske Bohunice site was changed in comparison with the assumptions in 1991-92; Considered V1 NPP decommissioning options are necessary to be re-evaluated in accordance with latest development of knowledge and approaches to NPP decommissioning in the world; Specific unit costs are substantially and differentially changed in comparison with the assumptions in 1991-92; Necessity to take into account technical changes resulted from V1 NPP reconstruction. (author)
Lifescience Database Archive (English)
Full Text Available 1.2 sp|Q6P6V7|EAPA2_RAT Experimental autoimmune prostatitis antigen ... 32 1.6 sp|Q28FN6|OTX2_XENTR Homeobox...32 2.7 sp|Q6QR59|EAPA2_MOUSE Experimental autoimmune prostatitis antige... 32 2.7 sp|Q91813|OTX2A_XENLA Home...TTASPAGY 49 >sp|Q6P6V7|EAPA2_RAT Experimental autoimmune prostatitis antigen 2 ho...SVPTIASSSAPVSIWSPASISPLSDPLSTS---------SSCMQRSYPMTYTQAS 183 >sp|Q6QR59|EAPA2_MOUSE Experimental autoimmune prostatitis
Monitoring program of surrounding of the NPP SE-EBO
International Nuclear Information System (INIS)
Dobis, L.; Kostial, J.
1997-01-01
The paper dealt with monitoring program of radiation control of surrounding of the NPP Bohunice, which has the aim: (1) to ensure the control of influence of work of the NPP Bohunice on the environment in their surrounding; (2) to ensure the back-ground for regular brief of control and supervisory organs about condition of the environment in surrounding of the NPP Bohunice; (3) to maintain the expected technical level of control of the NPP Bohunice and to exploit optimally the technical means; (4) to solicit permanently the data about the radioactivity of environment in surrounding of the NPP Bohunice for forming of files of the data; (5) to exploit purposefully the technical equipment, technical workers and to maintain their in permanent emergency and technical eligibility for the case of the breakdown; (6) to obtain permanently the files of the values for qualification of the reference levels. This program of monitoring includes the radiation control of surrounding of the NPP Bohunice, in the time of normal work of power-station's blocks, inclusively of all types of trouble-shooting and repairer works in surrounding of the NPP Bohunice, up to distance 20 km from power-station. The monitoring includes: outlets from the NPP Bohunice, monitoring of radiation characteristics in surrounding of the NPP Bohunice, (aerosols, fall-outs, soil), the links of food chains: (grass and fodder, milk, agriculture products), hydrosphere in surrounding (surface waters, drink water, bores of radiation control in complex of the NPP Bohunice, components of the hydrosphere), measurement of radiation from external sources (measurement of the dose rates, measurement of the doses [sk
Dispositivos estéticos y formas sensibles de la emancipación
Directory of Open Access Journals (Sweden)
María Luciana Cadahia
2016-08-01
Full Text Available Se explora la noción de dispositivo desde una perspectiva estético-política. Se inquieren los motivos para distanciarnos de las lecturas de Agamben, Esposito y el Colectivo tiqqun,se examina la interpretación de Deleuze al respecto, en una dimensión poco conocida, y se amplía esta perspectiva hacia una concepción estética del dispositivo, atendiendo para ello a Martín-Barbero. Finalmente, se considera el vínculo problemático entre el dispositivo y la positividad estética, para acercarnos a Schiller, quien da las pautas para disolver el vínculo problemático.
Directory of Open Access Journals (Sweden)
Bárbara Cortés Cabrera
2015-12-01
Full Text Available En septiembre de 2015, el Tribunal Europeo de Derechos Humanos resolvió el caso caratulado Affaire Khlaifia et autres v. Italie (Caso Khlaifia y otros c. Italia, relativo al reclamo presentado contra Italia por la retención ilegal, condiciones de detención, e infracciones al debido proceso de migrantes tunecinos que ingresaron ilegalmente al país, a través de embarcaciones ligeras. El fallo es sumamente interesante, pues analiza ciertos estándares jurídicos que deben aplicarse al procedimiento administrativo observado por el Estado, para la expulsión del país de los inmigrantes. El presente trabajo busca identificar los principales criterios establecidos en la sentencia, y compararlos con los estándares establecidos previamente por la doctrina y los otros sistemas de derechos humanos.
galaxieEST: addressing EST identity through automated phylogenetic analysis.
Nilsson, R Henrik; Rajashekar, Balaji; Larsson, Karl-Henrik; Ursing, Björn M
2004-07-05
Research involving expressed sequence tags (ESTs) is intricately coupled to the existence of large, well-annotated sequence repositories. Comparatively complete and satisfactory annotated public sequence libraries are, however, available only for a limited range of organisms, rendering the absence of sequences and gene structure information a tangible problem for those working with taxa lacking an EST or genome sequencing project. Paralogous genes belonging to the same gene family but distinguished by derived characteristics are particularly prone to misidentification and erroneous annotation; high but incomplete levels of sequence similarity are typically difficult to interpret and have formed the basis of many unsubstantiated assumptions of orthology. In these cases, a phylogenetic study of the query sequence together with the most similar sequences in the database may be of great value to the identification process. In order to facilitate this laborious procedure, a project to employ automated phylogenetic analysis in the identification of ESTs was initiated. galaxieEST is an open source Perl-CGI script package designed to complement traditional similarity-based identification of EST sequences through employment of automated phylogenetic analysis. It uses a series of BLAST runs as a sieve to retrieve nucleotide and protein sequences for inclusion in neighbour joining and parsimony analyses; the output includes the BLAST output, the results of the phylogenetic analyses, and the corresponding multiple alignments. galaxieEST is available as an on-line web service for identification of fungal ESTs and for download / local installation for use with any organism group at http://galaxie.cgb.ki.se/galaxieEST.html. By addressing sequence relatedness in addition to similarity, galaxieEST provides an integrative view on EST origin and identity, which may prove particularly useful in cases where similarity searches return one or more pertinent, but not full, matches and
International Nuclear Information System (INIS)
1996-01-01
The main efforts of Nuclear Regulatory Authority of the Slovak Republic (NRA SR) was focused on support of quality assurance programmes development at responsible organizations Bohunice V-1 and V-v and Mochovce NPPs and their inspection. Development of the level two documentation of a partial quality assurance programme for NPP operation continued at Mochovce NPP. Most of documentation has been submitted to NRA SR for comments and approval. NRA SR invited a mission of French experts to Mochovce NPP to review preparation and performance of internal audits that would be beneficial for improvement in this kind activities at the NPP. Bohunice NPP continued in development of a partial quality assurance programme for operation. The Quality Assurance Programme submitted to NRA SR for approval. Based on a request of Bohunice NPPs, NRA SR consulted the draft quality assurance programme developed by Siemens for stage of the 'Basic Design' of V-1 NPP upgrading. The programme had not been submitted for approval to NRA SR prior to completion of works by Siemens. Based on an internal audit that had been performed, corrective measures were proposed to meet requirements on review and approval of suppliers quality assurance programmes. Requirements related to the quality assurance at nuclear installations were prepared to be incorporated into principles of a act on peaceful use of nuclear power in Slovak Republic
Chapter No.8. Personnel qualification and training
International Nuclear Information System (INIS)
2002-01-01
The overall training system and the development projects of training the staff of all categories from NPP V-1, NPP V-2 Bohunice, SE-VYZ and NPP Mochovce were the subject of UJD's attention. During 2001 following inspections were carried out on nuclear personnel training: - PP's Bohunice: an inspection focused on compliance with requirements for staff qualifications and compliance with the prescribed training of Bohunice plant staff; - Mochovce NPP: an inspection focused on compliance with the requirements for staff qualifications and compliance with the prescribed training of NPP Mochovce staff; - SE-VYZ: an inspection focused on compliance with the requirements for staff qualifications and compliance with the prescribed training of SE-VYZ staff. Training the staff of the NPP's Bohunice: - The fundamental and periodical theoretical training as sure as the fundamental and periodical simulator training is carried out by the VUJE Training centre in Trnava. - The fundamental practical training in the workplace and training for the change work- rank is carried at Bohunice plant. Training of the staff of the NPP Mochovce: - The fundamental and periodical theoretical training is carried out by the VUJE Training centre in Trnava. The fundamental practical training in the workplace and training for the change work- rank as well as the fundamental and periodical simulator training is carried at Mochovce plant. Based on a successful passing of examination before the examining committee, UJD issues a certificate on special professional skills of selected staff members of nuclear installations for specific activity for the given type of nuclear installation and for the following positions: 1. Scientific shift manager for start up with the right of manipulation; 2. Shift supervisor; 3. Unit supervisor; 4. Primary circuit operator; 5. Secondary circuit operator; 6. Reactor physicist; 7. Scientific shift manager for start up without the right of manipulation. Examinations of
Betancur, J. A.; Osorio-Gómez, Gilberto; Arnedo, Aida; Yarce Botero, Andrés.
2014-06-01
Nowadays, it is very important to explore the qualitative characteristics of autonomous mobility systems in automobiles, especially disruptive technology like Vehicle to Vehicle (V2V) and Infrastructure to Vehicle (I2V), in order to comprehend how the next generation of automobiles will be developed. In this sense, this research covers a general review about active safety in automobiles where V2V and I2V systems have been implemented; identifying the more realistic possibilities related to V2V and I2V technology and analyzing the current applications, some systems in development process and some future conceptual proposals. Mainly, it is notorious the potential development of mixing V2V and I2V systems pointing to increase the driver's attention; therefore, a configuration between these two technologies and some augmented reality system for automobiles (Head-Up Display and Head-Down Display) is proposed. There is a huge potential of implementation for this kind of configuration once the normative and the roadmap for its development can be widely established.
Imunogenicidade da cepa avirulenta RV194-2 do vírus rábico em camundongos
Directory of Open Access Journals (Sweden)
Rugimar Marcovistz
1996-12-01
Full Text Available O vírus rábico RV194-2, uma variante avirulenta da cepa CVS (Challenge Vírus Standard, produz uma infecção inaparente quando inoculado intracerebralmente em camundongos adultos. Sugerindo que a resposta imunológica do hospedeiro permite a eliminação do vírus do sistema nervoso central. Por esta razão foram estudadas a indução de interferon e a resposta imune humoral em camundongos BALB/c inoculados com vírus RV194-2. Durante a infecção, estes camundongos apresentaram elevados níveis de interferon no plasma e no cérebro com altos títulos de anticorpos neutralizantes anti-rábicos. A 2-5A sintetase. um marcador da ação dos interferons,foi também analisada no cérebro destes animais. Sua atividade, aumentou, paralelamente, á produção de interferon, demonstrando que este interferon é bioquímicamente ativo. O vírus RV194-2 também induziu, 45 dias após sua inoculação, proteção aos animais quando desafiados com a cepa virulenta CVS. Estes resultados demonstram que a cepa RV194-2possui um alto nível imunogênico.RV194-2 rabies virus, an avirulent mutant of CVS strain, induces an inapparent infection limited to the central nervous system (CNS in adult mice inoculated intracerebrally. This fact suggest that immune response of the host is able to eliminate the virus in CNS. For this reason, we have studied the induction of interferon and the humoral immune responses in BALB/c mice after RV194-2 inoculation. These mice presented high levels of interferon in the plasma and in the brain, with elevated levels of neutralizing antirabies antibodies. The 2-5A synthetase, an enzyme marker of interferon action, was analyzed in the brain of inoculated animals. Its enhancement in parallel to the interferon production in the brain, showed biochemical evidence that this interferon is active. Forty five days after RV194-2 virus inoculation, mice were protected against a challenge with the CVS virulent strain. The results presented
Directory of Open Access Journals (Sweden)
Koh Eunhee
2007-07-01
Full Text Available Abstract Background EstE1 is a hyperthermophilic esterase belonging to the hormone-sensitive lipase family and was originally isolated by functional screening of a metagenomic library constructed from a thermal environmental sample. Dimers and oligomers may have been evolutionally selected in thermophiles because intersubunit interactions can confer thermostability on the proteins. The molecular mechanisms of thermostabilization of this extremely thermostable esterase are not well understood due to the lack of structural information. Results Here we report for the first time the 2.1-Å resolution crystal structure of EstE1. The three-dimensional structure of EstE1 exhibits a classic α/β hydrolase fold with a central parallel-stranded beta sheet surrounded by alpha helices on both sides. The residues Ser154, Asp251, and His281 form the catalytic triad motif commonly found in other α/β hydrolases. EstE1 exists as a dimer that is formed by hydrophobic interactions and salt bridges. Circular dichroism spectroscopy and heat inactivation kinetic analysis of EstE1 mutants, which were generated by structure-based site-directed mutagenesis of amino acid residues participating in EstE1 dimerization, revealed that hydrophobic interactions through Val274 and Phe276 on the β8 strand of each monomer play a major role in the dimerization of EstE1. In contrast, the intermolecular salt bridges contribute less significantly to the dimerization and thermostability of EstE1. Conclusion Our results suggest that intermolecular hydrophobic interactions are essential for the hyperthermostability of EstE1. The molecular mechanism that allows EstE1 to endure high temperature will provide guideline for rational design of a thermostable esterase/lipase using the lipolytic enzymes showing structural similarity to EstE1.
Lifescience Database Archive (English)
Full Text Available me 1 OS=Physcomitrella patens GN=P... 236 6e-62 sp|P33529|PHY_MOUSC Phytochrome OS=Mougeotia scalaris GN=PHY...>sp|P33529|PHY_MOUSC Phytochrome OS=Mougeotia scalaris GN=PHY PE=2 SV=2 Length = 1124 Score = 216 bits (551)...t) OS=Pinus sylvest... 229 9e-59 tr|Q3V8G6|Q3V8G6_MOUSC Phytochrome OS=Mougeotia scala
Trimming and clustering sugarcane ESTs
Directory of Open Access Journals (Sweden)
Guilherme P. Telles
2001-12-01
Full Text Available The original clustering procedure adopted in the Sugarcane Expressed Sequence Tag project (SUCEST had many problems, for instance too many clusters, the presence of ribosomal sequences, etc. We therefore redesigned the clustering procedure entirely, including a much more careful initial trimming of the reads. In this paper the new trimming and clustering strategies are described in detail and we give the new official figures for the project, 237,954 expressed sequence tags and 43,141 clusters.O método de clustering adotado no Projeto SUCEST (Sugarcane EST Project tinha vários problemas (muitos clusters, presença de seqüências de ribossomo etc. Nós assumimos a tarefa de reprojetar todo o processo de clustering, propondo uma "limpeza" inicial mais cuidadosa das seqüências. Neste artigo as estratégias de limpeza das seqüências e de clustering são descritas em detalhe, incluindo os números oficiais do projeto (237,954 ESTs e 43,141 clusters.
International Nuclear Information System (INIS)
Zadrazil, J.; Cvan, M.; Strimelsky, V.
1987-01-01
The TEP 1 program is used for automated evaluation of the technical and economic parameters of nuclear power plant units with WWER-440 reactors. This is an application program developed by the Research Institute for Nuclear Power Plants in Jaslovske Bohunice for the KOMPLEX-URAN 2M information system, delivered by the USSR to the V-2 nuclear power plants in Jaslovske Bohunice and in Dukovany. The TEP 1 program is written in FORTRAN IV and its operation has two parts. First the evaluation of technical and economic parameters of operation for a calculation interval of 10 mins and second, the control of the calculation procedure, follow-up on input data, determination of technical and economic parameters for a lengthy time interval, and data printout and storage. The TEP 1 program was tested at the first unit of the V-2 power plant and no serious faults appeared in the process of the evaluation of technical and economic parameters. A modification of the TEP 1 programme for the Dukovany nuclear power plant is now being tested on the first unit of the plant. (Z.M.)
Relatório de Estágio Curricular – Moveis Carlos Alfredo Barros da Silva, Lda (Rebordosa/Gandra)
Pimenta, Rita
2013-01-01
O estágio teve início no dia 17 de Junho e terminou a 9 de Agosto. Decorreu na empresa Moveis Carlos Alfredo. LDA, Wewood. Foram realizados vários trabalhos, alguns deles realizados em simultâneo. O primeiro trabalho consistia na modelação de duas mesas de jantar, o segundo consistiu na modelação de varias peças, a pedido de vários clientes individuais, enquanto desenvolvia este, tinha em mãos também a modelação 2D de algumas peças da empresa. O quarto trabalho consistia na conceção de ...
Energy Technology Data Exchange (ETDEWEB)
Stubna, M.; Michal, V., E-mail: Marian.Stubna@vuje.sk, E-mail: V.Michal@iaea.org [VUJE, Inc. Trnava (Slovakia); Daniska, V., E-mail: Daniska@decom.sk [DECOM, Inc. Trnava (Slovakia); Sirota, J., E-mail: Sirota.Jan@javys.sk [JAVYS, Inc. Bratislava, (Slovakia)
2013-08-15
This contribution deals with planning, management and organizational aspects of decommissioning of NPP shut down due to the accident (prototype NPP A1) and NPP shut down after normal operation (NPP V1). The A1 and V1 NPPs are located very close in Bohunice nuclear site however both plants have very different technology and operational history. The preparation of A1 NPP decommissioning strategy and relevant decommissioning plans was long term process, because the plant was shut down after the accident in 1977 and decommissioning was implemented first time in Slovakia with many specific difficulties. The decommissioning planning of V1 NPP was shorter and easier, because the plant was shut down after normal operation, there were lessons learned from the A1 NPP decommissioning planning, available legislation, available financing etc. Development of decommissioning strategies, preparation and planning for decommissioning, development of legislation for decommissioning, management of decommissioning projects and other aspects are described and compared. Lessons learned are formulated on the basis of analysis of past, ongoing and planned decommissioning activities in Slovakia. (author)
International Nuclear Information System (INIS)
1993-01-01
This Report of the IAEA Assessment of Safety Significant Events Team (ASSET) presents the results of the team's review of the status of implementation of the recommendations made by the 1988 ASSET mission to Bohunice nuclear power plant in Slovakia, and of progress made by plant management in prevention of incidents. The findings, conclusions and suggestions presented herein reflect the views of the ASSET experts. They are provided for consideration by the responsible Slovakian authorities. The ASSET team's views presented in this report are based on review of the documentation made available and on the discussions with plant staff. The report includes the official response of the operating and regulatory organizations of Slovakia to the ASSET findings and conclusions. Figs, tabs
Lifescience Database Archive (English)
Full Text Available 9VIRU L protein OS=Lymphocytic choriomeningitis... 33 10.0 >tr|Q672V4|Q672V4_ASPFL Monooxygenase OS=Aspergil...N 162 >tr|A2SUM3|A2SUM3_9VIRU L protein OS=Lymphocytic choriomeningitis virus GN=L PE=4 SV=1 Length = 2209 S...: 261 LSLGKWLKPVGNKGVRAAVTPSGQAIALVEEKG-KRASSVFVARPAGMD 308 >sp|P14240|L_LYCVA RNA-directed RNA polymerase OS=Lymphocytic choriomenin...gitis virus (strain Armstrong) GN=L PE=1 SV=1 Length = 2210 Score = 30.8 bits (68),
Management of the Bohunice RPVs annealing procedures
International Nuclear Information System (INIS)
Repka, M.
1994-01-01
The program of annealing regeneration procedure of RPVs units 1 and 2 of NPP V-1 (EBO) realization in the year 1993, is the topic of this paper. In the paper the following steps are described in detail: the preparation works, the annealing procedure realization schedule and safety management: starting with zero conditions, assembling of annealing apparatus, annealing procedure, cooling down and disassembling procedure of annealing apparatus. At the end the programs of annealing of both RPVs including the dosimetry measurements are discussed and evaluated. (author). 3 figs
Assessment of spent WWER-440 fuel performance under long-term storage conditions
Energy Technology Data Exchange (ETDEWEB)
Kupca, L [VUJE Inc. (Slovakia)
2012-07-01
In the Slovak Republic are under operation 6 units (4 in the Jaslovske Bohunice site, and 2 in the Mochovce), 2 units are under construction in Mochovce site. All units are WWER-440 type. The fresh fuel is imported from the Russian Federation. The spent fuel assemblies are stored in wet conditions in Bohunice Interim Storage Spent Fuel Facility (SFIS). By 15 July 2008, there were 8413 assemblies in SFIS. The objectives are: 1) Wet AR storage of spent fuel from the NPP Bohunice and Mochovce: Surveillance of conditions for spent fuel storage in the at-reactor (AR) storage pools of both NPP's (characteristics of pool water, corrosion product data); Visual control of storage pool components; Evaluation of storage conditions with respect to long-term stability (corrosion of fuel cladding, structural materials); 2) Wet SFIS storage at Bohunice: Measurement of spent fuel conditions during the long-term wet storage, activity data in the storage casks and amount of crud; Surveillance program for SFIS structural materials.
International Nuclear Information System (INIS)
Kuruc, J.; Kvito, P.
2005-01-01
Fibre-reinforced concrete container (FRCC) are used for long-time repository of radioactive wastes. Low- and middle-active radwastes from operation of the NPPs V-1, V-2 Jaslovske Bohunice, Mochovce NPP and from decommissioned NPP A-1 (Jaslovske Bohunice) are treated in the plant SE-VYZ in Jaslovske Bohunice and after immobilisation are deposited in National Radwaste Repository Mochovce (RU RAO). After filling of the RU RAO, FRCC will be stored during 300 years. During this time the integrity of the FRCC must be guaranteed. By the influence of autoradiolysis of the cellulose and bituminized radwastes as well as in cement grout the gases are formed, mainly the hydrogen, methane and carbon dioxide. In the case of presence of available water (a w ≥ 0.63) and in presence of microbes and moulds at appropriate conditions the biological decomposition of cellulose materials may proceed with formation of H 2 , CH 4 a CO 2 . With increasing of developed gases may increase pressure in FRCC, that may initiate the loss of integrity of the FRCC with following endangering of radiation safety of the RU RAO, respectively of the territory over the repository.Authors developed the new mathematical model of pressure of gases in FRCC and in deposited barrels with cellulose and bituminized radwastes. The mathematical model is based on biological decomposition of cellulose materials as well as on radiation decomposition of cellulose, bitumen and concrete. In this mathematical model the diffusion through the walls of FRCC is the main process responsible for decreasing of the pressure. This model was developed in two basic variants: (1) Mathematical model of gas pressure in FRCC as function of dose; (2) Mathematical model of gas pressure in FRCC as function of mass of cellulose
International Nuclear Information System (INIS)
2009-01-01
In this leaflet the results of monitoring of chemical gaseous and liquid effluents into the rivers Vah and Dudvah as well as of radiation monitoring of Bohunice V1 NPP and Bohunice Radioactive Waste Processing Centre (MSVP) are presented. The radioactive effluents into atmosphere within January - January 2009 (for NPP V1, A1, and MSVP, respectively) were: 0.470 TBq (0.024% of annually limit (AL)) for V1 of rare gases; 0.437 MBq (0.001% AL) for V1), 0.531 MBq (0.06% of AL) for A1 and 0.011 MBq (0.004% of AL) for MSVP) of aero-soles; 4.024 MBq (0.006% of AL) for V1) of iodine. The radioactive effluents into atmosphere and hydrosphere within a January 2009 for NPP V1, A1 and MSVP, respectively) were: 0.470 TBq (V1) of rare gases; 0.437 MBq (V1), 0.531 MBq (A1) and 0.011 MBq (MSVP) of aero-soles; 4.024 MBq (V1) of iodine; 1.358 MBq (V1) and 2.68 MBq (A1 and MSVP, totally) of corrosive and fission products, and 124.4 GBq (V1) and 13.12 GBq (A1 and MSVP, totally) of tritium. For the period January - January 2009 these radioactive effluents into recipient of Vah River represent for corrosive and fission products 1.358 MBq (0.010% of AL) for V1, 2.66 MBq (0.02% of AL) for A1; and for tritium it is 124.4 GBq (0.622% of AL) for V1, 13.12 GBq (0.13% of AL) for A1. Chemical effluents are reported, too
International Electrotechnical Commission. Geneva
2005-01-01
Power cables with extruded insulation and their accessories for rated voltages from 1 kV (Um = 1,2 kV) up to 30 kV (Um = 36 kV) : Part 2: cables for rated voltages from 6 kV (Um = 7,2 kV) up to 30 kV (Um = 36 kV)
Lifescience Database Archive (English)
Full Text Available Large structural protein OS=Zaire ebolavirus (strain Mayinga-76) Align length 64 Score (bit) 34.3 E-value 0... sp|Q05318|L_EBOZM Large structural protein OS=Zaire ebolavirus (... 34 0.56 sp|P... kinase receptor Tie-1 OS=B... 32 2.1 sp|Q6V1Q2|L_EBOZ5 Large structural protein OS=Zaire ebolavirus (... 32...N=H... 30 8.1 >sp|Q05318|L_EBOZM Large structural protein OS=Zaire ebolavirus (strain Mayinga-76) GN=L PE=3 ...|Q6V1Q2|L_EBOZ5 Large structural protein OS=Zaire ebolavirus (strain Kikwit-95) GN=L PE=3 SV=1 Length = 2212
Lifescience Database Archive (English)
Full Text Available List Contact us AcEST AcEST(EST sequences of Adiantum capillus-veneris and their annotation) Data detail Dat...a name AcEST(EST sequences of Adiantum capillus-veneris and their annotation) DOI 10.18908/lsdba.nbdc00839-0...01 Description of data contents EST sequence of Adiantum capillus-veneris and its annotation (clone ID, libr...le search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acest#en Data acquisition method Capillary ...ainst UniProtKB/Swiss-Prot and UniProtKB/TrEMBL databases) Number of data entries Adiantum capillus-veneris
Neuronal responses in visual area V2 (V2) of macaque monkeys with strabismic amblyopia.
Bi, H; Zhang, B; Tao, X; Harwerth, R S; Smith, E L; Chino, Y M
2011-09-01
Amblyopia, a developmental disorder of spatial vision, is thought to result from a cascade of cortical deficits over several processing stages beginning at the primary visual cortex (V1). However, beyond V1, little is known about how cortical development limits the visual performance of amblyopic primates. We quantitatively analyzed the monocular and binocular responses of V1 and V2 neurons in a group of strabismic monkeys exhibiting varying depths of amblyopia. Unlike in V1, the relative effectiveness of the affected eye to drive V2 neurons was drastically reduced in the amblyopic monkeys. The spatial resolution and the orientation bias of V2, but not V1, neurons were subnormal for the affected eyes. Binocular suppression was robust in both cortical areas, and the magnitude of suppression in individual monkeys was correlated with the depth of their amblyopia. These results suggest that the reduced functional connections beyond V1 and the subnormal spatial filter properties of V2 neurons might have substantially limited the sensitivity of the amblyopic eyes and that interocular suppression was likely to have played a key role in the observed alterations of V2 responses and the emergence of amblyopia.
Directory of Open Access Journals (Sweden)
Dalong Guo
2016-03-01
Full Text Available Due to the intermittent nature, renewable energy sources (RES has brought new challenges on load balancing and energy dispatching to the Smart Grid. Potentially served as distributed energy storage, Electric Vehicle’s (EV battery can be used as a way to help mitigate the pressure of fluctuation brought by RES and reinforce the stability of power systems. This paper gives a comprehensive review of the current situation of EV technology and mainly emphasizing three EV discharging operations which are Vehicle to Grid (V2G, Vehicle to Home (V2H, and Vehicle to Building (V2B, respectively. When needed, EV’s battery can discharge and send its surplus energy back to power grid, residential homes, or buildings. Based on our data analysis, we argue that V2G with the largest transmission power losses is potentially less efficient compared with the other two modes. We show that the residential users have the incentive to schedule the charging, V2G, and V2H according to the real-time price (RTP and the market sell-back price. In addition, we discuss some challenges and potential risks resulting from EVs’ fast growth. Finally we propose some suggestions on future power systems and also argue that some incentives or rewards need to be provided to motivate EV owners to behave in the best interests of the overall power systems.
International Nuclear Information System (INIS)
Slavik, O.; Kucharova, D.; Listjak, M.; Fueloep, M.
2008-01-01
The aim of this paper is to evaluate maximal dose rate (DR) of gamma radiation above different configurations of reservoirs with spent nuclear fuel with cooling period 1.8 year and to compare by buildup factor method (Visiplan) and Monte Carlo simulations and to appreciate influence of scattered photons in the case of calculation of fully filled fuel transfer storage (FTS). On the ground of performed accounts it was shown, that relative contributions of photons from adjacent reservoirs are in the case buildup factor method (Visiplan) similar to Monte Carlo simulations. It means, that Visiplan can be used also for valuation of contributions of of dose rates from neighbouring reservoirs. It was shown, that calculations of DR by Visiplan are conservatively overestimated for this source of radiation and thickness of shielding approximately 2.6 - 3 times. Also following these calculations resulted, that by storage of reservoirs with cooling period 1.8 years in FTS is not needed any additional protection measures for workers against primal safety report. Calculated DR also above fully filled FTS by these reservoirs in Jaslovske Bohunice is very low on the level 0.03 μSv/h. (authors)
International Nuclear Information System (INIS)
Slavik, O.; Kucharova, D.; Listjak, M.; Fueloep, M.
2009-01-01
The aim of this paper is to evaluate maximal dose rate (DR) of gamma radiation above different configurations of reservoirs with spent nuclear fuel with cooling period 1.8 year and to compare by buildup factor method (Visiplan) and Monte Carlo simulations and to appreciate influence of scattered photons in the case of calculation of fully filled fuel transfer storage (FTS). On the ground of performed accounts it was shown, that relative contributions of photons from adjacent reservoirs are in the case buildup factor method (Visiplan) similar to Monte Carlo simulations. It means, that Visiplan can be used also for valuation of contributions of of dose rates from neighbouring reservoirs. It was shown, that calculations of DR by Visiplan are conservatively overestimated for this source of radiation and thickness of shielding approximately 2.6 - 3 times. Also following these calculations resulted, that by storage of reservoirs with cooling period 1.8 years in FTS is not needed any additional protection measures for workers against primal safety report. Calculated DR also above fully filled FTS by these reservoirs in Jaslovske Bohunice is very low on the level 0.03 μSv/h. (authors)
Lifescience Database Archive (English)
Full Text Available LN_BFV Non-structural polyprotein OS=Barmah forest v... 32 3.2 sp|Q02910|CPN_DROME Calphotin OS=Drosophila m...SDITIADLTGTG 306 >sp|P87515|POLN_BFV Non-structural polyprotein OS=Barmah forest virus PE=2 SV=2 Length = 24
Lifescience Database Archive (English)
Full Text Available lodeaminase y4tK OS=Rhiz... 32 2.6 sp|P87515|POLN_BFV Non-structural polyprotein OS=Barmah forest v... 32 2....EVIAGVKTGRTRESDITIADLTGTG 306 >sp|P87515|POLN_BFV Non-structural polyprotein OS=Barmah forest virus PE=2 SV=
International Nuclear Information System (INIS)
Nam, Ki Hyun; Park, Sung Ha; Lee, Won Ho; Hwang, Kwang Yeon
2010-01-01
Hormone sensitive lipase (HSL) plays a major role in energy homeostasis and lipid metabolism. Several crystal structures of HSL-homolog proteins have been identified, which has led to a better understanding of its molecular function. HSLhomolog proteins exit as both monomer and dimer, but the biochemical and structural basis for such oligomeric states has not been successfully elucidated. Therefore, we determined the crystal structure of HSL-homolog protein EstE7 from a metagenome library at 2.2 A resolution and characterized the oligomeric states of EstE7 both structurally and biochemically. EstE7 protein prefers the dimeric state in solution, which is supported by its higher enzymatic activity in the dimeric state. In the crystal form, EstE7 protein shows two-types of dimeric interface. Specifically, dimerization via the external β8-strand occurred through tight association between two pseudosymmetric folds via salt bridges, hydrogen bonds and van der Waals interactions. This dimer formation was similar to that of other HSL-homolog protein structures such as AFEST, BEFA, and EstE1. We anticipate that our results will provide insight into the oligomeric state of HSLhomolog proteins
Morfologia do estômago e do duodeno da paca (Cuniculus paca Linnaeus, 1766
Directory of Open Access Journals (Sweden)
M.R.F. Machado
2015-12-01
Full Text Available Considerando a importância da paca (Cuniculus paca, Linnaeus, 1766, tanto como fonte proteica alternativa para a população quanto pela possibilidade de vir a se tornar um animal de experimentação e pela falta de informações sobre a sua anatomia, objetivou-se descrever a morfologia macroscópica e histológica do estômago e do duodeno desse roedor, reconhecendo as relações, forma e posição que esses órgãos estabelecem entre si e com outros órgãos. O estômago da paca é unicavitário, está no plano médio mais voltado para o antímero esquerdo, transversalmente, na região hipocôndrica em posição ventrocaudal, interposto entre o esôfago e o duodeno. O duodeno da paca se inicia em sequência ao estômago, segue caudalmente até o nível da quinta ou sexta vértebra lombar, na altura das quais se curva e toma direção cranial, dirigindo-se até o nível da transição entre a última vértebra torácica e a primeira vértebra lombar, onde se continua como jejuno. Histologicamente, o estômago e o duodeno da paca possuem o padrão característico da arquitetura dos órgãos ocos, apresentando as seguintes túnicas: mucosa, submucosa, muscular e serosa. Da forma que se conduziu este estudo, conclui-se que o estômago e duodeno da paca, de forma geral, possuem características morfológicas macroscópicas e histológicas semelhantes às dos animais domésticos e de outros roedores selvagens.
Evaluation of doses during the handling and transport of radioactive wastes containers
International Nuclear Information System (INIS)
Kubik, I.; Kusovska, Z.; Hanusik, V.; Mrskova, A.; Kapisovsky, V.
2000-01-01
Radioactive waste products from the nuclear power plants (NPPs) must be isolated from contact with people for very long period of time. Low and intermediate-level waste will be disposed of in Slovakia in specially licensed Regional disposal facility which is located near the NPP Mochovce site. Radioactive waste accumulated in the Jaslovsk. Bohunice site, during the decommissioning process of the NPP A-1 and arising from the NPP V-1 and NPP V-2 operation, will be processed and shipped in standard concrete containers to the Mochovce Regional disposal facility. The treatment centre was build at the NPP Jaslovsk? Bohunice site which is in the trial operation now. It is supposed that radioactive waste containers will be transported by train from the treatment centre Jaslovsk? Bohunice to the site of Radioactive Waste Repository at Mochovce and by truck in the area of repository. To estimate the occupational radiation exposure during the transport the calculations of dose rates from the containers are necessary. The national regulations allow low level of radiation to emanate from the casks and containers. The maximum permissible volume radioactivity of wastes inside the container is limited in such a way that irradiation level should not exceed 2 mGy/h for the contact irradiation level and 0,1 mGy/h at 2-meter distance. MicroShield code was used to analyse shielding and assessing exposure from gamma radiation of containers to people. A radioactive source was conservatively modelled by homogenous mixture of radionuclides with concrete. Standard rectangular volume source and shield geometry is used in model calculations. The activities of the personnel during the transport and storage of containers are analysed and results of the evaluation of external dose rates and effective doses are described. (author)
Directory of Open Access Journals (Sweden)
Yang Jun-Bo
2010-12-01
Full Text Available Abstract Background The castor bean (Ricinus communis L., a monotypic species in the spurge family (Euphorbiaceae, 2n = 20, is an important non-edible oilseed crop widely cultivated in tropical, sub-tropical and temperate countries for its high economic value. Because of the high level of ricinoleic acid (over 85% in its seed oil, the castor bean seed derivatives are often used in aviation oil, lubricants, nylon, dyes, inks, soaps, adhesive and biodiesel. Due to lack of efficient molecular markers, little is known about the population genetic diversity and the genetic relationships among castor bean germplasm. Efficient and robust molecular markers are increasingly needed for breeding and improving varieties in castor bean. The advent of modern genomics has produced large amounts of publicly available DNA sequence data. In particular, expressed sequence tags (ESTs provide valuable resources to develop gene-associated SSR markers. Results In total, 18,928 publicly available non-redundant castor bean EST sequences, representing approximately 17.03 Mb, were evaluated and 7732 SSR sites in 5,122 ESTs were identified by data mining. Castor bean exhibited considerably high frequency of EST-SSRs. We developed and characterized 118 polymorphic EST-SSR markers from 379 primer pairs flanking repeats by screening 24 castor bean samples collected from different countries. A total of 350 alleles were identified from 118 polymorphic SSR loci, ranging from 2-6 per locus (A with an average of 2.97. The EST-SSR markers developed displayed moderate gene diversity (He with an average of 0.41. Genetic relationships among 24 germplasms were investigated using the genotypes of 350 alleles, showing geographic pattern of genotypes across genetic diversity centers of castor bean. Conclusion Castor bean EST sequences exhibited considerably high frequency of SSR sites, and were rich resources for developing EST-SSR markers. These EST-SSR markers would be particularly
Chapter 9. Personnel qualification and training
International Nuclear Information System (INIS)
2001-01-01
The overall training system and the development of projects for training of all categories of NPP V-1, NPP V-2 Bohunice, SE-VYZ and NPP Mochovce staff were the subject of Nuclear Regulatory Authority of the Slovak Republic (UJD) attention. During 2000, the following inspections were carried out on nuclear personnel training: (a) NPP Bohunice: an inspection focused on compliance with requirements for staff qualifications and compliance with the prescribed training of Bohunice plant staff ; (b) NPP Mochovce: an inspection focused on compliance with the requirements for staff qualifications and compliance with the prescribed training of NPP Mochovce staff; an inspection focused on verifying the simulator aided training; an inspection focused on checking the preparedness of NPP Mochovce operation and technical personnel for NPP Mochovce Unit 2 operation; (c) Technology for treatment and conditioning of radioactive waste Bohunice (BSC): an inspection focused on compliance with the requirements for staff qualifications and compliance with the prescribed training of SE-VYZ staff; VUJE Trnava: verification of technical equipment and professional skills of VUJE Trnava staff and tasks arising out of the 'Authorisation on nuclear installation staff training'. Examinations of selected personnel were scheduled according to the plan of examining committee meetings. For each examined person written tests are generated by the computer from the database of test questions at the Training Centre of VUJE Trnava for individual positions - categories of selected staff of NPP V-1 and NPP V-2 Bohunice and NPP Mochovce so that the examination questions both in written and oral part equally cover individual facilities and regimes of operation of NPP. The database is continuously updated, thereby containing new questions resulting from the recent changes carried out at NPPs. A part of the examination in case of promotion to a higher position is the practical part, which is conducted under
Application of Moessbauer spectroscopy on corrosion products of NPP
Energy Technology Data Exchange (ETDEWEB)
Dekan, J., E-mail: julius.dekan@stuba.sk; Lipka, J.; Slugen, V. [Institute of Nuclear and Physical Engineering, Faculty of Electrical Engineering and Information Technology, SUT (Slovakia)
2013-04-15
Steam generator (SG) is generally one of the most important components at all nuclear power plants (NPP) with close impact to safe and long-term operation. Material degradation and corrosion/erosion processes are serious risks for long-term reliable operation. Steam generators of four VVER-440 units at nuclear power plants V-1 and V-2 in Jaslovske Bohunice (Slovakia) were gradually changed by new original 'Bohunice' design in period 1994-1998, in order to improve corrosion resistance of SGs. Corrosion processes before and after these design and material changes in Bohunice secondary circuit were studied using Moessbauer spectroscopy during last 25 years. Innovations in the feed water pipeline design as well as material composition improvements were evaluated positively. Moessbauer spectroscopy studies of phase composition of corrosion products were performed on real specimens scrapped from water pipelines or in form of filters deposits. Newest results in our long-term corrosion study confirm good operational experiences and suitable chemical regimes (reduction environment) which results mostly in creation of magnetite (on the level 70 % or higher) and small portions of hematite, goethite or hydrooxides. Regular observation of corrosion/erosion processes is essential for keeping NPP operation on high safety level. The output from performed material analyses influences the optimisation of operating chemical regimes and it can be used in optimisation of regimes at decontamination and passivation of pipelines or secondary circuit components. It can be concluded that a longer passivation time leads more to magnetite fraction in the corrosion products composition.
Lifescience Database Archive (English)
Full Text Available rome B OS=Nicotiana tabacum GN=PHYB ... 78 2e-21 sp|P33529|PHY_MOUSC Phytochrome OS=Mougeotia scalaris GN=PH...+EG+GLS+ +K++KLMN Sbjct: 1065 GEGLPPELVQDMFHSSRWVTKEGLGLSMCRKILKLMN 1101 >sp|P33529|PHY_MOUSC Phytochrome OS=Mougeotia scala...TVI Chromosome chr12 scaffold_47, whole genom... 73 9e-21 tr|Q3V8G6|Q3V8G6_MOUSC Phytochrome OS=Mougeotia scala
Evaluación estética de seis tipos de coronas para dientes primarios
Directory of Open Access Journals (Sweden)
Héctor Alejandro Ramírez Peña
2017-03-01
Full Text Available Objetivo: Evaluar las preferencias estéticas en relación con el color y la forma de coronas primarias utilizadas para dientes incisivos superiores primarios, mediante la realización de una encuesta a miembros de la Academia Mexicana de Odontología Pediatrica (AMOP. Material y Métodos: Se establecieron seis grupos de estudio con seis coronas diferentes: grupo 1, coronas de zirconia EZ-Pedo; grupo 2, coronas de zirconia NuSmile Zr; grupo 3, coronas estéticas hechas en el consultorio; grupo 4, coronas de fundas de celuloide; grupo 5, coronas estéticas prefabricadas NuSmile signature; y grupo 6, coronas estéticas fenestradas. Se llevaron a cabo encuestas con la finalidad de conocer las preferencias estéticas de estas diferentes coronas, con la finalidad de conocer cuál es la mejor opción para su uso en el consultorio dental. Resultados: Noventa miembros de la AMOP realizaron una encuesta válida, y se determinó que el grupo 4 fue el mejor evaluado, seguido de los grupos 2, 5, 1, 6 y 3. Se identificaron diferencias significativas entre los diferentes grupos. Conclusiones: Las coronas de fundas de celuloide fueron seleccionadas como mejor alternativa de uso en los dientes primarios anteriores, por parte de los miembros de la AMOP; asimismo, se consideró a las coronas de zirconia como una buena opción terapéutica. Es recomendable que se implemente el tratamiento estético en dientes primarios, para realizar un tratamiento integral.
International Nuclear Information System (INIS)
Ziman, V.; Alaxin, E.
1983-01-01
The theoretical education of personnel takes place in the branch training centre in Jaslovske Bohunice and in the concern training centre of the Slovak Power Plants. Practical training takes place in the Bohunice V-1 power plant. Selected specialists are trained in the training centre of the Novo Voronezh nuclear power plant, at the Paks nuclear plant and in the training centre of the Tusimice power plant. The recruitment, selection, schooling, practical training and placement of personnel and their assignment to posts is done in such a manner as to make sure that the complexly trained personnel is available 6 months to 3 years prior to the physical start-up of the nuclear power plant. The training of university graduates for the post of reactor operator takes 18 months or more. Trained personnel attend in-service training courses in form of complementary courses whose content includes such problems as the elimination of typified possible accidents, on the basis of the analysis of all failures which occurred in the previous period. The rising quality of personnel training at the Bohunice V-1 nuclear power plant is reflected in the decreasing number of failures caused by the human factor and in the increased availability of the power units. (M.D.)
Chen, Qi; Luan, Zheng-Jiao; Yu, Hui-Lei; Cheng, Xiaolin; Xu, Jian-He
2015-11-01
A new carboxylic esterase RhEst1 which catalyzes the hydrolysis of (S)-(+)-2,2-dimethylcyclopropanecarboxylate (S-DmCpCe), the key chiral building block of cilastatin, was identified and subsequently crystallized in our previous work. Mutant RhEst1A147I/V148F/G254A was found to show a 5-fold increase in the catalytic activity. In this work, molecular dynamic simulations were performed to elucidate the molecular determinant of the enzyme activity. Our simulations show that the substrate binds much more strongly in the A147I/V148F/G254A mutant than in wild type, with more hydrogen bonds formed between the substrate and the catalytic triad and the oxyanion hole. The OH group of the catalytic residue Ser101 in the mutant is better positioned to initiate the nucleophilic attack on S-DmCpCe. Interestingly, the "170-179" loop which is involved in shaping the catalytic sites and facilitating the product release shows remarkable dynamic differences in the two systems. Based on the simulation results, six residues were identified as potential "hot-spots" for further experimental testing. Consequently, the G126S and R133L mutants show higher catalytic efficiency as compared with the wild type. This work provides molecular-level insights into the substrate binding mechanism of carboxylic esterase RhEst1, facilitating future experimental efforts toward developing more efficient RhEst1 variants for industrial applications. Copyright © 2015 Elsevier Inc. All rights reserved.
Crowdsourcing-Assisted Radio Environment Database for V2V Communication
Directory of Open Access Journals (Sweden)
Keita Katagiri
2018-04-01
Full Text Available In order to realize reliable Vehicle-to-Vehicle (V2V communication systems for autonomous driving, the recognition of radio propagation becomes an important technology. However, in the current wireless distributed network systems, it is difficult to accurately estimate the radio propagation characteristics because of the locality of the radio propagation caused by surrounding buildings and geographical features. In this paper, we propose a measurement-based radio environment database for improving the accuracy of the radio environment estimation in the V2V communication systems. The database first gathers measurement datasets of the received signal strength indicator (RSSI related to the transmission/reception locations from V2V systems. By using the datasets, the average received power maps linked with transmitter and receiver locations are generated. We have performed measurement campaigns of V2V communications in the real environment to observe RSSI for the database construction. Our results show that the proposed method has higher accuracy of the radio propagation estimation than the conventional path loss model-based estimation.
Lifescience Database Archive (English)
Full Text Available |Q5U5V2|APPT_MOUSE Probable phosphotransferase LOC123688 homol... 30 7.1 sp|P89946|POLS_BFV Structural polyprotein OS=Barmah forest...>sp|P89946|POLS_BFV Structural polyprotein OS=Barmah forest virus PE=3 SV=2 Lengt
Directory of Open Access Journals (Sweden)
Fabio A. Digirolamo
2012-06-01
Full Text Available La vía TOR ("Target Of Rapamycin" de mamíferos es una red proteica de regulación para una amplia gama de procesos involucrados en el crecimiento y la diferenciación celular, constituyendo un interruptor funcional entre el metabolismo anabólico y catabólico de la célula. El Trypanosoma cruzi, agente etiológico de la enfermedad de Chagas, tiene un ciclo de vida muy complejo con diferentes estadios morfológicos en varios hospedadores. Este ciclo de vida implica que los parásitos enfrentan grandes fluctuaciones en el medio extracelular que deben ser detectadas y a las cuales deben responder adaptando su metabolismo. Un candidato a ser el mediador entre los receptores/sensores del medio y la respuesta adaptativa celular es la vía TOR. En este trabajo integramos los datos bibliográficos de la vía TOR de organismos tripanosomátidos con un análisis in silico (simulación computacional de procesos o estructuras biológicas del genoma del parásito. Se proponen además posibles efectores y procesos regulados por esta ruta metabólica. Teniendo en cuenta que existe muy poca información sobre los mecanismos de transducción de señales en tripanosomátidos, consideramos que el mapa presentado en este trabajo puede ser una referencia para futuros trabajos experimentales.
Relaciones de equivalencia con estímulos compuestos
Directory of Open Access Journals (Sweden)
Aldo Hernández, Sonia Céspedes, Leonardo Prieto
2007-03-01
Full Text Available El propósito de la presente investigación fue identificar las relaciones emergentes de entrenamientos entre estímulos muestra simples con estímulos de comparación compuestos. El estudio realizado corresponde a una investigación de tipo intrasujeto. Se contó con diez estudiantes universitarios, seis hombres y cuatro mujeres, con edades entre los 17 y 22 años de edad fueron escogidos por conveniencia y recibieron entrenamiento en discriminación condicional a través de tareas de igualación a la muestra arbitraria de tres elecciones por medio de un aplicativo en Visual Basic. En el primer y segundo bloque de entrenamiento se establecieron las relaciones condicionales entre estímulos muestra simples y estÌmulos de comparación compuestos (ej., A1-B1B1; A2-B2B2; A3-C3C3 y B1-C1C1; B2-C2C2; B3-C3C3 y se conformaron tres clases equivalentes de tres miembros cada una (ej., A1A1-B1B1-C1C1, asÌ como relaciones equivalencia-equivalencia (ej. A1A2- B1B2-C1C2. Cuatro de los diez participantes mostraron relaciones emergentes de simetrÌa, transitividad y equivalencia junto con relaciones equivalencia-equivalencia. Estos hallazgos indican que los entrenamientos entre estímulos simples y compuestos o viceversa producen relaciones emergentes propias de la equivalencia de estímulos.
International Nuclear Information System (INIS)
2006-01-01
During April 26-28, 2006 was carried out The 14 th Annual Nuclear Safety Information Meeting, NUSIM 2006. Scientific conference deals with problems of reactor safety upgrading, mainly of two blocks of the NPP V-1 Bohunice as well as decommissioning of the NPP A-1 Bohunice. Other problems of the nuclear engineering were discussed. The Conference proceeded in the following sessions: (I) Survey on the Situation of Nuclear Power in the Partner Countries; (II) Experiences with WWER operation. Almost 100 participants from the Slovak Republic, Austria, Serbia and Montenegro, Czech Republic and Germany took part in the conference. Thirty-three scientific lectures and three papers were presented.
International Nuclear Information System (INIS)
Zhu Hanneng; Chen Wenying; Xiong Sidong
2000-01-01
Telomerase is a ribonucleoprotein complex that adds heximeric repeats called telomeres to the growing ends of chromosomal DNA. Telomerase activity is present in a vast majority of tumors but is repressed in most normal tissues. Human telomerase catalytic subunit gene (hEST2) reverse transcriptase (RT) segment was cloned by PCR according to the sequence published in GeneBank. PCR was used to investigate the expression of the hEST2 RT segment in diverse tumors as well as in various normal tissues. Results indicated that hEST2 RT segment was detectable in tumor cells lines but not in normal cells and tissues. In order to identify the relationship between telomerase and the biological effect of radiation injury, HeLa cells, KB cells and A431 cells were employed to measure the change in telomerase activity after 60 Co-ray irradiation at RNA level and protein level. Quantitative PCR determined that expression of hEST2 RT segment that encodes seven motifs of the human telomeras decreased with increasing dosage of radiation. In addition, a PCR-based telomeric repeat amplification protocol was used to assay telomerase activity after exposure to radiation. The results strongly support the experiments we had made: Telomerase activity decreases with increasing dosage of radiation. We conclude that detection of the hEST2 RT segment by Northern blotting is a new method for detecting telomerase activity. Furthermore, radiation can cause a dose-dependent decrease in telomerase activity. The effect of radiation on telomerase is one possible reason for the death of cancer cells after irradiation. (author)
Beam Tracking in Switched-Beam Antenna System for V2V Communication
Directory of Open Access Journals (Sweden)
Settawit Poochaya
2016-01-01
Full Text Available This paper presents the proposed switched beam antenna system for V2V communication including optimum antenna half power beamwidth determination in urban road environments. SQP optimization method is selected for the computation of optimum antenna half power beamwidth. In addition, beam tracking algorithm is applied to guarantee the best beam selection with maximum RSSI. The results present the success of the proposed system with the increasing of V2V performance metrics. Also, V2V data dissemination via the proposed system introduces the enhancement of V2V link in terms of RSSI, PER, BER, Tsafe, and Rsafe. The results indicate the improvement of V2V link reliability. Consequently, the road safety is improved.
Lifescience Database Archive (English)
Full Text Available hiz... 32 3.1 sp|P87515|POLN_BFV Non-structural polyprotein OS=Barmah forest v... 32 3.1 sp|Q02910|CPN_DROME...G 306 >sp|P87515|POLN_BFV Non-structural polyprotein OS=Barmah forest virus PE=2 SV=2 Length = 2410 Score =
Congestion based mechanism for route discovery in a V2I-V2V system applying smart devices and IoT.
Parrado, Natalia; Donoso, Yezid
2015-03-31
The Internet of Things is a new paradigm in which objects in a specific context can be integrated into traditional communication networks to actively participate in solving a determined problem. The Vehicle-to-Vehicle (V2V) and Vehicle-to-Infrastructure (V2I) technologies are specific cases of IoT and key enablers for Intelligent Transportation Systems (ITS). V2V and V2I have been widely used to solve different problems associated with transportation in cities, in which the most important is traffic congestion. A high percentage of congestion is usually presented by the inappropriate use of resources in vehicular infrastructure. In addition, the integration of traffic congestion in decision making for vehicular traffic is a challenge due to its high dynamic behavior. In this paper, an optimization model over the load balancing in the congestion percentage of the streets is formulated. Later, we explore a fully congestion-oriented route discovery mechanism and we make a proposal on the communication infrastructure that should support it based on V2I and V2V communication. The mechanism is also compared with a modified Dijkstra's approach that reacts at congestion states. Finally, we compare the results of the efficiency of the vehicle's trip with the efficiency in the use of the capacity of the vehicular network.
Congestion Based Mechanism for Route Discovery in a V2I-V2V System Applying Smart Devices and IoT
Directory of Open Access Journals (Sweden)
Natalia Parrado
2015-03-01
Full Text Available The Internet of Things is a new paradigm in which objects in a specific context can be integrated into traditional communication networks to actively participate in solving a determined problem. The Vehicle-to-Vehicle (V2V and Vehicle-to-Infrastructure (V2I technologies are specific cases of IoT and key enablers for Intelligent Transportation Systems (ITS. V2V and V2I have been widely used to solve different problems associated with transportation in cities, in which the most important is traffic congestion. A high percentage of congestion is usually presented by the inappropriate use of resources in vehicular infrastructure. In addition, the integration of traffic congestion in decision making for vehicular traffic is a challenge due to its high dynamic behavior. In this paper, an optimization model over the load balancing in the congestion percentage of the streets is formulated. Later, we explore a fully congestion-oriented route discovery mechanism and we make a proposal on the communication infrastructure that should support it based on V2I and V2V communication. The mechanism is also compared with a modified Dijkstra’s approach that reacts at congestion states. Finally, we compare the results of the efficiency of the vehicle’s trip with the efficiency in the use of the capacity of the vehicular network.
A estética como factor promotor da aprendizagem
Directory of Open Access Journals (Sweden)
Fátima Maria BEZERRA BARBOSA
2012-02-01
Full Text Available La reflexión filosófica sobre el arte, lo hermoso, lo bueno, lo verdadero y su capacidad de promover el desarrollo humano es un tema que remonta a Platón en la cultura occidental. Considerando que la educación debe ser entendida como un fenómeno integral, que abarca no sólo las dimensiones intelectuales sino también las dimensiones sensibles, la intuición y el raciocinio, las capacidades imaginativas y creativas, el «saber ser» y el «saber estar» parejas del «conocer» y del «saber hacer», pensamos que es incuestionable la importancia de la estética en el fenómeno educativo. El objetivo de este trabajo es demostrar la importancia de la educación estética como motor fundamental de desarrollo humano y, en este sentido, como catalizador de la motivación y del aprendizaje, para que, a través de la imaginación y de la creatividad, sea posible la innovación en la construcción de vías alternativas para un mundo más humano y placentero.
2-minute Gridded Global Relief Data (ETOPO2) v2
National Oceanic and Atmospheric Administration, Department of Commerce — Two-minute gridded global relief for both ocean and land areas are available in the ETOPO2v2 (2006) database. ETOPO2v2 replaced ETOPO2 (2001). The historic 2-minute...
International Nuclear Information System (INIS)
2005-01-01
A brief account of activities carried out by the Vyskumny ustav energetickych zariadeni, a.s. (VUEZ) in 2004 is presented. These activities are reported under the headings: (1) Introductory address by the Chairman of the Board of Directors; (2) Mission and vision; (3) Basic data; (4) Product portfolio and customer services; (5) VUEZ - Quality policy; (6) Human resources; (7) Economic data; (8) Auditor's certificate; (8) Adving, s.r.o.; (9) Contact persons and addresses. In 2004, the decisive domestic market capacities of VUEZ were focused on its main business partner SE, a.s., particularly on the Jaslovske Bohunice NPP. VUEZ was one of the major contractors participating in investment projects such as the Upgrading of the Jaslovske Bohunice V2 NPP. In addition, sealing work and periodical integrated leakage rate tests in nuclear power plants were resumed. In the field of fossil-fuel power plants, a substantial increase in services provided by VUEZ Emission Measurement Laboratory was recorded. In the field of experimental research, another bilateral project was implemented with IRSN Paris - an extensive programme aimed at verifying the operational reliability of emergency core cooling systems for PWR reactors. In 2004, experimental tests in this field were performed also for Westinghouse. In the process of preparation for the Jaslovske Bohunice V1 NPP decommissioning, intensive work was performed for the Project Management Unit Consultant - an international consortium consisting of Electricite de France, Empresarios Agrupados Internacional S.A., Iberdrola Ingenieria y Consultoria S.A., and Soluziona Ingenieria S.A. In the field of leak-tightness improvement in nuclear power plants, work was executed in foreign plants such as the Dukovany NPP, Czech Republic, and the Paks NPP, Hungary. In the field of investment deliveries, hermetic doors designed for the RAW Repository in the Paks NPP were manufactured for and delivered to OLAJTERV R.t. Company, Budapest, Hungary
NPP Mochovce - a project of extraordinay significance
International Nuclear Information System (INIS)
Chwolik, I.; Debru, M.
2000-01-01
In this paper and in this presentation the reactor safety upgrading of two blocks of the NPP V-1 Bohunice, some results of participation on safety upgrading by the German-French consortium EUCOM (Framatome and Siemens-KWU) are presented. (author)
Energy Technology Data Exchange (ETDEWEB)
Longequeue, J P [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1958-07-15
The scintillation pair spectrometer is designed to allow the measurement of the energy of {gamma} rays in the range 2 to 20 MeV. Such an instrument is chosen because of its main features: high energy resolution and ease of working. Against this, however, the efficiency is low. It was possible to tolerate this low efficiency because of the facts that the {gamma}-rays studied emanated from (p, {gamma}) reactions and that the two electrostatic acceleration available could provide beams of 500 {mu}A having energy maxima at 300 and 600 keV. We used the {gamma} rays produced by the reactions {sup 23}Na (p, {gamma}) {sup 24}Mg, {sup 19}F (p, {alpha} {gamma}) {sup 16}O and {sup 7}Li (p, {gamma}) {sup 8}Be as well as the {gamma} rays emitted by sources of RTh and of {sup 24}Na. Under these conditions the spectrometer attained a resolving power of 6,5 {+-} 0,5 per cent at 6,1 MeV and it was able to separate the 14,8 and 17,6 MeV lines produced by the reaction {sup 7}Li (p, {gamma}) {sup 8}Be. As well as this, the efficiency which varied from 2.10{sup -4} to 1,7.10{sup -3} between 2 and 20 MeV was well above the efficiencies already obtained with this type of instrument. (author) [French] Le spectrometre a scintillations et a paires presente dans cette these a pour but de mesurer l'energie des rayonnements {gamma} dans la bande de 2 a 20 MeV. Le choix d'un tel appareil est du a ses caracteristiques essentielles: bonne resolution en energie et maniabilite. Par contre, son efficacite est faible. Nous avons pu tolerer cette faible efficacite car les rayonnements {gamma} que nous avons etudies provenaient de reactions (p, {gamma}) et les deux accelerateurs electrostatiques dont nous disposions pouvaient fournir des faisceaux de 500 {mu}A avec des energies maximum de 300 et 600 keV. Nous avons utilise les rayonnements {gamma} produits par les reactions {sup 23}Na (p, {gamma}) {sup 24}Mg, {sup 19}F (p, {alpha} {gamma}) {sup 16}O et {sup 7}Li (p, {gamma}) {sup 8}Be ainsi que les
DEFF Research Database (Denmark)
Vergara, Walter; Fenhann, Jørgen Villy; Schletz, Marco Christian
El objetivo del análisis presentado en este informe esidentificar una vía para la descarbonización completa de la economía regional de América Latina y el Caribe (ALC) para mediados de este siglo. Esto se logra a través de una revisión de acciones sectoriales específicas dentro de un contexto...... tecnológico y económico previsible. El análisis se lleva a cabo en un momento de considerable discusión del problema del cambio climático a nivel mundial y después de una década de notable progreso socioeconómico a nivel regional. En el informe también se discuten las principales barreras que tienen que ser...
International Nuclear Information System (INIS)
2009-01-01
In this leaflet the results of monitoring of chemical gaseous and liquid effluents into the rivers Vah and Dudvah as well as of radiation monitoring of Bohunice V1 NPP and Bohunice Radioactive Waste Processing Centre (MSVP) are presented. The radioactive effluents into atmosphere within January - December 2008 (for NPP V1, A1, and MSVP, respectively) were: 6.834 TBq (0.342% of annually limit (AL)) for V1 of rare gases; 19.956 MBq (0.025% AL) for V1), 18.56 MBq (1.97% of AL) for A1 and 0.545 MBq (0.18% of AL) for MSVP) of aero-soles; 16.754 MBq (0.026% of AL) for V1) of iodine. The radioactive effluents into atmosphere and hydrosphere within a December 2008 for NPP V1, A1 and MSVP, respectively) were: 0.844 TBq (V1) of rare gases; 0.998 MBq (V1), 14.68 MBq (A1) and 0.047 MBq (MSVP) of aero-soles; 0.229 MBq (V1) of iodine; 0.670 MBq (V1) and 7.46 MBq (A1 and MSVP, totally) of corrosive and fission products, and 52.9 GBq (V1) and 12.98 GBq (A1 and MSVP, totally) of tritium. For the period January - December 2008 these radioactive effluents into recipient of Vah River represent for corrosive and fission products 17.704 MBq (0.136% of AL) for V1, 113.23 MBq (0.94% of AL) for A1; and for tritium it is 4330.1 GBq (21.650% of AL) for V1, 212.37 GBq (2.12% of AL) for A1. Chemical effluents are reported, too
Lifescience Database Archive (English)
Full Text Available is GN=MGC... 96 1e-18 tr|Q4KLF0|Q4KLF0_XENLA MGC116435 protein OS=Xenopus laevis GN=MG... 96 1e-18 tr|Q6AZL1|Q6AZL1_XENTR Fink...8 tr|Q91V99|Q91V99_MOUSE Fau protein (Fragment) OS=Mus musculus GN... 95 3e-18 tr|Q642K5|Q642K5_MOUSE Finkel...-Biskis-Reilly murine sarcoma virus... 95 3e-18 tr|Q5BJN7|Q5BJN7_RAT Finkel-Biskis-Reilly murine sarcoma vir...... 95 3e-18 tr|Q56JV7|Q56JV7_BOVIN Ubiquitin-like/S30 ribosomal fusion prote... 95 3e-18 tr|Q3SZG2|Q3SZG2_BOVIN Fink
Lifescience Database Archive (English)
Full Text Available 496, wh... 35 3.3 tr|B3CJG2|B3CJG2_9VIRU RNA-dependent RNA polymerase OS=Lettuce v... 34 5.6 tr|Q48DX1|Q48DX...VIRU RNA-dependent RNA polymerase OS=Lettuce virus X GN=RdRp PE=4 SV=1 Length = 1708 Score = 34.3 bits (77),
Lifescience Database Archive (English)
Full Text Available 2 tr|Q4R1A7|Q4R1A7_PEDDU Plastocyanin OS=Pediastrum duplex GN=Pcy ... 75 2e-12 tr|B0JHN7|B0JHN7_MICAN Plasto... V+ Sbjct: 86 KGLAFSAGESFESTFSEPGTYTYYCEPHRGAGMVGTITVQ 125 >tr|Q4R1A7|Q4R1A7_PEDDU Plastocyanin OS=Pediastrum duplex
Lifescience Database Archive (English)
Full Text Available ZM Large structural protein OS=Zaire ebolavirus (... 33 1.2 sp|A2BN93|IF2A_HYPBU Translation initiation fact...1Q2|L_EBOZ5 Large structural protein OS=Zaire ebolavirus (... 32 2.7 sp|Q9SRX2|RL191_ARATH 60S ribosomal pro...structural protein OS=Zaire ebolavirus (strain Mayinga-76) GN=L PE=3 SV=2 Length = 2212 Score = 33.1 bits (7...QF 620 F Sbjct: 308 DF 309 >sp|Q6V1Q2|L_EBOZ5 Large structural protein OS=Zaire ebolavirus (strain Kikwit-95
Lifescience Database Archive (English)
Full Text Available rized cyclodeaminase y4tK OS=Rhiz... 32 3.2 sp|P87515|POLN_BFV Non-structural polyprotein OS=Barmah forest v...AFPELGEVIAGVKTGRTRESDITIADLTGTG 306 >sp|P87515|POLN_BFV Non-structural polyprotein OS=Barmah forest virus PE
Nuclear business worth billions begins
International Nuclear Information System (INIS)
Beer, G.; Marcan, P.; Slovak, K.
2005-01-01
The first V1 unit of Bohunice nuclear power station is to be shutdown by the end of next year. However, its decommissioning can only start in 2011 as before the decommissioning can start the second unit must be shutdown and the nuclear fuel to be stored in a basin must cool down. But in spite of these limitations, the decommissioning process has already started. Various analyses and projects have been put out to tender, work on the technical division of the decommissioned V1 units from the V2 units, which will remain in service, has also began. The state owned company, GovCo, a.s., will be in charge of the decommissioning of the V1 units. The method to be applied to the decommissioning of the V1 units has not yet been selected. The project management unit of Slovak Electric favours immediate decommissioning. 'Not only will decommissioning start immediately following the removal of the nuclear fuel, but it will also be done continuously,'explained unit director, Peter Hlbocky. Using this procedure, decommissioned could be complete by 2026. The question as to whether the power plant will be completely decommissioned to create a green field site will, according to P. Hlbocky, depend on Slovakia's future plans regarding nuclear energy generation at Jaslovske Bohunice, which could be a suitable location for building a new nuclear power station. In such a case, a part of the infrastructure would remain in place. 'Should Slovakia decide to continue its nuclear program, it would be a waste not to take advantage of the existing infrastructure,' said P. Hlbocky. The cabinet is to decide on the method to be used for decommissioning of the V1 reactor and the time frame for the process by the end of next year. The cabinet will decide mainly on the basis of cost estimates to be prepared together with decommissioning concept that is currently under preparation. The decommissioning concept financed by the Bohunice International Decommissioning Support Fund should provide more
DEFF Research Database (Denmark)
Vikner, Sten; Christensen, Ken Ramshøj; Nyvad, Anne Mette
2017-01-01
As in Nyvad et al. (2017), we will explore a particular derivation of (embedded) V2, in terms of a cP/CP-distinction, which may be seen as a version of the CP-recursion analysis (de Haan & Weerman 1986; Vikner 1995 and many others). e idea is that because embedded V2 clauses do not allow extraction......, whereas other types of CP-recursion clauses do (Christensen et al. 2013a; 2013b; Christensen & Nyvad 2014), CP-recursion in embedded V2 is assumed to be fundamentally di erent from other kinds of CP-recursion, in that main clause V2 and embedded V2 involve a CP (“big CP”), whereas other clausal...... projections above IP are instances of cP (“little cP”)....
SO2 and NO removal from flue gas over V2O5/AC at lower temperatures - role of V2O5 on SO2 removal
International Nuclear Information System (INIS)
Ma, Jianrong; Liu, Zhenyu; Liu, Qingya; Guo, Shijie; Huang, Zhanggen; Xiao, Yong
2008-01-01
Supporting V 2 O 5 onto an activated coke (AC) has been reported to significantly increase the AC's activity in simultaneous SO 2 and NO removal from flue gas. To understand the role of V 2 O 5 on SO 2 removal, V 2 O 5 /AC is studied through SO 2 removal reaction, surface analysis, X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS) and Fourier transform infrared (FTIR) techniques. It is found that the main role of V 2 O 5 in SO 2 removal over V 2 O 5 /AC is to catalyze SO 2 oxidation through a VOSO 4 -like intermediate species, which reacts with O 2 to form SO 3 and V 2 O 5 . The SO 3 formed transfers from the V sites to AC sites and then reacts with H 2 O to form H 2 SO 4 . At low V 2 O 5 loadings, a V atom is able to catalyze as many as 8 SO 2 molecules to SO 3 . At high V 2 O 5 loadings, however, the number of SO 2 molecules catalyzed by a V atom is much less, due possibly to excessive amounts of V 2 O 5 sites in comparison to the pores available for SO 3 and H 2 SO 4 storage. (author)
Lifescience Database Archive (English)
Full Text Available ves = 33/70 (47%), Gaps = 5/70 (7%) Frame = +1 Query: 442 APQLKPSDSQTVHLRPSAPPANEEQTATASAHSAP-----QLKPSAPS...0/60 (50%), Gaps = 1/60 (1%) Frame = +1 Query: 433 LPQAPQLKPSDSQTVHLRPSAPPA-NEEQTATASAHSAPQLKPSAPSANGEQTATAS...6%), Positives = 34/71 (47%), Gaps = 2/71 (2%) Frame = +1 Query: 433 LPQAPQLKPSDSQTVHLRPSAPPA-NEEQTATASAHSAPQLKPSAPS...= 28/56 (50%) Frame = +1 Query: 445 PQLKPSDSQTVHLRPSAPPANEEQTATASAHSAPQLKPSAPSANG...y: 436 PQAPQLKPSDS--QTV----HLRPSAPPANEEQTATASAHSAPQLKPSAPSANGEQT-AT 594 PQAPQ +P Q V ++PSAPP +Q A S P +P+ P
PCR-Based EST Mapping in Wheat (Triticum aestivum L.
Directory of Open Access Journals (Sweden)
J. PERRY GUSTAFSON
2009-04-01
Full Text Available Mapping expressed sequence tags (ESTs to hexaploid wheat is aimed to reveal the structure and function of the hexaploid wheat genome. Sixty eight ESTs representing 26 genes were mapped into all seven homologous chromosome groups of wheat (Triticum aestivum L using a polymerase chain reaction technique. The majority of the ESTs were mapped to homologous chromosome group 2, and the least were mapped to homologous chromosome group 6. Comparative analysis between the EST map from this study and the EST map based on RFLPs showed 14 genes that have been mapped by both approaches were mapped to the same arm of the same homologous chromosome, which indicated that using PCR-based ESTs was a reliable approach in mapping ESTs in hexaploid wheat.
Integration of V2H/V2G Hybrid System for Demand Response in Distribution Network
Energy Technology Data Exchange (ETDEWEB)
Wang, Yubo; Sheikh, Omar; Hu, Boyang; Chu, Chi-Cheng; Gadh, Rajit
2014-11-03
Integration of Electrical Vehicles (EVs) with power grid not only brings new challenges for load management, but also opportunities for distributed storage and generation in distribution network. With the introduction of Vehicle-to-Home (V2H) and Vehicle-to-Grid (V2G), EVs can help stabilize the operation of power grid. This paper proposed and implemented a hybrid V2H/V2G system with commercialized EVs, which is able to support both islanded AC/DC load and the power grid with one single platform. Standard industrial communication protocols are implemented for a seamless respond to remote Demand Respond (DR) signals. Simulation and implementation are carried out to validate the proposed design. Simulation and implementation results showed that the hybrid system is capable of support critical islanded DC/AC load and quickly respond to the remote DR signal for V2G within 1.5kW of power range.
Development of EST-derived markers in Dendrobium from EST of related taxa
Narisa Juejun; Chataporn Chunwongse; Julapark Chunwongse
2013-01-01
Public databases are useful for molecular marker development. The major aim of this study was to develop expressedsequence tag (EST)-derived markers in Dendrobium from available ESTs of Phalaenopsis and Dendrobium. A total of 6063sequences were screened for simple sequence repeats (SSRs) and introns. Primers flanking these regions were generated andtested on genomic DNAs of Phalaenopsis and Dendrobium. Twenty-three percent of amplifiable Phalaenopsis EST-derivedmarkers were cross-genera trans...
Lifescience Database Archive (English)
Full Text Available ... 33 1.1 sp|Q7TSF1|DSG1B_MOUSE Desmoglein-1-beta OS=Mus musculus GN=Dsg1b... 31... 30 7.4 sp|Q61495|DSG1A_MOUSE Desmoglein-1-alpha OS=Mus musculus GN=Dsg1... 30 7.4 sp|Q9SIB4|WOX3_ARATH WUSC...hia co... 30 9.6 sp|Q01550|TANA_XENLA Tanabin OS=Xenopus laevis PE=2 SV=1 30 9.6 sp|Q7TSF0|DSG1C_MOUSE Desmog...VAEYVTH 428 IVG WDE LP D V E+ E+V+H Sbjct: 322 IVGGNWDEVLPVDVRVPEEIQEFVSH 347 >sp|Q7TSF1|DSG1B_MOUSE Desmogl
Electrochemistry of V2ON with lithium
International Nuclear Information System (INIS)
Zhou Yongning; Liu Chang; Chen Huajun; Zhang Long; Li Wenjing; Fu Zhengwen
2011-01-01
Highlights: → We have prepared V 2 ON thin film by reactive dc sputtering method and annealing process. → We investigated for its electrochemistry with lithium. → V 2 ON thin films exhibit a large reversible specific capacity of 830 mAh g -1 with much less polarization than VN thin films. → The reversible transformation between nanocrystalline V 2 ON and well dispersed V, Li 2 O, Li 3 N nano-composites were revealed. - Abstract: V 2 ON thin film has been successfully fabricated by reactive dc sputtering method and annealing process and was investigated for its electrochemistry with lithium. The reversible discharge capacities of V 2 ON/Li cells cycled between 0.01 and 4.0 V were found in the range of 803-915 mAh g -1 during the first 50 cycles. By using ex situ scanning electron microscopy, transmission electron microscopy, selected-area electron diffraction and X-ray photoelectron spectroscopy measurements, the reversible transformation between nanocrystalline V 2 ON and well dispersed V, Li 2 O, Li 3 N nano-composites were revealed in the lithium electrochemical reaction. V 2 ON thin film exhibits high reversible capacity and good cycle performance with remarkable lower polarization than VN thin film.
A era MTV: análise da estética de videoclipe (1984- 2009)
Trevisan, Michele Kapp
2011-01-01
Uma das mais importantes evoluções registradas no reino da cena musical de massas foi o aparecimento do fenômeno videoclipe. Trata-se de um formato audiovisual que modificou a maneira de “ver” a musica. Porém, foi a emissora Music Television, criada na década de 80, que deu a este a devida importância, tornando-se referencia de uma estética. Assim, o presente trabalho objetiva analisar a estética de videoclipe durante a era MTV, a partir da observação dos vídeos premiados nas principais categ...
Directory of Open Access Journals (Sweden)
Thierry Roisnel
2012-07-01
Full Text Available The vanadium oxide arsenate with formula K2V2O2(AsO42, dipotassium divanadium(IV dioxide diarsenate, has been synthesized by solid-state reaction in an evacuated silica ampoule. Its structure is isotypic with K2V2O2(PO42. The framework is built up from corner-sharing VO6 octahedra and AsO4 tetrahedra, creating an infinite [VAsO8]∞ chain running along the a- and c-axis directions. The K+ cations are located in hexagonal tunnels, which are delimited by the connection of the [VAsO8]∞ chains.
Lifescience Database Archive (English)
Full Text Available erase A OS=Aspergillus tubingen... 50 1e-05 sp|P0C1S9|DGLB_RAT Sn1-specific diacy...|P47145|YJ77_YEAST Putative lipase YJR107W OS=Saccharomyces ce... 50 8e-06 sp|O42815|FAEA_ASPTU Feruloyl est
Lifescience Database Archive (English)
Full Text Available IC6|VGLG_LNYV Glycoprotein G OS=Lettuce necrotic yellows v... 29 9.4 sp|A6VMF8|MEND_ACTSZ 2-succinyl-5-enolp...SPQKVVIENSWAFRNGINY 259 Query: 218 WKD 210 W D Sbjct: 260 WND 262 >sp|Q9DIC6|VGLG_LNYV Glycoprotein G OS=Lettuce
Neuronal Responses in Visual Area V2 (V2) of Macaque Monkeys with Strabismic Amblyopia
Bi, H.; Zhang, B.; Tao, X.; Harwerth, R. S.; Smith, E. L.; Chino, Y. M.
2011-01-01
Amblyopia, a developmental disorder of spatial vision, is thought to result from a cascade of cortical deficits over several processing stages beginning at the primary visual cortex (V1). However, beyond V1, little is known about how cortical development limits the visual performance of amblyopic primates. We quantitatively analyzed the monocular and binocular responses of V1 and V2 neurons in a group of strabismic monkeys exhibiting varying depths of amblyopia. Unlike in V1, the relative eff...
Polycrystalline V2O5/Na0.33V2O5 electrode material for Li+ ion redox supercapacitor
International Nuclear Information System (INIS)
Manikandan, Ramu; Justin Raj, C.; Rajesh, Murugesan; Kim, Byung Chul; Park, Sang Yeup; Cho, Bo-Bae; Yu, Kook Hyun
2017-01-01
Highlights: • Different polycrystalline V 2 O 5 /Na 0.33 V 2 O 5 nanostructures were synthesized via simple co-precipitation technique. • The various molar ratios of NaOH precipitator determine the morphology, structural and electrochemical properties of V/Na. • The equimolar ratio of reactant and precipitator shows the formation of ∼96% of pure crystalline phase of V 2 O 5 . • Li + ions intercalation and deintercalation process enhanced the specific capacitance. - Abstract: This work essentially offers a new kind of V 2 O 5 /Na 0.33 V 2 O 5 as electrochemical active material for the development of Li + ion redox supercapacitors. Here, polycrystalline mixed phase of V 2 O 5 /Na 0.33 V 2 O 5 (V/Na) nanostructures are synthesized via simple co-precipitation technique. The various molar ratio of precipitator (NaOH) in the synthesis process displays different nanostructures of V/Na. The structural and morphological properties of V/Na samples are studied using physico-chemical analysis methods. The electrochemical properties of V/Na nanostructured samples are performed using cyclic voltammetry, galvanostatic charge/discharge test and electrochemical impedance spectroscopy techniques in 1 M LiClO 4 aqueous electrolyte. The sample V/Na synthesized using equimolar ratio of vanadium salt and precipitator displayed nanopellet morphology, which exhibited the highest capacitance value of 334 Fg −1 at 1 Ag −1 discharge current density. Moreover, these polycrystalline V/Na nanostructured electrodes show excellent electrochemical properties with comparable stability after 1000 charge/discharge cycles.
Directory of Open Access Journals (Sweden)
Cook Douglas R
2008-05-01
Full Text Available Abstract Background Vitis vinifera (V. vinifera is the primary grape species cultivated for wine production, with an industry valued annually in the billions of dollars worldwide. In order to sustain and increase grape production, it is necessary to understand the genetic makeup of grape species. Here we performed mRNA profiling using Massively Parallel Signature Sequencing (MPSS and combined it with available Expressed Sequence Tag (EST data. These tag-based technologies, which do not require a priori knowledge of genomic sequence, are well-suited for transcriptional profiling. The sequence depth of MPSS allowed us to capture and quantify almost all the transcripts at a specific stage in the development of the grape berry. Results The number and relative abundance of transcripts from stage II grape berries was defined using Massively Parallel Signature Sequencing (MPSS. A total of 2,635,293 17-base and 2,259,286 20-base signatures were obtained, representing at least 30,737 and 26,878 distinct sequences. The average normalized abundance per signature was ~49 TPM (Transcripts Per Million. Comparisons of the MPSS signatures with available Vitis species' ESTs and a unigene set demonstrated that 6,430 distinct contigs and 2,190 singletons have a perfect match to at least one MPSS signature. Among the matched sequences, ESTs were identified from tissues other than berries or from berries at different developmental stages. Additional MPSS signatures not matching to known grape ESTs can extend our knowledge of the V. vinifera transcriptome, particularly when these data are used to assist in annotation of whole genome sequences from Vitis vinifera. Conclusion The MPSS data presented here not only achieved a higher level of saturation than previous EST based analyses, but in doing so, expand the known set of transcripts of grape berries during the unique stage in development that immediately precedes the onset of ripening. The MPSS dataset also revealed
Non est hic. Le cas exemplaire de la protection du fugitif
Directory of Open Access Journals (Sweden)
Jean-Pierre Cavaillé
2007-06-01
Full Text Available Le cas dont je voudrais ici esquisser l’histoire et montrer quelques uns des enjeux, est surtout, sinon exclusivement connu, aujourd’hui encore, dans la version proposée par Benjamin Constant pour mettre en évidence une conséquence nécessaire et selon lui inacceptable de la morale kantienne. Constant en effet écrit, dans ces Réactions politiques, publiées en 1797 : Le principe moral […] que dire la vérité est un devoir, s’il était pris d’une manière absolue et isolée, rendrait toute société i...
Identification de Staphylococcus aureus : est-il possible de réduire ...
African Journals Online (AJOL)
SARAH
31 janv. 2014 ... influencer la recherche de la staphylocoagulase libre ? 6027. Identification de Staphylococcus aureus : est-il possible de réduire le volume de plasma de lapin sans influencer la recherche de la staphylocoagulase libre ? Bankolé H.S., Dougnon T.V., Fiogbé E.P., Amoussou A.N., Baba-Moussa L.
Internal flooding analyses results of Slovak NPPs
International Nuclear Information System (INIS)
Sopira, Vladimir
2000-01-01
The assessment of the flood risk was the objective of the internal flooding analysis for NPPs Bohunice V1, V2 and Mochovce. All important flooding sources were identified. The rooms containing safety important components were analyzed from the point of view of: Integrity of flood boundaries; Capability for drainage; Flood signalisation; Flood localization and liquidation; Vulnerability of safety system component. The redundancies of safety systems are located mostly separately and no flood can endanger more than single train. It can be concluded that NPPs with WWER-440 are very safe against the flooding initiating event
Directory of Open Access Journals (Sweden)
María Gladys Ceretta Soria
2002-01-01
Full Text Available El relacionamiento entre la biblioteca universitaria y la heterogenidad de sus usuarios (estudiantes, docentes, investigadores, graduados, ha sufrido grandes transformaciones como consecuencia del impacto provocado por las nuevas formas de comunicación y de acceso a la información, producto de los dinámicos avances tecnológicos. Frente a las tendencias que pronostican que la biblioteca universitaria ha dejado de tener sentido en un mundo en el que la información supera los límites físicos de una institución y en el cual el usuario se relaciona directa e individualmente con la información a través de la computadora, se promueve el rol fundamental de la biblioteca universitaria como mediadora de los procesos de enseñanza-aprendizaje y de apoyo a la investigación y a la generación de nuevo conocimiento. Se considera que una de las formas apropiadas para favorecer este rol es establecer canales de comunicación que fortalezcan el vínculo interactivo biblioteca-usuario a través de la consolidación institucional de instancias de orientación y formación de usuarios, destacándose el papel fundamental que en este proceso de relacionamiento desarrolla el profesional Bibliotecólogo. Se toma como punto de referencia la situación actual que al respecto presentan las Bibliotecas Universitarias en el Uruguay. Se establecen algunas pautas generales para el desarrollo de esta propuesta.
Lifescience Database Archive (English)
Full Text Available (strain Z) GN=P/V/C ... 35 0.35 sp|P69280|V_SENDH Protein V OS=Sendai virus (strain Harris...DLPCGQV 596 R D C ++ Sbjct: 372 MRPDPFCREI 381 >sp|P69280|V_SENDH Protein V OS=Sendai virus (strain Harris)
EST Express: PHP/MySQL based automated annotation of ESTs from expression libraries.
Smith, Robin P; Buchser, William J; Lemmon, Marcus B; Pardinas, Jose R; Bixby, John L; Lemmon, Vance P
2008-04-10
Several biological techniques result in the acquisition of functional sets of cDNAs that must be sequenced and analyzed. The emergence of redundant databases such as UniGene and centralized annotation engines such as Entrez Gene has allowed the development of software that can analyze a great number of sequences in a matter of seconds. We have developed "EST Express", a suite of analytical tools that identify and annotate ESTs originating from specific mRNA populations. The software consists of a user-friendly GUI powered by PHP and MySQL that allows for online collaboration between researchers and continuity with UniGene, Entrez Gene and RefSeq. Two key features of the software include a novel, simplified Entrez Gene parser and tools to manage cDNA library sequencing projects. We have tested the software on a large data set (2,016 samples) produced by subtractive hybridization. EST Express is an open-source, cross-platform web server application that imports sequences from cDNA libraries, such as those generated through subtractive hybridization or yeast two-hybrid screens. It then provides several layers of annotation based on Entrez Gene and RefSeq to allow the user to highlight useful genes and manage cDNA library projects.
EST Express: PHP/MySQL based automated annotation of ESTs from expression libraries
Directory of Open Access Journals (Sweden)
Pardinas Jose R
2008-04-01
Full Text Available Abstract Background Several biological techniques result in the acquisition of functional sets of cDNAs that must be sequenced and analyzed. The emergence of redundant databases such as UniGene and centralized annotation engines such as Entrez Gene has allowed the development of software that can analyze a great number of sequences in a matter of seconds. Results We have developed "EST Express", a suite of analytical tools that identify and annotate ESTs originating from specific mRNA populations. The software consists of a user-friendly GUI powered by PHP and MySQL that allows for online collaboration between researchers and continuity with UniGene, Entrez Gene and RefSeq. Two key features of the software include a novel, simplified Entrez Gene parser and tools to manage cDNA library sequencing projects. We have tested the software on a large data set (2,016 samples produced by subtractive hybridization. Conclusion EST Express is an open-source, cross-platform web server application that imports sequences from cDNA libraries, such as those generated through subtractive hybridization or yeast two-hybrid screens. It then provides several layers of annotation based on Entrez Gene and RefSeq to allow the user to highlight useful genes and manage cDNA library projects.
Estéticas no design de joias contemporâneas
Directory of Open Access Journals (Sweden)
Erika Yamamoto Lee
2015-06-01
Full Text Available O presente artigo refere-se à ação de produzir joias, na contemporaneidade, considerando o pensamento, o conhecimento e o sentimento do autor joalheiro. A história da joalheria e a da estética são relacionadas, ressaltando as mudanças sociológicas das principais rupturas escolásticas nas artes e na filosofia das formas. A atividade do designer de joias está atrelada aos estudos do mercado, da trajetória do belo, na sociedade, com o objetivo de encarnar na forma e sua essência no objeto estético. O conhecimento em profundidade sobre o belo e suas categorias estéticas seguem o seu tempo e mercado, permitindo ao designer liberar o caminho para o juízo crítico, a faculdade de pensar a forma, na fronteira entre teoria e prática, emoção e cálculo. A joia contemporânea reluz o belo, a técnica, a ideia, o imaginário. A estética contemporânea pondera a escassez de matéria-prima e os vários pensamentos que refletem na criação da forma. O conteúdo deste texto pincela brevemente a importância do conhecimento do designer no desenvolvimento de novas formas para atender às exigências do mercado.
Lifescience Database Archive (English)
Full Text Available nt DNA helicase recG OS=Helicoba... 32 2.5 sp|Q05318|L_EBOZM Large structural protein OS=Zaire ebolavirus (...... 32 2.5 sp|Q6V1Q2|L_EBOZ5 Large structural protein OS=Zaire ebolavirus (... 32 2.5 sp|Q5XX01|L_EBOSU Large... structural protein OS=Sudan ebolavirus (... 32 2.5 sp|Q66802|L_EBOSM Large structural protein OS=Sudan ebola...a (strain K... 31 3.3 sp|Q8JPX5|L_EBORR Large structural protein OS=Reston ebolav...irus ... 31 4.3 sp|Q91DD4|L_EBORE Large structural protein OS=Reston ebolavirus ... 31 4.3 sp|Q5WFS8|RS2_BAC
Report of influence on environment 2006
International Nuclear Information System (INIS)
2007-01-01
The joint stock company Jadrova a vyradovacia spolocnost, a. s. (JAVYS) has established in the Slovak power engineering industry just recently. According to transaction documents about privatisation of the joint stock company Slovenske elektrarne, a. s. (SE), on 6-th July 2005 there was established state-owned organisation GovCo from which VYZ plants and V1 power plant were separated. Since 1-st April 2006, the company GovCo assumed responsibility for JE V1 plant, decommissioning of nuclear facilities in Slovakia, processing, treatment and storage of radioactive waste and care for spent nuclear fuel. Seat of the company changed to operation from Jaslovske Bohunice and, on 7-th August, also the company's name changed to Jadrova vyradovacia spolocnost, a.s.. Since March 2007, the company's name is Jadrova a vyradovacia spolocnost, a. s. Starting position of the company in the Slovak power engineering sector developed from achieved results of long- term operation of plants of the company SE, a. s. - VYZ and EBO V1. Apart from operation of currently only one block of V1 nuclear power plant, the company carries out the first phase of the A1 nuclear power plant decommissioning project, operates radioactive waste processing centre in Bohunice (Bohunicke spracovatelske centrum radioaktivnych odpadov), bitumen and vitrification line of radioactive waste processing and fragmentation plant for metal radioactive waste. Currently, new facility - final processing of liquid radioactive waste in Mochovce is being put into operation. This chain is crowned by safe storage of processed low and medium-active waste in Republic's Repository of Radioactive Waste (Republikove ulozisko RAO) in Mochovce. The company also operates spent nuclear fuel in-process store in Jaslovske Bohunice, which is resistant to seismic activity and compacted. This Report contains the results of monitoring of the environment in JAVYS, a.s. in 2006
Strengthening of the nuclear safety regulatory body. Field evaluation review
International Nuclear Information System (INIS)
1996-10-01
As a result of a request from the Preparation Committee of the Nuclear Regulatory Authority (NRA) in 1992, and as recommended by the CEC/RAMG (Commission of European Communities/Regulatory Assistance Management Group) and the Agency mission in July 1993 to the Slovak Republic, the project SLR/9/005 was approved in 1993 as a model project for the period 1994-1996. Current budge is $401,340 and disbursements to date amount to $312,873. The project time schedule has been extended to 1997. The major conclusions of this evaluation are as follows: The project responded to an urgent national need, as well as to a statutory mandate of the Agency, and was adequately co-ordinated with other international assistance programmes to NRA. The project was designed as a structured programme of assistance by means of expert missions, scientific visits and a limited amount of equipment, acting upon several key areas of NRA regulatory responsibilities. Agency assistance was provided in a timely manner. A high concentration of expert missions was noticed at the initial stages of the project, which posed some managements problems. This was corrected to some extent in the course of implementation. Additionally, some overlapping of expert mission recommendations suggests that improvements are needed in the design of such missions. The exposure to international regulatory practice and expertise has resulted in substantial developments of NRA, both in organizational and operational terms. The project can claim to have contributed to NRA having gained governmental and international confidence. NRA's role in the safety assessment of Bohunice V1 reconstruction, as well as in Bohunice V2 safety review, Bohunice A1 decommissioning and in informing the public, also points at the success achieved by the project. The institutional and financial support of the Government contributed decisively to the project achievements. (author). Figs, tabs
Penny S. Lawson; R. Edward Thomas; Elizabeth S Walker
1996-01-01
OPTIGRAMI V2 is a computer program available for IBM persaonl computer with 80286 and higher processors. OPTIGRAMI V2 determines the least-cost lumber grade mix required to produce a given cutting order for clear parts from rough lumber of known grades in a crosscut-first rough mill operation. It is a user-friendly integrated application that includes optimization...
We should use nuclear power plants as good as possible
International Nuclear Information System (INIS)
Kaplanova, J.
2004-01-01
In this paper visit of Austrian journalist Christian Hunger (redactor of the Austrian broadcast OE1) on the Jaslovske Bohunice NPP and Mochovce NPP is described. Upgrade of the Jaslovske Bohunice NPP and finishing of a building of the Mochovce NPP as well as shut-down of the first and second blocks of the Jaslovske Bohunice NPP are discussed
Nuclear safety in Slovak Republic. Status of safety improvements
International Nuclear Information System (INIS)
Toth, A.
1999-01-01
Status of the safety improvements at Bohunice V-1 units concerning WWER-440/V-230 design upgrading were as follows: supplementing of steam generator super-emergency feed water system; higher capacity of emergency core cooling system; supplementing of automatic links between primary and secondary circuit systems; higher level of secondary system automation. The goal of the modernization program for Bohunice V-1 units WWER-440/V-230 was to increase nuclear safety to the level of the proposals and IAEA recommendations and to reach probability goals of the reactor concerning active zone damage, leak of radioactive materials, failures of safety systems and damage shields. Upgrading program for Mochovce NPP - WWER-440/V-213 is concerned with improving the integrity of the reactor pressure vessel, steam generators 'leak before break' methods applied for the NPP, instrumentation and control of safety systems, diagnostic systems, replacement of in-core monitoring system, emergency analyses, pressurizers safety relief valves, hydrogen removal system, seismic evaluations, non-destructive testing, fire protection. Implementation of quality assurance has a special role in improvement of operational safety activities as well as safety management and safety culture, radiation protection, decommissioning and waste management and training. The Year 2000 problem is mentioned as well
Lifescience Database Archive (English)
Full Text Available 0Y1|P1254_THEMA Phosphorylated carbohydrates phosphatase T... 58 4e-08 sp|P77247|YNIC_ECOLI Phosphatase yniC...hydrates phosphatase TM_1254 OS=Thermotoga maritima GN=TM_1254 PE=1 SV=1 Length = 2...PELYLLAAKNLGVSPAECLAFEDSVNGSIAAKRAGMKCVI 183 Query: 515 TKKRV 529 +V Sbjct: 184 VPNKV 188 >sp|Q9X0Y1|P1254_THEMA Phosphorylated carbo
Lifescience Database Archive (English)
Full Text Available V NSP1 OS=Italian lapine rotavirus 30/96 GN... 35 2.4 tr|A7QGY9|A7QGY9_VITVI Chromosome chr3 scaffold_95, wh...tr|Q1WK43|Q1WK43_9REOV NSP1 OS=Italian lapine rotavirus 30/96 GN=NSP1 PE=4 SV=1 Length = 492 Score = 34.7 bi
Energy Technology Data Exchange (ETDEWEB)
Kupca, L.; Beno, P. [Nuclear Power Plants Research Institute, Trnava (Slovakia)
1997-04-01
A broad overview of the leak before break (LBB) application to the Slovakian V-1 nuclear power plant is presented in the paper. LBB was applied to the primary cooling circuit and surge lines of both WWER 440 type units, and also used to assess the integrity of safety related piping in the feed water and main steam systems. Experiments and calculations performed included analyses of stresses, material mechanical properties, corrosion, fatigue damage, stability of heavy component supports, water hammer, and leak rates. A list of analysis results and recommendations are included in the paper.
3.0 V High Energy Density Symmetric Sodium-Ion Battery: Na4V2(PO4)3∥Na3V2(PO4)3.
Yao, Xuhui; Zhu, Zixuan; Li, Qi; Wang, Xuanpeng; Xu, Xiaoming; Meng, Jiashen; Ren, Wenhao; Zhang, Xinhe; Huang, Yunhui; Mai, Liqiang
2018-03-28
Symmetric sodium-ion batteries (SIBs) are considered as promising candidates for large-scale energy storage owing to the simplified manufacture and wide abundance of sodium resources. However, most symmetric SIBs suffer from suppressed energy density. Here, a superior congeneric Na 4 V 2 (PO 4 ) 3 anode is synthesized via electrochemical preintercalation, and a high energy density symmetric SIB (Na 3 V 2 (PO 4 ) 3 as a cathode and Na 4 V 2 (PO 4 ) 3 as an anode) based on the deepened redox couple of V 4+ /V 2+ is built for the first time. When measured in half cell, both electrodes show stabilized electrochemical performance (over 3000 cycles). The symmetric SIBs exhibit an output voltage of 3.0 V and a cell-level energy density of 138 W h kg -1 . Furthermore, the sodium storage mechanism under the expanded measurement range of 0.01-3.9 V is disclosed through an in situ X-ray diffraction technique.
MnV2O6.V2O5 cross-like nanobelt arrays: synthesis, characterization and photocatalytic properties
International Nuclear Information System (INIS)
Abbood, Hayder A.; Ahmed, Khalid Abdelazez Mohamed; Ren, Yong; Huang, Kaixun
2013-01-01
Single-crystalline MnV 2 O 6 .V 2 O 5 cross-like nanobelt arrays were successfully synthesized by hydrothermal reaction. The products were characterized by X-ray diffraction, transmission electron microscopy and high-resolution transmission electron microscopy. The effects of the reaction conditions such as pH, V 5+ /Mn 2+ ratio, carboxymethyl cellulose concentration and reaction time on the morphology of the products were studied. The band gap of the as-prepared products was calculated via diffuse reflectance spectral analysis and their activity of photocatalytic oxidation was evaluated by photodegradation of methylene blue under visible-light irradiation. The results showed that the degradation efficiency of methylene blue catalyzed by the calcinated products is remarkably enhanced due to Mn doping, suggesting that MnV 2 O 6 .V 2 O 5 cross-like nanobelt arrays are a good candidate for visible-light-driven photocatalysts. (orig.)
International Nuclear Information System (INIS)
Slach, J.
2004-01-01
The following activities are described: (i) Installation of pipe whip restraints on piping for high pressure and temperature steam and feed piping; (ii) Installation of air receivers for quick-acting valves with air actuator on VVER 440 units at the Jaslovske Bohunice V2 NPP; (iii) Replacement of the technical water distribution system material in the reactor hall of the Temelin VVER 1000 units; Installation of measuring nozzles on main steam piping DN 600 at the Temelin VVER 1000 units. (P.A.)
International Nuclear Information System (INIS)
2001-01-01
The main efforts of Nuclear Regulatory Authority of the Slovak Republic (UJD) have been focused on inspection of quality assurance programmes of Slovak Power Stations, plc. and its daughter companies at Bohunice and Mochovce. Two quality assurance inspections in the area of periodical in service inspections (V-2 units) and tests of selected equipment (NPP V-2 units) and operation control (V-1 units) has been performed at NPPs Bohunice. One violation of decree on quality assurance of selected equipment has been found in the area of documentation archiving. The inspection concerning the implementation of quality assurance programme for operation of NPP Mochovce in the area of operation control has been performed focused on safety aspects of operation, operational procedures, control of operational events and feedback from operational experience. The results of this inspection were positive. Inspection of implementation of quality assurance programme for operation of radioactive waste repository (RU RAW) at the Mochovce location has been performed focused on receiving of containers, with radioactive wastes, containers handling, radiation monitoring, activities of documentation control and radiation protection at the repository site. No serious deficiencies have been found out. Also one inspection of experimental nuclear installations of VUJE Trnava at Jaslovske Bohunice site has been performed focused on procurement control, quality audits, documentation and quality records control when performing activities at experimental nuclear installations. The activity on development of internal quality assurance system continued. The implementation of this system will assure quality and effective fulfilment enlarged tasks of UJD with limited resources for its activity. The analyses of possible use of existing internal administrative control documentation as a basis for future quality system procedures was performed in co-operation with an external specialised organisation. The
VUJE tasks and activities during gradual upgrading
International Nuclear Information System (INIS)
Ferenc, M.
2001-01-01
The paper describes the organization and management of the Gradual Upgrading of the Bohunice V1 NPP and the principle tasks and scope of activities provided by VUJE Trnava, Inc. It also describes the system of supplies and the system of quality assurance both in the consortium and in subcontractors. (author)
Fine-Grained vs. Average Reliability for V2V Communications around Intersections
Abdulla, Mouhamed; Wymeersch, Henk
2017-01-01
Intersections are critical areas of the transportation infrastructure associated with 47% of all road accidents. Vehicle-to-vehicle (V2V) communication has the potential of preventing up to 35% of such serious road collisions. In fact, under the 5G/LTE Rel.15+ standardization, V2V is a critical use-case not only for the purpose of enhancing road safety, but also for enabling traffic efficiency in modern smart cities. Under this anticipated 5G definition, high reliability of 0.99999 is expecte...
Lifescience Database Archive (English)
Full Text Available 9.1 tr|A4V047|A4V047_DROME Brother of odd with entrails limited, iso... 33 9.1 >tr|B4L9X7|B4L9X7_DROMO GI141...IITQPESGKPPNQPLHSPHEAMPSFLGSIPMRKRILPAPTLDLMDPHHHP 673 >tr|A4V047|A4V047_DROME Brother of odd with entrails
Lifescience Database Archive (English)
Full Text Available NVISWNAMLAAYTYCGCNDGVLELFDQMLFQ 196 V TAL+ + +L +A VF+ ++V+SWNA++A C + V + +M + Sbjct: 192 VFMTALI----RSRKLAEALEVFEACRGKDVVSWNAVMAG...D S Sbjct: 199 RSRKLAEALEVFEACRGKDVVSWNAVMAGLVQFCCGEVPGF-WRRMCCEGVKPDNFAFSG 257 Q
Energy Technology Data Exchange (ETDEWEB)
Neill, J. M.; Young, J. C.; Trimble, G. D.; Beyster, J. R. [General Atomic Division of General Dynamics Corporation, John Jay Hopkins Laboratory for Pure and Applied Science, San Diego, CA (United States)
1965-08-15
calculations has been considerably improved. The theoretical scattering kernel is based on a Debye frequency spectrum with a cut-off frequency adjusted to satisfy the specific heat measurements for BeO. Significant Bragg trapping of low energy neutrons is observed in the measurements. (author) [French] Des mesures de spectres de neutrons thermiques dans des ralentisseurs utiles en technologie des reacteurs sont en cours a la General Atomic. Ces mesures ont pour objet de verifier si les modeles de diffusion proposes pour ces ralentisseurs conviennent bien. Actuellement, on obtient les noyaux de diffusion en mesurant directement les sections efficaces de diffusion differentielles doubles ou en les deduisant d'une etude des mouvements vibrationnels et rotationnels des molecules dans un liquide ou du spectre des vibrations du reseau dans un solide. La mesure directe s'est ressentie de quelques difficultes experimentales auxquelles ont s'est heurte pour obtenir l'intensite et la resolution desirees et apporter les corrections voulues pour tenir compte de la diffusion multiple dans l'echantillon. Du point de vue de l'application a la technologie des reacteurs, le deuxieme moyen d'obtention du noyau de diffusion est plus satisfaisant dans de nombreux cas. Les mesures integrales qui ont ete faites, combinees a des calculs comparatifs des spectres de neutrons, permettent de porter un jugement sur la qualite des modeles theoriques de diffusion pour H{sub 2}O, D{sub 2}O et BeO. Les auteurs presentent des spectres variables selon l'angle et la position, qui ont ete mesures dans H{sub 2}O et D{sub 2}O empoisonnes par du bore ou du cadmium et sont en meilleur accord avec les valeurs theoriques. Il s'avere que le modele de Nelkin pour H{sub 2}O constitue une bonne description preliminaire de la diffusion due a ce ralentisseur. Il s'avere de meme que le modele de Honeck pour D{sub 2}O, qui est un developpement du modele incoherent de Nelkin pour H{sub 2}O, represente egalement une description
Directory of Open Access Journals (Sweden)
Vitor Marcel Schühli
2011-06-01
formação do indivíduo, a partir de teorias que apostam na possibilidade de a arte impulsionar a transformação sobre a realidade e contribuir para a superação da alienação. Foram analisadas as teorias de educação estética dos autores marxistas L. G. Iuldáchev, B. M. Teplov, e A. Sánchez Vázquez. No recorte aqui proposto, buscou-se demonstrar que, apesar de os três autores partirem de uma concepção histórico-social de individualidade, suas formulações diferem no que diz respeito à abordagem do fenômeno da catarse. Na dialética entre identifi cação e distanciamento do sujeito com o objeto artístico, a ênfase dos autores sobre um ou outro momento da relação acaba por marcar sua posição em torno do fenômeno da catarse. Enquanto em Iuldachév e em Teplov pode-se dizer que encontra destaque o momento da identifi cação, Sánchez Vázquez busca com o conceito de situação estética recuperar a importância do distanciamento nessa relação. Acredita-se que estudar as formulações desses teóricos pode iluminar as refl exões atuais sobre a educação estética, bem como auxiliar, com sua perspectiva materialista e dialética, a crítica aos estudos que absolutizam o papel da consciência no projeto de transformação social.
Música pop : da estética, conceitos e preconceitos
Teles, Maria Filipa
2008-01-01
Dissertação de Mestrado em Estudos Americanos apresentada à Universidade Aberta O estudo daquilo que é normalmente definido como Cultura Pop tem-se encontrado tradicionalmente dividido em três linhas gerais: a que não a considera como objecto digno de estudo; a que, embora se dedique ao seu estudo, a considera um objecto menor; e a que a reconhece como objecto de estudo académico válido. Este trabalho procura libertar-se dos preconceitos anteriormente expostos, reflectind...
Development of EST-derived markers in Dendrobium from EST of related taxa
Directory of Open Access Journals (Sweden)
Narisa Juejun
2013-04-01
Full Text Available Public databases are useful for molecular marker development. The major aim of this study was to develop expressedsequence tag (EST-derived markers in Dendrobium from available ESTs of Phalaenopsis and Dendrobium. A total of 6063sequences were screened for simple sequence repeats (SSRs and introns. Primers flanking these regions were generated andtested on genomic DNAs of Phalaenopsis and Dendrobium. Twenty-three percent of amplifiable Phalaenopsis EST-derivedmarkers were cross-genera transferable to Dendrobium. Forty-one markers from both Phalaenopsis and Dendrobium thatamplified in Dendrobium were assessed on six commercial cultivars and six wild accessions. All of them were transferableamong Dendrobium species. High polymorphism and heterozygosity were observed within wild accessions. Sixteen polymorphic markers were evaluated for linkage analysis on an F1 segregating population. Seven markers were mapped into threelinkage groups, two of which showed syntenic relationship between dendrobium and rice. This relationship will facilitatefurther quantitative trait loci (QTL mapping and comparative genomic studies of Dendrobium. Our results indicate thatPhalaenopsis EST-derived markers are valuable tools for genetic research and breeding applications in Dendrobium.
Structure of recombinant Ves v 2 at 2.0 Angstrom resolution
DEFF Research Database (Denmark)
Skov, Lars K; Seppälä, Ulla; Coen, Jeremy J F
2006-01-01
Wasp venom from Vespula vulgaris contains three major allergens: Ves v 1, Ves v 2 and Ves v 5. Here, the cloning, expression, biochemical characterization and crystal structure determination of the hyaluronidase Ves v 2 from family 56 of the glycoside hydrolases are reported. The allergen...... was expressed in Escherichia coli as an insoluble protein and refolded and purified to obtain full enzymatic activity. Three N-glycosylation sites at Asn79, Asn99 and Asn127 were identified in Ves v 2 from a natural source by enzymatic digestions combined with MALDI-TOF mass spectrometry. The crystal structure...... of recombinant Ves v 2 was determined at 2.0 A resolution and reveals a central (beta/alpha)(7) core that is further stabilized by two disulfide bonds (Cys19-Cys308 and Cys185-Cys197). Based on sequence alignments and structural comparison with the honeybee allergen Api m 2, it is proposed that a conserved...
Lifescience Database Archive (English)
Full Text Available EAMPSFLGSIPMRKRILPAPTLDLMDPHHHP 673 >tr|A4V047|A4V047_DROME Brother of odd with entrails limited, isoform B ...E Brother of odd with entrails limited, iso... 33 9.9 >tr|B4L9X7|B4L9X7_DROMO GI14159 OS=Drosophila mojavens...8_DROER GG24967 OS=Drosophila erecta GN=GG24967 P... 33 9.9 tr|A4V047|A4V047_DROM
Adjacent Vehicle Number-Triggered Adaptive Transmission for V2V Communications.
Wei, Yiqiao; Chen, Jingjun; Hwang, Seung-Hoon
2018-03-02
For vehicle-to-vehicle (V2V) communication, such issues as continuity and reliability still have to be solved. Specifically, it is necessary to consider a more scalable physical layer due to the high-speed mobility of vehicles and the complex channel environment. Adaptive transmission has been adapted in channel-dependent scheduling. However, it has been neglected with regards to the physical topology changes in the vehicle network. In this paper, we propose a physical topology-triggered adaptive transmission scheme which adjusts the data rate between vehicles according to the number of connectable vehicles nearby. Also, we investigate the performance of the proposed method using computer simulations and compare it with the conventional methods. The numerical results show that the proposed method can provide more continuous and reliable data transmission for V2V communications.
23. X avati Pärnu muuseumis näitus "EST-design"
2002-01-01
Väljapanek annab ülevaate eesti tootedisaini hetkeseisust ja tutvustab eesti disaini ekspordiks loodud kaubamärki. EST-designi kontseptsiooni on välja töötanud Toivo Rande, märgi on kujundanud Sven Sõrmus. Näitusel esinevad M. Grünberg, E. Jürgenson, T. Luisk, T. Mang, G. Nahkur, A. Puuraid, M. Pärn, K. Raidmets, T. Raidmets, K. Soans, T. Vellama
Diagnostic and monitoring systems produced in Vuje, Okruzna 5, 918 64 Trnava, Slovak Republic
International Nuclear Information System (INIS)
Oksa, G.; Bahna, J.; Murin, V.; Kucharek, P.; Smutny, S.
1996-01-01
Based on the 20 years experience in on-line vibration diagnostics of mechanical components in the primary circuit of nuclear power plant PWR WWER-440, Vuje, Okruzna 5, 918 64 Trnava produces its own diagnostic and monitoring systems since 1990. The variety of diagnostic systems includes: loose part monitoring system (LPMS), monitoring system of main circulating pumps (MCPMS), vibration monitoring system (LVMS), leakage monitoring system (LMS). The emphasis in the hardware solution is put on the design modularity and versatility so that many subcomponents (circuit boards) are common or highly similar for all systems. Using exclusively digital data for processing enhances the reliability of the measurements and allows the easy data transportation from one computer to another (e.g., for more sophisticated analysis). Trends in the software development follow the similar path as for the hardware solution - namely, the modularity and versatility of software is the imperative goal. The modern operating systems also incorporate the ability of network communication, which is crucial for the integration of stand-alone diagnostic systems into nuclear power plants information system. So far a number of systems have been successfully installed: 6 LPMSs (Jaslovske Bohunice, Dukovany), 4 MCPMs (Jaslovske Bohunice) and 2 LVMSs (Jaslovske Bohunice), all systems operate in PWR WWER-440 environment. Another diagnostic systems are under construction: 2 LPMSs (Temelin, PWR WWER-1000), 2 MCMSs (Mochovce - PWR WWER-440) and 2 LMSs (Jaslovske Bohunice). (author). 1 fig
Diagnostic and monitoring systems produced in Vuje, Okruzna 5, 918 64 Trnava, Slovak Republic
Energy Technology Data Exchange (ETDEWEB)
Oksa, G; Bahna, J; Murin, V; Kucharek, P; Smutny, S [Vyskumny Ustav Jadrovych Elektrarni, Trnava (Slovakia)
1997-12-31
Based on the 20 years experience in on-line vibration diagnostics of mechanical components in the primary circuit of nuclear power plant PWR WWER-440, Vuje, Okruzna 5, 918 64 Trnava produces its own diagnostic and monitoring systems since 1990. The variety of diagnostic systems includes: loose part monitoring system (LPMS), monitoring system of main circulating pumps (MCPMS), vibration monitoring system (LVMS), leakage monitoring system (LMS). The emphasis in the hardware solution is put on the design modularity and versatility so that many subcomponents (circuit boards) are common or highly similar for all systems. Using exclusively digital data for processing enhances the reliability of the measurements and allows the easy data transportation from one computer to another (e.g., for more sophisticated analysis). Trends in the software development follow the similar path as for the hardware solution - namely, the modularity and versatility of software is the imperative goal. The modern operating systems also incorporate the ability of network communication, which is crucial for the integration of stand-alone diagnostic systems into nuclear power plants information system. So far a number of systems have been successfully installed: 6 LPMSs (Jaslovske Bohunice, Dukovany), 4 MCPMs (Jaslovske Bohunice) and 2 LVMSs (Jaslovske Bohunice), all systems operate in PWR WWER-440 environment. Another diagnostic systems are under construction: 2 LPMSs (Temelin, PWR WWER-1000), 2 MCMSs (Mochovce - PWR WWER-440) and 2 LMSs (Jaslovske Bohunice). (author). 1 fig.
Interferência da taxa de estímulo na avaliação do potencial evocado miogênico vestibular
Directory of Open Access Journals (Sweden)
Aline Tenório Lins Carnaúba
2013-10-01
Full Text Available Os potenciais miogênicos evocados vestibulares (VEMP vêm sendo empregados como exame complementar para estudos otoneurológicos, ainda pouco explorados clinicamente. Esse potencial avalia a função vestibular, especificamente do sáculo, nervo vestibular inferior e/ou núcleo vestibular. OBJETIVO: Verificar a maior taxa de estímulos possível (e confiável na obtenção do VEMP. MÉTODO: Foi registrado o potencial em 18 sujeitos, variando-se a taxa de estímulos entre 5,1 e 40,8 estímulos/s. Forma de estudo: Estudo de coorte contemporânea com corte transversal. RESULTADOS: As latências se mantiveram constantes e as amplitudes foram progressivamente reduzidas com o aumento da taxa de estimulação. Contudo, não houve diferença estatisticamente significativa entre os parâmetros simultaneamente, quando aplicados os testes ANOVA e Kruskal-Wallis. Os dados obtidos nesta pesquisa demonstraram que, quando comparadas as taxas de estimulação de 5,1 e 10,2 estímulos/s, houve ausência de diferença estatisticamente significativas para o parâmetro latência. CONCLUSÃO: Conclui-se que a maior taxa de estimulação confiável é a de 10,2 estímulos/s, para a amostra estudada de adultos jovens ouvintes normais.
ASTEC V2 severe accident integral code main features, current V2.0 modelling status, perspectives
International Nuclear Information System (INIS)
Chatelard, P.; Reinke, N.; Arndt, S.; Belon, S.; Cantrel, L.; Carenini, L.; Chevalier-Jabet, K.; Cousin, F.; Eckel, J.; Jacq, F.; Marchetto, C.; Mun, C.; Piar, L.
2014-01-01
The severe accident integral code ASTEC, jointly developed since almost 20 years by IRSN and GRS, simulates the behaviour of a whole nuclear power plant under severe accident conditions, including severe accident management by engineering systems and procedures. Since 2004, the ASTEC code is progressively becoming the reference European severe accident integral code through in particular the intensification of research activities carried out in the frame of the SARNET European network of excellence. The first version of the new series ASTEC V2 was released in 2009 to about 30 organizations worldwide and in particular to SARNET partners. With respect to the previous V1 series, this new V2 series includes advanced core degradation models (issued from the ICARE2 IRSN mechanistic code) and necessary extensions to be applicable to Gen. III reactor designs, notably a description of the core catcher component to simulate severe accidents transients applied to the EPR reactor. Besides these two key-evolutions, most of the other physical modules have also been improved and ASTEC V2 is now coupled to the SUNSET statistical tool to make easier the uncertainty and sensitivity analyses. The ASTEC models are today at the state of the art (in particular fission product models with respect to source term evaluation), except for quenching of a severely damage core. Beyond the need to develop an adequate model for the reflooding of a degraded core, the main other mean-term objectives are to further progress on the on-going extension of the scope of application to BWR and CANDU reactors, to spent fuel pool accidents as well as to accidents in both the ITER Fusion facility and Gen. IV reactors (in priority on sodium-cooled fast reactors) while making ASTEC evolving towards a severe accident simulator constitutes the main long-term objective. This paper presents the status of the ASTEC V2 versions, focussing on the description of V2.0 models for water-cooled nuclear plants
El gusto estético en la globalización
Directory of Open Access Journals (Sweden)
Carlos Fajardo Fajardo
2014-09-01
Full Text Available ¿Cómo opera el proceso del gusto y de la emoción estética en la disgregación entre el sujeto y el objeto posmodernos? La pluralidad, la heterogeneidad y lo multi-procesal conforman el corpus del juicio de gusto actual. Su resultado es la construcción de otros tipos de figuras del mundo, nuevas imágenes de lo real, diversas y distintas, creadas a partir no de la unidad y universalidad del placer estético clásico y dieciochesco, sino por medio de una emoción intersubjetiva y multiforme. El gusto es víctima del tiempo. De lo interesante estético burgués se ha pasado a lo impactante y espectacularizado posindustrial. Entonces, lo light, la alta costura, el turismo, el “mundo del arte”, la word music, la publicidad, los diseños del hogar, la farándula, los artistas jet, la literatura de autoayuda y de intimidades de famosos son las nuevas esferas de un gusto que ha puesto contra la pared todas las antiguas competencias de críticos de arte modernos y del público lector ilustrado en general. ¿Qué tipo de gusto actualmente ejercitamos?, o bien, ¿de qué manera hemos mutado el juicio de gusto en disgusto fragmentado, indescible, descentrado? Este ensayo contribuye a dar algunas respuestas a estos interrogantes.
Fernández-Vega, Iván
2016-01-01
El objetivo principal de este Trabajo de Fin de Grado ha sido el de implementar un entorno de programación para un robot móvil Turtlebot-2 dotado de un brazo articulado WidowX. Para ello, se ha modelado este conjunto robótico en el simulador V-REP a partir de las descripciones físicas de los mismos, y se han ajustado diversos parámetros para que el comportamiento del robot simulado sea lo más parecido al del robot real. Para implementar las aplicaciones que controlen nuestro co...
Directory of Open Access Journals (Sweden)
Bárbara C. R. Monte-Mór
2008-01-01
Full Text Available Síndromes mieloproliferativas (SMPs são doenças hematopoéticas de origem clonal que apresentam amplificação de uma ou mais linhagens mielóides. Policitemia vera (PV, trombocitemia essencial (TE, mielofibrose idiopática (MF e leucemia mielóide crônica (LMC são consideradas SMPs clássicas e apresentam características clínicas e biológicas comuns. Ao contrário de LMC, cuja etiologia está relacionada à proteína constitutivamente ativa Bcr-Abl, o mecanismo molecular de PV, TE e MF permaneceu por muito tempo desconhecido. Esta revisão se foca na recente descoberta da mutação JAK2 V617F em pacientes com PV, TE e MF, sua relação com o fenótipo mieloproliferativo e implicações na abordagem clínica de pacientes.Myeloproliferative disorders are clonal hematopoietic diseases that are characterized by the amplification of one or more myeloid lineages. Polycythemia vera, essential thrombocythemia, idiopathic myelofibrosis and chronic myeloid leukemia are considered classic myeloproliferative disorders and share common clinical and biological features. While the genetic basis of chronic myeloid leukemia is shown to be the constitutive active protein BCR-ABL, the main molecular lesions in polycythemia vera, essential thrombocythemia and idiopathic myelofibrosis remain unknown. This review focuses on the recent discovery of the JAK2 V617F mutation, its relationship to the myeloproliferative phenotype and implications in the clinical approach of patients.
Adjacent Vehicle Number-Triggered Adaptive Transmission for V2V Communications
Wei, Yiqiao; Chen, Jingjun
2018-01-01
For vehicle-to-vehicle (V2V) communication, such issues as continuity and reliability still have to be solved. Specifically, it is necessary to consider a more scalable physical layer due to the high-speed mobility of vehicles and the complex channel environment. Adaptive transmission has been adapted in channel-dependent scheduling. However, it has been neglected with regards to the physical topology changes in the vehicle network. In this paper, we propose a physical topology-triggered adaptive transmission scheme which adjusts the data rate between vehicles according to the number of connectable vehicles nearby. Also, we investigate the performance of the proposed method using computer simulations and compare it with the conventional methods. The numerical results show that the proposed method can provide more continuous and reliable data transmission for V2V communications. PMID:29498646
76 FR 2800 - Amendment of VOR Federal Airways V-2 and V-21; Hawaii
2011-01-18
...-1263; Airspace Docket No. 10-AWP-17] Amendment of VOR Federal Airways V-2 and V-21; Hawaii AGENCY... Omnidirectional Range (VOR) Federal airway legal descriptions in the State of Hawaii. The FAA is taking this... Regulations (14 CFR) part 71 by amending two VOR Federal Airways, V-2 and V-21, located in the State of Hawaii...
Liang, Chun; Wang, Gang; Liu, Lin; Ji, Guoli; Fang, Lin; Liu, Yuansheng; Carter, Kikia; Webb, Jason S; Dean, Jeffrey F D
2007-05-29
With the advent of low-cost, high-throughput sequencing, the amount of public domain Expressed Sequence Tag (EST) sequence data available for both model and non-model organism is growing exponentially. While these data are widely used for characterizing various genomes, they also present a serious challenge for data quality control and validation due to their inherent deficiencies, particularly for species without genome sequences. ConiferEST is an integrated system for data reprocessing, visualization and mining of conifer ESTs. In its current release, Build 1.0, it houses 172,229 loblolly pine EST sequence reads, which were obtained from reprocessing raw DNA sequencer traces using our software--WebTraceMiner. The trace files were downloaded from NCBI Trace Archive. ConiferEST provides biologists unique, easy-to-use data visualization and mining tools for a variety of putative sequence features including cloning vector segments, adapter sequences, restriction endonuclease recognition sites, polyA and polyT runs, and their corresponding Phred quality values. Based on these putative features, verified sequence features such as 3' and/or 5' termini of cDNA inserts in either sense or non-sense strand have been identified in-silico. Interestingly, only 30.03% of the designated 3' ESTs were found to have an authenticated 5' terminus in the non-sense strand (i.e., polyT tails), while fewer than 5.34% of the designated 5' ESTs had a verified 5' terminus in the sense strand. Such previously ignored features provide valuable insight for data quality control and validation of error-prone ESTs, as well as the ability to identify novel functional motifs embedded in large EST datasets. We found that "double-termini adapters" were effective indicators of potential EST chimeras. For all sequences with in-silico verified termini/terminus, we used InterProScan to assign protein domain signatures, results of which are available for in-depth exploration using our biologist
Directory of Open Access Journals (Sweden)
Carter Kikia
2007-05-01
Full Text Available Abstract Background With the advent of low-cost, high-throughput sequencing, the amount of public domain Expressed Sequence Tag (EST sequence data available for both model and non-model organism is growing exponentially. While these data are widely used for characterizing various genomes, they also present a serious challenge for data quality control and validation due to their inherent deficiencies, particularly for species without genome sequences. Description ConiferEST is an integrated system for data reprocessing, visualization and mining of conifer ESTs. In its current release, Build 1.0, it houses 172,229 loblolly pine EST sequence reads, which were obtained from reprocessing raw DNA sequencer traces using our software – WebTraceMiner. The trace files were downloaded from NCBI Trace Archive. ConiferEST provides biologists unique, easy-to-use data visualization and mining tools for a variety of putative sequence features including cloning vector segments, adapter sequences, restriction endonuclease recognition sites, polyA and polyT runs, and their corresponding Phred quality values. Based on these putative features, verified sequence features such as 3' and/or 5' termini of cDNA inserts in either sense or non-sense strand have been identified in-silico. Interestingly, only 30.03% of the designated 3' ESTs were found to have an authenticated 5' terminus in the non-sense strand (i.e., polyT tails, while fewer than 5.34% of the designated 5' ESTs had a verified 5' terminus in the sense strand. Such previously ignored features provide valuable insight for data quality control and validation of error-prone ESTs, as well as the ability to identify novel functional motifs embedded in large EST datasets. We found that "double-termini adapters" were effective indicators of potential EST chimeras. For all sequences with in-silico verified termini/terminus, we used InterProScan to assign protein domain signatures, results of which are available
Slovak Electric, plc, Mochovce Nuclear Power Plant
International Nuclear Information System (INIS)
2000-01-01
In this popular scientific brochure a brief description of history construction of Bohunice Nuclear Power Plant is presented. The chart of electricity generation in WWER 440/V-213 nuclear power plant is described. Operation and safety improvements at Mochovce NPP as well as environment protection are presented. Basic data of Mochovce NPP are included
Local structural and electronic properties of V2O3 and ZnV2O4
International Nuclear Information System (INIS)
Pfalzer, P.
2004-01-01
In this thesis the electronically correlated transition metal oxide compounds V 2 O 3 and ZnV 2 O 4 , which are of basic interest for solid state physics, are investigated using X-ray absorption techniques. Measurements of the fine structure at Vanadium and Oxygen K absorption edges together with a comparison to theoretically calculated spectra show that the local properties of these materials, which under certain conditions deviate drastically from the long-range properties known so far, crucially influence the characteristic behaviour. It is shown that the two insulating phases of V 2 O 3 (the paramagnetic insulating (PI) and the antiferromagnetic insulating (AFI) phase) exhibit very similar local properties which are well distinguished from those of the paramagnetic metallic (PM) phase. In particular, a disagreement is found between the local and the long-range spatial symmetry of the PI phase. It is further shown that at the metal-insulator transition from the PM to the AFI phase structural changes preceed changes of the electronic and magnetic properties. This suggests that the metal-insulator transition is structurally driven. In ZnV 2 O 4 characteristic differences are found between the local properties of single crystalline and powdered samples. These originate either from strain in the single crystals or from anisotropy of the electronic states
Lifescience Database Archive (English)
Full Text Available G_TRTV Major surface glycoprotein G OS=Turkey rhino... 30 7.4 >sp|P33495|VGLG_TRT...V Major surface glycoprotein G OS=Turkey rhinotracheitis virus GN=G PE=2 SV=1 Length = 391 Score = 30.4 bits...rface glycoprotein G OS=Turkey rhinotracheitis virus Align length 33 Score (bit) 30.4 E-value 7.4 Report BLA...t (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id P33495 Definition sp|P33495|VGLG_TRTV Major su
SE-VYZ - Decommissioning of Nuclear Installations, Radioactive Waste and Spent Fuel Management
International Nuclear Information System (INIS)
Anon
2004-01-01
In this presentations processes of radioactive waste treatment in the Bohunice Radioactive Waste Processing Center (SE-VYZ), Jaslovske Bohunice are presented. Decommissioning of the A-1 NPP is also presented. Disposal of conditioned radioactive waste in fibre concrete containers (FCC) are transported to Mochovce from Jaslovske Bohunice by the transport truck where are reposited in the National radioactive waste repository Mochovce. The Interim spent fuel storage facility (ISFSF) is included into this presentation
Lifescience Database Archive (English)
Full Text Available 2. 5' end sequence. DK956801 CL1196Contig1 Show DK956801 Clone id TST39A01NGRL0026_L02 Library TST39 Length ...585 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0026_L02. 5' end sequence. Accession DK956801...apped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK956801...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK956801|Adiantum capillus-v
Hydrogen storage study on Ti2CrV and ZrFe1.8V0.2 composite system
International Nuclear Information System (INIS)
Banerjee, S.; Kumar, A.; Pillai, C.G.S.; Sudarsan, V.
2012-01-01
Ti 2 CrV is reported to have one of the highest hydrogen storage capacities (more than 4 wt. %) among the bcc phase transition metal alloys. It has been found from the earlier study that Ti 2 CrV alloy shows quite good hydrogen absorption property but the desorption temperature is on the higher side. The in-situ temperature programmed desorption profile shows that the hydrogen desorption starts from 120℃ and the desorption peak comes at 180℃, which is slightly high for the vehicular application. On the other hand ZrFe 1.8 V 0.2 Laves phase alloy has low hydrogen absorption capacity, but at the room temperature it can desorp all its hydrogen. The pressure composition isotherm of ZrFe 1.8 V 0.2 alloy generated during the experiment shows the typical characteristics of the room temperature reversible hydride. The in-situ temperature programmed desorption shows that the hydride can desorb all the hydrogen below room temperature
La radio no está amenazada por internet
Directory of Open Access Journals (Sweden)
Bruce Girard
2015-01-01
Full Text Available La radio es mucho más penetrante y asequible, el uso de los servicios de Internet puede contribuir a informar mejor a sus clientes y establecer interactividad. En vista que por ahora la accesibilidad del Internet es accesible solo a unos pocos, para la radio no es una amenaza el Internet. Enuncia los roles de la radio y señala que está considerada como un vínculo comunitario. Trata además sobre las radio-cadenas satelitales, la radio e Internet: convergencia para la democracia y el crecimiento de la brecha de los que acceden a la información.
Planning for Environmental Restoration in Slovak Republic
International Nuclear Information System (INIS)
Slavik, O.; Moravek, J.
1995-01-01
The restoration in the Slovak Republic concerns to the contaminated banks of the waste water recipient of the Bohunice Nuclear Power Plant. The identified contamination, consisting mainly of 137 Cs, is a result of two accidents on the CO 2 -cooled and heavy water moderated NPP Bohunice-A1 unit of NPP Bohunice complex. Two type of radiation risk scenarios, namely the bank use and contaminated soil (from bank) use scenario were investigated in relation to decision making on the planning for restoration of the contaminated banks. Results of dose assessments and the approach to planning for restoration of contaminated banks are summarized in the paper. Some details from the worked out technical design of the contaminated soil removal from the banks and its safe disposal in a near surface isolated basin are introduced in the paper too
In vitro binding and receptor-mediated activity of terlipressin at vasopressin receptors V1 and V2.
Jamil, Khurram; Pappas, Stephen Chris; Devarakonda, Krishna R
2018-01-01
Terlipressin, a synthetic, systemic vasoconstrictor with selective activity at vasopressin-1 (V 1 ) receptors, is a pro-drug for the endogenous/natural porcine hormone [Lys 8 ]-vasopressin (LVP). We investigated binding and receptor-mediated cellular activities of terlipressin, LVP, and endogenous human hormone [Arg 8 ]-vasopressin (AVP) at V 1 and vasopressin-2 (V 2 ) receptors. Cell membrane homogenates of Chinese hamster ovary cells expressing human V 1 and V 2 receptors were used in competitive binding assays to measure receptor-binding activity. These cells were used in functional assays to measure receptor-mediated cellular activity of terlipressin, LVP, and AVP. Binding was measured by [ 3 H]AVP counts, and the activity was measured by fluorometric detection of intracellular calcium mobilization (V 1 ) and cyclic adenosine monophosphate (V 2 ). Binding potency at V 1 and V 2 was AVP>LVP>terlipressin. LVP and terlipressin had approximately sixfold higher affinity for V 1 than for V 2 . Cellular activity potency was also AVP>LVP>terlipressin. Terlipressin was a partial agonist at V 1 and a full agonist at V 2 ; LVP was a full agonist at both V 1 and V 2 . The in vivo response to terlipressin is likely due to the partial V 1 agonist activity of terlipressin and full V 1 agonist activity of its metabolite, LVP. These results provide supportive evidence for previous findings and further establish terlipressin pharmacology for vasopressin receptors.
This report identifies the security approach associated with a communications data delivery system that supports vehicle-to-vehicle (V2V) and vehicle-to-infrastructure (V2I) communications. The report describes the risks associated with communication...
Critical Elements of Vehicle-to-Grid (V2G) Economics
Energy Technology Data Exchange (ETDEWEB)
Steward, Darlene M. [National Renewable Energy Laboratory (NREL), Golden, CO (United States)
2017-09-07
This report explores the critical elements of V2G economics. Section 2 summarizes the elements and costs of a V2G system. Section 3 describes V2G revenue-generating services and the business cases for providing these services. Section 4 notes real-world V2G applications. Section 5 lists concerns related to V2G. Section 6 concludes and summarizes V2G cost and revenue elements.
Chávez Sevillano, Manuel Gustavo; Soldevilla Galarza, Luciano
2014-01-01
El adulto suele ofrecer resistencia a los convencionales tratamientos ortodóncicos, debido a la necesidad de llevar brackets visibles, tanto metálicos como estéticos de porcelana. El concepto de Ortodoncia Estética Invisible u Ortodoncia Lingual cubre las expectativas de este tipo de pacientes. La técnica multibrackets con aparatología lingual tiene aproximadamente 25 años de desarrollo y con la experiencia de los casos tratados, se ha llegado a la concepción de una técnica completamente prot...
DECIPHERING CONTRIBUTIONS TO THE EXTRAGALACTIC GAMMA-RAY BACKGROUND FROM 2 GeV TO 2 TeV
Energy Technology Data Exchange (ETDEWEB)
Lisanti, Mariangela; Mishra-Sharma, Siddharth [Department of Physics, Princeton University, Princeton, NJ 08544 (United States); Necib, Lina; Safdi, Benjamin R. [Center for Theoretical Physics, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States)
2016-12-01
Astrophysical sources outside the Milky Way, such as active galactic nuclei and star-forming galaxies, leave their imprint on the gamma-ray sky as nearly isotropic emission referred to as the extragalactic gamma-ray background (EGB). While the brightest of these sources may be individually resolved, their fainter counterparts contribute diffusely. In this work, we use a recently developed analysis method, called the Non-Poissonian Template Fit, on up to 93 months of publicly available data from the Fermi Large Area Telescope to determine the properties of the point sources (PSs) that comprise the EGB. This analysis takes advantage of photon-count statistics to probe the aggregate properties of these source populations below the sensitivity threshold of published catalogs. We measure the source-count distributions and PS intensities, as a function of energy, from ∼2 GeV to 2 TeV. We find that the EGB is dominated by PSs, likely blazars, in all seven energy sub-bins considered. These results have implications for the interpretation of IceCube’s PeV neutrinos, which may originate from sources that contribute to the non-blazar component of the EGB. Additionally, we comment on implications for future TeV observatories such as the Cherenkov Telescope Array. We provide sky maps showing locations most likely to contain these new sources at both low (≲50 GeV) and high (≳50 GeV) energies for use in future observations and cross-correlation studies.
DECIPHERING CONTRIBUTIONS TO THE EXTRAGALACTIC GAMMA-RAY BACKGROUND FROM 2 GeV TO 2 TeV
International Nuclear Information System (INIS)
Lisanti, Mariangela; Mishra-Sharma, Siddharth; Necib, Lina; Safdi, Benjamin R.
2016-01-01
Astrophysical sources outside the Milky Way, such as active galactic nuclei and star-forming galaxies, leave their imprint on the gamma-ray sky as nearly isotropic emission referred to as the extragalactic gamma-ray background (EGB). While the brightest of these sources may be individually resolved, their fainter counterparts contribute diffusely. In this work, we use a recently developed analysis method, called the Non-Poissonian Template Fit, on up to 93 months of publicly available data from the Fermi Large Area Telescope to determine the properties of the point sources (PSs) that comprise the EGB. This analysis takes advantage of photon-count statistics to probe the aggregate properties of these source populations below the sensitivity threshold of published catalogs. We measure the source-count distributions and PS intensities, as a function of energy, from ∼2 GeV to 2 TeV. We find that the EGB is dominated by PSs, likely blazars, in all seven energy sub-bins considered. These results have implications for the interpretation of IceCube’s PeV neutrinos, which may originate from sources that contribute to the non-blazar component of the EGB. Additionally, we comment on implications for future TeV observatories such as the Cherenkov Telescope Array. We provide sky maps showing locations most likely to contain these new sources at both low (≲50 GeV) and high (≳50 GeV) energies for use in future observations and cross-correlation studies.
Lifescience Database Archive (English)
Full Text Available ESCFE Adhesin for cattle intestine colonization... 36 2.0 tr|Q8XD19|Q8XD19_ECO57 Putative uncharacterized pr...41_ECOLX Adhesin for cattle intestine colonization... 35 5.9 tr|B6ZPK4|B6ZPK4_ECO57 PKD domain protein OS=Es...221 >tr|B7LJF8|B7LJF8_ESCFE Adhesin for cattle intestine colonization OS=Escherichia fergusonii GN=siiEA PE=...VGVLKTSSKQASNGV 598 + + TS+ +A V Sbjct: 395 ALVLSGTSNAEAGQTV 410 >tr|B7N941|B7N941_ECOLX Adhesin for cattle intestine colonization
Lifescience Database Archive (English)
Full Text Available N-dependent NADH-azoreductase 3 OS=Pseud... 31 6.1 sp|Q05127|VP35_EBOZM Polymerase cofactor VP35 OS=Zaire ebola...viru... 30 8.0 sp|Q6V1Q9|VP35_EBOZ5 Polymerase cofactor VP35 OS=Zaire ebolavir...u... 30 8.0 sp|Q91DE0|VP35_EBORE Polymerase cofactor VP35 OS=Reston ebolavir... 30 8.0 >sp|Q5GH22|XKR2_SMIMA...sp|Q05127|VP35_EBOZM Polymerase cofactor VP35 OS=Zaire ebolavirus (strain Mayinga-76) GN=VP35 PE=1 SV=1 Leng
Energy Technology Data Exchange (ETDEWEB)
Furth, H. P.; Killeen, J. [Lawrence Radiation Laboratory, Livermore, CA (United States); Rosenbluth, M. N. [General Atomic Division, General Dynamics Corporation and University of California (San Diego), La Jolla, CA (United States); Coppi, B. [University of California (San Diego), La Jolla, CA (United States)
1966-04-15
}B regions. The rotational transform is generated by a helical Script-Small-L = 2 winding and stagnated by an auxiliary poloidal field. (author) [French] Les auteurs etablissent un critere de stabilite a l'egard de l'interchange gravitationnel dans les dispositifs torriidaux a l'aide de l'equation hydrodynamique dans laquelle on tient compte d'une reistivite finie. La stabilite depended'une expression qui se reduit au signe de la derivee seconde du volume par unite de flux (V'') lorsque le plasma n'entoure pas de conducteurs
Electrical properties of V205-ZnO-TeO2 glasses. V205-ZnO-TeO2 kei garasu no denki dendo
Energy Technology Data Exchange (ETDEWEB)
Mori, H; Igarashi, J; Sakata, H [Tokai Univ., Tokyo (Japan). Faculty of Engineering
1993-12-01
It is known that glasses contained Transition Metal Oxide (TMO) such as V2O5 show a semi-conductivity, those conductive mechanism has been understood according to the Small Polaron Hopping (SPH) theory developed by Mott and Austin. Authors investigated the glass formation regions, de-conductivity([sigma]) and the conductive mechanism for V2O5-Bi2O3-TeO2 glasses as a tellurite glass containing the TMO. It was clarified that the adiabatic SPH and the non-adiabatic SPH are satisfied for the glasses with V2O5>50 mol% and V2O5<50 mol%, respectively. In this study, the electrical properties of V2O5-ZnO-TeO2 glasses were investigated, and the SPH conductions were considered from the standpoints of the polaron band width J, carrier mobility [mu], carrier density Nc. The conductive mechanism and dependence of V2O5 density on Seebeck coefficients Q were clarified in which a formation region of V2O5 is from 30 to 60 mol%. 40 refs., 9 figs., 2 tabs.
International Nuclear Information System (INIS)
Vasilchenko, I.; Lushin, V.; Shumeev, A.
2006-01-01
FAs, in the region of FA-and-absorber rod butt joint due to arrangement of hafnium plates in the upper part of FA casing was also solved. The correctness of solutions, laid down in the design of the new generation fuel assemblies, is successfully confirmed by the results of trial operation. It is planned to apply the new generation fuel for WWER-440 reactors of V-213 type at power units of Dukovany NPP in 2005, and in 2006 at Mochovce NPP and at Bohunice NPP V-2 units 3 and 4. In 2007 it is planned to extend an application of vibration-proof working assemblies of new generation for power units of V-230 type at Kola NPP Unit 1
Calibration of a dePangher long counter from 2 keV to 19 MeV
Energy Technology Data Exchange (ETDEWEB)
Slaughter, D R; Rueppel, D W [California Univ., Livermore (USA). Lawrence Livermore Lab.
1977-09-01
The authors have measured the sensitivity of a dePangher precision long counter (PLC) relative to /sup 7/Li(p,n), T(p,n), and T(d,n) differential cross sections over the neutron energy range 10 keV-19 MeV. Absolute sensitivity at 2 keV is also measured, using a scandium filtered beam at a reactor. Results obtained with errors in the range 5-30% are consistent with the assumption of a nearly constant sensitivity over the range 2 keV-6 MeV, but exhibit a reduction above 12 MeV.
International Nuclear Information System (INIS)
Martínez, J.; Savoini, B.; Monge, M.A.; Muñoz, A.; Armstrong, D.E.J.; Pareja, R.
2013-01-01
Highlights: • W-2V and ODS W-2V-0.5Y 2 O 3 alloys have been produced following a powder metallurgy route. • Grain microstructure and microhardness have been studied after isothermal treatments in vacuum. • Both alloys exhibit a duplex grain size population: a submicron-sized grain and a coarse grained one. • The Y 2 O 3 addition inhibits growth of the coarse grains for T 2 O 3 nanoparticles enhance the microhardness of W-2V-0.5Y 2 O 3 . -- Abstract: W-2V and ODS W-2V-0.5Y 2 O 3 alloys have been produced following a powder metallurgy route consisting of mechanical alloying and a subsequent high isostatic pressing HIP at 1573 K. The grain microstructure and microhardness recovery of the alloys have been studied in samples subjected to isothermal treatments in vacuum in temperature range 1073–1973 K. Both alloys exhibit a duplex grain size distribution consisting of a submicron-sized grain and a coarse-grained population. It has been found that the Y 2 O 3 addition inhibits growth of the coarse grains at T 2 O 3 , respectively, was observed at T ≥ 1573 K. It resulted that the rate constant for grain growth is 30 times higher in W-2V-0.5Y 2 O 3 than in W-2V. The considerable enhancement of the microhardness in the W-2V-0.5Y 2 O 3 appears to be associated to dispersion strengthening
Marys Lake 69/115-kV transmission line upgrade and substation expansion projects
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-05-01
Western Area Power Administration (Western) and the Platte River Power Authority (Platte River) propose to upgrade portions of the existing electric transmission and substation system that serves the Town of Estes Park, Colorado. The existing transmission lines between the Estes Power Plant Switchyard and the Marys Lake Substation include a 115,000 volt (115-kV) line and 69,000 volt (69-kV) line. Approximately one mile is a double-circuit 115/69-kV line on steel lattice structures, and approximately two miles consists of separate single-circuit 115-kV and a 69-kV lines, constructed on wood H-Frame structures. Both lines were constructed in 1951 by the US Bureau of Reclamation. The existing transmission lines are on rights-of-way (ROW) that vary from 75 feet to 120 feet and are owned by Western. There are 48 landowners adjacent to the existing ROW. All of the houses were built adjacent to the existing ROW after the transmission lines were constructed. Upgrading the existing 69-kV transmission line between the Marys Lake Substation and the Estes Power Plant Switchyard to 115-kV and expanding the Marys Lake Substation was identified as the most effective way in which to improve electric service to Estes Park. The primary purpose and need of the proposed project is to improve the reliability of electric service to the Town of Estes Park. Lack of reliability has been a historical concern, and reliability will always be less than desired until physical improvements are made to the electrical facilities serving Estes Park.
Marys Lake 69/115-kV transmission line upgrade and substation expansion projects
International Nuclear Information System (INIS)
1996-05-01
Western Area Power Administration (Western) and the Platte River Power Authority (Platte River) propose to upgrade portions of the existing electric transmission and substation system that serves the Town of Estes Park, Colorado. The existing transmission lines between the Estes Power Plant Switchyard and the Marys Lake Substation include a 115,000 volt (115-kV) line and 69,000 volt (69-kV) line. Approximately one mile is a double-circuit 115/69-kV line on steel lattice structures, and approximately two miles consists of separate single-circuit 115-kV and a 69-kV lines, constructed on wood H-Frame structures. Both lines were constructed in 1951 by the US Bureau of Reclamation. The existing transmission lines are on rights-of-way (ROW) that vary from 75 feet to 120 feet and are owned by Western. There are 48 landowners adjacent to the existing ROW. All of the houses were built adjacent to the existing ROW after the transmission lines were constructed. Upgrading the existing 69-kV transmission line between the Marys Lake Substation and the Estes Power Plant Switchyard to 115-kV and expanding the Marys Lake Substation was identified as the most effective way in which to improve electric service to Estes Park. The primary purpose and need of the proposed project is to improve the reliability of electric service to the Town of Estes Park. Lack of reliability has been a historical concern, and reliability will always be less than desired until physical improvements are made to the electrical facilities serving Estes Park
Vehicle-to-vehicle communications : readiness of V2V technology for application.
2014-08-01
The purpose of this research report is to assess the readiness for application of vehicle-to-vehicle (V2V) : communications, a system designed to transmit basic safety information between vehicles to facilitate warnings to : drivers concerning impend...
Directory of Open Access Journals (Sweden)
María Garcés Quílez
2018-04-01
Full Text Available In response to climate change, which is caused by the increasing pollution of the environment and leads to the deterioration of human health, future electricity generations should reduce reliance on fossil fuels by growing the use of clean and renewable energy generation sources and by using clean vehicle technologies. Battery storage systems have been recognized as one of the most promising approaches for supporting the renewable energy generation sources and cleanly powering vehicles instead of burning gasoline and diesel fuel. However, the cost of batteries is still a prominent barrier for their use in stationary and traction applications. As a rule, the cost of batteries can be decreased by lowering material costs, enhancing process efficiencies, and increasing production volume. Another more effective solution is called Vehicle-to-grid (V2G application. In V2G application, the battery system can be used to support the grid services, whereas the battery is still in the vehicle. To make a battery system economically viable for V2G/G2V applications, an effective power-electronics converter should be selected as well. This converter should be supported by an advanced control strategy. Therefore, this article provides a detailed technical assessment and review of V2G/G2V concepts, in conjunction with various power-electronics converter topologies. In this paper, modeling and detailed control strategies are fully designed and investigated in terms of dynamic response and harmonics. Furthermore, an extensive design and analysis of charging systems for low-duty/high-duty vehicles are also presented.
Directory of Open Access Journals (Sweden)
Célia D.S. Bell
2012-05-01
Full Text Available This study aims at contributing to the investigation on the instruction of EST (English for Science and Technology vocabulary, in terms of receptive use of the language. It evaluates the effectiveness of two teaching approaches to the acquisition of vocabulary. The first approach consisted of teaching vocabulary through the use of dictionaries, where the words were merely translated into the learners’ L1 or defined in the target language thus promoting superficial level of word processing. The second approach employed activities promoting deep level of word processing. Data were analysed quantitatively. Results indicated that the two approaches seem to have some equipotentiality, as far as EST vocabulary is concerned.
Electron-positron collision physics: 1 MeV to 2 TeV
International Nuclear Information System (INIS)
Perl, M.L.
1988-07-01
An overview of electron-positron collision physics is presented. It begins at 1 MeV, the energy region of positronium formation, and extends to 2 TeV, the energy region which requires an electron- positron linear collider. In addition, the concept of searching for a lepton-specific forces is discussed. 18 refs., 15 figs., 1 tab
Déficit congénital en facteur V: à propos d'un cas | Boujrad | Pan ...
African Journals Online (AJOL)
Le déficit congénital en facteur V est une anomalie rare de la coagulation, initialement décrite par Owren en 1947 et connue sous le nom de para hémophilie. Elle est transmise selon un mode autosomique récessif. En générale elle est symptomatique à l'état homozygote. Le facteur V est un cofacteur essentiel dans la ...
Energy Technology Data Exchange (ETDEWEB)
Kristofova, Kristina; Daniska, Vladimir; Ondra, Frantisek; Rehak, Ivan; Vasko, Marek [DECOM SLOVAKIA spol. s.r.o., Trnava (Slovakia)
2004-12-01
The presented study is focused on model decommissioning cost calculations for primary circuit of A-1 nuclear power plant in Jaslovske Bohunice. In addition, the survey of advanced decommissioning costing is included together with impact analyses of contamination on particular decommissioning parameters. OMEGA code decommissioning cost calculations for primary circuit of A-1 NPP presented in the study are performed and evaluated under the following conditions: different contamination level of inner and outer surfaces; different waste management scenarios; application and non-application of pre-dismantling decontamination; different start of decommissioning: 2004, 2010, 2020, 2030, 2040; radionuclide composition of primary circuit contamination in A-1 NPP with occurrence of alpha radionuclides and fission products as a consequence of operational accident with damaged fuel cladding; radionuclide composition of primary circuit contamination in V-2 NPP in Jaslovske Bohunice as a representative NPP with an operation without accidents and therefore neither non-alpha contaminants nor fission products are included. The results of all the above mentioned conditions impacts on calculated costs, manpower, exposure and distribution of materials arisen from decommissioning are evaluated in detail within the calculation sensitivity analysis.
International Nuclear Information System (INIS)
Kristofova, Kristina; Daniska, Vladimir; Ondra, Frantisek; Rehak, Ivan; Vasko, Marek
2004-12-01
The presented study is focused on model decommissioning cost calculations for primary circuit of A-1 nuclear power plant in Jaslovske Bohunice. In addition, the survey of advanced decommissioning costing is included together with impact analyses of contamination on particular decommissioning parameters. OMEGA code decommissioning cost calculations for primary circuit of A-1 NPP presented in the study are performed and evaluated under the following conditions: different contamination level of inner and outer surfaces; different waste management scenarios; application and non-application of pre-dismantling decontamination; different start of decommissioning: 2004, 2010, 2020, 2030, 2040; radionuclide composition of primary circuit contamination in A-1 NPP with occurrence of alpha radionuclides and fission products as a consequence of operational accident with damaged fuel cladding; radionuclide composition of primary circuit contamination in V-2 NPP in Jaslovske Bohunice as a representative NPP with an operation without accidents and therefore neither non-alpha contaminants nor fission products are included. The results of all the above mentioned conditions impacts on calculated costs, manpower, exposure and distribution of materials arisen from decommissioning are evaluated in detail within the calculation sensitivity analysis
Energy Technology Data Exchange (ETDEWEB)
Martínez, J.; Savoini, B.; Monge, M.A. [Departamento de Física, Universidad Carlos III de Madrid, 28911-Leganés Madrid (Spain); Muñoz, A., E-mail: angel.munoz@uc3m.es [Departamento de Física, Universidad Carlos III de Madrid, 28911-Leganés Madrid (Spain); Armstrong, D.E.J. [Department of Materials, University of Oxford, Park Road, Oxford OX1 3PH (United Kingdom); Pareja, R. [Departamento de Física, Universidad Carlos III de Madrid, 28911-Leganés Madrid (Spain)
2013-10-15
Highlights: • W-2V and ODS W-2V-0.5Y{sub 2}O{sub 3} alloys have been produced following a powder metallurgy route. • Grain microstructure and microhardness have been studied after isothermal treatments in vacuum. • Both alloys exhibit a duplex grain size population: a submicron-sized grain and a coarse grained one. • The Y{sub 2}O{sub 3} addition inhibits growth of the coarse grains for T < 1973 K. • The Y{sub 2}O{sub 3} nanoparticles enhance the microhardness of W-2V-0.5Y{sub 2}O{sub 3}. -- Abstract: W-2V and ODS W-2V-0.5Y{sub 2}O{sub 3} alloys have been produced following a powder metallurgy route consisting of mechanical alloying and a subsequent high isostatic pressing HIP at 1573 K. The grain microstructure and microhardness recovery of the alloys have been studied in samples subjected to isothermal treatments in vacuum in temperature range 1073–1973 K. Both alloys exhibit a duplex grain size distribution consisting of a submicron-sized grain and a coarse-grained population. It has been found that the Y{sub 2}O{sub 3} addition inhibits growth of the coarse grains at T < 1973 K. Submicron grain growth, with activation enthalpy of 1.9 and 2.49 eV for W-2V and W-2V-0.5Y{sub 2}O{sub 3}, respectively, was observed at T ≥ 1573 K. It resulted that the rate constant for grain growth is 30 times higher in W-2V-0.5Y{sub 2}O{sub 3} than in W-2V. The considerable enhancement of the microhardness in the W-2V-0.5Y{sub 2}O{sub 3} appears to be associated to dispersion strengthening.
Construction of new EST-SSRs for Fusarium resistant wheat breeding.
Yumurtaci, Aysen; Sipahi, Hulya; Al-Abdallat, Ayed; Jighly, Abdulqader; Baum, Michael
2017-06-01
Surveying Fusarium resistance in wheat with easy applicable molecular markers such as simple sequence repeats (SSRs) is a prerequest for molecular breeding. Expressed sequence tags (ESTs) are one of the main sources for development of new SSR candidates. Therefore, 18.292 publicly available wheat ESTs were mined and genotyping of newly developed 55 EST-SSR derived primer pairs produced clear fragments in ten wheat cultivars carrying different levels of Fusarium resistance. Among the proved markers, 23 polymorphic EST-SSRs were obtained and related alleles were mostly found on B and D genome. Based on the fragment profiling and similarity analysis, a 327bp amplicon, which was a product of contig 1207 (chromosome 5BL), was detected only in Fusarium head blight (FHB) resistant cultivars (CM82036 and Sumai) and the amino acid sequences showed a similarity to pathogen related proteins. Another FHB resistance related EST-SSR, Contig 556 (chromosome 1BL) produced a 151bp fragment in Sumai and was associated to wax2-like protein. A polymorphic 204bp fragment, derived from Contig 578 (chromosome 1DL), was generated from root rot (FRR) resistant cultivars (2-49; Altay2000 and Sunco). A total of 98 alleles were displayed with an average of 1.8 alleles per locus and the polymorphic information content (PIC) ranged from 0.11 to 0.78. Dendrogram tree with two main and five sub-groups were displayed the highest genetic relationship between FRR resistant cultivars (2-49 and Altay2000), FRR sensitive cultivars (Seri82 and Scout66) and FHB resistant cultivars (CM82036 and Sumai). Thus, exploitation of these candidate EST-SSRs may help to genotype other wheat sources for Fusarium resistance. Copyright © 2017 Elsevier Ltd. All rights reserved.
Ghosh, Meena; Vijayakumar, Vidyanand; Soni, Roby; Kurungot, Sreekumar
2018-05-10
The maximum capacitive potential window of certain pseudocapacitive materials cannot be accessed in aqueous electrolytes owing to the low dissociation potential of 1.2 V possessed by water molecules. However, the inferior pseudocapacitance exhibited by the commonly used electrode materials when integrated with non-aqueous electrolytes still remains a challenge in the development of supercapacitors (SC). Proper selection of materials for the electrode and a rational design process are indeed important to overcome these practical intricacies so that such systems can perform well with non-aqueous electrolytes. We address this challenge by fabricating a prototype all-solid-state device designed with high-capacitive V2O5 as the electrode material along with a Li-ion conducting organic electrolyte. V2O5 is synthesized on a pre-treated carbon-fibre paper by adopting an electrochemical deposition technique that effects an improved contact resistance. A judicious electrode preparation strategy makes it possible to overcome the constraints of the low ionic and electrical conductivities imposed by the electrolyte and electrode material, respectively. The device, assembled in a symmetrical fashion, achieves a high specific capacitance of 406 F g-1 (at 1 A g-1). The profitable aspect of using an organic electrolyte is also demonstrated with an asymmetric configuration by using activated carbon as the positive and V2O5 as the negative electrode materials, respectively. The asymmetric device displays a wide working-voltage window of 2.8 V and delivers a high energy density of 102.68 W h kg-1 at a power density of 1.49 kW kg-1. Moreover, the low equivalent series resistance of 9.9 Ω and negligible charge transfer resistance are observed in the impedance spectra, which is a key factor that accounts for such an exemplary performance.
Radio Resource Management for V2V Discovery
DEFF Research Database (Denmark)
Alvarez, Beatriz Soret; Gatnau, Marta; Kovács, Istvan
2016-01-01
Big expectations are put into vehicular communications (V2X) for a safer and more intelligent driving. With human lives at risk, the system cannot afford to fail, which translates into very stringent reliability and latency requirements to the radio network. One of the challenges is to find...... efficient radio resource management (RRM) strategies for direct vehicle-to-vehicle (V2V) communication that can fulfil the requirements even with high traffic density. In cellular networks, a device-to-device (D2D) communication is usually split into two phases: the discovery process, for node awareness...... of each other; and the communication phase itself, where data exchange takes place. In the case of V2V, the discovery phase can utilize the status information that cars broadcast periodically as the beacons to detect the presence of neighbouring cars. For the delivery of specific messages (e...
RIEN N’EST FIXE: L’EXPÉRIENCE-NIETZSCHE ET LE QUOTIDIEN ÉDUCATIONNEL
Directory of Open Access Journals (Sweden)
Luciano Bedin da Costa
2011-12-01
Full Text Available Cet article est une lecture du quotidienne éducationnel par la philosophie de riedrich Nietzsche (1844-1900 avec des concepts tels quels : expérience, nihilisme, ressentiment, mauvaise conscience, force et de la volonté de puissance. La théorie de Nietzsche est utilisé comme un outil de réflexion sur les pratiques quotidiennes vécu dans l'éducation, de rompre avec l'inertie du discours des pleurs et nihiliste. Ce que nous appelons l'expérience de Nietzsche implique un autre regard, une grande santé et une éthique pour une évasion de la cristallisation et production des différences. MOTS-CLÉS : expérience; Nietzsche, nihilisme, formation, volonté de puissance
Gunarathne, Thilina
2015-01-01
If you are a Big Data enthusiast and wish to use Hadoop v2 to solve your problems, then this book is for you. This book is for Java programmers with little to moderate knowledge of Hadoop MapReduce. This is also a one-stop reference for developers and system admins who want to quickly get up to speed with using Hadoop v2. It would be helpful to have a basic knowledge of software development using Java and a basic working knowledge of Linux.
Chapter 4. Assessment and inspection of nuclear installations
International Nuclear Information System (INIS)
2001-01-01
develop protocols in which the findings from these inspections are specified. This protocol also contains orders and measures imposed by UJD to correct the shortcomings found. Qualifications and examinations of nuclear safety inspectors are assured in accordance with an internal guideline of UJD. Inspectors take part not only in training courses and other technical meetings organised by the IAEA, but also in some special training courses organised in co-operation with nuclear safety regulators from European countries, USA, Canada and Japan. In next part of this chapter there are presented in details the assessment activity as well as the inspection activity of UJD on the NPP V-1 Bohunice, NPP V-2 Bohunice, NPP Mochovce, NPP A-1 Bohunice, Interim spent fuel storage Bohunice, Technology for treatment and conditioning of radioactive waste Bohunice, National Radioactive Waste Repository Mochovce, Nuclear facilities of VUJE Trnava, Statistical data on assessment and inspection activity of UJD
Long-term measurement with calorimetric probes at unit 1 of V-1 nuclear power plant
International Nuclear Information System (INIS)
Erben, O.; Szasz, Z.; Jirousek, V.; Teren, S.
1989-01-01
Two calorimetric probes were tested at the first unit of the Bohunice V-1 nuclear power plant in long-term operation, i.e., during one whole reactor duty time. Each probe consisted of five fission calorimeters and one compensation calorimeter with a tungsten body. The actual calorimeters were provided with jacketed thermocouples 0.5 mm indiameter and 19 m in length. A detailed description is presented of the measuring chains and measurement techniques. Also described is the method of the disposal of the irradiated probes. The method is presented of the evaluation of measured data and the results are discussed of the analysis of these data. The measurements, including measurements during reactor shut-down and the results of the analysis of the measured data proved good viability and stability of the used calorimetres. The method of measuring the thermocouple signals is simple and the in-service evaluation of required data is quick. In order to increase measurement efficiency it would be appropriate to complete the measuring chain and to automate it. Reliability is a affected merely by protecting the thermocouples against mechanical damage during measurement probe handling and on the reactor. (Z.M.). 5 figs., 5 tabs., 5 refs
Strongly coupled SU(2v boson and LEP1 versus LEP2
Directory of Open Access Journals (Sweden)
M. Bilenky
1993-10-01
Full Text Available If new strong interactions exist in the electroweak bosonic sector (e.g., strong Higgs sector, dynamical electroweak breaking, etc., it is natural to expect new resonances, with potentially strong couplings. We consider an additional vector-boson triplet, V+-, V0, associated with an SU(2v local symmetry under the specific (but rather natural assumption that ordinary fermions are SU(2v singlets. Mixing of the V triplet with the W+-, Z0 bosons effectively leads to an SU(2L×U(1Y violating vector-boson-fermion interaction which is strongly bounded by LEP1 data. In contrast, the potentially large deviation of the Z0W+W- coupling from its SU(2L×U(1Y value is hardly constrained by LEP1 data. Results from experiments with direct access to the trilinear Z0W+W− coupling (LEP200, NLC are urgently needed.
Nuclear energetics as environmentally affable source - present and and future
International Nuclear Information System (INIS)
Suchomel, J.
2002-01-01
In this paper the situation in nuclear energetics in the world in 2000 year is presented. Climatic changes initiated by burning of the fossil fuels an influence of nuclear energetics are discussed. Author informs that European Union and U.S.A. supports developing of nuclear energetics. Nuclear phobia from radiation risk of some inhabitants is compared with risks of other man activities. Possibilities of the electricity production by alternative sources are compared. Liability of the Slovak Republic for decommissioning of two reactor of the V-1 Jaslovske Bohunice NPP in 2006 and 2008, which is compared with the Program of safety improvement of these reactors are discussed. Author and Slovak Nuclear Society accept gladly the suggestion of government of the Slovak Republic that they reassess this liability. The best alternative for decommissioned Jaslovske Bohunice NPP will be the completion of the 3 rd and 4 th blocks of the Mochovce NPP
Antimatière Est-elle la clé de l'Univers?
Grousson, Mathieu
2009-01-01
"De quoi est fait l'Univers? De matière ordinaire et, selon la théorie actuelle, de matière noire et d'énergie noire... dont nul ne sait rien! Et s'il s'agissait plutôt d'antimatière? Car elle permet de réécrire l'histoire du cosmos sans déroger à ses lois et, cette fois, sans nulle zone d'ombre. Reste à vérifier qu'elle antigravite bien..." (14 pages)
TENCompetence Learning Design Toolkit, Runtime component, ccsi_v3_2_10c_v1_4
Sharples, Paul; Popat, Kris; Llobet, Lau; Santos, Patricia; Hernández-Leo, Davinia; Miao, Yongwu; Griffiths, David; Beauvoir, Phillip
2010-01-01
Sharples, P., Popat, K., Llobet, L., Santos, P., Hernandez-Leo, D., Miao, Y., Griffiths, D. & Beauvoir, P. (2009) TENCompetence Learning Design Toolkit, Runtime component, ccsi_v3_2_10c_v1_4 This release is composed of three files corresponding to CopperCore Service Integration (CCSI) v3.2-10cv1.4,
2000-10-05
This booklet presents the eighteen winners in a competition for projects that promote environmentally sustainable transportation (EST). These range from car sharing to hydrogen fueled buses to public transit promotion campaign. Each project is presen...
WP5 Evaluation: D54-D55 Evaluation Results V2 (V3)
Van Rosmalen, Peter
2011-01-01
Van Rosmalen, P. (2010, 19 May). WP5 Evaluation: D54-D55 Evaluation Results V2 (V3). Presentation at idSpace Final Review, Heerlen, The Netherlands: Open University of the Netherlands. idSpace-project.
Software V and V of PPS for Shin-Hanul Nuclear Power Plant Units 1 and 2
International Nuclear Information System (INIS)
Park, Cheollak; Kang, Dongpa; Choe, Changhui; Sohn, Sedo; Beak, Seungmin
2013-01-01
Software V and V processes determine whether the development products of a given activity conform to the requirements of that activity and whether the software satisfies its intended use and user needs. This paper introduces the software V and V activities and tasks performed during the software development life cycle performed during the software development life cycle of the Plant Protection System (PPS) for Shin-Hanul Nuclear Power Plant Units 1 and 2 (SHN 1 and 2). The PPS generates signals to actuate Reactor Trip (RT) and Engineered Safety Features (ESF) whenever monitored processes exceed predetermined limits, and the PPS software is classified safety critical and an independent V and V is thus required according to regulations, code and standards. The software V and V efforts, sufficiently disciplined and rigorous, are quite essential to demonstrate that the software development process is of a high quality. The software V and V of PPS for SHN 1 and 2 has been accomplished successfully with systematic V and V procedures and methods established until test phase in compliance with related code and standards. In particular, the use of automated tools such as LDRA and DOORS greatly has contributed to an improvement of a software quality, and a reduction of a verification time and human errors
Chapter No.5. Nuclear materials and physical protection of nuclear installations
International Nuclear Information System (INIS)
2002-01-01
fully attained. Regulatory activity in ensuring nuclear safety during the transport of nuclear materials and radioactive waste was made in compliance with the 'Atomic Act' and particular UJD decree. These documents contain requirements of the IAEA for the safe transport of radioactive materials. During the assessed period following transports were carried out: (a) 5 transports of fresh nuclear fuel from the Russian Federation to NPP Bohunice and 1 transport to NPP Mochovce; The fuel is stored in a fresh fuel storage of NPP Mochovce and NPP V-1 and V-2 Bohunice; (b) 3 transports of uranium concentrate from the Czech Republic to the Russian Federation via the territory of SR. All transports of nuclear materials in 2001 were carried out in compliance with conditions of the UJD permit, there were no significant shortcomings found
International Nuclear Information System (INIS)
1998-01-01
A brief account of activities in international co-operation carried out by the Nuclear power plants Jaslovske Bohunice in 1997 is presented. Professionality of the Bohunice NPPs staff was highly appreciated by inviting them to be the OSART team members
Double-push skating versus V2 and V1 skating on uphill terrain in cross-country skiing.
Stöggl, Thomas; Kampel, Wolfgang; Müller, Erich; Lindinger, Stefan
2010-01-01
The aims of the study were a) to compare the double-push skating technique with the V2 and the V1 skating techniques on an uphill terrain by a kinematic and kinetic analysis, b) to provide kinetic and kinematic data of the V1 technique at maximal skiing speeds, and c) to test the hypotheses that the double-push skating technique is faster compared with the V2 and the V1 skating techniques. Six elite skiers performed maximum speed sprints over a 60-m uphill section (7 degrees -10 degrees) using the double-push, the V2, and the V1 techniques. Pole and plantar forces and cycle characteristics were analyzed. The double-push skating technique was approximately 4.3% faster (P push and the V2 techniques demonstrated longer cycle lengths, lower cycle rates (both P push technique compared with the V2 technique (all P values push technique compared with the other two techniques (P push techniques compared with the V2 technique stress the mechanical advantage of those techniques on uphill terrain. Because of larger cycle lengths, lower cycle rate, longer recovery times, and equal poling frequency, the double-push technique might be seen as more economic on steep uphills compared with the V1 technique. From a tactical point of view compared with the V1 technique, the double-push technique needs less space due to less lateral displacement, and no technique transitions are necessary when entering and leaving an uphill section.
Neutron-induced 2.2 MeV background in gamma ray telescopes
International Nuclear Information System (INIS)
Zanrosso, E.M.; Long, J.L.; Zych, A.D.; White, R.S.; Hughes Aircraft Co., Los Angeles, CA)
1985-01-01
Neutron-induced gamma ray production is an important source of background in Compton scatter gamma ray telescopes where organic scintillator material is used. Most important is deuteron formation when atmospheric albedo and locally produced neutrons are thermalized and subsequently absorbed in the hydrogenous material. The resulting 2.2 MeV gamma line essentially represents a continuous isotropic source within the scintillator itself. Interestingly, using a scintillator material with a high hydrogen-to-carbon ratio to minimize the neutron-induced 4.4 MeV carbon line favors the np reaction. The full problem of neutron-induced background in Compton scatter telescopes has been previously discussed. Results are presented of observations with the University of California balloon-borne Compton scatter telescope where the 2.2 MeV induced line emission is prominently seen
Eel-Ernal võidutses sõjakool / Kristo Sinivee
Sinivee, Kristo
2011-01-01
Eel-Erna võistlus toimus 6.-7. mail Pärnumaal, sellel osales 21 võistkonda Kaitseliidust, kaitseväest, Kaitseväe Ühendatud Õppeasutustest, Politsei- ja Piirivalveametist ja vanglate relvastatud üksusest. Eel-Erna tulemused
Directory of Open Access Journals (Sweden)
Bruno Mello Mulato
2010-03-01
órficos, e 259 alelos foram encontrados. O número de alelos por lócus variou entre 2-21, com média de 8,63. Os acessos possuem uma quantidade significativa de alelos raros, sendo os acessos 19, 35, 63 e 65 os que apresentaram maior número de alelos exclusivos. Os acessos 75 e 79 são os mais similares e os acessos 31 e 35, e 40 e 78 são os mais divergentes. Foi observada baixa correlação entre resultados de SSR e EST-SSR. Portanto, uma análise adequada de diversidade em soja deve ser feita utilizando-se tanto marcadores microssatélites genômicos como funcionais. A diversidade genética dos acessos selecionados é alta, tendo sido encontrados cinco grupos e vários subgrupos. Observou-se moderada relação entre divergência genética e origem geográfica dos acessos.
PI-RADS v2: Current standing and future outlook.
Smith, Clayton P; Türkbey, Barış
2018-05-01
The Prostate Imaging-Reporting and Data System (PI-RADS) was created in 2012 to establish standardization in prostate multiparametric magnetic resonance imaging (mpMRI) acquisition, interpretation, and reporting. In hopes of improving upon some of the PI-RADS v1 shortcomings, the PI-RADS Steering Committee released PI-RADS v2 in 2015. This paper reviews the accuracy, interobserver agreement, and clinical outcomes of PI-RADS v2 and comments on the limitations of the current literature. Overall, PI-RADS v2 shows improved sensitivity and similar specificity compared to PI-RADS v1. However, concerns exist regarding interobserver agreement and the heterogeneity of the study methodology.
Balasubramanian, Preetha; Williams, Constance; Shapiro, Mariya B; Sinangil, Faruk; Higgins, Keith; Nádas, Arthur; Totrov, Maxim; Kong, Xiang-Peng; Fiore-Gartland, Andrew J; Haigwood, Nancy L; Zolla-Pazner, Susan; Hioe, Catarina E
2018-01-11
Immunization with HIV AIDSVAX gp120 vaccines in the phase III VAX003 and VAX004 trials did not confer protection. To understand the shortcomings in antibody (Ab) responses induced by these vaccines, we evaluated the kinetics of Ab responses to the V1V2 and V3 regions of gp120 and the induction of Ab-mediated antiviral functions during the course of 7 vaccinations over a 30.5-month period. Plasma samples from VAX003 and VAX004 vaccinees and placebo recipients were measured for ELISA-binding Abs and for virus neutralization, Ab-dependent cellular phagocytosis (ADCP), and Ab-dependent cellular cytotoxicity (ADCC). Ab responses to V1V2 and V3 peaked after 3 to 4 immunizations and declined after 5 to 7 immunizations. The deteriorating responses were most evident against epitopes in the underside of the V1V2 β-barrel and in the V3 crown. Correspondingly, vaccinees demonstrated higher neutralization against SF162 pseudovirus sensitive to anti-V1V2 and anti-V3 Abs after 3 or 4 immunizations than after 7 immunizations. Higher levels of ADCP and ADCC were also observed at early or mid-time points as compared with the final time point. Hence, VAX003 and VAX004 vaccinees generated V1V2- and V3-binding Abs and functional Abs after 3 to 4 immunizations, but subsequent boosts did not maintain these responses.
Energy Technology Data Exchange (ETDEWEB)
Julien, J [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1967-05-15
Different kinds of experiments and analysis methods allowing to achieve neutron resonances parameters in the low energy range (1 eV {yields} 5000 eV) are described. A great deal of effort to improve experimental conditions and data processing in order to know the spin value J = I {+-} 1/2 has been spent. The time of flight method was used. A few target nuclei I = 3/2 and 1 = 1/2 have been studied. For I = 3/2 (Ga, As, 3r, Au) we find S{sub o} J = 2 {approx_equal} 2 S{sub o} J = 1 and S{sub o} J = 1 {approx_equal} S{sub o} J = 0 for I = 1/2 (Tm, Pt) but {sup 77}Se. Fluctuations of the total radiative width {gamma}{sub {gamma}} depend on the spin value I = I {+-} 1/2 when E1 transition, are enhanced for one of the both spin states. The magnitude of these fluctuations can be explained of the strength of E1 transitions (E{sub {gamma}} {approx} 7 MeV) is supposed to be proportional to E{sup 5}{sub {gamma}} instead of E{sup 3}{sub {gamma}}. The distribution of levels spacings against spin value J are considered and are compared to theoretical predictions. (author) [French] On decrit les differentes methodes d'analyse permettant d'obtenir les parametres des resonances de neutron dans le domaine d'energie 1 eV {yields} 5000 eV. Un effort particulier a ete fait pour connaitre la valeur du spin J = I {+-} 1/2. Les types d'experience et les analyses des donnees, developpes et ameliores pour determiner J sont decrits. Les resultats obtenus ont permis l'etude de differentes proprietes en fonction du spin J. On trouve: S{sub o} J 2 {approx_equal} 2 S{sub o} J = 1 pour les noyaux I = 3/2 etudies (Ga, As, Br, Au) et S{sub o} J = 1 {approx_equal} S{sub o} J = 0 Pour le Tm et {sup 195}Pt de spin I = 1/2. On constate que les largeurs radiatives totales {gamma}{sub {gamma}} fluctuent si des transitions E1 aux premiers etats excites sont favorisees. Ces fluctuations peuvent etre expliquees si on suppose que les intensites de ces transitions sont proportionnelles a E{sup 5}{sub {gamma
Energy Technology Data Exchange (ETDEWEB)
Nakano, K.; Yoshizaki, H. [Department of Materials Science, Osaka Prefecture University, Sakai, Osaka 599-8531 (Japan); Saitoh, Y. [Takasaki Advanced Radiation Research Institute, Japan Atomic Energy Agency, Takasaki, Gunma 370-1292 (Japan); Ishikawa, N. [Tokai Research and Development Center, Tokai-mura, Naka-gun, Ibaraki 319-1195 (Japan); Iwase, A., E-mail: iwase@mtr.osakafu-u.ac.jp [Department of Materials Science, Osaka Prefecture University, Sakai, Osaka 599-8531 (Japan)
2016-03-01
To simulate energetic neutron irradiation effects, yttria-stabilized zirconia (YSZ) which is one of the major materials for electrical corrosion potential sensors (ECP sensors) was irradiated with heavy ions at energies ranging from 7.3 MeV to 2.2 GeV. Ion irradiation effects on the lattice structure were analyzed using the X-ray diffraction (XRD). The increase in lattice constant was induced by the ion irradiation. It was dominated by the elastic collision process and not by the electronic excitation process. The lattice disordering which was observed as a broadening of XRD peaks was also induced by the irradiation especially for 200 MeV Xe ion irradiation. The present result suggests that the expansion and/or the disordering of YSZ lattice induced by energetic neutrons may affect the durability of a joint interface between a metal housing and YSZ membrane for the usage of ECP sensors in nuclear power reactors.
Wheat EST resources for functional genomics of abiotic stress
Directory of Open Access Journals (Sweden)
Links Matthew G
2006-06-01
Full Text Available Abstract Background Wheat is an excellent species to study freezing tolerance and other abiotic stresses. However, the sequence of the wheat genome has not been completely characterized due to its complexity and large size. To circumvent this obstacle and identify genes involved in cold acclimation and associated stresses, a large scale EST sequencing approach was undertaken by the Functional Genomics of Abiotic Stress (FGAS project. Results We generated 73,521 quality-filtered ESTs from eleven cDNA libraries constructed from wheat plants exposed to various abiotic stresses and at different developmental stages. In addition, 196,041 ESTs for which tracefiles were available from the National Science Foundation wheat EST sequencing program and DuPont were also quality-filtered and used in the analysis. Clustering of the combined ESTs with d2_cluster and TGICL yielded a few large clusters containing several thousand ESTs that were refractory to routine clustering techniques. To resolve this problem, the sequence proximity and "bridges" were identified by an e-value distance graph to manually break clusters into smaller groups. Assembly of the resolved ESTs generated a 75,488 unique sequence set (31,580 contigs and 43,908 singletons/singlets. Digital expression analyses indicated that the FGAS dataset is enriched in stress-regulated genes compared to the other public datasets. Over 43% of the unique sequence set was annotated and classified into functional categories according to Gene Ontology. Conclusion We have annotated 29,556 different sequences, an almost 5-fold increase in annotated sequences compared to the available wheat public databases. Digital expression analysis combined with gene annotation helped in the identification of several pathways associated with abiotic stress. The genomic resources and knowledge developed by this project will contribute to a better understanding of the different mechanisms that govern stress tolerance in
Maria Avdjuško väntab Priimäest filmi / Verni Leivak
Leivak, Verni, 1966-
2009-01-01
Näitlejanna debüteerib režissöörina, vändates lühimängufilmi, kus Linnar Priimägi peategelasena kehastab iseennast. Operaatoriks on Istvan Borbas Rootsist, näitlejateks veel M. Avdjuško ja Taavi Eelmaa
Electrochemical sensing property of Mn doped V2O5 nanoparticles
International Nuclear Information System (INIS)
Suresh, R.; Giribabu, K.; Manigandan, R.; Narayanan, V.; Vijayalakshmi, L.; Stephen, A.
2012-01-01
In this study, pure V 2 O 5 and Mn doped V 2 O 5 nanoparticles were synthesized by thermal decomposition method. The FT-IR spectrum of Mn doped V 2 O 5 shows the bands at 822 and 1027 cm -1 which essentiaIIy of crystalline V 2 O 5 . Further, the bands observed in Mn doped V 2 O 5 are all shifted to lower wave number than the V 2 O 5 . The optical property of the nanocomposite was studied using UV-Visible absorption spectroscopy. The XRD data also revealed that the Mn doped V 2 O 5 obtained had an orthorhombic structure. The diffraction peaks in Mn doped V 2 O 5 nanoparticles are similar to that of V 2 O 5 . There was no indication of any other impurities in the sample. However, all the peaks of V 2 O 5 are slightly shifted to tower 2θ values. The FE-SEM image of V 2 O 5 shows that the particles adopt ellipse-like particles with different sizes due to aggregation. The synthesized nanoparticles were used to modify glassy carbon electrode (GCE) and the modified electrode was used to detect uric acid (UA) by voltammetric techniques. The effects of Mn on the optical, morphological and electrochemical detecting property of V 2 O 5 have also been studied. (author)
Directory of Open Access Journals (Sweden)
Clara Inés Sánchez Arciniegas
2002-11-01
Full Text Available ¿Existe alguna armonía entre el conocimiento y la estética? Sin duda alguna el hombre con conocimiento y sin virtud de la estética es un autómata; este necesita de las diferentes manifestaciones en las que se encuentra plasmada y necesita recordarlas continuamente. La estética como doctrina de conocimiento no es reciente, en el siglo xviii cuando por primera vez se define teóricamente hasta nuestros días en la Universidad actual. Esta última aparentemente menos evidente debido a las nuevas formas de aprendizaje con herramientas tecnológicas muy avanzadas y contraria a la imagen del universitario que hace dos siglos como complemento a su educación se distraía a través del Gran Tour, partida que tiene el turismo para fomentar el goce estético. ¿Cuál es entonces la relación entre distracción y formación? Se debe entonces reflexionar y comprender que el conocimiento interdisciplinario y la metodología debe procurar en los hombres actitudes adecuadas frente a la cultura y el arte a través del conocimiento.
Electrochemical Behavior of Molten V2O5-K2S2O7-KHSO4 Systems
DEFF Research Database (Denmark)
Petrushina, Irina; Bjerrum, Niels; Berg, Rolf W.
1997-01-01
The electrochemical behavior of K2S2O7-KHSO4-V2O5, K2S2O7-V2O4 and K2S2O7-KHSO4-V2O4 melts was studied in argon and SO2/air atmospheres using a gold electrode. In order to identify the voltammetric waves due to KHSO4, molten KHSO4 and mixtures of K2S2O7-KHSO4 were investigated by voltammetry...
Energy Technology Data Exchange (ETDEWEB)
Krueger, Manja; Koeppe-Grabow, Birte [Magdeburg Univ. (Germany)
2017-05-15
Vanadium silicide alloys are potentially interesting high temperature materials, since they combine high mechanical strength at temperatures of up to 1 000 C with a low density. In this study, the microstructures of innovative V-Si-B high temperature materials are examined using different analytical methods. The selected V-9Si-13B model alloy was manufactured using a powder metallurgical process route as well as an ingot metallurgical process. The alloys show a vanadium solid solution phase as well as the high-strength silicide phases V{sub 3}Si and V{sub 5}SiB{sub 2}. Especially for the powder metallurgically fabricated alloy, showing finely dispersed phases, the quantification of microstructural constituents is difficult. The phases, however, can be separated from one another via computer tomography.
Glass formation in AgI:Ag2O:V2O5 and AgI:Ag2O:(V2O5+B2O3) systems
International Nuclear Information System (INIS)
Kaushik, R.; Hariharan, K.
1988-01-01
Transport properties of glasses in the system AgI:Ag 2 O: V 2 O 5 and AgI:Ag 2 O: (V 2 O 5 +B 2 O 3 ) have ben investigated. It was found that, at high AgI concentrations, the addition of another glass former (B 2 O 3 ) did not improve the conduction characteristics of the pure vanadate glasses, the best conducting composition of which had ambient temperature, ionic conductivity comparable to that of conventional liquid electrolytes. The highest conducting composition was used as an electrolyte in the study of silver solid state cells. The discharge characteristics of different cells fabricated with the glassy electrolyte, have been compared with those having the best conducting polycrystalline ompositions as electrolytes. 11 refs.; 4 figs.; 1 table
Robust model predictive cooperative adaptive cruise control subject to V2V impairments
Van Nunen, Ellen; Verhaegh, Jan; Silvas, Emilia; Semsar-Kazerooni, Elham; Van De Wouw, Nathan
2018-01-01
To improve traffic throughput, Cooperative Adaptive Cruise Control (CACC) has been proposed as a solution. The usage of Vehicle-to-Vehicle (V2V) communication enables short following distances, thereby increasing road capacity and fuel reduction (especially for trucks). Control designs for CACC use
PAVE: Program for assembling and viewing ESTs
Directory of Open Access Journals (Sweden)
Bomhoff Matthew
2009-08-01
Full Text Available Abstract Background New sequencing technologies are rapidly emerging. Many laboratories are simultaneously working with the traditional Sanger ESTs and experimenting with ESTs generated by the 454 Life Science sequencers. Though Sanger ESTs have been used to generate contigs for many years, no program takes full advantage of the 5' and 3' mate-pair information, hence, many tentative transcripts are assembled into two separate contigs. The new 454 technology has the benefit of high-throughput expression profiling, but introduces time and space problems for assembling large contigs. Results The PAVE (Program for Assembling and Viewing ESTs assembler takes advantage of the 5' and 3' mate-pair information by requiring that the mate-pairs be assembled into the same contig and joined by n's if the two sub-contigs do not overlap. It handles the depth of 454 data sets by "burying" similar ESTs during assembly, which retains the expression level information while circumventing time and space problems. PAVE uses MegaBLAST for the clustering step and CAP3 for assembly, however it assembles incrementally to enforce the mate-pair constraint, bury ESTs, and reduce incorrect joins and splits. The PAVE data management system uses a MySQL database to store multiple libraries of ESTs along with their metadata; the management system allows multiple assemblies with variations on libraries and parameters. Analysis routines provide standard annotation for the contigs including a measure of differentially expressed genes across the libraries. A Java viewer program is provided for display and analysis of the results. Our results clearly show the benefit of using the PAVE assembler to explicitly use mate-pair information and bury ESTs for large contigs. Conclusion The PAVE assembler provides a software package for assembling Sanger and/or 454 ESTs. The assembly software, data management software, Java viewer and user's guide are freely available.
PAVE: program for assembling and viewing ESTs.
Soderlund, Carol; Johnson, Eric; Bomhoff, Matthew; Descour, Anne
2009-08-26
New sequencing technologies are rapidly emerging. Many laboratories are simultaneously working with the traditional Sanger ESTs and experimenting with ESTs generated by the 454 Life Science sequencers. Though Sanger ESTs have been used to generate contigs for many years, no program takes full advantage of the 5' and 3' mate-pair information, hence, many tentative transcripts are assembled into two separate contigs. The new 454 technology has the benefit of high-throughput expression profiling, but introduces time and space problems for assembling large contigs. The PAVE (Program for Assembling and Viewing ESTs) assembler takes advantage of the 5' and 3' mate-pair information by requiring that the mate-pairs be assembled into the same contig and joined by n's if the two sub-contigs do not overlap. It handles the depth of 454 data sets by "burying" similar ESTs during assembly, which retains the expression level information while circumventing time and space problems. PAVE uses MegaBLAST for the clustering step and CAP3 for assembly, however it assembles incrementally to enforce the mate-pair constraint, bury ESTs, and reduce incorrect joins and splits. The PAVE data management system uses a MySQL database to store multiple libraries of ESTs along with their metadata; the management system allows multiple assemblies with variations on libraries and parameters. Analysis routines provide standard annotation for the contigs including a measure of differentially expressed genes across the libraries. A Java viewer program is provided for display and analysis of the results. Our results clearly show the benefit of using the PAVE assembler to explicitly use mate-pair information and bury ESTs for large contigs. The PAVE assembler provides a software package for assembling Sanger and/or 454 ESTs. The assembly software, data management software, Java viewer and user's guide are freely available.
International Nuclear Information System (INIS)
Oszwaldowski, S.; Jarosz, M.
1997-01-01
Complex equilibria in multiligand niobium(V) systems with 2-(5-bromo-2-pyridilazo)-5-diethyl aminophenol (5-Br-PADAP), tartrate and hydrogen peroxide and vanadium(V) with 5-Br-PADP and tartrate were evaluated by reversed-phase high-performance liquid chromatography (RP-HPLC) using C 18 column and VIS detection at 590 nm. In Nb(V)-H 2 O 2 -tartrate-(5-Br P ADAP) system formation of multiligand niobium complex, non-reactive towards 5-Br-PADAP, was postulated. For V(V) system distribution of metal ion between V(V)-(5-Br-PADAP) binary and V(V)-tartrate-(5-Br-PADAP) ternary complexes were evaluated. On this base it was proved, that coloured ternary vanadium complex is only an intermediate stage in the formation of stable V(V)-tartrate binary complex. (author). 14 refs, 7 figs
User's manual for seismic analysis code 'SONATINA-2V'
International Nuclear Information System (INIS)
Hanawa, Satoshi; Iyoku, Tatsuo
2001-08-01
The seismic analysis code, SONATINA-2V, has been developed to analyze the behavior of the HTTR core graphite components under seismic excitation. The SONATINA-2V code is a two-dimensional computer program capable of analyzing the vertical arrangement of the HTTR graphite components, such as fuel blocks, replaceable reflector blocks, permanent reflector blocks, as well as their restraint structures. In the analytical model, each block is treated as rigid body and is restrained by dowel pins which restrict relative horizontal movement but allow vertical and rocking motions between upper and lower blocks. Moreover, the SONATINA-2V code is capable of analyzing the core vibration behavior under both simultaneous excitations of vertical and horizontal directions. The SONATINA-2V code is composed of the main program, pri-processor for making the input data to SONATINA-2V and post-processor for data processing and making the graphics from analytical results. Though the SONATINA-2V code was developed in order to work in the MSP computer system of Japan Atomic Energy Research Institute (JAERI), the computer system was abolished with the technical progress of computer. Therefore, improvement of this analysis code was carried out in order to operate the code under the UNIX machine, SR8000 computer system, of the JAERI. The users manual for seismic analysis code, SONATINA-2V, including pri- and post-processor is given in the present report. (author)
La metaphore est-elle la marque de l’insuffisance de l’esprit?
Directory of Open Access Journals (Sweden)
Isabelle Oliveira
2010-01-01
Full Text Available L’une des caractéristiques les plus communément reconnues à la discipline de la terminologie est sa conceptualité. Au contraire de l’opinion émise sur la métaphore, la terminologie s’efforce de travailler à partir de notions précises dont le sens doit être délimité et l’articulation à d’autres notions explicitée afin de bannir les ambiguïtés et les fausses évidences qu’elles véhiculent. Elle se distingue aussi du texte poétique caractérisé en particulier par la richesse des images et le jeu sur les signifiants. On comprend dès lors pourquoi la métaphore apparaît de prime abord comme une ennemie du champ de la terminologie qu’il faudrait bannir à tout prix. Cette figure de rhétorique consistant en un transport de sens risque à tout moment de rendre inopérant l’effort d’univocité et de rigueur du travail du terminologue. Mais la métaphore n’est pourtant pas absente des textes de spécialité. Il faut dès lors se demander si cette présence est « accidentelle”, contingente, ou si elle est incontournable et signifiante. Pour cela, il nous faudra étudier à la fois la place de la métaphore dans le texte de spécialité, et le discours des scientifiques portant sur elle. Mais une telle démarche nous laisse prisonnier de la dichotomie entre concept et métaphore et masque peutêtre une parenté inaperçue entre eux. Si le concept est habité par la métaphore, qu’en est-il du discours de spécialité? N’est-il pas réduit à n’être qu’un vaste poème qui ne s’avouerait pas comme tel? Est-elle seulement une figure de style ou aurait-elle un impact qui outrepasseraitsa modeste fonction discursive ? Il semble bien, même si le débat sur la métaphore et son usage est loin d’être clos. Notre théorie s’inscrit plutôt dans le sens d’une réévaluation du sens, d’une extension toujours plus grande de l’impact de ce trope qui, plus qu’une simple finalité esthétique, aurait une
Study of the /sup 12/N 2. 43 MeV level. [Differential cross sections; 44 MeV /sup 3/He; 52 MeV p
Energy Technology Data Exchange (ETDEWEB)
Cecil, F E; Shepard, J R; Sercely, R R; Peterson, R J [Colorado Univ., Boulder (USA). Nuclear Physics Lab.; King, N S.P. [California Univ., Davis (USA). Crocker Nuclear Lab.
1976-10-11
The differential cross sections have been measured for the reactions /sup 12/C(/sup 3/He, /sup 3/He')/sup 12/C(17.77 MeV 0/sup +/ T = 1) and /sup 12/C(/sup 3/He, t)/sup 12/N(2.43 MeV) at Esub(/sup 3/He) = 44 MeV. The similar shapes of the angular distributions and the relative magnitudes of the cross sections suggest that the /sup 12/N 2.43 MeV level is the 0/sup +/ T = 1 analog to the /sup 12/C 17.77 MeV level. The reaction /sup 14/N(p, t)/sup 12/N(2.43 MeV) at Esub(p) = 52 MeV is also studied. The strength with which this level is excited in this reaction is consistent with reasonable two-step calculations assuming the 2.43 MeV level to have Jsup(..pi..) = 0/sup +/.
International Nuclear Information System (INIS)
Dobak, Dobroslav
2002-01-01
This paper is an effort to summarize the way Slovak Bohunice NPP has gone through since the historical change in the Middle and Eastern European countries. Milestones on the way were: 1989 - change of political system; increasing interest of the public appearance; creation of work capacities - personnel and technical; education/exchange with Western countries; 1994 - establishment of Foreign Affairs and PR Department reporting directly to the NPP manager; application of various approaches, some observed from other countries; creation of utility policy - place of PR in the company; establishment of QA system - description of PR activities, goals, interlinks etc.; annual planning process including activities, finance, education (training). Lessons learned are: the NPP managers were not prepared; the public was not (and still is not) prepared to obtain specific information; education is crucial in opinion winning; simple overtake of methods from others is not always applicable; strategy and feedback are necessary. Special case was the early closure Bohunice V1 NPP
International Nuclear Information System (INIS)
2001-01-01
In this chapter used abbreviations and radiation safety of NPPs in Slovak Republic are presented. Results of monitoring of NPP Bohunice V-1 and V-2 as well as NPP Mochovce are presented. A brief account of activities carried out by the Nuclear Regulatory Authority of the Slovak Republic in 2000 is presented. The collective dose is one of the fundamental indicators to assess the level of nuclear safety and safety culture. This is the total dose of both external and internal exposure of the whole of the body measured with a personal dosimeter and a calculated internal exposure over a certain period of time. Measured doses to the utility personnel, the staff of supplier organisations and official working visits are included
Quasielastic 3He(e,e'p)2H Reaction at Q2=1.5 GeV2 for Recoil Momenta up to 1 GeV/c
International Nuclear Information System (INIS)
Rvachev, M. M.; Benmokhtar, F.; Penel-Nottaris, E.; Aniol, K. A.; Bertozzi, W.; Boeglin, W. U.; Butaru, F.; Calarco, J. R.; Chai, Z.; Chang, C. C.; Chen, J.-P.; Chudakov, E.; Cisbani, E.; Cochran, A.; Cornejo, J.; Dieterich, S.; Djawotho, P.; Duran, W.; Epstein, M. B.; Finn, J. M.; Fissum, K. G.; Frahi-Amroun, A.; Frullani, S.; Furget, C.; Garibaldi, F.; Gayou, O.; Gilad, S.; Gilman, R.; Glashausser, C.; Hansen, J.-O.; Higinbotham, D. W.; Hotta, A.; Hu, B.; Iodice, M.; Iomni, R.; Jager, C. W. de; Jiang, X.; Jones, M. K.; Kelly, J. J.; Kox, S.; Kuss, M.; Laget, J. M.; De Leo, R.; LeRose, J. J.; Liatard, E.; Lindgren, R.; Liyanage, N.; Lourie, R. W.; Malov, S.; Margaziotis, D. J.; Markowitz, P.; Merchez, F.; Michaels, R.; Mitchell, J.; Mougey, J.; Perdrisat, C. F.; Punjabi, V. A.; Ransome, R. D.; Saha, A.; Simon, D.; Strauch, S.; Suleiman, R.; Tamae, T.; Templon, J. A.; Tieulent, R.; Ueno, H.; Ulmer, P. E.; Urciuoli, G. M.; Voutier, E.; Wijesooriya, K.; Wojtsekhowski, B.
2005-01-01
We have studied the quasielastic 3He(e,e'p)2H reaction in perpendicular coplanar kinematics, with the energy and the momentum transferred by the electron fixed at 840 MeV and 1502 MeV/c, respectively. The 3He(e,e'p)2H cross section was measured for missing momenta up to 1000 MeV/c, while the ATL asymmetry was extracted for missing momenta up to 660 MeV/c. For missing momenta up to 150 MeV/c, the cross section is described by variational calculations using modern 3He wave functions. For missing momenta from 150 to 750 MeV/c, strong final-state interaction effects are observed. Near 1000 MeV/c, the experimental cross section is more than an order of magnitude larger than predicted by available theories. The ATL asymmetry displays characteristic features of broken factorization with a structure that is similar to that generated by available models
Inferindo personalidade por meio de estórias
Directory of Open Access Journals (Sweden)
Guilherme Gomes Cardoso
2014-11-01
Full Text Available Recentemente aspectos sutis do ser humano começaram a ser estudados e utilizados por computadores, um desses é a personalidade. Existem vários estudos que analisam como estruturá-la e extraí-la computacionalmente. No entanto, um dos gargalos no seu estado da arte atual é a forma não sutil para inferir personalidade do usuário. Este trabalho tem como objetivo mostrar o relato de uma experiência que demonstra os passos iniciais e os resultados parciais de uma pesquisa em andamento sobre um método alternativo e mais sutil para inferir a personalidade do usuário. Os resultados apresentam o uso de histórias como uma abordagem promissora, entretanto demanda novos testes baseados em metodologias estatisticamente mais consistentes.
Linking retinotopic fMRI mapping and anatomical probability maps of human occipital areas V1 and V2.
Wohlschläger, A M; Specht, K; Lie, C; Mohlberg, H; Wohlschläger, A; Bente, K; Pietrzyk, U; Stöcker, T; Zilles, K; Amunts, K; Fink, G R
2005-05-15
Using functional MRI, we characterized field sign maps of the occipital cortex and created three-dimensional maps of these areas. By averaging the individual maps into group maps, probability maps of functionally defined V1 or V2 were determined and compared to anatomical probability maps of Brodmann areas BA17 and BA18 derived from cytoarchitectonic analysis (Amunts, K., Malikovic, A., Mohlberg, H., Schormann, T., Zilles, K., 2000. Brodmann's areas 17 and 18 brought into stereotaxic space-where and how variable? NeuroImage 11, 66-84). Comparison of areas BA17/V1 and BA18/V2 revealed good agreement of the anatomical and functional probability maps. Taking into account that our functional stimulation (due to constraints of the visual angle of stimulation achievable in the MR scanner) only identified parts of V1 and V2, for statistical evaluation of the spatial correlation of V1 and BA17, or V2 and BA18, respectively, the a priori measure kappa was calculated testing the hypothesis that a region can only be part of functionally defined V1 or V2 if it is also in anatomically defined BA17 or BA18, respectively. kappa = 1 means the hypothesis is fully true, kappa = 0 means functionally and anatomically defined visual areas are independent. When applying this measure to the probability maps, kappa was equal to 0.84 for both V1/BA17 and V2/BA18. The data thus show a good correspondence of functionally and anatomically derived segregations of early visual processing areas and serve as a basis for employing anatomical probability maps of V1 and V2 in group analyses to characterize functional activations of early visual processing areas.
Nécrologie: Ivan Impens (1935-2014. Celui qui ne dépasse pas son maître est un pauvre disciple
Directory of Open Access Journals (Sweden)
Bogaert, J.
2014-01-01
Full Text Available Obituary: Ivan Impens (1935-2014. Poor is the disciple who does not surpass his master. La gale sarcoptique ovine est la forme de gale la plus répandue au Nord-est algérien. Elle est due à Sarcoptes scabiei var. ovis. Une vaste enquête a été entreprise afin de déterminer la prévalence et le profil saisonnier de la maladie. Durant une période d'une année, plusieurs aspects ont été étudiés au Nord-est algérien. La prévalence moyenne de la maladie s'élevait à 12,02% sur les marchés à bestiaux de trois régions (Souk Ahras, Guelma et Tebessa. La période à haut risque s'est étalée de décembre à mars; quant au reste de l'année, le taux d'infestation est faible voire nul. L'infestation clinique a atteint 60% des cheptels de la région d'El-Tarf, et 49,5% des ovins examinés se sont révélés galeux. La maladie frappe les animaux de tout âge avec un taux d'infestation de 50,5% chez les brebis, 37% chez les agneaux et 22,3% chez les béliers. L'étude des aspects lésionnels et cliniques de la population ovine parasitée à El-Tarf a révélé que 55% d'individus présentaient une atteinte du museau, 30% montraient une extension des lésions crouteuses vers le chanfrein et le front, 10% avaient la tête totalement envahie par les croutes et uniquement 5% révélaient une extension vers les extrémités. Il semble que la charge parasitaire totale a une forte corrélation avec l'étendue des lésions.
ESAP plus: a web-based server for EST-SSR marker development.
Ponyared, Piyarat; Ponsawat, Jiradej; Tongsima, Sissades; Seresangtakul, Pusadee; Akkasaeng, Chutipong; Tantisuwichwong, Nathpapat
2016-12-22
Simple sequence repeats (SSRs) have become widely used as molecular markers in plant genetic studies due to their abundance, high allelic variation at each locus and simplicity to analyze using conventional PCR amplification. To study plants with unknown genome sequence, SSR markers from Expressed Sequence Tags (ESTs), which can be obtained from the plant mRNA (converted to cDNA), must be utilized. With the advent of high-throughput sequencing technology, huge EST sequence data have been generated and are now accessible from many public databases. However, SSR marker identification from a large in-house or public EST collection requires a computational pipeline that makes use of several standard bioinformatic tools to design high quality EST-SSR primers. Some of these computational tools are not users friendly and must be tightly integrated with reference genomic databases. A web-based bioinformatic pipeline, called EST Analysis Pipeline Plus (ESAP Plus), was constructed for assisting researchers to develop SSR markers from a large EST collection. ESAP Plus incorporates several bioinformatic scripts and some useful standard software tools necessary for the four main procedures of EST-SSR marker development, namely 1) pre-processing, 2) clustering and assembly, 3) SSR mining and 4) SSR primer design. The proposed pipeline also provides two alternative steps for reducing EST redundancy and identifying SSR loci. Using public sugarcane ESTs, ESAP Plus automatically executed the aforementioned computational pipeline via a simple web user interface, which was implemented using standard PHP, HTML, CSS and Java scripts. With ESAP Plus, users can upload raw EST data and choose various filtering options and parameters to analyze each of the four main procedures through this web interface. All input EST data and their predicted SSR results will be stored in the ESAP Plus MySQL database. Users will be notified via e-mail when the automatic process is completed and they can
Câncer de estômago: fatores de risco
Directory of Open Access Journals (Sweden)
Anna Valéria de Britto
Full Text Available Há cinqüenta anos o câncer de estômago vem perdendo a importância em termos de morbi-mortalidade em países considerados de primeiro mundo. Isso não ocorre no Brasil. Os principais fatores de risco evidenciados a partir de estudos epidemiológicos em várias populações do mundo e associados a essa neoplasia são alguns padrões de dieta. Com a descoberta do papel carcinogênico das nitrosaminas e do potencial anti-oxidante da vitamina C, algumas das associações entre câncer gástrico e padrões de dieta passaram a ser parcialmente entendidas. Com a descrição da Helicobacter pylori em 1983 e as evidências da relação dessa bactéria com certos processos patológicos do estômago, alguns precursores do câncer gástrico, novos elementos foram agregados ao processo fisiopatológico dessa entidade. O conhecimento hoje adquirido sobre a fisiopatologia do câncer gástrico, mesmo que parcial, fornece perspectivas estimulantes para prevenção e diagnóstico precoce.
Câncer de estômago: fatores de risco
Directory of Open Access Journals (Sweden)
Britto Anna Valéria de
1997-01-01
Full Text Available Há cinqüenta anos o câncer de estômago vem perdendo a importância em termos de morbi-mortalidade em países considerados de primeiro mundo. Isso não ocorre no Brasil. Os principais fatores de risco evidenciados a partir de estudos epidemiológicos em várias populações do mundo e associados a essa neoplasia são alguns padrões de dieta. Com a descoberta do papel carcinogênico das nitrosaminas e do potencial anti-oxidante da vitamina C, algumas das associações entre câncer gástrico e padrões de dieta passaram a ser parcialmente entendidas. Com a descrição da Helicobacter pylori em 1983 e as evidências da relação dessa bactéria com certos processos patológicos do estômago, alguns precursores do câncer gástrico, novos elementos foram agregados ao processo fisiopatológico dessa entidade. O conhecimento hoje adquirido sobre a fisiopatologia do câncer gástrico, mesmo que parcial, fornece perspectivas estimulantes para prevenção e diagnóstico precoce.
Lifescience Database Archive (English)
Full Text Available Q2PFD7|PSD3_MOUSE PH and SEC7 domain-containing protein 3 OS=... 32 3.1 sp|P16289|L_RABVS Large structural protein OS=Rabies... virus (stra... 31 4.0 sp|P11213|L_RABVP Large structural protein OS=Rabies virus (stra... 3...1 4.0 sp|A3RM23|L_RABVI Large structural protein OS=Rabies virus (stra... 31 4.0 sp|Q8B6J5|L_RABVH Large structural protein OS=Rabies... virus (stra... 31 4.0 sp|A3F5L9|L_RABVE Large structural protein OS=Rabies...PH and SEC7 domain-containing protein 3 OS=... 30 8.9 sp|Q0GBY0|L_RABVR Large structural protein OS=Rabies v
Prime note sulla tutela penale dei culti nei Paesi dell’Est Europa
Directory of Open Access Journals (Sweden)
Giovanni Cimbalo
2011-05-01
Full Text Available Testo della relazione tenuta al Convegno “La Carta e la Corte” (Ferrara, 27 ottobre 2007 destinata alla pubblicazione negli Atti. SOMMARIO: 1. Alcune considerazioni preliminari sullo status delle Confessioni religiose nei paesi dell’Est Europa - 2. I nuovi orientamenti del diritto penale nell’Est Europa - 3. Le norme statali in materia di tutela penale dei culti e del sentimento religioso. 3. Le norme penali relative ai culti e a al sentimento religioso prima del 1992 nei Paesi dell’Est Europa - 4. Tipologie e tecniche legislative di tutela penale dei culti dopo il 1992 nei Paesi dell’Est Europa - 5. Alcune sommarie considerazioni.
Draft Genome Sequences of Vibrio alginolyticus Strains V1 and V2, Opportunistic Marine Pathogens
DEFF Research Database (Denmark)
Castillo, Daniel; D'Alvise, Paul; Kalatzis, Panos G.
2015-01-01
We announce the draft genome sequences of Vibrio alginolyticus strains V1 and V2, isolated from juvenile Sparus aurata and Dentex dentex, respectively, during outbreaks of vibriosis. The genome sequences are 5,257,950 bp with a G+C content of 44.5% for V. alginolyticus V1 and 5,068,299 bp with a G...
Synthesis, band structure, and optical properties of Ba2ZnV2O8
International Nuclear Information System (INIS)
Chen, D.-G.; Cheng, W.-D.; Wu, D.-S.; Zhang, H.; Zhang, Y.-C.; Gong, Y.-J.; Kan, Z.-G.
2004-01-01
A novel compound Ba 2 ZnV 2 O 8 has been synthesized in high temperature solution reaction and its crystal structure has been characterized by means of single crystal X-ray diffraction analysis. It crystallizes in monoclinic system and belongs to space group P2 1 /c with a=7.9050(16), b=16.149(3), c=6.1580(12)A, β=90.49(3). It builds up from 1-D branchy chains of [ZnV 2 O 8 4- ] ∞ , and the Ba 2+ cations are located in the space among these chains. The IR spectrum, ultraviolet-visible diffuse reflection integral spectrum and fluorescent spectra of this compound have been investigated. The calculated results of energy band structure by the density functional theory method show that the solid-state compound of Ba 2 ZnV 2 O 8 is an insulator with direct band gap of 3.48eV. The calculated total and partial density of states indicate that the top valence bands are contributions from the mixings of O-2p, V-3d, and Zn-3d states and low conduction bands mostly originate from unoccupied antibonding states between the V-3d and O-2p states. The V-O bonds are mostly covalence characters and Zn-O bonds are mostly ionic interactions, and the ionic interaction strength is stronger between the Ba-O than between the Zn-O. The refractive index of n x , n y , and n z is estimated to be 1.7453, 1.7469, and 1.7126, respectively, at wavelength of 1060nm for Ba 2 ZnV 2 O 8 crystal
SNP-finding in pig mitochondrial ESTs
DEFF Research Database (Denmark)
Scheibye-Alsing, Karsten; Cirera Salicio, Susanna; Gilchrist, M.J.
2008-01-01
The Sino-Danish pig genome project produced 685 851 ESTs (Gorodkin et al. 2007), of which 41 499 originated from the mitochondrial genome. In this study, the mitochondrial ESTs were assembled, and 374 putative SNPs were found. Chromatograms for the ESTs containing SNPs were manually inspected, an......, and 112 total (52 non-synonymous) SNPs were found to be of high confidence (five of them are close to disease-causing SNPs in humans). Nine of the high-confidence SNPs were tested experimentally, and eight were confirmed. The SNPs can be accessed online at http://pigest.ku.dk/more.mito...
Directory of Open Access Journals (Sweden)
Carlos Augusto Rincón-Soto
2014-01-01
Full Text Available La exigencia de la implementación de los estándares internacionales en información financiera está articulada a los términos de otros estándares internacionales, aunque no es una restricción adquirir los estándares contables sin integrar los otros estándares en Colombia, estos se acoplan de manera sistémica, en un apoyo integrador. Realizar una implementación adecuada, requiere de tomar estrategias razonables, este trabajo muestra como los estándares de proyectos ofrecen los fundamentos necesarios para dirigir y gestionar el montaje de un sistema de información contable integral, que incluya las diferentes necesidades de los usuarios.
Genetic diversity of cucumber estimated by morpho-physiological and EST-SSR markers.
Pandey, Sudhakar; Ansari, Waquar Akhter; Pandey, Maneesh; Singh, Bijendra
2018-02-01
In the present study, genetic variation among 40 cucumber genotypes was analyzed by means of morpho-physiological traits and 21 EST-SSR markers. Diversity was observed for morpho-physiological characters like days to 50% female flowering (37-46.9, number of fruits/plant (1.33-5.80), average fruit weight (41-333), vine length (36-364), relative water content (58.5-92.7), electrolyte leakage (15.9-37.1), photosynthetic efficiency (0.40-0.75) and chlorophyll concentration index (11.1-28.6). The pair wise Jaccard similarity coefficient ranged from 0.00 to 0.27 for quantitative traits and 0.24 to 0.96 for EST-SSR markers indicating that the accessions represent genetically diverse populations. With twenty-one EST-SSR markers, polymorphism revealed among 40 cucumber genotypes, number of alleles varied 2-6 with an average 3.05. Polymorphism information content varied from 0.002 to 0.989 (mean = 0.308). The number of effective allele (Ne), expected heterozygosity (He) and unbiased expected heterozygosity (uHe) of these EST-SSRs were 1.079-1.753, 0.074-0.428 and 0.074-0.434, respectively. Same 21 EST-SSR markers transferability checked in four other Cucumis species: snapmelon ( Cucumis melo var. momordica ), muskmelon ( Cucumis melo L.), pickling melon ( Cucumis melo var. conomon ) and wild muskmelon ( Cucumis melo var. agrestis ) with frequency of 61.9, 95.2, 76.2, and 76.2%, respectively. Present study provides useful information on variability, which can assist geneticists with desirable traits for cucumber germplasm utilization. Observed physiological parameters may assists in selection of genotype for abiotic stress tolerance also, EST-SSR markers may be useful for genetic studies in related species.
The CaV2.3 R-type voltage-gated Ca2+ channel in mouse sleep architecture.
Siwek, Magdalena Elisabeth; Müller, Ralf; Henseler, Christina; Broich, Karl; Papazoglou, Anna; Weiergräber, Marco
2014-05-01
Voltage-gated Ca(2+) channels (VGCCs) are key elements in mediating thalamocortical rhythmicity. Low-voltage activated (LVA) CaV 3 T-type Ca(2+) channels have been related to thalamic rebound burst firing and to generation of non-rapid eye movement (NREM) sleep. High-voltage activated (HVA) CaV 1 L-type Ca(2+) channels, on the opposite, favor the tonic mode of action associated with higher levels of vigilance. However, the role of the HVA Non-L-type CaV2.3 Ca(2+) channels, which are predominantly expressed in the reticular thalamic nucleus (RTN), still remains unclear. Recently, CaV2.3(-/-) mice were reported to exhibit altered spike-wave discharge (SWD)/absence seizure susceptibility supported by the observation that CaV2.3 mediated Ca(2+) influx into RTN neurons can trigger small-conductance Ca(2+)-activated K(+)-channel type 2 (SK2) currents capable of maintaining thalamic burst activity. Based on these studies we investigated the role of CaV2.3 R-type Ca(2+) channels in rodent sleep. The role of CaV2.3 Ca(2+) channels was analyzed in CaV2.3(-/-) mice and controls in both spontaneous and artificial urethane-induced sleep, using implantable video-EEG radiotelemetry. Data were analyzed for alterations in sleep architecture using sleep staging software and time-frequency analysis. CaV2.3 deficient mice exhibited reduced wake duration and increased slow-wave sleep (SWS). Whereas mean sleep stage durations remained unchanged, the total number of SWS epochs was increased in CaV2.3(-/-) mice. Additional changes were observed for sleep stage transitions and EEG amplitudes. Furthermore, urethane-induced SWS mimicked spontaneous sleep results obtained from CaV2.3 deficient mice. Quantitative Real-time PCR did not reveal changes in thalamic CaV3 T-type Ca(2+) channel expression. The detailed mechanisms of SWS increase in CaV2.3(-/-) mice remain to be determined. Low-voltage activated CaV2.3 R-type Ca(2+) channels in the thalamocortical loop and extra
E o que está fora da ordem do discurso escolar?
Directory of Open Access Journals (Sweden)
Josí Aparecida de Freitas
2013-10-01
Full Text Available Pretendo, com este texto, estabelecer algumas relações entre o artigo "A ordem do discurso escolar", de Luís Henrique Sommer (2007 e a obra "A ordem do discurso" de Michel Foucault (1999. Trago do texto de Foucault alguns pressupostos que ele considera importantes para realizar seu trabalho de análise discursiva e que vão aparecer, de alguma forma, transportados - no trabalho de Sommer - para o âmbito escolar. Recorto, ainda, do texto de Sommer, um enunciado em que o autor afirma que “ensino, metodologia, didática, planejamento são conceitos interditados, estão fora da ordem do discurso escolar” (SOMMER, 2007, p. 63. Lanço algumas problematizações a partir desse enunciado, relacionando-o, em uma perspectiva pós-estruturalista, apoiada também em Foucault, a um “campo de significação” (SILVA, 2011, p. 123 caracterizado por conhecimentos considerados verdadeiros e conexões com relações de poder, ao qual se costuma chamar de currículo.
The Verb Always Leaves IP in V2 Clauses
DEFF Research Database (Denmark)
Schwartz, Bonnie D.; Vikner, Sten
2007-01-01
The verb second (V2) phenomenon, as it is found in the Germanic languages, has been the focus of much attention within recent syntactic research. In most of the literature on V2, it is assumed that the verb in all V2 clauses has moved to a head position outside IP, e.g. Cº. In Schwartz & Vikner...... (1989) we claimed that all V2 clauses were CPs, and we referred to this analysis as the 'traditional' analysis. In this paper we shall call it the 'V2 outside IP' analysis, and by using this term we want to convey that although in what follows we will adhere to the view that the verb moves to Cº, any...... analysis in which the verb moves into an Xº which is the sister of IP may be compatible with what we say here. Various alternatives to this analysis have been explored in the literature, and here we will address two in particular: One alternative is that there is an asymmetry between subject...
Directory of Open Access Journals (Sweden)
Jorge Peñuela
2011-05-01
Full Text Available En este ensayo exploro algunos argumentos de Hannah Arendt, con el fin de mostrar las razones que explican el odio que se manifestaba en las discusiones artísticas de comienzos del siglo XX, odio que persiste aún en muchos escenarios artísticos actuales. Con Arendt sostengo que este fenómeno no está superado, porque el odio es la herramienta que despliega el Capital, para amalgamar a todos los desheredados que ha creado. Contextualizo en la práctica artística colombiana el siguiente argumento de Arendt: el capitalismo creó una amalgama de frustrados sociales, políticos y estéticos que destruye la esfera pública como lugar para el acontecer de la política, amalgama que denominó populacho. Introduzco la categoría de populacho estético, para hablar del odio que ha animado las prácticas artísticas en Colombia desde 1940.
Dimensional stability of Ti--6Al--6V--2Sn
International Nuclear Information System (INIS)
Rack, H.J.
1978-08-01
The dimensional stability of Ti-6Al-6V-2Sn has been examined. It is shown that in the duplex annealed condition Ti-6Al-6V-2Sn is dimensionally stable at temperatures up to 448 0 K for 512 hrs. Solution treated Ti-6Al-6V-2Sn undergoes large dimensional changes during both initial aging between 673 and 973 0 K and subsequent exposure to low temperatures ( 0 K). These results indicate that if close dimensional tolerances must be maintained, duplex annealed Ti-6Al-6V-2Sn should be selected. Selection of treated and aged Ti-6Al-6V-2Sn should only be considered if accompanied by full scale environmental testing
Code Verification Capabilities and Assessments in Support of ASC V&V Level 2 Milestone #6035
Energy Technology Data Exchange (ETDEWEB)
Doebling, Scott William [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Budzien, Joanne Louise [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Ferguson, Jim Michael [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Harwell, Megan Louise [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Hickmann, Kyle Scott [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Israel, Daniel M. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Magrogan, William Richard III [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Singleton, Jr., Robert [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Srinivasan, Gowri [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Walter, Jr, John William [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Woods, Charles Nathan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)
2017-09-26
This document provides a summary of the code verification activities supporting the FY17 Level 2 V&V milestone entitled “Deliver a Capability for V&V Assessments of Code Implementations of Physics Models and Numerical Algorithms in Support of Future Predictive Capability Framework Pegposts.” The physics validation activities supporting this milestone are documented separately. The objectives of this portion of the milestone are: 1) Develop software tools to support code verification analysis; 2) Document standard definitions of code verification test problems; and 3) Perform code verification assessments (focusing on error behavior of algorithms). This report and a set of additional standalone documents serve as the compilation of results demonstrating accomplishment of these objectives.
2 x 2 TeV mu(superscript +) mu (superscript) collider
International Nuclear Information System (INIS)
Mokhov, N.V.; Noble, R.J.
1996-10-01
The scenarios for high-luminosity 2 x 2 TeV and 250 x 250 GeV μ + μ - colliders are presented. Having a high physics potential, such a machine has specific physics and technical advantages and disadvantages when compared with an e + e - collider. Parameters for the candidate designs and the basic components - proton source, pion production and decay channel, cooling, acceleration and collider storage ring - are considered. Attention is paid to the areas mostly affecting the collider performance: targetry, energy spread, superconducting magnet survival, detector backgrounds, polarization, environmental issues. 13 refs., 9 figs., 4 tabs
Fine structure of V2+ energy levels in CsCaF3:V2+
International Nuclear Information System (INIS)
Avram, C.N.; Brik, M.G.
2004-01-01
Theoretical investigations of the fine structure of the lasing 4 T 2g level in a CsCaF 3 :V 2+ crystal were carried out. The spin-orbit splitting of the 4 T 2g term in the static low crystal field was obtained from the Eisenstein matrices and using parameters (Dq, B, C, ζ SO ) appropriate for the 4 T 2g - 4 A 2g zero-phonon line. The 4 T 2g spinor splitting has been modeled by the second-order spin-orbit Hamiltonian. The effect of the dynamical Jahn-Teller interaction on the spin-orbit splitting of the 4 T 2g term was taken into account; the Jahn-Teller stabilization energy, ZPL splitting and the Huang-Rhys parameter for the e g normal mode were all evaluated
Radwaste management and spent fuel management in JAVYS
International Nuclear Information System (INIS)
Bozik, M.; Strazovec, R.
2010-01-01
In this work authors present radwaste management and spent fuel management in JAVYS, a.s. Processing of radioactive wastes (RAW) in the Bohunice Radioactive Waste Processing Center and surface storage of RAW in National RAW Repository as well as Interim Spent fuel storage in Jaslovske Bohunice are presented.
Experiências de Estágio: Contribuições para a Transição Universidade-Trabalho
Directory of Open Access Journals (Sweden)
Claudia Sampaio Correa da Silva
2013-04-01
Full Text Available As experiências de formação no ensino superior são fundamentais para o desenvolvimento profissional. Este estudo teve por objetivo compreender de que forma as experiências de estágio contribuem para o desenvolvimento da adaptabilidade de carreira e para a transição entre os papéis de estudante a profissional em formandos universitários. Participaram seis formandos de um curso de Engenharia Civil, com idades entre 22 e 29 anos. Foram realizadas entrevistas semi-estruturadas individuais, posteriormente analisadas quanto ao conteúdo. Os resultados revelaram que as experiências de estágio influenciam o desenvolvimento da adaptabilidade de carreira, especialmente nas dimensões de curiosidade e confiança. Além disso, várias características dos estágios mencionadas pelos entrevistados mostraram-se relacionadas ao desenvolvimento de carreira, revelando sua importância para o processo de transição do papel de estudante para o de profissional. O artigo conclui com implicações para a prática e a pesquisa.
2 TeV walking technirho at LHC?
Directory of Open Access Journals (Sweden)
Hidenori S. Fukano
2015-11-01
Full Text Available The ATLAS collaboration has recently reported an excess of about 2.5 σ global significance at around 2 TeV in the diboson channel with the boson-tagged fat dijets, which may imply a new resonance beyond the standard model. We provide a possible explanation of the excess as the isospin-triplet technivector mesons (technirhos, denoted as ρΠ±,3 of the walking technicolor in the case of the one-family model as a benchmark. As the effective theory for the walking technicolor at the scales relevant to the LHC experiment, we take a scale-invariant version of the hidden local symmetry model so constructed as to accommodate technipions, technivector mesons, and the technidilaton in such a way that the model respects spontaneously broken chiral and scale symmetries of the underlying walking technicolor. In particular, the technidilaton, a (pseudo Nambu–Goldstone boson of the (approximate scale symmetry predicted in the walking technicolor, has been shown to be successfully identified with the 125 GeV Higgs. Currently available LHC limits on those technihadrons are used to fix the couplings of technivector mesons to the standard-model fermions and weak gauge bosons. We find that the technirhos are mainly produced through the Drell–Yan process and predominantly decay to the dibosons, which accounts for the currently reported excess at around 2 TeV. The consistency with the electroweak precision test and other possible discovery channels of the 2 TeV technirhos are also addressed.
Jain, Prateek; Jain, Trapti
2016-04-01
The objective of this paper is to examine the vehicle-to-grid (V2G) power capability of aggregated electric vehicles (EV) in the manner that they are being adopted by the consumers with their growing infiltration in the vehicles market. The proposed modeling of V2G and grid-to-vehicle (G2V) energy profiles blends the heterogeneous attributes namely, driven mileages, arrival and departure times, travel and parking durations, and speed dependent energy consumption of mobility trends. Three penetration percentages of 25 %, 50 % and 100 % resulting in varied compositions of battery electric vehicle (BEV) and plug-in hybrid electric vehicle (PHEV) in the system, as determined by the consumers' acceptance, have been considered to evaluate the grid capacity for V2G. Distinct charge-discharge powers have been selected as per charging standards to match contemporary vehicles and infrastructure requirements. Charging and discharging approaches have been devised to replicate non-linear characteristics of Li-ion battery. Effects of simultaneous conjunction of V2G and G2V power curves with daily conventional load profile are quantified drawn upon workplace-discharging home-charging scheme. Results demonstrated a marked drop in load and hence in market price during morning hours which is hurriedly overcompensated by the hike during evening hours with rising penetration level and charge-discharge power.
International Nuclear Information System (INIS)
Chrapciak, Vladimir
2000-01-01
In this paper are activity, neutron and gamma source strength of 1 kg WWER-440 spent fuel (enrichment 3.6%, burnup 40 MWd/kg U) for short (Is up to 2 500 000 s(=1 month) and long period (l y up to 100 000 years) published. In the first period (up to 100 years) dominates activity from fission products. After 100 years main sources are actinides (mainly Pu). Gamma is produced first 100 years from fission products and later from actinides. Neutrons ((α,n) and spontaneous fission) are from various isotopes Np, Pu, Am and Cm. In second part is neutron measurement (dependence neutron sources on burnup for WWER-440 3.6% fuel) in NPP Jaslovske Bohunice described. (Author)
Data rate based congestion control in V2V communication for traffic safety applications
Belagal Math, C.; Özgür, A.; Heemstra de Groot, S.M.; Li, H.
2015-01-01
Vehicle-to-Vehicle (V2V) communication systems intend to increase safety and efficiency of the transportation networks. At high vehicle density, the communication channel may become congested, impairing the reliability of the safety applications. As a counter measure, the European Telecommunications
KASS v.2.2. scheduling software for construction
Krzemiński Michał
2016-01-01
The paper presents fourth version of specialist useful software in scheduling KASS v.2.2 (Algorithm Scheduling Krzeminski System). KASS software is designed for construction scheduling, specially form flow shop models. The program is being dedicated closely for the purposes of the construction. In distinguishing to other used programs in tasks of this type operational research criteria were designed closely with the thought about construction works and about the specificity of the building pr...
activismo y estéticas en experimento
Directory of Open Access Journals (Sweden)
Omar Rincón
2005-01-01
Full Text Available Podemos comunicarlo todo: tenemos las tecnologías de la comunicación cada vez más cerca; pero no podemos contar nada, porque no tenemos nada qué decir, ni sabemos cómo decirlo. Hay que inventarlo todo, intervenir de nuevo la sociedad desde la comunicación. Es necesario convertir los medios en experiencia estética, social y política. ¿Cómo? Usando a las tecnologías para el activismo y el experimento; recurriendo a los llamado retro, porque no es lo más actual, lo más mercado, como experiencia de inspiración y emoción. Hay que volver a las estéticas, a los modos de narrar y a las historias que están inscritas en nuestras identidades locales; en nuestras sensibilidades femeninas, juveniles o sexuales; en nuestras tradiciones étnicas, o en nuestros modos urbanos. Sólo basta una minicámara para inventar el universo. En este ensayo se realiza un alegato contra los universos estético-narrativopolíticos construidos por la máquina televisiva y la homogeneidad del mercado. En este texto se argumenta a favor del activismo comunicativo, de la exploración tecnológica y de la inspiración étnica como estrategias para generar una mayor conciencia sobre el valor social de la comunicación, la intervención estético-narrativa de la sociedad y la importancia política de los medios de la gente.
International Nuclear Information System (INIS)
Arkani-Hamed, Nima; Hall, Lawrence; Murayama, Hitoshi; Smith, David; Weiner, Neal
2000-01-01
Theories in which neutrino masses are generated by a conventional see-saw mechanism generically yield masses which are O(v 2 ) in units where M Pl = 1, which is naively too small to explain the results from SuperKamiokande. In supersymmetric theories with gravity mediated supersymmetry breaking, the fundamental small parameter is not v/M Pl , but m I /M Pl , where m I is the scale of supersymmetry breaking in the hidden sector. We note that m I 3 /M Pl 2 is only slightly too large to explain SuperKamiokande, and present two models that achieve neutrino masses at this order in m I , one of which has an additional suppression λ τ 2 , while the other has additional suppression arising from a loop factor. The latter model shares a great deal of phenomenology with a class of models previously explored, including the possibility of viable sneutrino dark matter
Measurement of the Deuteron Spin Structure Function g_1^d(x) for 1 (GeV/c)^2 < Q^2 < 40 (GeV/c)^2
E155 Collaboration
1999-01-01
New measurements are reported on the deuteron spin structure function g_1^d. These results were obtained from deep inelastic scattering of 48.3 GeV electrons on polarized deuterons in the kinematic range 0.01 < x < 0.9 and 1 < Q^2 < 40 (GeV/c)^2. These are the first high dose electron scattering data obtained using lithium deuteride (6Li2H) as the target material. Extrapolations of the data were performed to obtain moments of g_1^d, including Gamma_1^d, and the net quark polarization Delta Si...
Anthony , P.L.; Arnold , R.G.; Averett , T.; Band , H.R.; Berisso , M.C.; Borel , H.; Bosted , P.E.; Bultmann , S.L.; Buenerd , M.; Chupp , T.; Churchwell , S.; Court , G.R.; Crabb , D.; Day , D.; Decowski , P.
1999-01-01
New measurements are reported on the deuteron spin structure function g_1^d. These results were obtained from deep inelastic scattering of 48.3 GeV electrons on polarized deuterons in the kinematic range 0.01 < x < 0.9 and 1 < Q^2 < 40 (GeV/c)^2. These are the first high dose electron scattering data obtained using lithium deuteride (6Li2H) as the target material. Extrapolations of the data were performed to obtain moments of g_1^d, including Gamma_1^d, and the net quark polarization Delta Si...
Identification of novel selective V2 receptor non-peptide agonists.
Del Tredici, Andria L; Vanover, Kim E; Knapp, Anne E; Bertozzi, Sine M; Nash, Norman R; Burstein, Ethan S; Lameh, Jelveh; Currier, Erika A; Davis, Robert E; Brann, Mark R; Mohell, Nina; Olsson, Roger; Piu, Fabrice
2008-10-30
Peptides with agonist activity at the vasopressin V(2) receptor are used clinically to treat fluid homeostasis disorders such as polyuria and central diabetes insipidus. Of these peptides, the most commonly used is desmopressin, which displays poor bioavailability as well as potent activity at the V(1b) receptor, with possible stress-related adverse effects. Thus, there is a strong need for the development of small molecule chemistries with selective V(2) receptor agonist activity. Using the functional cell-based assay Receptor Selection and Amplification Technology (R-SAT((R))), a screening effort identified three small molecule chemotypes (AC-94544, AC-88324, and AC-110484) with selective agonist activity at the V(2) receptor. One of these compounds, AC-94544, displayed over 180-fold selectivity at the V(2) receptor compared to related vasopressin and oxytocin receptors and no activity at 28 other G protein-coupled receptors (GPCRs). All three compounds also showed partial agonist activity at the V(2) receptor in a cAMP accumulation assay. In addition, in a rat model of central diabetes insipidus, AC-94544 was able to significantly reduce urine output in a dose-dependent manner. Thus, AC-94544, AC-88324, and AC-110484 represent novel opportunities for the treatment of disorders associated with V(2) receptor agonist deficiency.
DEFF Research Database (Denmark)
Pilegaard, Henrik
2003-01-01
We perform a direct comparison of the {Succinct Solver v2.0} and {XSB Prolog v2.6} based on experiments with {Control Flow Analyses} of scalable {Discretionary Ambient programs} and {Carmel programs}. To facilitate this comparison we expand ALFP clauses accepted by the Succinct Solver into more g...
A novel CaV2.2 channel inhibition by piracetam in peripheral and central neurons.
Bravo-Martínez, Jorge; Arenas, Isabel; Vivas, Oscar; Rebolledo-Antúnez, Santiago; Vázquez-García, Mario; Larrazolo, Arturo; García, David E
2012-10-01
No mechanistic actions for piracetam have been documented to support its nootropic effects. Voltage-gated calcium channels have been proposed as a promising pharmacological target of nootropic drugs. In this study, we investigated the effect of piracetam on Ca(V)2.2 channels in peripheral neurons, using patch-clamp recordings from cultured superior cervical ganglion neurons. In addition, we tested if Ca(V)2.2 channel inhibition could be related with the effects of piracetam on central neurons. We found that piracetam inhibited native Ca(V)2.2 channels in superior cervical ganglion neurons in a dose-dependent manner, with an IC(50) of 3.4 μmol/L and a Hill coefficient of 1.1. GDPβS dialysis did not prevent piracetam-induced inhibition of Ca(V)2.2 channels and G-protein-coupled receptor activation by noradrenaline did not occlude the piracetam effect. Piracetam altered the biophysical characteristics of Ca(V)2.2 channel such as facilitation ratio. In hippocampal slices, piracetam and ω-conotoxin GVIA diminished the frequency of excitatory postsynaptic potentials and action potentials. Our results provide evidence of piracetam's actions on Ca(V)2.2 channels in peripheral neurons, which might explain some of its nootropic effects in central neurons.
Resistance irrelevant CYP417A2v2 was found degrading insecticide in Laodelphax striatellus.
Miah, Mohammad Asaduzzaman; Elzaki, Mohammed Esmail Abdalla; Han, Zhaojun
2017-07-01
Cytochrome P450 monooxygenases (CYPs) usually overexpressed in resistant strain were found involved in oxidative detoxification of insecticides. In this study, an investigation was conducted to confirm if resistance irrelevant CYPs which were not overexpressed in resistant strain before, were capable of degrading insecticides. Three resistance irrelevant CYPs viz. CYP417A2v2, CYP425A1v2, and CYP4DJ1 from CYP4 family of Laodelphax striatellus were randomly selected for experiments. CYP417A2v2 and CYP425A1v2 were found expressed successfully in Sf9 cell line while CYP4DJ1 was not expressed successfully and out of two expressed CYPs, only CYP417A2v2 showed its efficient catalytic activity. For catalytic activity, three traditional model probe substrates and five insecticides were assayed. For the probe substrates screened, p -nitroanisole and ethoxycoumarin were preferentially metabolized by CYP417A2v2 (specific activity 3.76 ± 1.22 and 1.63 ± 0.37 nmol min -1 mg protein -1 , respectively) and they may be potential diagnostic probes for this enzyme. Among insecticides, only imidacloprid was efficiently degraded by CYP417A2v2. Incubation of imidacloprid with CYP417A2v2 of L. striatellus and subsequent HPLC, LC-MS, and MS/MS analysis revealed the formation of imidacloprid metabolites, that is, 4' or 5'hydroxy-imidacloprid by hydroxylation. This result implies the exemption of CYPs character that it is not always, all the CYPs degrading insecticides being selected and overexpressed in resistant strains and the degrading CYPs without mutations to upregulate could be candidates during insecticide resistance evolution. This characterization of individual insect CYPs in insecticide degradation can provide insight for better understand of insecticide resistance development.
The evaluation of H total cross section from 20 MeV to 2 GeV
Energy Technology Data Exchange (ETDEWEB)
Tingjin, Liu [Chinese Nuclear Data Center, Beijing, BJ (China)
1996-06-01
The H total cross section was evaluated in the neutron energy region from 20 to 2000 MeV. The recommended experimental data were fitted by using Spline fit program with knot optimization, the fit values are taken as recommended ones. The data are compared with those from ENDF/B-6 (<100 MeV), the differences are 0.5%{approx}2.0% from 20 to 40 MeV, and almost the same in the energy region 40{approx}100 MeV.
Pharmacokinetic properties of radiolabeled mutant Interleukin-2v: a PET imaging study.
Hartimath, Siddesh V; Manuelli, Valeria; Zijlma, Rolf; Signore, Alberto; Nayak, Tapan K; Freimoser-Grundschober, Anne; Klein, Christian; Dierckx, Rudi A J O; de Vries, Erik F J
2018-01-23
Interleukin-2 (IL2) is a cytokine that can stimulate cytotoxic immune cells to attack infected and malignant cells. Unfortunately, IL2 can also cause serious immune-related toxicity. Recently, a mutant of IL2 (IL2v) with abolished CD25 binding, increased plasma half-life and less toxicity was engineered. Unlike wild-type IL2 (wt-IL2), mutant IL2v does not bind to the α-subunit (CD25) of the high affinity IL2αβγ receptor, but only to its β and γ subunit. Here, we investigated the biological properties of IL2v and compared with the wt-IL2 using fluorine-18 and PET. [ 18 F]FB-IL2v binds specifically to IL2 receptors (IL2R) on activated human peripheral blood monocytes (hPBMCs) and is cleared mainly by the kidneys (Balb/c mice). [ 18 F]FB-IL2v PET studies in SCID mice injected with hPBMCs revealed high uptake in the implant (0.85 ± 0.15 SUV), which was significantly reduced after pretreatment with wt-IL2 or mutant IL2v (SUV 0.26 ± 0.1 and 0.46 ± 0.1, p FB-IL2v to IL2R was reversible. The volume of distribution (V T ) and the non-displaceable binding potential (BP nd ) of mutant [ 18 F]FB-IL2v in the implant were approximately 3 times lower than those of wild-type [ 18 F]FB-IL2 ( p FB-IL2v in the implant ( p FB-IL2 binds stronger to IL2R and has faster kinetics than [18F]FB-IL2v, which makes it less suitable as a therapeutic drug. [ 18 F]FB-IL2v, on the other hand, seems to have better properties for use as a therapeutic drug.
International Nuclear Information System (INIS)
1994-05-01
The prime objective of the IAEA Technical Co-operation Project on Evaluation of Safety Aspects of WWER-440 model 213 NPPs is to co-ordinate and to integrate assistance to national organizations in studying selected aspects of safety for the same type of reactors. Consequently, the study integrated the results generated by national activities carried out in the Czech Republic, Hungary, Slovakia and Ukraine and co-ordinated through the IAEA. Valuable assistance in carrying out the tasks was also provided by Bulgaria and Poland. A set of publications is being prepared to present the results of the project. The publications are intended to facilitate the review and utilization of the results of the project. They are also providing assistance in further refinement and/or extension of plant specific safety evaluation of model 213 NPPs. This Technical Document addressing the design basis and safety related design features of WWER-440 model 213 plants is the first of the series to be published. It is hoped that this document will be useful to anyone working in the field of WWER safety, and in particular to experts planning, executing or reviewing studies related to the subject. Refs, 36 figs, tabs
Upgrading of sesame from 800 MeV to 2.5 GeV (Summary of the Technical Design)
International Nuclear Information System (INIS)
Asfour, F.I.
2004-01-01
A Synchrotron-light for Experimental Science and Applications in the Middle East (SESAME), was decided to be built in Jordan as a gift by Germany, based on BESSY 800 MeV synchrotron in Berlin after upgrading to serve as a seed for a new research center in 1998. The initial proposal for SESAME issued in 1999 to move BESSY to the Middle East in a modified form to high performance machine that would cover a broad spectral range, including hard X-rays. For chat BESSY-1, is changed to six-fold symmetry by changing the circumference from 64 to 100 meters and modification of bending magnets, thus the energy was increased to 1 GeV. To reach hard X-ray the intention was to introduce two 13 - pole superconducting wigglers with magnetic field 7.5 tesla, these wigglers provide a critical energy of 5 KeV and useful flux up to 20 KeV. However these wigglers have some disadvantages :1) they are costly, 2) need a special knowledge for running and 3) have an influence on beam behavior. In 2000 - 2001 appeared a scientific need of more beam lines in this spectral range (most users require hard X-ray). The simplest way of doing this is by getting hard X-ray from bending magnets. This is possible by increasing the energy to 2 GeV. Since Jordan will provide the building as a copy of the ANKA (60 m x 60 m) Synchrotron Light Source with 2.5 GeV storage ring. The design of SESAME project has been worked with maximum circumference 124 m. It is a 8- fold symmetry machine with energy 2 GeV. By using gradient bending magnets it is possible to have 12 for the installation of insertion devices and furthermore a reduction of natural emittance down to 18 nm rad. This is really the art of synchrotron light source. This was done in July 2002. To enhance the hard X-ray capability to be more in line, it was suggested to increase the energy up to 2.5 GeV. The option of 2.5 GeV machine is to explore its use with 2 in vacuum undulators, and of running the 2.5 machine at 2 GeV if that is needed for ultra
Single crystals of the anisotropic Kagome staircase compounds Ni3V2O8 and Co3V2O8
Balakrishnan, G.; Petrenko, O. A.; Lees, M. R.; Paul, D. McK.
2004-01-01
Compounds with a Kagome type lattice are known to exhibit magnetic frustration. Large single crystals of two compounds Ni3V2O8 and Co3V2O8, which are variants of a Kagome net lattice, have been grown successfully by the floating zone technique using an optical image furnace. The single crystals are of high quality and exhibit intriguing magnetic properties.
Zhang, Jingming; Lanuza, Guillermo M; Britz, Olivier; Wang, Zhi; Siembab, Valerie C; Zhang, Ying; Velasquez, Tomoko; Alvarez, Francisco J; Frank, Eric; Goulding, Martyn
2014-04-02
Reciprocal activation of flexor and extensor muscles constitutes the fundamental mechanism that tetrapod vertebrates use for locomotion and limb-driven reflex behaviors. This aspect of motor coordination is controlled by inhibitory neurons in the spinal cord; however, the identity of the spinal interneurons that serve this function is not known. Here, we show that the production of an alternating flexor-extensor motor rhythm depends on the composite activities of two classes of ventrally located inhibitory neurons, V1 and V2b interneurons (INs). Abrogating V1 and V2b IN-derived neurotransmission in the isolated spinal cord results in a synchronous pattern of L2 flexor-related and L5 extensor-related locomotor activity. Mice lacking V1 and V2b inhibition are unable to articulate their limb joints and display marked deficits in limb-driven reflex movements. Taken together, these findings identify V1- and V2b-derived neurons as the core interneuronal components of the limb central pattern generator (CPG) that coordinate flexor-extensor motor activity. Copyright © 2014 Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
1998-01-01
Public relations activities continued in a well-proved form of organizing plant visits and Information Centre off - site activities. Bohunice NPPs were visited by the number of 7294 visitors in 1997. A brief account of activities in public relations carried out by the Nuclear power plants Jaslovske Bohunice in 1997 is presented
Ishii, Takayuki; Sakai, Tsubasa; Kojitani, Hiroshi; Mori, Daisuke; Inaguma, Yoshiyuki; Matsushita, Yoshitaka; Yamaura, Kazunari; Akaogi, Masaki
2018-06-04
We have investigated high-pressure, high-temperature phase transitions of spinel (Sp)-type MgV 2 O 4 , FeV 2 O 4 , and MnCr 2 O 4 . At 1200-1800 °C, MgV 2 O 4 Sp decomposes at 4-7 GPa into a phase assemblage of MgO periclase + corundum (Cor)-type V 2 O 3 , and they react at 10-15 GPa to form a phase with a calcium titanite (CT)-type structure. FeV 2 O 4 Sp transforms to CT-type FeV 2 O 4 at 12 GPa via decomposition phases of FeO wüstite + Cor-type V 2 O 3 . MnCr 2 O 4 Sp directly transforms to the calcium ferrite (CF)-structured phase at 10 GPa and 1000-1400 °C. Rietveld refinements of CT-type MgV 2 O 4 and FeV 2 O 4 and CF-type MnCr 2 O 4 confirm that both the CT- and CF-type structures have frameworks formed by double chains of edge-shared B 3+ O 6 octahedra (B 3+ = V 3+ and Cr 3+ ) running parallel to one of orthorhombic cell axes. A relatively large A 2+ cation (A 2+ = Mg 2+ , Fe 2+ , and Mn 2+ ) occupies a tunnel-shaped space formed by corner-sharing of four double chains. Effective coordination numbers calculated from eight neighboring oxygen-A 2+ cation distances of CT-type MgV 2 O 4 and FeV 2 O 4 and CF-type MnCr 2 O 4 are 5.50, 5.16, and 7.52, respectively. This implies that the CT- and CF-type structures practically have trigonal prism (six-coordinated) and bicapped trigonal prism (eight-coordinated) sites for the A 2+ cations, respectively. A relationship between cation sizes of VIII A 2+ and VI B 3+ and crystal structures (CF- and CT-types) of A 2+ B 2 3+ O 4 is discussed using the above new data and available previous data of the postspinel phases. We found that CF-type A 2+ B 2 3+ O 4 crystallize in wide ionic radius ranges of 0.9-1.4 Å for VIII A 2+ and 0.55-1.1 Å for VI B 3+ , whereas CT-type phases crystallize in very narrow ionic radius ranges of ∼0.9 Å for VIII A 2+ and 0.6-0.65 Å for VI B 3+ . This would be attributed to the fact that the tunnel space of CT-type structure is geometrically less flexible due to the smaller coordination
TYLCV-Is movement in planta does not require V2 protein
Energy Technology Data Exchange (ETDEWEB)
Hak, Hagit [Institute of Plant Sciences, Agricultural Research Organization, The Volcani Center, Bet Dagan (Israel); Department of Biological Chemistry, The Alexander Silberman Institute of Life Sciences, The Hebrew University of Jerusalem (Israel); Levy, Yael; Chandran, Sam A.; Belausov, Eduard [Institute of Plant Sciences, Agricultural Research Organization, The Volcani Center, Bet Dagan (Israel); Loyter, Abraham [Department of Biological Chemistry, The Alexander Silberman Institute of Life Sciences, The Hebrew University of Jerusalem (Israel); Lapidot, Moshe [Institute of Plant Sciences, Agricultural Research Organization, The Volcani Center, Bet Dagan (Israel); Gafni, Yedidya, E-mail: ygafni@volcani.agri.gov.il [Institute of Plant Sciences, Agricultural Research Organization, The Volcani Center, Bet Dagan (Israel)
2015-03-15
Tomato yellow leaf curl virus (TYLCV), a major tomato pathogen causing extensive crop losses, is a whitefly-transmitted geminivirus. V2 mutants of TYLCV-Is and related viruses tend to induce symptomless infection with attenuated viral DNA levels, while accumulating close to wild-type DNA levels in protoplasts, suggesting V2 as a movement protein. The discovery of plant-silencing mechanisms and viral silencing suppressors, V2 included, led us to reconsider V2's involvement in viral movement. We studied two mutant versions of the virus, one impaired in V2 silencing-suppression activity, and another carrying a non-translatable V2. While both mutant viruses spread in the infected plant to newly emerged leaves at the same rate as the wild-type virus, their DNA-accumulation levels were tenfold lower than in the wild-type virus. Thus, we suggest that the setback in virus proliferation, previously ascribed to a movement impediment, is due to lack of silencing-suppression activity. - Highlights: • TYLCV-Is V2 protein is localized in distinct microbodies throughout the cell cytoplasm, around the nucleus and in association with cytoplasmic strands but is not associated with the plasmodesmata. • Disruption of RNA-silencing suppression activity of TYLCV-Is V2 protein causes low titer of the virus in the infected plants. • The movement of TYLCV-Is in planta does not require a functional V2 protein.
International Nuclear Information System (INIS)
Kim, SeungBum; Joo, Sangbum; Yoon, Hyun C.; Ryu, Yeonwoo; Kim, Kyeong Kyu; Kim, T. Doohun
2007-01-01
Est25, a ketoprofen-specific hormone-sensitive lipase from a metagenomic library, was crystallized and diffraction data were collected to 1.49 Å resolution. Ketoprofen, a nonsteroidal anti-inflammatory drug, inhibits the synthesis of prostaglandin. A novel hydrolase (Est25) with high ketoprofen specificity has previously been identified using a metagenomic library from environmental samples. Recombinant Est25 protein with a histidine tag at the N-terminus was expressed in Escherichia coli and purified in a homogenous form. Est25 was crystallized from 2.4 M sodium malonate pH 7.0 and X-ray diffraction data were collected to 1.49 Å using synchrotron radiation. The crystals belong to the monoclinic space group C2, with unit-cell parameters a = 197.8, b = 95.2, c = 99.4 Å, β = 97.1°
La révélation des lois de la nature
Omnès, Roland
2008-01-01
Les lois de la nature sont-elles inventées par les scientifiques ? Ou sont-elles découvertes par eux ? Préexistent-elles dans la nature ? Ou lui sont-elles imposées ? L'enjeu est clair : la science va-t-elle détruire la nature ? Roland Omnès, l'un des maîtres de la physique théorique en France, montre dans cet essai que les lois de la nature ne sont ni inventées ni découvertes, mais révélées. Comme jadis Dieu s'est révélé à Moïse en lui donnant les Tables de la Loi, aujourd'hui la nature se révèle au physicien dans des formules mathématiques. Cette réflexion est menée au plus près d'une explication claire des lois de la physique. Un grand livre de science et de conscience.
Directory of Open Access Journals (Sweden)
César Rey
2002-01-01
Full Text Available Este artículo presenta los resultados de un estudio descriptivo realizado con un grupo de 59 hombres que habían ejercido violencia contra su pareja y un grupo de 38 mujeres que habían sido víctima de este tipo de violencia. Las variables analizadas fueron: promedio y rango de edades, grupos de edad, número de hijos, estado civil, escolaridad, ocupación, tipo de violencia auto informada, frecuencia auto informada de violencia, tiempo de convivencia, motivos de la violencia e historia de maltrato en la familia de origen. Los datos que sirvieron de base para este estudio fueron recolectados de nueve informes pertenecientes al Programa Psicojurídico de Prevención de la Violencia en el Contexto Familiar del Servicio de Atención Psicológica de la Universidad Nacional de Colombia. Los resultados se discuten a la luz de estudios descriptivos previos y de los factores de riesgo de la violencia conyugal más conocidos
Mendes, Dário Miguel dos Santos
2017-01-01
O presente documento descreve o trabalho realizado no segundo ano letivo do Mestrado em Produção de Conteúdos Digitais. Relatando um estágio decorrido na empresa tecnológica Compta S.A. Neste relatório é feita uma apresentação da empresa, bem como os seus objetivos como tal. De seguida, efetua-se um enquadramento do estágio no âmbito contextual dos conteúdos digitais, descrevendo as tecnologias utilizadas, necessárias à criação de aplicações para dispositivos móveis. São ainda apresentados...
Neutron electric form factor up to Q2 = 1.47 GeV/c2
International Nuclear Information System (INIS)
Madey, Richard; Semenov, Andrei; Taylor, S.; Aghalaryan, Aram; Crouse, Erick; MacLachlan, Glen; Plaster, Bradley; Shigeyuki Tajima; William Tireman; Chenyu Yan; Abdellah Ahmidouch; Brian Anderson; Hartmuth Arenhovel; Razmik Asaturyan; Baker, O.; Alan Baldwin; Herbert Breuer; Roger Carlini; Christy, E.; Steve Churchwell; Leon Cole; Areg Danagoulian; Donal Day; Mostafa Elaasar; Rolf Ent; Manouchehr Farkhondeh; Howard Fenker; John Finn; Liping Gan; Kenneth Garrow; Paul Gueye; Calvin Howell; Bitao Hu; Mark Jones; James Kelly; Cynthia Keppel; Mahbubul Khandaker; Wooyoung Kim; Stanley Kowalski; Allison Lung; David Mack; Manley, D.; Pete Markowitz; Joseph Mitchell; Hamlet Mkrtchyan; Allena Opper; Charles Perdrisat; Vina Punjabi; Brian Raue; Tilmann Reichelt; Joerg Reinhold; Julie Roche; Yoshinori Sato; Irina Semenova; Wonick Seo; Neven Simicevic; Smith, G.; Samuel Stepanyan; Vardan Tadevosyan; Liguang Tang; Paul Ulmer; William Vulcan; Watson, J. W.; Steven Wells; Frank Wesselmann; Stephen Wood; Chen Yan; Seunghoon Yang; Lulin Yuan; Wei-Ming Zhang; Hong Guo Zhu; Xiaofeng Zhu
2003-01-01
The ratio of the electric to the magnetic form factor of the neutron, g /equiv G En /G Mn , was measured via recoil polarimetry (R.G. Arnold, C.E. Carlson, F. Gross, Phys. Rev. C 23, 363 (1981)) from the quasielastic 2 H (/mathop(e)/limitse' /mathop(n)/limits) 1H reaction at three values of Q 2 (viz, 0.45, 1.15, and 1.47 (GeV/c) 2 ) in Hall C of the Thomas Jefferson National Accelerator Facility. The data reveal that GEn continues to follow the Galster parameterization up to Q 2 = 1.15 (GeV/c) 2 and rises above the Galster parameterization at Q 2 = 1.47 (GeV/c) 2
International Nuclear Information System (INIS)
Hascik, J.; Slugen, V.; Lipka, J.; Hinca, R.; Toth, I.; Groene, R.; Uvacik, P.; Kupca, L.
1998-01-01
Gamma spectroscopic analyse and first experimental results of original irradiated reactor pressure vessel surveillance specimens are discussed in. In 1994, the new ''Extended Surveillance Specimen Program for nuclear Reactor Material Study'' was started in collaboration with the nuclear power plants (NPP) V-2 Bohunice (Slovakia). The first batch of MS samples (after 1 year, which is equivalent to 5 years of loading RPV-steel) was measured and interpreted using the new four components approach with the aim to observe microstructural changes due to thermal and neutron treatment resulting from operating conditions in NPP. The systematic changes in the relative areas of Moessbauer spectra components were observed. (author)
International Nuclear Information System (INIS)
Samohyl, P.
1993-07-01
The fatigue damage of the primary circuit of WWER-440/213c reactors was evaluated proceeding from actual and design operating data of units 3 and 4 of the Bohunice V-2 nuclear power plant. A complex computation model was set up, encompassing the main circulation pipeline, pressurizer pipeline, emergency core aftercooling system pipeline, steam pipeline, and feedwater pipeline. The standardized STATIC code was applied to the stress analysis, and the FATLBB code was used to determine the crack increment for all operating states and primary circuit sections. The probability of fatigue failure of the pipelines was found to be low. (J.B.). 55 tabs., 3 figs., 9 refs
Directory of Open Access Journals (Sweden)
Yong-Suk eLee
2016-03-01
Full Text Available A novel esterase, MtEst45, was isolated from a fosmid genomic library of Microbulbifer thermotolerans DAU221. The encoding gene is predicted to have a mass of 45,564 Da and encodes 495 amino acids, excluding a 21 amino acid signal peptide. MtEst45 showed a low amino acid identity (approximately 23–24% compared with other lipolytic enzymes belonging to Family III, a closely related bacterial lipolytic enzyme family. MtEst45 also showed a conserved GXSXG motif, G131IS133YG135, which was reported as active site of known lipolytic enzymes, and the putative catalytic triad composed of D237 and H265. Because these mutants of MtEst45, which was S133A, D237N, and H265L, had no activity, these catalytic triad essential for the enzyme catalysis. MtEst45 was overexpressed in Escherichia coli BL21 (DE3 and purified via His-tag affinity chromatography. The optimal pH and temperature of MtEst45 were estimated to be 8.17 and 46.27°C by response surface methodology, respectively. Additionally, MtEst45 was also active between 1–15°C. The optimal hydrolysis substrate for MtEst45 among p-nitrophenyl esters (C2–C18 was p-nitrophenyl butyrate, and the Km and Vmax values were 0.0998 mM and 550 μmol/min/mg of protein, respectively. MtEst45 was strongly inhibited by Hg2+, Zn2+, and Cu2+ ions; by phenylmethanesulfonyl fluoride; and by β-mercaptoethanol. Ca2+ did not affect the enzyme’s activity. These biochemical properties, sequence identity, and phylogenetic analysis suggest that MtEst45 represents a novel and valuable bacterial lipolytic enzyme family and is useful for biotechnological applications.
Lifescience Database Archive (English)
Full Text Available ++ + +S G + C C YQ Sbjct: 223 VWLPLMHRLAHVENVFHPVECSYCHCESMMGFRYRCQQCHNYQ 265 >sp|O70585|DTNB_MOUSE Dystrobr...P + A V + P+ C++ + +S G + C C YQ Sbjct: 223 VWLPLMHRLAHVENVFHPVECSYCHCESMMGFRYRCQ
International Nuclear Information System (INIS)
Hroch, A.
2009-01-01
Slovenske elektrarne, a. s. (SE) entered the year 2008 with a determination to achieve the best possible profit from power production. During the process of production optimization were taken into account external conditions, which were mentioned in the last issue. The result is SE supply reaching 22 251 GWh. Very satisfactory for us is the fact that high fulfillments by nuclear power plants have exceeded the expectations. Bohunice V1 NPP up to 103%, Bohunice V2 NPP up to 104,5% and Mochovce NPP up to 102, 9%. Nonfulfillment of hydroelectric and thermal power plants is a result of objective reasons- as for thermal power plants due to market conditions and in case of hydroelectric power plants this has been a result of hydrological reasons. Just a few words to a crisis that appeared in January 2009. When we look back, we have to divide the issue into two periods (crises). The first one is an economic crisis the consequences of which were apparent already in December, where the providers of supporting services among industrial customers were unable to guarantee those services (the service is activated by reduction of consumption and since then there was no sale of their products, they cut off their production, i.e. power production, and as a consequence, no reserve for Ss remained.) Missing supporting services have been purchased by a transmission system provider on both daily and monthly basis. There was a demand for SRV, TRV30MIN, + TRV3MIN+, however, there were no extreme values. (author)
Energy Technology Data Exchange (ETDEWEB)
Song, Y. [Ames Laboratory, U.S. Department of Energy and Department of Chemistry, Iowa State University, Ames, Iowa 50011 (United States); Evans, M. [Ames Laboratory, U.S. Department of Energy and Department of Chemistry, Iowa State University, Ames, Iowa 50011 (United States); Ng, C. Y. [Ames Laboratory, U.S. Department of Energy and Department of Chemistry, Iowa State University, Ames, Iowa 50011 (United States); Hsu, C.-W. [Chemical Science Division, Lawrence Berkeley National Laboratory, Berkeley, California 94720 (United States); Jarvis, G. K. [Chemical Science Division, Lawrence Berkeley National Laboratory, Berkeley, California 94720 (United States)
2000-01-15
We have obtained rotationally resolved pulsed-field ionization photoelectron (PFI-PE) spectra for O{sub 2} in the energy range of 17.05-18.13 eV, covering the ionization transitions O{sub 2}{sup +}(A {sup 2}{pi}{sub u},v{sup +}=0-12,N{sup +})(<-)O{sub 2}(X {sup 3}{sigma}{sub g}{sup -},v{sup ''}=0,N{sup ''}). Although these O{sub 2}{sup +}(A {sup 2}{pi}{sub u},v{sup +}) PFI-PE bands have significant overlaps with vibrational bands for O{sub 2}{sup +}(a {sup 4}{pi}{sub u}) and O{sub 2}{sup +}(X {sup 2}{pi}{sub g}), we have identified all the O{sub 2}{sup +}(A {sup 2}{pi}{sub u},v{sup +}=0-12) bands by simulation of spectra obtained using supersonically cooled O{sub 2} samples with rotational temperatures {approx_equal}20 and 220 K. While these v{sup +}=0-12 PFI-PE bands represent the first rotationally resolved photoelectron data for O{sub 2}{sup +}(A {sup 2}{pi}{sub u}), the PFI-PE bands for O{sub 2}{sup +}(A {sup 2}{pi}{sub u},v{sup +}=9 and 10) are the first rotationally resolved spectroscopic data for these levels. The simulation also allows the determination of accurate ionization energies, vibrational constants, and rotational constants for O{sub 2}{sup +}(A {sup 2}{pi}{sub u},v{sup +}=0-12). The analysis of the PFI-PE spectra supports the conclusion of the previous emission study that the O{sub 2}{sup +}(A {sup 2}{pi}{sub u},v{sup +}=9 and 10) states are strongly perturbed by a nearby electronic state. (c) 2000 American Institute of Physics.
Energy Technology Data Exchange (ETDEWEB)
Gregoire, G.; Pecquenard, B.; Baffier, N. [Centre National de la Recherche Scientifique (CNRS), 75 - Paris (France). Laboratoire de Chimie Appliquee de l`Etat Solide; Soudan, P.; Farcy, J.; Pereira-Ramos, J.P. [Centre National de la Recherche Scientifique (CNRS), 94 - Ivry-sur-Seine (France). Laboratoire d`Electrochimie Catalyse et Synthese Organique
1996-12-31
V{sub 2}O{sub 5} based compounds are interesting low potential materials for rechargeable cathodes of lithium electrochemical generators. However, the ionic conductivity and the reversibility of electrochemical cycling of V{sub 2}O{sub 5} are limited by the possibilities of lithium insertion. This work shows that the doping of vanadium pentoxide by a M{sup 3+} trivalent transition element (M Fe, Al, Cr or La) allows to intercalate a more important amount of lithium and to improve the behaviour of the material during cycling. These materials of M{sub 0.11}V{sub 2}O{sub 5.16} formula are obtained by sol-gel synthesis. the electrochemical study of the Fe compound has shown that it is a mixed oxide with a behaviour similar to V{sub 2}O{sub 5}. The maximum capacity is of about 2 F/mole in the case of Fe, Al and Cr compounds and of about 1.7 F/mole in the case of La. The structural evolution of the Fe compound has been followed during the chemical insertion of Li and the same succession of phases ({alpha}, {epsilon}, {delta} and {gamma}) is observed as in Li{sub x}V{sub 2}O{sub 5} compounds but with a delay. The occurrence of the {gamma} phase, in particular, which is involved in recharging problems is delayed thanks to the (Fe-O){sub n} chains perpendicular to the (V{sub 2}O{sub 5}){sub n} layers. Abstract only. (J.S.) 3 refs.
Energy Technology Data Exchange (ETDEWEB)
Gregoire, G; Pecquenard, B; Baffier, N [Centre National de la Recherche Scientifique (CNRS), 75 - Paris (France). Laboratoire de Chimie Appliquee de l` Etat Solide; Soudan, P; Farcy, J; Pereira-Ramos, J P [Centre National de la Recherche Scientifique (CNRS), 94 - Ivry-sur-Seine (France). Laboratoire d` Electrochimie Catalyse et Synthese Organique
1997-12-31
V{sub 2}O{sub 5} based compounds are interesting low potential materials for rechargeable cathodes of lithium electrochemical generators. However, the ionic conductivity and the reversibility of electrochemical cycling of V{sub 2}O{sub 5} are limited by the possibilities of lithium insertion. This work shows that the doping of vanadium pentoxide by a M{sup 3+} trivalent transition element (M Fe, Al, Cr or La) allows to intercalate a more important amount of lithium and to improve the behaviour of the material during cycling. These materials of M{sub 0.11}V{sub 2}O{sub 5.16} formula are obtained by sol-gel synthesis. the electrochemical study of the Fe compound has shown that it is a mixed oxide with a behaviour similar to V{sub 2}O{sub 5}. The maximum capacity is of about 2 F/mole in the case of Fe, Al and Cr compounds and of about 1.7 F/mole in the case of La. The structural evolution of the Fe compound has been followed during the chemical insertion of Li and the same succession of phases ({alpha}, {epsilon}, {delta} and {gamma}) is observed as in Li{sub x}V{sub 2}O{sub 5} compounds but with a delay. The occurrence of the {gamma} phase, in particular, which is involved in recharging problems is delayed thanks to the (Fe-O){sub n} chains perpendicular to the (V{sub 2}O{sub 5}){sub n} layers. Abstract only. (J.S.) 3 refs.
C112 C123 generated by two particle correlations through v2 and v3
Energy Technology Data Exchange (ETDEWEB)
Longacre, Ronald S.
2018-01-31
Abstract: In this note we consider the three particle correlators C112 and C123 and how they can be generated from a pure two particle correlation by interacting with a v2 and a v3 of the overall system.
ANC of 6.92 MeV (2"+) and 7.12 MeV (1"-) states from sub-Coulomb "1"2C("6Li,d) data
International Nuclear Information System (INIS)
Mondal, Ashok; Basu, C.; Adhikari, S.
2016-01-01
The determination of the astrophysical S-factor of the "1"2C(α,γ) reaction at 300 keV requires a R-matrix extrapolation. This is because a direct measurement of this reaction at 300 keV is almost impossible due to the very small cross-section. The R-matrix extrapolation requires as input the asymptotic normalization constant (ANC) of mainly two "1"6O states states viz. 6.92 MeV and 7.12 MeV on which the fit is most sensitive. The ANC of these two states have been determined from indirect measurements, mainly from "1"2C("6Li,d) and "1"2C("7Li,t) alpha transfer reactions. Most of these measurements are done at above barrier energies as cross-sections are larger. In this work, we determine the ANC of the 6.92 MeV and 7.12 MeV states of "1"6O using the "1"2C("6Li,d) data of Heikkinen et al measured at 4.5 to 5.0 MeV incident energies. The data spans over a larger angular span in comparison to Avila though the former data do not cover the very backward angles as in the Avila data. As the Heikkinen data has never been analyzed to extract the ANC we report the results of our analysis of the data
Radioactive wastes and their disposal
International Nuclear Information System (INIS)
Neumann, L.
1984-01-01
The classification of radioactive wastes is given and the achievements evaluated in the disposal of radioactive wastes from nuclear power plants. An experimental pilot unit was installed at the Jaslovske Bohunice nuclear power plant for the bituminization of liquid radioactive wastes. UJV has developed a mobile automated high-output unit for cementation. In 1985 the unit will be tested at the Jaslovske Bohunice and the Dukovany nuclear power plants. A prototype press for processing solid wastes was manufactured which is in operation at the Jaslovske Bohunice plant. A solidification process for atypical wastes from long-term storage of spent fuel elements has been developed to be used for the period of nuclear power plant decommissioning. (E.S.)
Uma nova proposta para o estágio de pratica de ensino em psicologia
Directory of Open Access Journals (Sweden)
Mary Neide Damico Figueiró
1991-08-01
Full Text Available The objective of this work was to propose a new alternative for the Teaching Practicum in Psychology which could provide better experiences for the licentiate student in the Educational field in terms of quality and in regards to the community needs. The methodology of this work consisted of planning, accomplishing and evaluating the extension courses and events of 20 or 30 hours taught by the licentiate students to Primary and Secondary school students, teachers of pre, school and primary school, nursery employees and the community in general. The results showed that in a significantly higher proportion the licentiate students considered, the experience in Teachining Practicum and the contribution of it to his/her professional career to be excellent. The clientele, as a whole, evaluated positively the quality of the courses and the range of the proposed objectives. It was concluded that the new alternative has brought new improvement to the Teaching Practicum, providing an integration of students of Higher Education with the primary and secondary teaching and the community in general" in favor of the knowledge democratization. O objetivo do presente trabalho foi propor uma nova alternativa para os estágios de Prática de Ensino em Psicologia que aprimorasse as experiências do licenciando no campo da Educação, dando mais qualidade a esses estágios, num vínculo com as necessidades da comunidade. A metodologia consistiu no planejamento, execução e avaliação de cursos-evento-extensão de 20 ou 30 horas pelos licenciados junto a alunos de 1° e 2° graus, professores de pré-escola e 1° grau, funcionários de creche e comunidade em geral. Quanto aos resultados, os licenciandos avaliaram, numa proporção significativamente maior, como sendo ótima a experiência em Prática de Ensino e a contribuição do estágio para a sua vida profissional. A clientela, em sua totalidade, avaliou de forma positiva a qualidade dos cursos e o alcance dos
CaV 3.1 and CaV 3.3 account for T-type Ca2+ current in GH3 cells
Directory of Open Access Journals (Sweden)
M.A. Mudado
2004-06-01
Full Text Available T-type Ca2+ channels are important for cell signaling by a variety of cells. We report here the electrophysiological and molecular characteristics of the whole-cell Ca2+ current in GH3 clonal pituitary cells. The current inactivation at 0 mV was described by a single exponential function with a time constant of 18.32 ± 1.87 ms (N = 16. The I-V relationship measured with Ca2+ as a charge carrier was shifted to the left when we applied a conditioning pre-pulse of up to -120 mV, indicating that a low voltage-activated current may be present in GH3 cells. Transient currents were first activated at -50 mV and peaked around -20 mV. The half-maximal voltage activation and the slope factors for the two conditions are -35.02 ± 2.4 and 6.7 ± 0.3 mV (pre-pulse of -120 mV, N = 15, and -27.0 ± 0.97 and 7.5 ± 0.7 mV (pre-pulse of -40 mV, N = 9. The 8-mV shift in the activation mid-point was statistically significant (P < 0.05. The tail currents decayed bi-exponentially suggesting two different T-type Ca2+ channel populations. RT-PCR revealed the presence of a1G (CaV3.1 and a1I (CaV3.3 T-type Ca2+ channel mRNA transcripts.
An, Xu; Gong, Hongliang; Yin, Jiapeng; Wang, Xiaochun; Pan, Yanxia; Zhang, Xian; Lu, Yiliang; Yang, Yupeng; Toth, Zoltan; Schiessl, Ingo; McLoughlin, Niall; Wang, Wei
2014-01-01
Visual scenes can be readily decomposed into a variety of oriented components, the processing of which is vital for object segregation and recognition. In primate V1 and V2, most neurons have small spatio-temporal receptive fields responding selectively to oriented luminance contours (first order), while only a subgroup of neurons signal non-luminance defined contours (second order). So how is the orientation of second-order contours represented at the population level in macaque V1 and V2? Here we compared the population responses in macaque V1 and V2 to two types of second-order contour stimuli generated either by modulation of contrast or phase reversal with those to first-order contour stimuli. Using intrinsic signal optical imaging, we found that the orientation of second-order contour stimuli was represented invariantly in the orientation columns of both macaque V1 and V2. A physiologically constrained spatio-temporal energy model of V1 and V2 neuronal populations could reproduce all the recorded population responses. These findings suggest that, at the population level, the primate early visual system processes the orientation of second-order contours initially through a linear spatio-temporal filter mechanism. Our results of population responses to different second-order contour stimuli support the idea that the orientation maps in primate V1 and V2 can be described as a spatial-temporal energy map. PMID:25188576
Zhao, Shixiang; Zhang, Xiang; Xu, Yang; Feng, Yufeng; Sheng, Wenhong; Cen, Jiannong; Wu, Depei; Han, Yue
2016-01-01
Most patients with polycythemia vera (PV) and half of essential thrombocythemia (ET) possess an activating JAK2V617F mutation. The objective of this study was to better define the effect of JAK2V617F mutant allele burden on clinical phenotypes in Chinese patients, especially thrombosis. By real-time polymerase chain reaction (RT-PCR), the JAK2V617F mutation burden was detected in 170 JAK2V617F-positive patients, including 54 PV and 116 ET. The results showed that JAK2V617F allele burden was higher in PV than in ET (PET (68.5% VS 26.7%) (PET patients showed increased JAK2V617F allele burden in the group with higher hemoglobin (HGB above 150 g/L) (PET. In PV patients, JAK2V617F mutation burden had influence on WBC counts. And the clinical characteristics of ET patients, such as WBC counts, hemoglobin level, splenomegaly and thrombosis, were influenced by JAK2V617F mutation burden. Male, high hemoglobin (HGB above 150 g/L), and increased JAK2V617F mutation burden (JAK2V617F allele burden ≥ 16.5%) were risks of thrombosis (PET patients by Logistic Regression.
International Nuclear Information System (INIS)
Wang, Wenhui; Chen, Zhenyu; Zhang, Jiaolong; Dai, Changsong; Li, Jiajie; Ji, Dalong
2013-01-01
In order to synthesize pure derivative of rhombohedral Li 3 V 2 (PO 4 ) 3 (LVP), lithium-ion batteries materials Li 2.5 Na 0.5 V (2−2x/3) Ni x (PO 4 ) 3 /C (x = 0.03, 0.06, 0.09) and its control, monoclinic Li 3 V 2 (PO 4 ) 3 /C (LVP/C), were prepared by sol–gel method. The samples were investigated by X-ray photoelectron spectroscopy (XPS), X-ray diffraction (XRD) spectroscopy, scanning electron microscopy (SEM), Raman spectroscopy, and electrochemical methods. The XRD patterns of Li 2.5 Na 0.5 V (2−2x/3) Ni x (PO 4 ) 3 /C are in good agreement with that of rhombohedral LVP, which indicates that the Na + –Ni 2+ composite doping can change the structure of monoclinic LVP. All the composite doping samples displayed a single flat plateau at 3.7 V in the charge/discharge voltage profile, which is caused by transformation of multi-phase mechanism to single-phase mechanism. For Li 2.5 Na 0.5 V 1.98 Ni 0.03 (PO 4 ) 3 /C, a specific discharge capacity of 108 mAh g −1 was achieved at a 0.5 C charge rate and a 1 C discharge rate, and a 99.0% retention rate of the initial capacity was obtained after 50 cycles
Extended N=2 supersymmetric matrix (1, s)-KdV hierarchies
International Nuclear Information System (INIS)
Krivonos, S.O.; Sorin, A.S.
1997-01-01
We propose the Lax operators for N=2 supersymmetric matrix generalization of the bosonic (1, s)-KdV hierarchies. The simplest examples - the N=2 supersymmetric a=4 KdV and a=5/2 Boussinesq hierarchies - are discussed in detail
Directory of Open Access Journals (Sweden)
Fritz Huguenin
2004-06-01
Full Text Available In this work, composites formed from a mixture of V2O5 and polyaniline (PANI were investigated, for applications as cathode materials for secondary lithium batteries. Electrochemical quartz crystal microbalance (EQCM data show that charge compensation in the [PANI]0.3V2O5 nanocomposite is achieved predominantly by Li+ migration. However, the charge compensation in the [PANI]V2O5 microcomposite occurs by Li+ and ClO4- transport. Electrochemical Impedance Spectroscopy (EIS measurements reveal several benefits of nanohybrid formation, including the achievement of shorter ionic diffusion pathways, the higher diffusion rate of the lithium ion and also the higher electronic conductivity, which are responsible for a synergetic effect of the energy storage properties.
Brasília dialogando com o self - doi: 10.5102/ucs.v1i2.512
Directory of Open Access Journals (Sweden)
Francisco Angelo Cechin
2008-04-01
Full Text Available Brasília é a cidade que constitui nossa casa. Uma casa muito bem dividida em compartimentos. A casa é um lugar onde nossa personalidade se forma e de onde retira inúmeras fontes de prazer, alegria e vivências. Queiramos ou não o lugar onde vivemos nos fala à consciência e registra em nossa memória suas influências. É uma pena que, muitas vezes, pela indiferença ou pela constante preocupação pela sobrevivência nossa mente não tem mais acesso ao diálogo relacional que se dá entre o real externo e nosso psiquismo ou self inconsciente. Nossos olhos vêem, nossos sentidos sentem suas mensagens que chegam ao nosso íntimo, mas a consciência é impedida de vivenciar seus efeitos. Este artigo convida a escutar este diálogo, e transformá-lo em criatividade interior e sobre o externo - Brasília.
The comparison of MODIS-Aqua (C5 and CALIOP (V2 & V3 aerosol optical depth
Directory of Open Access Journals (Sweden)
J. Redemann
2012-03-01
Full Text Available We assess the consistency between instantaneously collocated level-2 aerosol optical depth (AOD retrievals from MODIS-Aqua (C5 and CALIOP (Version 2 & 3, comparing the standard MODIS AOD (MYD04_L2 data to the AOD calculated from CALIOP aerosol extinction profiles for both the previous release (V2 and the latest release (V3 of CALIOP data. Based on data collected in January 2007, we investigate the most useful criteria for screening the MODIS and CALIOP retrievals to achieve the best agreement between the two data sets. Applying these criteria to eight months of data (Jan, Apr, Jul, Oct 2007 and 2009, we find an order of magnitude increase for the CALIOP V3 data density (by comparison to V2, that is generally accompanied by equal or better agreement with MODIS AOD. Differences in global, monthly mean, over-ocean AOD (532 nm between CALIOP and MODIS range between 0.03 and 0.04 for CALIOP V3, with CALIOP generally biased low, when all available data from both sensors are considered. Root-mean-squares (RMS differences in instantaneously collocated AOD retrievals by the two instruments are reduced from values ranging between 0.14 and 0.19 using the unscreened V3 data to values ranging from 0.09 to 0.1 for the screened data. A restriction to scenes with cloud fractions less than 1% (as defined in the MODIS aerosol retrievals generally results in improved correlation (R2>0.5, except for the month of July when correlations remain relatively lower. Regional assessments show hot spots in disagreement between the two sensors in Asian outflow during April and off the coast of South Africa in July.
CP determination and tests for CP or P violation by the V1V2 decay mode
International Nuclear Information System (INIS)
Nelson, C.A.
1984-01-01
A decay mode such as phiphi, UPSILONUPSILON, K/sup asterisk+/K/sup asterisk-/, or D/sup asterisk+/D/sup asterisk-/ can be used to distinguish between a neutral spin-0 technipion and a neutral spin-0 Higgs particle. By this generalization of phiphi parity test, the CP eigenvalue γ/sub C/P can be determined for an X particle of any spin J which decays CP invariantly into VV, or VV-bar, where each vector meson either decays into two spin-0 bosons, or is ω. The absence in a VV, or VV-bar, decay channel of sin2phi and sinphi terms in the azimuthal distribution is due to CP invariance and/or P invariance. For a V 1 V 2 decay channel without a V 1 bold-arrow-left-rightV 2 exchange property, and in a mode like K/sup asterisk+/K /sup asterisk0/, such terms would imply that P is violated. For a V 1 V 2 mode such as phiω where each vector meson is its own antiparticle, such terms would imply that both P and CP are violated; when CP invariance holds, the γ/sub C/P(-)/sup J/ eigenvalue of X can be determined provided certain amplitudes do not accidentally vanish
Development of 66 kV/6.9 kV 2 MV A prototype HTS power transformer
International Nuclear Information System (INIS)
Bohno, T.; Tomioka, A.; Imaizumi, M.; Sanuki, Y.; Yamamoto, T.; Yasukawa, Y.; Ono, H.; Yagi, Y.; Iwadate, K.
2005-01-01
We have developed the technology of the producing a HTS magnet for the power transformer. Three subjects have been mainly studied, high voltage technologies, large current and low AC loss technologies and sub-cooling system technologies to establish the technology of 66 kV/6.9 kV 10 MV A class HTS power transformer. In order to verify the validity of elemental technologies, such as high voltage technologies, large current and low AC loss technologies and sub-cooling system technologies, single-phase 2 MV A class 66 kV/6.9 kV prototype HTS transformer was manufactured and tested. In the load loss (AC loss) measurement, it was obtained that the measured value of 633 W was almost corresponding to the calculated value of 576 W at the rated operation of 2 MV A. Moreover, the breakdown was not found all voltage withstand test. These test results indicate that elemental technologies were established for the development of 66 kV/6.9 kV 10 MV A class HTS power transformer
International Nuclear Information System (INIS)
Carny, P.; Suchon, D.; Chyly, M.; Smejkalova, E.; Fabova, V.
2008-01-01
ESTE EU is information system and software for radiological impacts assessment to the territory of the country in case of radiation accident inside/outside of the country .The program enables to model dispersion of radioactive clouds in small-scale and meso-scale. The system enables the user to estimate prediction of the source term (release to the atmosphere ) for any point of radiation/nuclear accident in Europe (for any point of the release, but especially for the sites of European power reactors ). The system enables to utilize results of real radiological monitoring in the process of source term estimation. Radiological impacts of release to the atmosphere are modelled and calculated across the Europe and displayed in the geographical information system (GIS). The school version of ESTE EU is intended for students of the universities which are interested in or could work in the field of emergency response, radiological and nuclear accidents, dispersion modelling, radiological impacts calculation and urgent or preventive protective measures implementation. The school version of ESTE EU is planned to be donated to specialized departments of faculties in Slovakia, Czech Republic, etc. System can be fully operated in Slovak, Czech or English language. (authors)
International Nuclear Information System (INIS)
Carny, P.; Suchon, D.; Chyly, M.; Smejkalova, E.; Fabova, V.
2009-01-01
ESTE EU is information system and software for radiological impacts assessment to the territory of the country in case of radiation accident inside/outside of the country .The program enables to model dispersion of radioactive clouds in small-scale and meso-scale. The system enables the user to estimate prediction of the source term (release to the atmosphere ) for any point of radiation/nuclear accident in Europe (for any point of the release, but especially for the sites of European power reactors ). The system enables to utilize results of real radiological monitoring in the process of source term estimation. Radiological impacts of release to the atmosphere are modelled and calculated across the Europe and displayed in the geographical information system (GIS). The school version of ESTE EU is intended for students of the universities which are interested in or could work in the field of emergency response, radiological and nuclear accidents, dispersion modelling, radiological impacts calculation and urgent or preventive protective measures implementation. The school version of ESTE EU is planned to be donated to specialized departments of faculties in Slovakia, Czech Republic, etc. System can be fully operated in Slovak, Czech or English language. (authors)
The electronic quenching rates of NO(A2Σ+, v'=0-2)
International Nuclear Information System (INIS)
Nee, J.B.; Juan, C.Y.; Hsu, J.Y.; Yang, J.C.; Chen, W.J.
2004-01-01
The electronic quenching rates of NO(A 2 Σ + , v ' =0-2) are measured for the gases He, Ar, Xe, N 2 , O 2 , CO 2 , N 2 O, and SF 6 . The variations of the fluorescence intensity were measured for the (0,0), (1,0), and (2,0) bands of the γ band system when the quencher gases were added. The quenching rates were determined by using the Stern-Volmer plots with the known radiative lifetimes of the excited states. The electronic quenching rate constants are fast for the group of gases of O 2 , CO 2 , N 2 O, and SF 6 , whose quenching rate constants are in the order of 10 -10 cm 3 /s. The quenching rate constants are slow for the group of gases including He, Ar, Xe, and N 2 whose rate constants are in the order of 10 -14 cm 3 /s. For the slow group, the quenching rate constants increase rapidly for v ' =2 compared with those of v ' =0 and 1. The charge transfer model and collision complex model are used to understand the quenching mechanism. For the fast group which mainly consists of gases with positive electron affinities, the charge transfer model adequately describes the mechanism. For the slow quenching group, a theoretical background is provided by consider the coupling of initial and final states in the complex potential surfaces
Energy Technology Data Exchange (ETDEWEB)
Deler, B [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1968-06-01
Results on {pi}{sup +}p scattering at 810 and 1300 MeV incoming kinetic energy are presented. In the three-body final states ({pi}{sup +}p {yields} {pi}{sup +}{pi}{sup 0}p or {pi}{sup +}{pi}{sup +}n) the N{sup *}{sub 33} production is strongly dominant. At 1300 MeV one also observes the {rho}, N{sup *}{sub 1/2} {sub 3/2} and N{sup *}{sub 1/2} {sub 5/2} productions. The difficulty in correctly separating these channels demands trying a more general analysis, taking simultaneously into account several processes (N{sup *}{pi}, {rho}N,...). A generalized isobaric model is discussed. Assuming the interaction of particles by pairs, we can carry out a partial wave analysis of the three body final state reactions. The expansion of the differential cross section in spherical harmonics for data between 600 and 1460 MeV (compilation of data from different laboratories) leads to a simple discussion of the angular effects for different parts of the Dalitz plot. A partial wave analysis has been made below 1 GeV. The reaction p {pi}{sup +}{pi}{sup 0} is correctly explained by considering only the N{sup *}{sub 33} production. The different partial waves are in agreement with the elastic phase shift analysis, except for the wave SD1 (corresponding to the elastic wave S31) which is found to be small. Therefore, the S31 resonance appears weakly coupled to the N{sup *}{sub 33}-{pi} channel. (author) [French] Les resultats de la mesure de la diffusion {pi}{sup +}p pour des energies cinetiques du {pi} incident egales a 810 MeV et 1300 MeV sont presentes. Dans les reactions a trois corps, {pi}{sup +}p {yields} {pi}{sup +}{pi}{sup 0}p ou {pi}{sup +}{pi}{sup +}n, la production de l'isobare 3/2 3/2 est fortement dominante. A 1300 MeV, on observe egalement la production du {rho} et des isobares 1/2 3/2 et 1/2 5/2. L'impossibilite de separer correctement ces differentes productions demande de chercher a effectuer l'analyse des donnees sous une forme plus generale permettant de tenir compte
Comme c'est curieux, comme c'est bizarre et quelle coïncidence ! concours de nouvelles
2015-01-01
Elles sont partout : dans la nature, nichées au coeur des tournesols, des cristaux de quartz et des coquilles d'escargot sous la forme du nombre d'or ; dans nos vies ponctuées de rencontres, d'événements qui se font écho. Coïncidences : simples fruits du hasard, vraiment, ou signes d'une causalité cachée ? Un pigeon aux intestins facétieux rencontre un Président de la République malchanceux... Un obus rencontre une chambre à coucher – mais ses occupants ont rendez-vous avec un gâteau… Un dictateur qui abuse son peuple à coups de coïncidences truquées sera démasqué grâce à la rencontre inopinée d'un officier et d'un poisson… Jonglant avec les probabilités, l'Histoire et l'actualité, les lauréats de cette 6e édition ont montré, cette fois encore, que la rigueur scientifique est la meilleure amie de la fantaisie et de l'imagination. Quant à la table ronde qui ouvre ce recueil, elle croise étymologie, chaînes de causalités et lignes d'univers pour arriver à ce constat, partag�...
International Nuclear Information System (INIS)
1997-01-01
Selected staffs (in the area of NPPs) are examined by the State Examining Committee established by Nuclear Regulatory Authority of the Slovak Republic (NRA SR's) chairman. The committee consists of representatives of NRA SR , Bohunice NPPs, Mochovce NPP, Research Institute of Nuclear Energy and experts from the Faculty of Electrical Engineering and Information Technology of the Slovak Technical University. The review of selected personnel of NPP V-1, V-2 and Mochovce NPP which passed exams in 1996 is given. NRA SR paid attention to the upgrading training process of individual categories of staff for V-1, V-2 and Mochovce NPPs, simulator training and training with computerized simulation system according to the United criteria of nuclear installation personnel training that started in 1992. During the year, an inspection was performed focused on examination of technical equipment of the simulator of Mochovce NPP, professional eligibility and overall preparation of simulator training including simulator software. Throughout the year launching works continued at the simulator with the deadline of commissioning to trial use operation in the first half of 1997
Handbook on synchrotron radiation, v.2
1987-01-01
Volume 2 of this series concentrates on the use of synchrotron radiation which covers that region of the electromagnetic spectrum which extends from about 10eV to 3keV in photon energy and is essentially the region where the radiation is strongly absorbed by atmospheric gases. It therefore has to make extensive use of a high vacuum to transport the radiation to the workstation where the presence of hard X-rays can cause extensive damage to both the optics and the targets used in the experimental rigs. The topics chosen for this volume have been limited to the disciplines of physics and chemi
Assessment of realizability constraints in v2-f turbulence models
International Nuclear Information System (INIS)
Sveningsson, A.; Davidson, L.
2004-01-01
The use of the realizability constraint in v 2 -f turbulence models is assessed by computing a stator vane passage flow. In this flow the stagnation region is large and it is shown that the time scale bound suggested by [Int. J. Heat Fluid Flow 17 (1995) 89] is well suited to prevent unphysical growth of turbulence kinetic energy. However, this constraint causes numerical instabilities when used in the equation for the relaxation parameter, f. It is also shown that the standard use of the realizability constraint in the v 2 -f model is inconsistent and some modifications are suggested. These changes of the v 2 -f model are examined and shown to have negligible effect on the overall performance of the v 2 -f model. In this work two different versions of the v 2 -f model are investigated and the results obtained are compared with experimental data. The model on a form similar to that originally suggested by Durbin (e.g. [AIAA J. 33 (1995) 659]) produced the overall best agreement with stator vane heat transfer data
International Nuclear Information System (INIS)
Salyer, R.L.; VanDenburg, J.W.; Prinja, A.K.; Kirby, T.; Busch, R.; Hong-Nian Jow
1996-07-01
The purpose of this research is to characterize existing 2 MeV, 4 MeV and 6 MeV buildup caps, and to determine if a buildup cap can be made for the 0.6 cm 3 thimble ionization chamber that will accurately measure exposures in a high-energy photon radiation field. Two different radiation transport codes were used to computationally characterize existing 2 MeV, 4 MeV, and 6 MeV buildup caps for a 0.6 cm 3 active volume thimble ionization chamber: ITS, The Integrated TIGER Series of Coupled Electron-Photon Monte Carlo Transport Codes; and CEPXS/ONEDANT, A One-Dimensional Coupled Electron-Photon Discrete Ordinates Code Package. These codes were also used to determine the design characteristics of a buildup cap for use in the 18 MeV photon beam produced by the 14 TW pulsed power HERMES-III electron accelerator. The maximum range of the secondary electron, the depth at which maximum dose occurs, and the point where dose and collision kerma are equal have been determined to establish the validity of electronic equilibrium. The ionization chamber with the appropriate buildup cap was then subjected to a 4 MeV and a 6 MeV bremmstrahlung radiation spectrum to determine the detector response
Ancestral amphibian v2rs are expressed in the main olfactory epithelium
Syed, Adnan S.; Sansone, Alfredo; Nadler, Walter; Manzini, Ivan; Korsching, Sigrun I.
2013-01-01
Mammalian olfactory receptor families are segregated into different olfactory organs, with type 2 vomeronasal receptor (v2r) genes expressed in a basal layer of the vomeronasal epithelium. In contrast, teleost fish v2r genes are intermingled with all other olfactory receptor genes in a single sensory surface. We report here that, strikingly different from both lineages, the v2r gene family of the amphibian Xenopus laevis is expressed in the main olfactory as well as the vomeronasal epithelium. Interestingly, late diverging v2r genes are expressed exclusively in the vomeronasal epithelium, whereas “ancestral” v2r genes, including the single member of v2r family C, are restricted to the main olfactory epithelium. Moreover, within the main olfactory epithelium, v2r genes are expressed in a basal zone, partially overlapping, but clearly distinct from an apical zone of olfactory marker protein and odorant receptor-expressing cells. These zones are also apparent in the spatial distribution of odor responses, enabling a tentative assignment of odor responses to olfactory receptor gene families. Responses to alcohols, aldehydes, and ketones show an apical localization, consistent with being mediated by odorant receptors, whereas amino acid responses overlap extensively with the basal v2r-expressing zone. The unique bimodal v2r expression pattern in main and accessory olfactory system of amphibians presents an excellent opportunity to study the transition of v2r gene expression during evolution of higher vertebrates. PMID:23613591
Tool sai veerandi Silvanost võla katteks / Hannes Sarv
Sarv, Hannes
2010-01-01
Indrek Rahumaa on väidetavalt võtnud Toomas Tooli ja Stephan David Balkini käest laenu, pantides Silvano Fashion Group aktsiaid. 31. detsembril andis ettevõte börsile teateid selle kohta, et Toomas Tool omab Silvano Fashion Groupi aktsiatest 24,52% ja Stephan David Balkin - 20%
Noor ja tahvuslik nüüdistants rahvusvahelisel võistlusel "C.O.N.T.EST '08" / Nele Suisalu
Suisalu, Nele
2008-01-01
Pärnus 29.-30. märtsini toimunud 1. rahvusvahelisest sõnadeta teatri konkursist "C.o.n.t.est 08". Selles osalejatest - Kristine Kyhl Andersen (Taani) "MEGO - assistendiga soolo nr3", Etcha Dvornik (Sloveenia-Prantsusmaa) "Alpid! Alpid!", Mihkel Ernits "Pealkirja veel ei ole", Ferenc Fehér "Sirzamanze", Cristina Planas Leitao (Portugal-Holland) "Nülitud", Anna Melnikova (Venemaa-Saksamaa) "Kolmekordne", Mariela Nestora (Kreeka) "Faux pas", Sonja Salkowitsch (Norra-Saksamaa) "Külm", Asako Shirai (Jaapan) "Viimane inimolend"
Directory of Open Access Journals (Sweden)
Li Yujun
2011-10-01
Full Text Available Abstract Background Currently there exists a limited availability of genetic marker resources in sweetpotato (Ipomoea batatas, which is hindering genetic research in this species. It is necessary to develop more molecular markers for potential use in sweetpotato genetic research. With the newly developed next generation sequencing technology, large amount of transcribed sequences of sweetpotato have been generated and are available for identifying SSR markers by data mining. Results In this study, we investigated 181,615 ESTs for the identification and development of SSR markers. In total, 8,294 SSRs were identified from 7,163 SSR-containing unique ESTs. On an average, one SSR was found per 7.1 kb of EST sequence with tri-nucleotide motifs (42.9% being the most abundant followed by di- (41.2%, tetra- (9.2%, penta- (3.7% and hexa-nucleotide (3.1% repeat types. The top five motifs included AG/CT (26.9%, AAG/CTT (13.5%, AT/TA (10.6%, CCG/CGG (5.8% and AAT/ATT (4.5%. After removing possible duplicate of published EST-SSRs of sweetpotato, a total of non-repeat 7,958 SSR motifs were identified. Based on these SSR-containing sequences, 1,060 pairs of high-quality SSR primers were designed and used for validation of the amplification and assessment of the polymorphism between two parents of one mapping population (E Shu 3 Hao and Guang 2k-30 and eight accessions of cultivated sweetpotatoes. The results showed that 816 primer pairs could yield reproducible and strong amplification products, of which 195 (23.9% and 342 (41.9% primer pairs exhibited polymorphism between E Shu 3 Hao and Guang 2k-30 and among the 8 cultivated sweetpotatoes, respectively. Conclusion This study gives an insight into the frequency, type and distribution of sweetpotato EST-SSRs and demonstrates successful development of EST-SSR markers in cultivated sweetpotato. These EST-SSR markers could enrich the current resource of molecular markers for the sweetpotato community and would
Directory of Open Access Journals (Sweden)
Renata Corrêa Pascotto
2009-12-01
Full Text Available Este trabalho avaliou os resultados estéticos de pacientes Classe II submetidos à terapia ortodôntica corretiva. Selecionaram-se, aleatoriamente, sete pacientes do gênero feminino, leucodermas, submetidas a tratamento ortodôntico corretivo com extração de pelo menos dois pré-molares e com início do tratamento aos 16 até 26 anos. Cada paciente foi entrevistada e as falas foram gravadas e posteriormente transcritas e analisadas. Modelos de estudo, teleradiografias e fotografias constantes nos prontuários foram consultados para se avaliar cinco parâmetros quantitativos: contorno facial, ângulo nasolabial, proporção áurea inter-incisivos, linha média facial e dentária e silhueta incisal no sorriso. Os resultados obtidos revelaram que o tratamento ortodôntico corretivo melhorou a estética facial, alterando medidas do tecido mole da face, o sorriso e as relações pessoais. Concluiu-se que as pesquisas qualitativas e quantitativas são complementares, pois uma análise de resultados, baseada somente em um parâmetro, pode mascarar o resultado real e revelar aspectos parciais. A análise qualitativa indica que ângulos e proporções faciais diferentes do que é proposto cientificamente como estético não interferem com os resultados do tratamento, contanto que a percepção facial dos sujeitos envolvidos vá ao encontro dos padrões de normalidade aceitos por estes e estabelecidos pela sociedade.The aim of this study was to investigate the aesthetic results of orthodontic treatment in Class II individuals. Seven Caucasian females were randomly selected, subjected to corrective orthodontic treatment with extraction of at least two pre-molars and initiation of treatment between 16 and 26 years of age. All patients were interviewed; their speeches were recorded and then transcribed and analyzed. Plaster models, lateral radiographs and photographs contained in records were consulted to assess five quantitative parameters: facial
Charge transportation in polyaniline/V2O5 composites
International Nuclear Information System (INIS)
Huguenin, Fritz; Torresi, Roberto M.
2004-01-01
In this work, composites formed from a mixture of V 2 O 5 and polyaniline (PANI) were investigated, for applications as cathode materials for secondary lithium batteries. Electrochemical quartz crystal microbalance (EQCM) data show that charge compensation in the [PANI] 0.3 V 2 O 5 nanocomposite is achieved predominantly by Li + migration. However, the charge compensation in the [PANI]V 2 O 5 microcomposite occurs by Li + and Cl O 4 - transport. Electrochemical Impedance Spectroscopy (EIS) measurements reveal several benefits of nanohybrid formation, including the achievement of shorter ionic diffusion pathways, the higher diffusion rate of the lithium ion and also the higher electronic conductivity, which are responsible for a synergetic effect of the energy storage properties. (author)
Crystal structure and magnetic properties of the solid-solution phase Ca3Co2-v Sc v O6
International Nuclear Information System (INIS)
Hervoches, Charles H.; Fredenborg, Vivian Miksch; Kjekshus, Arne; Fjellvag, Helmer; Hauback, Bjorn C.
2007-01-01
The two crystallographically non-equivalent Co atoms of the quasi-one-dimensional crystal structure of Ca 3 Co 2 O 6 form chains with alternating, face-sharing polyhedra of Co2O 6 trigonal prisms and Co1O 6 octahedra. This compound forms a substitutional solid-solution phase with Sc, in which the Sc atoms enter the Co2 sublattice exclusively. The homogeneity range of Ca 3 Co 2- v Sc v O 6 (more specifically Ca 3 Co1Co2 1- v Sc v O 6 ) extends up to v∼0.55. The crystal structure belongs to space group R3-barc with lattice parameters (in hexagonal setting): 9.0846(3)≤a≤9.1300(2) A and 10.3885(4)≤c≤10.4677(4) A. The magnetic moment decreases rapidly with increasing amount of the non-magnetic Sc solute in the lattice. - Graphical abstract: The quasi-one-dimensional Ca 3 Co 2 O 6 phase forms a substitutional solid-solution system with Sc, in which the Sc atoms enter the Co2 sublattice exclusively. The homogeneity range of Ca 3 Co 2- v Sc v O 6 extends up to v∼0.55. The magnetic moment decreases rapidly with increasing amount of the non-magnetic Sc solute in the lattice
Directory of Open Access Journals (Sweden)
Maria Luísa P. Natividade Targon
2007-01-01
Full Text Available In order to obtain a better understanding of what is citrus, 33 cDNA libraries were constructed from different citrus species and genera. Total RNA was extracted from fruits, leaves, flowers, bark, seeds and roots, and subjected or not to different biotic and abiotic stresses (pathogens and drought and at several developmental stages. To identify putative promoter sequences, as well as molecular markers that could be useful for breeding programs, one shotgun library was prepared from sweet orange (Citrus sinensis var. Olimpia. In addition, EST libraries were also constructed for a citrus pathogen, the oomycete Phythophthora parasitica in either virulent or avirulent form. A total of 286,559 cDNA clones from citrus were sequenced from their 5’ end, generating 242,790 valid reads of citrus. A total of 9,504 sequences were produced in the shotgun library and the valid reads were assembled using CAP3. In this procedure, we obtained 1,131 contigs and 4,083 singletons. A total of 19,200 cDNA clones from P. parasitica were sequenced, resulting in 16,400 valid reads. The number of ESTs generated in this project is, to our knowledge, the largest citrus sequence database in the world.
Postnatal Expression of V2 Vasopressin Receptor Splice Variants in the Rat Cerebellum
Vargas, Karina J.; Sarmiento, José M.; Ehrenfeld, Pamela; Añazco, Carolina C.; Villanueva, Carolina I.; Carmona, Pamela L.; Brenet, Marianne; Navarro, Javier; Müller-Esterl, Werner; Figueroa, Carlos D.; González, Carlos B.
2010-01-01
The V2 vasopressin receptor gene contains an alternative splice site in exon-3, which leads to the generation of two splice variants (V2a and V2b) first identified in the kidney. The open reading frame of the alternatively spliced V2b transcripten codes a truncated receptor, showing the same amino acid sequence as the canonical V2a receptor up to the 6th transmembrane segment, but displaying a distinct sequence to the corresponding 7th transmembrane segment and C-terminal domain relative to the V2a receptor. Here, we demonstrate the postnatal expression of V2a and V2b variants in the rat cerebellum. Most importantly, we showed by in situ hybridization and immunocytochemistry that both V2 splice variants were preferentially expressed in Purkinje cells, from early to late postnatal development. In addition, both variants were transiently expressed in the neuroblastic external granule cells and Bergmann fibers. These results indicate that the cellular distributions of both splice variants are developmentally regulated, and suggest that the transient expression of the V2 receptor is involved in the mechanisms of cerebellar cytodifferentiation by AVP. Finally, transfected CHO-K1 .expressing similar amounts of both V2 splice variants, as that found in the cerebellum, showed a significant reduction in the surface expression of V2a receptors, suggesting that the differential expression of the V2 splice variants regulate the vasopressin signaling in the cerebellum. PMID:19281786
XAS study of V2O5/Al2O3 catalysts doped with rare earth oxides
International Nuclear Information System (INIS)
Centeno, M.A.; Malet, P.; Capitan, M.J.; Benitez, J.J.; Carrizosa, I.; Odriozola, J.A.
1995-01-01
This paper reports on XAS studies of well dispersed V 2 O 5 /Al 2 O 3 and V 2 O 5 /Sm 2 O 3 /Al 2 O 3 samples. XAS spectra at V-K and Sm-L III edges show that the rare earth oxide favours the formation of regular tetrahedral units, [VO 4 ], over the surface of the support. Positions of the preedge peak at the V-K edge, and intensities of the white line at the Sm-L III edge also suggest modifications in the electronic density around V and Sm atoms when they are simultaneously supported over Al 2 O 3 . ((orig.))
Color and vanadium valency in V-doped ZrO2
International Nuclear Information System (INIS)
Ren, Feng; Ishida, Shingo; Takeuchi, Nobuyuki
1993-01-01
The distribution and chemical states of vanadium in V-doped ZrO 2 were studied to clarify the origin of the color of vanadium-zirconium yellow pigment in comparison with vanadium-tin yellow pigment. ESCA data and measurements of lattice constants of V-doped ZrO 2 revealed that vanadium was dissolved mainly as V 4+ substituting for Zr in ZrO 2 lattice, and its solubility limit was 0.5 wt% as V 2 O 5 . It was found that the yellow color of vanadium-zirconium yellow was produced predominantly by the dissolved vanadium and that the contribution of vanadium oxide on ZrO 2 grains to the yellow color was about 1.30 of that of the dissolved vanadium when compared on the basis of equimolar quantity of vanadium. Most of the undissolved vanadium oxide was in an amorphous or a poorly crystallized state
Color-Space-Based Visual-MIMO for V2X Communication
Jai-Eun Kim; Ji-Won Kim; Youngil Park; Ki-Doo Kim
2016-01-01
In this paper, we analyze the applicability of color-space-based, color-independent visual-MIMO for V2X. We aim to achieve a visual-MIMO scheme that can maintain the original color and brightness while performing seamless communication. We consider two scenarios of GCM based visual-MIMO for V2X. One is a multipath transmission using visual-MIMO networking and the other is multi-node V2X communication. In the scenario of multipath transmission, we analyze the channel capacity numerically and w...
Development and production of an oligonucleotide MuscleChip: use for validation of ambiguous ESTs
Directory of Open Access Journals (Sweden)
Lanfranchi Gerolamo
2002-10-01
Full Text Available Abstract Background We describe the development, validation, and use of a highly redundant 120,000 oligonucleotide microarray (MuscleChip containing 4,601 probe sets representing 1,150 known genes expressed in muscle and 2,075 EST clusters from a non-normalized subtracted muscle EST sequencing project (28,074 EST sequences. This set included 369 novel EST clusters showing no match to previously characterized proteins in any database. Each probe set was designed to contain 20–32 25 mer oligonucleotides (10–16 paired perfect match and mismatch probe pairs per gene, with each probe evaluated for hybridization kinetics (Tm and similarity to other sequences. The 120,000 oligonucleotides were synthesized by photolithography and light-activated chemistry on each microarray. Results Hybridization of human muscle cRNAs to this MuscleChip (33 samples showed a correlation of 0.6 between the number of ESTs sequenced in each cluster and hybridization intensity. Out of 369 novel EST clusters not showing any similarity to previously characterized proteins, we focused on 250 EST clusters that were represented by robust probe sets on the MuscleChip fulfilling all stringent rules. 102 (41% were found to be consistently "present" by analysis of hybridization to human muscle RNA, of which 40 ESTs (39% could be genome anchored to potential transcription units in the human genome sequence. 19 ESTs of the 40 ESTs were furthermore computer-predicted as exons by one or more than three gene identification algorithms. Conclusion Our analysis found 40 transcriptionally validated, genome-anchored novel EST clusters to be expressed in human muscle. As most of these ESTs were low copy clusters (duplex and triplex in the original 28,000 EST project, the identification of these as significantly expressed is a robust validation of the transcript units that permits subsequent focus on the novel proteins encoded by these genes.
Experiences from start-up and use of fail-safe reactor level meter with KNITU probes
International Nuclear Information System (INIS)
Badiar, S.; Sipka, J.; Vanco, P.; Slanina, Marek; Liska, L.; Gavora, D.
2001-01-01
Within the framework of the reconstruction of both V1 Bohunice units with WWER-440/V-230 reactors, the VUJE-SIEMENS consortium implemented measurement systems for coolant level monitoring in reactor pressure vessels with 1E qualification, resp. with the qualification of category 1 according to NUSS RG1.97. The solution uses KNITU 11 probes made by Russian POZIT company. In operating plants, the installation causes problems in relation to the existing technology and quality assurance system. In the phase of implementation, the most important tasks were to resolve component quality, to commission the system, and to check its performance. (Authors)
2 TeV HEB beam abort at the SSCL
International Nuclear Information System (INIS)
Schailey, R.; Bull, J.; Clayton, T.; Kocur, P.; Mokhov, N.V.
1993-01-01
The High Energy Booster (HEB) of the Superconducting Super Collider Laboratory (SSCL) will require a full aperture beam abort over a dynamic energy range of 200 GeV to 2 TeV. Since the HEB is a bi-polar machine, both clockwise (CW) and counter-clockwise (CCW) beam aborts are required. Also, the stored beam energy of 6.55 MJ in the superconducting HEB imposes the full aperture requirement. In this report, the authors describe the abort channels in the HEB utility straight sections, aperture restrictions, mechanical interferences and solutions, kicker misfires, and a 2 TeV beam absorber
Lifescience Database Archive (English)
Full Text Available ral polyprotein OS=Barmah forest v... 30 6.6 sp|Q6B966|NAL14_MOUSE NACHT, LRR and PYD domains-containing pro...QSL 1601 >sp|P87515|POLN_BFV Non-structural polyprotein OS=Barmah forest virus PE
A salmonid EST genomic study: genes, duplications, phylogeny and microarrays
Directory of Open Access Journals (Sweden)
Brahmbhatt Sonal
2008-11-01
Full Text Available Abstract Background Salmonids are of interest because of their relatively recent genome duplication, and their extensive use in wild fisheries and aquaculture. A comprehensive gene list and a comparison of genes in some of the different species provide valuable genomic information for one of the most widely studied groups of fish. Results 298,304 expressed sequence tags (ESTs from Atlantic salmon (69% of the total, 11,664 chinook, 10,813 sockeye, 10,051 brook trout, 10,975 grayling, 8,630 lake whitefish, and 3,624 northern pike ESTs were obtained in this study and have been deposited into the public databases. Contigs were built and putative full-length Atlantic salmon clones have been identified. A database containing ESTs, assemblies, consensus sequences, open reading frames, gene predictions and putative annotation is available. The overall similarity between Atlantic salmon ESTs and those of rainbow trout, chinook, sockeye, brook trout, grayling, lake whitefish, northern pike and rainbow smelt is 93.4, 94.2, 94.6, 94.4, 92.5, 91.7, 89.6, and 86.2% respectively. An analysis of 78 transcript sets show Salmo as a sister group to Oncorhynchus and Salvelinus within Salmoninae, and Thymallinae as a sister group to Salmoninae and Coregoninae within Salmonidae. Extensive gene duplication is consistent with a genome duplication in the common ancestor of salmonids. Using all of the available EST data, a new expanded salmonid cDNA microarray of 32,000 features was created. Cross-species hybridizations to this cDNA microarray indicate that this resource will be useful for studies of all 68 salmonid species. Conclusion An extensive collection and analysis of salmonid RNA putative transcripts indicate that Pacific salmon, Atlantic salmon and charr are 94–96% similar while the more distant whitefish, grayling, pike and smelt are 93, 92, 89 and 86% similar to salmon. The salmonid transcriptome reveals a complex history of gene duplication that is
Directory of Open Access Journals (Sweden)
Soraya Ferreira Alves
2016-09-01
Full Text Available http://dx.doi.org/10.5007/2175-7968.2016v36n3p34 A Audiodescrição (AD, recurso utilizado para tornar o teatro, o cinema, a TV, bem como obras de arte visuais, acessíveis a pessoas com deficiência visual, vem aos poucos sendo implantada no Brasil e demandando profissionais capacitados. Com base nessa constatação, este artigo traz o relato de um projeto desenvolvido durante estágio pós-doutoral que se dedicou ao confronto da estética cinematográfica com as técnicas de audiodescrição a fim de verificar como o conhecimento da primeira pode contribuir para a formação do audiodescritor. Por meio da pesquisa-ação, foi produzido um curta-metragem adaptado de um conto de Mário de Andrade intitulado O Peru de Natal. O filme homônimo, assim como sua audiodescrição, foram realizados pelos alunos e professores da disciplina Tradução Intersemiótica do curso de Letras da Universidade Estadual do Ceará (UECE. Assim, pretendeu-se sugerir procedimentos didáticos que partiram da experiência dos alunos ao avaliarem suas escolhas e as implicações destas.
Pairagon+N-SCAN_EST: a model-based gene annotation pipeline
DEFF Research Database (Denmark)
Arumugam, Manimozhiyan; Wei, Chaochun; Brown, Randall H
2006-01-01
This paper describes Pairagon+N-SCAN_EST, a gene annotation pipeline that uses only native alignments. For each expressed sequence it chooses the best genomic alignment. Systems like ENSEMBL and ExoGean rely on trans alignments, in which expressed sequences are aligned to the genomic loci...... with de novo gene prediction by using N-SCAN_EST. N-SCAN_EST is based on a generalized HMM probability model augmented with a phylogenetic conservation model and EST alignments. It can predict complete transcripts by extending or merging EST alignments, but it can also predict genes in regions without EST...
Directory of Open Access Journals (Sweden)
Nuria Garatachea Vallejo
2005-01-01
Full Text Available Muchos son los estudios que demuestran el potencial de la frecuencia cardiaca (FC para estimar el coste energético de una actividad física, ya que se relaciona directamente con el consumo de oxígeno (V. O2. La mayoría de estudios describen la relación V. O2- FC como lineal para un amplio rango de esfuerzo, exceptuando los valores de reposo aunque se han propuesto diferentes funciones matemáticas continuas no lineales sin existir todavía un acuerdo en la ecuación más apropiada. También existen estudios que apuntan un cambio en la relación V. O2-FC en función de la intensidad del esfuerzo. Nuestro objetivo fue determinar cuál es la mejor función matemática que describe la relación entre la FC y el V. O2 y decidir cuál es la mejor función matemática para estimar el V. O2 a diferentes intensidades de esfuerzo. Participaron 14 sujetos que realizaron una prueba de esfuerzo máxima sobre cicloergómetro y una prueba que consistía en pedalear a 5 intensidades de esfuerzo (40, 50, 60, 70 y 80% del V. O2max durante 3 minutos. Durante ambas pruebas se midió V. O2 y frecuencia cardiaca. El modelo lineal y potencial fueron los modelos matemáticos más exactos para describir la relación V. O2-FC. El mayor error de estimación se produjo a bajas intensidades de esfuerzo. En conclusión, la elección de un tipo u otro de regresión influye en la exactitud del método de monitorización de la frecuencia cardiaca.
The first disease connection for Ca(v)2.2 channels
Czech Academy of Sciences Publication Activity Database
Weiss, Norbert
2015-01-01
Roč. 34, č. 3 (2015), s. 217-219 ISSN 0231-5882 R&D Projects: GA ČR GA15-13556S; GA MŠk 7AMB15FR015 Institutional support: RVO:61388963 Keywords : calcium channel * Ca(v)2.2 channel * channelopathies * myoclonus-dystonia syndrome Subject RIV: CE - Biochemistry Impact factor: 0.892, year: 2015
Directory of Open Access Journals (Sweden)
Yonal-Hindilerden I
2015-06-01
Full Text Available Ipek Yonal-Hindilerden, Aynur Daglar-Aday, Basak Akadam-Teker, Ceylan Yilmaz, Meliha Nalcaci, Akif Selim Yavuz, Deniz SarginDivision of Hematology, Department of Internal Medicine, Istanbul Medical Faculty, Istanbul University, Fatih-Istanbul, Turkey Background: Despite insights into the genetic basis of Philadelphia-negative myeloproliferative neoplasms (Ph-negative MPNs, a significant proportion of essential thrombocythemia (ET and primary myelofibrosis (PMF patients present with no known MPN disease alleles. There were no previous studies investigating the impact of ASXL1 mutations in Ph-negative MPNs in Turkey. In the current study, we investigated the prognostic significance of ASXL1 mutations in Turkish MPN patients. We also aimed to determine the prognostic significance of JAK2V617F allele burden and the relationship of JAK2V617F mutation with ASXL1 mutations in Ph-negative MPNs. Methods: About 184 patients from a single center diagnosed with Ph-negative MPNs were screened for ASXL1, JAK2V617F mutations, and JAK2V617F allele burden: 107 ET and 77 PMF. Results: A total of 29 ASXL1 mutations were detected in 24.7% of PMF and 8.4% of ET patients. ASXL1-mutated ET patients showed a trend toward an increase in the incidence of cerebrovascular events and higher total leukocyte counts. ASXL1-mutation in PMF was associated with older age and a higher prevalence of bleeding complications. In univariate analysis, overall survival (OS was significantly reduced in ASXL1-mutated PMF patients. In multivariate analysis, Dynamic International Prognostic Scoring System-plus high-risk category and ASXL1 mutation status were independently associated with shorter survival in PMF. In PMF, mutational status and allele burden of JAK2V617F showed no difference in terms of OS and leukemia-free survival. Conclusion: We conclude that ASXL1 mutations are molecular predictors of short OS in PMF. Keywords: Philadelphia-negative myeloproliferative neoplasms (Ph
Energy Technology Data Exchange (ETDEWEB)
Ortega, J. [Laboratorio de Termodinamica y Fisicoquimica de Fluidos, Parque Cientifico-Tecnologico, Campus Universitario de Tafira, Universidad de Las Palmas de Gran Canaria, 35071 Las Palmas de Gran Canaria, Canary Islands (Spain)]. E-mail: jortega@dip.ulpgc.es; Marrero, E. [Laboratorio de Termodinamica y Fisicoquimica de Fluidos, Parque Cientifico-Tecnologico, Campus Universitario de Tafira, Universidad de Las Palmas de Gran Canaria, 35071 Las Palmas de Gran Canaria, Canary Islands (Spain)
2007-05-15
The experimental data of excess molar enthalpies H{sub m}{sup E} and excess molar volumes V{sub m}{sup E} are presented for a set of 25 binary mixtures comprised of the first five methyl esters C{sub u-1}H{sub 2u-1}COOCH{sub 3} (u=1 to 5) and five {alpha},{omega}-dichloroalkanes, ClCH{sub 2}(CH{sub 2}){sub v-2}CH{sub 2}Cl (v=2 to 6), obtained at a temperature of 298.15K and atmospheric pressure. Except for the mixtures with u=1 and v=2 to 6, which are all endothermic and with u=5 and v=2 to 6, which are all exothermic, the others present net endo/exothermic effects and these mixing effects evolve quasiregularly, from endothermic to exothermic, depending on the dichloroalkane present. However, the V{sub m}{sup E} are positive in most mixtures except for those corresponding to u=4,5 and v=5,6, which present contraction effects. These results indicate a set of specific interactions with simultaneous effects for V{sub m}{sup E} of expansion/contraction and for exothermic/endothermic H{sub m}{sup E} for this set of mixtures. The change in V{sub m}{sup E} with the chain length of the compounds is irregular. To achieve a good application of the UNIFAC model using the version of Dang and Tassios, parameters of the ester (G)/dichloride (G') interaction were calculated again, making a distinction, during its application, dependent on the acid part of the ester u. Hence, interaction parameters are presented as a function of u, and of the dichloroalkane chain length v. The most appropriate general expression was of the type:a{sub G/G{sup '}}={phi}(u,v)={sigma}sub(i=0)sup(n)a{sub i-1}u{sup i-1}+{sigma}sub(i=0= )sup(n)b{sub i-1}v{sup i-1}and with this proposal good estimations of enthalpies were obtained with the UNIFAC model.
Contextual modulation revealed by optical imaging exhibits figural asymmetry in macaque V1 and V2.
Zarella, Mark D; Ts'o, Daniel Y
2017-01-01
Neurons in early visual cortical areas are influenced by stimuli presented well beyond the confines of their classical receptive fields, endowing them with the ability to encode fine-scale features while also having access to the global context of the visual scene. This property can potentially define a role for the early visual cortex to contribute to a number of important visual functions, such as surface segmentation and figure-ground segregation. It is unknown how extraclassical response properties conform to the functional architecture of the visual cortex, given the high degree of functional specialization in areas V1 and V2. We examined the spatial relationships of contextual activations in macaque V1 and V2 with intrinsic signal optical imaging. Using figure-ground stimulus configurations defined by orientation or motion, we found that extraclassical modulation is restricted to the cortical representations of the figural component of the stimulus. These modulations were positive in sign, suggesting a relative enhancement in neuronal activity that may reflect an excitatory influence. Orientation and motion cues produced similar patterns of activation that traversed the functional subdivisions of V2. The asymmetrical nature of the enhancement demonstrated the capacity for visual cortical areas as early as V1 to contribute to figure-ground segregation, and the results suggest that this information can be extracted from the population activity constrained only by retinotopy, and not the underlying functional organization.
Formação de classes funcionais de estímulos musicais
Directory of Open Access Journals (Sweden)
Alex Roberto Machado
2009-04-01
Full Text Available O objetivo deste experimento foi verificar o efeito do treino discriminativo sobre a formação de classes funcionais de melodias em andamentos e modos diferentes. Nove estudantes universitários do 2° período da graduação em Psicologia foram divididos em três grupos: Modo, Andamento ou Misto. O software SomPsi, produzido especialmente para este estudo, treinou os participantes e gerou relatórios com informações sobre os desempenhos, nas quatro fases do procedimento. O treino proposto mostrou-se eficiente para a formação das classes funcionais de estímulos sonoros musicais. Observou-se que agrupamentos de estímulos pela propriedade andamento foram mais facilmente discriminados que os agrupados pela melodia. A manipulação combinada das duas propriedades, em condição convergente, permitiu desempenho superior dos participantes. A rápida formação de classes funcionais e equivalentes de estímulos musicais, a partir de procedimentos de ensino automatizado de relações condicionais entre estímulos musicais, indica a possibilidade de uso desse procedimento na iniciação à música.
Facile synthesis and characterization of rough surface V2O5 ...
Indian Academy of Sciences (India)
2017-09-20
Sep 20, 2017 ... V2O5 nanomaterials with rough surface were synthesized using commercial V2O5, ethanol (EtOH) and H2O ... properties make them available as power sources for the next- ... by the electrospinning method and obtained high capacitance .... performed in the potential range of −0.6 to 0.8 V at a current.
Directory of Open Access Journals (Sweden)
Elena eBorra
2011-06-01
Full Text Available Non-extrastriate projections to area V1 in monkeys, now demonstrated by several anatomical studies, are potential substrates of physiologically documented multisensory effects in primary sensory areas. The full network of projections among association and primary areas, however, is likely to be complex and is still only partially understood. In the present report, we used the anterograde tracer biotinylated dextran amine to investigate projections to areas V1 and V2 from subdivisions of the parietal association cortex in macaque. Parietal cortex was chosen to allow comparisons between projections from this higher association area and from other previously reported areas. In addition, we were interested in further elucidating pathways to areas V1 and V2 from parietal areas, as potentially contributing to attention and active vision. Of eight cases, three brains had projections only to area V2, and the five others projected to both areas V1 and V2. Terminations in area V1 were sparse. These were located in supragranular layers I, II, upper III; occasionally in IVB; and in layer VI. Terminations in V2 were denser, and slightly more prevalent in the supragranular layers. For both areas, terminations were in the calcarine region, corresponding to the representation of the peripheral visual field. By reconstructions of single axons, we demonstrated that four of nine axons had collaterals, either to V1 and V2 (n=1 or to area V1 and a ventral area likely to be TEO (n=3. In area V1, axons extended divergently in layer VI as well as layer I. Overall, these and previous results suggest a nested connectivity architecture, consisting of multiple direct and indirect recurrent projections from association areas to area V1. Terminations in area V1 are not abundant, but could be potentiated by the network of indirect connections.
Progressive building methods in nuclear power plant construction
International Nuclear Information System (INIS)
Sikura, V.
1980-01-01
A detailed description is given of the new prospective technologies used in the construction of the Bohunice V-1 nuclear power plant. They include the use of steel and large-area forms, the use of profile sheets as a substitute for forms, assembled raw partitions, wall shells consisting of clamped porous concrete slabs, assembled roof shells, special finish of concrete walls, bearing wall deep foundation, the use of modern building machinery for concreting, reinforcing and welding works. (M.S.)
Pressure-induced charge ordering of LiV2O4
International Nuclear Information System (INIS)
Takeda, K.; Hidaka, H.; Kotegawa, H.; Kobayashi, T.C.; Shimizu, K.; Harima, H.; Fujiwara, K.; Miyoshi, K.; Takeuchi, J.; Ohishi, Y.; Adachi, T.; Takata, M.; Nishibori, E.; Sakata, M.; Watanuki, T.; Shimomura, O.
2005-01-01
The powder X-ray diffraction experiments of LiV 2 O 4 have been performed at low temperature and high pressure using synchrotron radiation. In the isothermal experiment at 10K, the cubic-rhombohedral phase transition corresponding to the metal-insulator transition is found at around 13GPa. This transition seems to be due to charge ordering of V ions on the analogy of the metal-insulator transition in AlV 2 O 4
Nuevos criterios estético-funcionales de las pantallas antirruido construidas de hormigón
Directory of Open Access Journals (Sweden)
Bello-Morales, Antonio
1989-06-01
Full Text Available The noise produced by road traffic can be abated either at the source (the traffic or at the receiver (housing or in external space. From the operational point of view, the most efficient and inmediat way of achieving this acoustic abatement is to situate some barriers near the road that interrumpt the path of the sonic waves, lessening the impact on the receiver until it reaches acceptable levels. An antinoise screen, because of its physical characteristics must fullfil two funtions: acoustic and aesthetic. The first one justifies its own viability and the second requieres an adequate insertion in urban spaces. In this work some basic action criteria that serves to guide in the obtaining an efficient aesthetic-funtional position of the anti-noise screens by the sides of roads or railways are developped.
El ruido producido por el tráfico vial puede atenuarse actuando en la fuente (el tráfico, en el receptor (las viviendas o en los espacios exteriores. Desde el aspecto operativo, la vía más eficaz e inmediata de conseguir esta atenuación acústica es situar unas pantallas próximas a las vías que, interrumpiendo la trayectoria de la onda sónica, amortigüe el impacto sobre el receptor hasta niveles aceptables. Una pantalla antirruido, por sus características físicas, debe cumplir dos funciones: acústica y estética. La primera justifica su propia viabilidad y la segunda exige una adecuada inserción en los espacios urbanos. En este trabajo se exponen unos criterios básicos de actuación que sirvan de orientación para conseguir una eficaz ubicación estético funcional de las pantallas antirruido en las márgenes de las carreteras o de los ferrocarriles.
Facile synthesis technology of Li_3V_2(PO_4)_3/C adding H_2O_2 in ball mill process
International Nuclear Information System (INIS)
Min, Xiujuan; Mu, Deying; Li, Ruhong; Dai, Changsong
2016-01-01
Highlights: • Sintering time of Li_3V_2(PO_4)_3 reduced to 6 hours by adding hydrogen peroxide. • Electrochemical performance of Li_3V_2(PO_4)_3 was improved by reducing sintering time. • The Li_3V_2(PO_4)_3 production process was simplified during material synthesis stage. - Abstract: Li_3V_2(PO_4)_3/C has stable structure, high theory specific capacity and good safety performance, therefore it has become the research focus of lithium-ion batteries in recent years. The facile synthesis technology of Li_3V_2(PO_4)_3/C was characterized by adding different amounts of H_2O_2. Structure and morphology characteristics were examined by XRD, TG, Raman Spectroscopy, XPS and SEM. Electrochemical performance was investigated by constant current charging and discharging test. The results revealed that the Li_3V_2(PO_4)_3/C electrochemical performance of adding 15 mL H_2O_2 was better after sintering during 6 h. At the charge cut-off voltage of 4.3 V, the first discharge capacity at 0.2 C rate reached 127 mAh g"−"1. Because of adding H_2O_2 in the ball-mill dispersant, the vanadium pentoxide formed the wet sol. The molecular-leveled mixture increased the homogeneity of raw materials. Therefore, the addition of H_2O_2 shortened the sintering time and significantly improved the electrochemical performance of Li_3V_2(PO_4)_3/C.
All solid-state V2O5-based flexible hybrid fiber supercapacitors
Li, Huan; He, Jin; Cao, Xin; Kang, Liping; He, Xuexia; Xu, Hua; Shi, Feng; Jiang, Ruibin; Lei, Zhibin; Liu, Zong-Huai
2017-12-01
Vanadium pentoxide/single-walled carbon nanotube (V2O5-SWCNT) hybrid fibers with good electrochemical performance and flexibility are firstly prepared by using wet-spinning method. V2O5 nanobelt suspension is obtained by mixing V2O5 bulk, 30% H2O2, H2O and followed by hydrothermally treating at 190 °C for 15 h. SWCNT suspension is suspended into V2O5 nanobelt suspension under vigorous stirring, the V2O5-SWCNT homogenous suspension is obtained. It is injected into a coagulation bath composed of 5 wt % CaCl2 ethanol-water solution using syringe pump, V2O5-SWCNT hybrid fibers are prepared by washing with deionized water and drying at room temperature. Reduced graphene oxide (RGO)-SWCNT hybrid fibers are also prepared by the similar wet-spinning approach and followed by reducing GO-SWCNT hybrid fibers in an aqueous solution of hydriodic acid. All solid-state asymmetric V2O5/SWCNT//RGO/SWCNT fiber supercapacitors are assembled with V2O5-SWCNT fiber as positive electrode and RGO-SWCNT fiber as negative electrode by using PVA-H3PO4 as gel electrolyte. The assembled device not only shows maximum volumetric energy density of 1.95 mW h cm-3 at a volumetric power density of 7.5 mW cm-3, superior rate performance and cycling stability, but also exhibits remarkable flexibility to tolerate long-term and repeated bending. This work will open a new application filed of V2O5-based fibers in wearable energy storage devices.
Directory of Open Access Journals (Sweden)
José Reinaldo Marrero-Zaldívar
2012-01-01
Full Text Available El artículo aborda las potencialidades axiológicas de la obra martiana para el desarrollo de la educación estética. Presenta un estudio sistematizado de los principales acercamientos estéticos y el análisis de la singularidad de su proyección para el cumplimiento de dicho objetivo. El autor, a partir del estudio de la obra martiana y las direcciones del abordaje de su crítica literaria y artística, sintetizó ideas que se integran como núcleos conceptuales del pensamiento estético martiano, las cuales constituyen pilares esenciales para el desarrollo de la educación estética. En correspondencia con el análisis realizado se elaboró una metodología la cual ha sido aplicada en centros del la educación preuniversitaria de la provincia y en el Programa de Introducción a la Didáctica en el Curso de Formación Básica de la Universidad de Ciencias Pedagógicas "José de la Luz y Caballero".
Lifescience Database Archive (English)
Full Text Available ct: 39 LKSTPFTSSHRRILPS-TTVTKQQFSVRASAAVETLEKTDAAIVEKSVNTIRFLAIDAVE 97 Query: 361 KANSGHPCLPMGCAPMGHILYDEIMR...YNPKYPYRFNRDRFVLSACHGCMLHYALLHLAGY 540 KANSGHP LPMGCAPMGHILYDE+M+YNPK PY FNRDRFVL...SA HGCML YALLHLAGY Sbjct: 98 KANSGHPGLPMGCAPMGHILYDEVMKYNPKNPYWFNRDRFVLSAGHGCMLQYALLHLAGY 157 Query: 541 DSV...TIRFLAVDAVNKANSGHPCLPMGCAPMGHILYD 426 A V AAVEA TD+ LV+ S+NTIRFLA+DAV KANSGHP LPMGCAPMGHILYD Sbjct: 60 ASAVV...RAAAVEALESTDIDQLVEKSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHILYD 119 Query: 427 EIMRYNPKYPYRFNRDRFVLSACHGCMLHYALLHLAG
Lifescience Database Archive (English)
Full Text Available kinase D... 31 6.8 sp|P26372|KRUC_SHEEP Keratin, ultra high-sulfur matrix protein O... 31 6.8 sp|P40798|STC_DROME Protein shuttle cra...ft OS=Drosophila melanoga... 30 8.8 sp|Q0V8T4|CTP5C_RAT
HIV-ravim võis saastuda tehases / Agnes Kuus
Kuus, Agnes
2007-01-01
Keemiliselt saastunud HIV-ravimi Viracept sattumine Eestisse on vähetõenäoline, kuid ohutuse huvides korjatakse kõik ravimid patsientide käest tagasi ning asendatakse ravimifirma kulul. Lisa: HIVi ravi
International Nuclear Information System (INIS)
Dodd, J.A.; Lipson, S.J.; Flanagan, D.J.; Blumberg, W.A.M.; Person, J.C.; Green, B.D.
1991-01-01
Measurements of the dynamics of NH(X 3 summation - , v =1--3), created in electron-irradiated N 2 /H 2 and Ar/N 2 /H 2 mixtures, have been performed. Time-resolved Fourier spectroscopy was used to observe NH(v→v--1) vibrational fundamental band emission. Time-dependent populations were then determined by spectral fitting. Subsequent kinetic fitting of these populations using a single-quantum relaxation model and a power-law dependence of k v on v yielded the following NH(v =1--3) relaxation rate constants (units of 10 -14 cm 3 s -1 ): k v=1 (N 2 )=1.2±0.5, k v=2 (N 2 )=3.8±1.5, k v=3 (N 2 )=7.5±2.5; k v=1 (Ar)=0.2±0.1, k v=2 (Ar)=0.5±0.2, k v=3 (Ar)=0.8±0.3; k v=1 (H 2 )≤50, k v=2 (H 2 )≤100, k v=3 (H 2 )≤150. In addition, the N 2 /H 2 data provided a measurement of the nascent excited vibrational state distribution resulting from the reaction N( 2 D)+H 2 →NH(X,v)+H. The ratio NH(1):NH(2):NH(3) was found to be 1.0:0.97:0.81 (±0.28 in each value). Comparison of the observed nascent distribution with that of a statistical model suggests that the ratio NH(0):NH(1)=0.47. Using this derived distribution, we find the average product level left-angle v right-angle =1.6, and the fraction of the available product energy in vibration left-angle f v right-angle =0.44
Friedel-Crafts Alkylation of o-xylene over V2O5/ZrO2 Catalysts
CSIR Research Space (South Africa)
Kesavan Pillai, Sreejarani
2012-01-01
Full Text Available The present study has undertaken the Friedel-Crafts benzylation of aromatics over the V2O5/ZrO2 catalysts systems. Catalysts with different V2O5 content (0-15wt %) was prepared by wet impregnation method and characterized by XRD, BET surface area...
Lifescience Database Archive (English)
Full Text Available 0.21 sp|Q8I7Z8|HAM_DROME Transcription factor hamlet OS=Drosophila me... 36 0.21 sp|P03189|V120_EBV Capsid ...QLTPTGSPRRSAAGS 572 + + T + SAA S Sbjct: 184 AKSSSAAPSSTEAKITSAAPS 204 >sp|Q8I7Z8|HAM_DROME Transcription factor hamlet
Lifescience Database Archive (English)
Full Text Available 5 1e-48 tr|Q01EK1|Q01EK1_OSTTA Cao undefined product (IC) OS=Ostreococcu... 130 7...FVKWKDGAPEEWIDAENVADDLI 584 EY V+WKDG WI AE +A D++ Sbjct: 97 EYLVEWKDGHEPSWIPAEAIAADVV 121 >tr|Q01EK1|Q01EK1_OSTTA Cao undefined
New α-Zn2V2O7/carbon nanotube nanocomposite for supercapacitors
International Nuclear Information System (INIS)
Venugopal, Nulu; Kim, Woo-Sik
2015-01-01
This study synthesized α-Zn 2 V 2 O 7 nanopowders using a hydrothermal approach followed by annealing treatment. The resulting powders were then mixed with multi-walled carbon nanotubes and electrochemically characterized as new nanocomposite electrodes for supercapacitors. The structure and surface morphology of the powders were characterized by X-ray diffraction, transmission electron microscopy, and scanning electron microscopy. Plus, the capacitive behavior of the composite electrodes was evaluated by cyclic voltammetry and galvanostatic charge-discharge cycles in different molar aqueous KCl solutions. The α-Zn 2 V 2 O 7 /multi-walled carbon nanotube composite electrodes were prepared using three different ratios and screened for their use in supercapacitors. As a result, the α-Zn 2 V 2 O 7 / multi-walled carbon nanotube composite electrode with a 1 : 2 ratio was identified as the best electrode with a specific capacitance value of 44.8 F g -1 in 0.5M KCl. Notwithstanding, all the tested composite electrodes demonstrated an excellent cycle stability and showed a less than 4% change in their specific capacitance values when compared to the initial values.
Exploiting a wheat EST database to assess genetic diversity.
Karakas, Ozge; Gurel, Filiz; Uncuoglu, Ahu Altinkut
2010-10-01
Expressed sequence tag (EST) markers have been used to assess variety and genetic diversity in wheat (Triticum aestivum). In this study, 1549 ESTs from wheat infested with yellow rust were used to examine the genetic diversity of six susceptible and resistant wheat cultivars. The aim of using these cultivars was to improve the competitiveness of public wheat breeding programs through the intensive use of modern, particularly marker-assisted, selection technologies. The F(2) individuals derived from cultivar crosses were screened for resistance to yellow rust at the seedling stage in greenhouses and adult stage in the field to identify DNA markers genetically linked to resistance. Five hundred and sixty ESTs were assembled into 136 contigs and 989 singletons. BlastX search results showed that 39 (29%) contigs and 96 (10%) singletons were homologous to wheat genes. The database-matched contigs and singletons were assigned to eight functional groups related to protein synthesis, photosynthesis, metabolism and energy, stress proteins, transporter proteins, protein breakdown and recycling, cell growth and division and reactive oxygen scavengers. PCR analyses with primers based on the contigs and singletons showed that the most polymorphic functional categories were photosynthesis (contigs) and metabolism and energy (singletons). EST analysis revealed considerable genetic variability among the Turkish wheat cultivars resistant and susceptible to yellow rust disease and allowed calculation of the mean genetic distance between cultivars, with the greatest similarity (0.725) being between Harmankaya99 and Sönmez2001, and the lowest (0.622) between Aytin98 and Izgi01.
Exploiting a wheat EST database to assess genetic diversity
Directory of Open Access Journals (Sweden)
Ozge Karakas
2010-01-01
Full Text Available Expressed sequence tag (EST markers have been used to assess variety and genetic diversity in wheat (Triticum aestivum. In this study, 1549 ESTs from wheat infested with yellow rust were used to examine the genetic diversity of six susceptible and resistant wheat cultivars. The aim of using these cultivars was to improve the competitiveness of public wheat breeding programs through the intensive use of modern, particularly marker-assisted, selection technologies. The F2 individuals derived from cultivar crosses were screened for resistance to yellow rust at the seedling stage in greenhouses and adult stage in the field to identify DNA markers genetically linked to resistance. Five hundred and sixty ESTs were assembled into 136 contigs and 989 singletons. BlastX search results showed that 39 (29% contigs and 96 (10% singletons were homologous to wheat genes. The database-matched contigs and singletons were assigned to eight functional groups related to protein synthesis, photosynthesis, metabolism and energy, stress proteins, transporter proteins, protein breakdown and recycling, cell growth and division and reactive oxygen scavengers. PCR analyses with primers based on the contigs and singletons showed that the most polymorphic functional categories were photosynthesis (contigs and metabolism and energy (singletons. EST analysis revealed considerable genetic variability among the Turkish wheat cultivars resistant and susceptible to yellow rust disease and allowed calculation of the mean genetic distance between cultivars, with the greatest similarity (0.725 being between Harmankaya99 and Sönmez2001, and the lowest (0.622 between Aytin98 and Izgi01.
Relatório de Estágio Curricular - Catedral Café (Guarda)
Carvalho, Catarina
2013-01-01
O estágio curricular foi desenvolvido no âmbito do curso de marketing lecionado no Instituto Politécnico da Guarda e foi realizado na empresa Catedralcafé sediada na cidade da Guarda. Teve como principal objetivo complementar a formação académica através do exercício de tarefas e funções práticas no âmbito de marketing. Quanto ao trabalho desenvolvido ao longo dos três meses foram várias as atividades elaboradas das quais se destaca: a criação de eventos, a criação de uma base de dados e a...
Contextual modulation revealed by optical imaging exhibits figural asymmetry in macaque V1 and V2
Directory of Open Access Journals (Sweden)
Zarella MD
2017-04-01
Full Text Available Mark D Zarella, Daniel Y Ts’o Department of Neurosurgery, SUNY Upstate Medical University, Syracuse, NY, USA Abstract: Neurons in early visual cortical areas are influenced by stimuli presented well beyond the confines of their classical receptive fields, endowing them with the ability to encode fine-scale features while also having access to the global context of the visual scene. This property can potentially define a role for the early visual cortex to contribute to a number of important visual functions, such as surface segmentation and figure–ground segregation. It is unknown how extraclassical response properties conform to the functional architecture of the visual cortex, given the high degree of functional specialization in areas V1 and V2. We examined the spatial relationships of contextual activations in macaque V1 and V2 with intrinsic signal optical imaging. Using figure–ground stimulus configurations defined by orientation or motion, we found that extraclassical modulation is restricted to the cortical representations of the figural component of the stimulus. These modulations were positive in sign, suggesting a relative enhancement in neuronal activity that may reflect an excitatory influence. Orientation and motion cues produced similar patterns of activation that traversed the functional subdivisions of V2. The asymmetrical nature of the enhancement demonstrated the capacity for visual cortical areas as early as V1 to contribute to figure–ground segregation, and the results suggest that this information can be extracted from the population activity constrained only by retinotopy, and not the underlying functional organization. Keywords: striate, extrastriate, segmentation, figure–ground, functional organization
Fleet operator risks for using fleets for V2G regulation
International Nuclear Information System (INIS)
Hill, Davion M.; Agarwal, Arun S.; Ayello, Francois
2012-01-01
Future fleets of vehicles may include electric vehicles (EVs) or hybrid electric vehicles (HEVs) because of potential fuel savings. Recent demonstration of diesel parallel hybrids in a delivery fleet led to fuel economy improvements, and hybrid bus demonstrations exhibited twice the fuel economy of the conventional bus. Fleet ownership may include management of a fleet of vehicles as small as 10 units and as large as hundreds or thousands. In addition to fuel savings, the newer extended range electric vehicles (EREVs) and pure EVs permit vehicle to grid (V2G) opportunities. These V2G opportunities may present additional revenue for fleets by providing ancillary services to local grid independent system operators (ISOs), provided that the burden of driving and V2G services do not accelerate the degradation of the battery systems in these vehicles. The subject of this study is to determine the financial risks associated with accelerated battery degradation in a V2G-enabled EREV fleet expected to perform ancillary service duty while charging in addition to the normal loads of drive cycle duty. We determine that battery cycle life during V2G duty is a critical parameter, which can determine whether or not the business model is viable. - Highlights: ► V2G regulation cycle life of EREV batteries must be >50,000 cycles to be profitable. ► Present knowledge and test data about the impact of V2G cycles on battery life are limited. ► Replacement of batteries and energy throughput are major factors in the cost–benefit analysis. ► V2G fleet is not viable with present data but can be viable with some technical advancement.
Driver, Brian E; Khalil, Ayesha; Henry, Timothy; Kazmi, Faraz; Adil, Amina; Smith, Stephen W
Precordial normal variant ST elevation (NV-STE), previously often called "early repolarization," may be difficult to differentiate from subtle ischemic STE due to left anterior descending (LAD) occlusion. We previously derived and validated a logistic regression formula that was far superior to STE alone for differentiating the two entities on the ECG. The tool uses R-wave amplitude in lead V4 (RAV4), ST elevation at 60 ms after the J-point in lead V3 (STE60V3) and the computerized Bazett-corrected QT interval (QTc-B). The 3-variable formula is: 1.196 x STE60V3 + 0.059 × QTc-B - 0.326 × RAV4 with a value ≥23.4 likely to be acute myocardial infarction (AMI). Adding QRS voltage in V2 (QRSV2) would improve the accuracy of the formula. 355 consecutive cases of proven LAD occlusion were reviewed, and those that were obvious ST elevation myocardial infarction were excluded. Exclusion was based on one straight or convex ST segment in V2-V6, 1 millimeter of summed inferior ST depression, any anterior ST depression, Q-waves, "terminal QRS distortion," or any ST elevation >5 mm. The NV-STE group comprised emergency department patients with chest pain who ruled out for AMI by serial troponins, had a cardiologist ECG read of "NV-STE," and had at least 1 mm of STE in V2 and V3. R-wave amplitude in lead V4 (RAV4), ST elevation at 60 ms after the J-point in lead V3 (STE60V3) and the computerized Bazett-corrected QT interval (QTc-B) had previously been measured in all ECGs; physicians blinded to outcome then measured QRSV2 in all ECGs. A 4-variable formula was derived to more accurately classify LAD occlusion vs. NV-STE and optimize area under the curve (AUC) and compared with the previous 3-variable formula. There were 143 subtle LAD occlusions and 171 NV-STE. A low QRSV2 added diagnostic utility. The derived 4-variable formula is: 0.052*QTc-B - 0.151*QRSV2 - 0.268*RV4 + 1.062*STE60V3. The 3-variable formula had an AUC of 0.9538 vs. 0.9686 for the 4-variable formula (p = 0
Ionic liquid intercalated V2O5 nanorods: synthesis and ...
Indian Academy of Sciences (India)
Administrator
materials for lithium ion battery, catalyst for photocata- lytic degradation ... ties.5,6 This compound is widely studied and is a promising material, both in the pure .... Figure 3 shows the Raman spectra of IL-V2O5 nanorods and calcined V2O5 ...
Directory of Open Access Journals (Sweden)
Maximilian Muenchhoff
Full Text Available Human immunodeficiency virus type 1 (HIV-1 genetic diversity poses a challenge to reliable viral load monitoring. Discrepancies between different testing platforms have been observed, especially for non-clade-B virus. Therefore we compare, in antiretroviral therapy (ART-naïve South African subjects predominantly infected with HIV-1 clade-C, three commercially available assays: the COBAS AmpliPrep/COBAS TaqMan HIV-1 Test version 2.0 by Roche (CAP/CTM v2.0, the BioMérieux NucliSens Version 2.0 Easy Q/Easy Mag (NucliSens v2.0 and the Roche COBAS Amplicor HIV-1 Monitor Test Version 1.5 (Amplicor v1.5. Strong linear correlation was observed and Bland-Altman analyses showed overall good agreement between the assays with mean viral load differences of 0.078 log cp/ml (NucliSens v2.0 - Amplicor v1.5, 0.260 log cp/ml (CAP/CTM v2.0 - Amplicor v1.5 and 0.164 log cp/ml (CAP/CTM v2.0 - NucliSens v2.0, indicating lower mean viral load results for the Amplicor v1.5 and higher mean readings for the CAP/CTM v2.0. Consistent with observations following previous comparisons of CAP/CTM v2.0 versus Amplicor v1.5, the CAP/CTM v2.0 assay detected low-level viremia (median 65 cp/ml in more than one-third of those in whom viremia had been undetectable (<20 cp/ml in assays using the NucliSens platform. These levels of viremia are of uncertain clinical significance but may be of importance in early detection of ART resistance in those on treatment. Overall the three assays showed good comparability of results but with consistent, albeit relatively small, discrepancies for HIV-1 clade-C samples, especially in the low-viremic range that should be taken into account when interpreting viral load data.
Adubação foliar de boro em diferentes estádios fenológicos da cultura do amendoim
Directory of Open Access Journals (Sweden)
João Paulo Machado Mantovani
2013-04-01
Full Text Available A adubação boratada foliar, na cultura do amendoim, pode ser uma estratégia viável para fornecimento desse elemento à planta; porém, são poucos os conhecimentos sobre dosagens, épocas e efeitos de parcelamento das doses. O objetivo deste trabalho foi avaliar as características de produção e a composição mineral foliar em diferentes doses, épocas de aplicação e parcelamentos da adubação boratada. O experimento foi conduzido na safra de verão 2010/2011, em Latossolo Vermelho distroférrico, em Rubiácea (SP. Foram estudadas as doses de zero; 0,5; 1,0; 1,5 e 2,0 kg ha-1 de boro (B, aplicadas por via foliar, utilizando-se como fonte o ácido bórico. Os efeitos da adubação boratada foram testados em doses únicas nos estádios V1 ou R5, além do parcelamento da dose de 1,0 kg ha-1 (0,5 kg ha-1 em V1 e R5, de 1,5 (0,75 kg ha-1 em V1 e R5; 0,5 kg ha-1 em V1, R1 e R5 e de 2,0 kg ha-1 (1,0 kg ha-1 em V1 e R5; 0,5 kg ha-1 em V1, R1, R3 e R5. O aumento na produtividade de amendoim em casca ocorreu apenas com a dose de 1,5 kg ha-1, parcelada em três aplicações de 0,5 kg ha-1 em V1, R1 e R5. A utilização de 2,0 kg ha-1 de B foliar no amendoim causou efeito depressivo na produtividade, rendimento e número de vagens por planta.
Lifescience Database Archive (English)
Full Text Available U Plastocyanin OS=Pediastrum duplex GN=Pcy ... 75 3e-12 tr|B7FH62|B7FH62_MEDTR Putative uncharacterized prot...PH+ A MVGTI V+ Sbjct: 86 KGLAFSAGESFESTFSEPGTYTYYCEPHRGAGMVGTITVQ 125 >tr|Q4R1A7|Q4R1A7_PEDDU Plastocyanin OS=Pediastrum duplex
Lifescience Database Archive (English)
Full Text Available PEDDU Plastocyanin OS=Pediastrum duplex GN=Pcy ... 75 3e-12 tr|B7FH62|B7FH62_MEDTR Putative uncharacterized ...YYC PH+ A MVGTI V+ Sbjct: 86 KGLAFSAGESFESTFSEPGTYTYYCEPHRGAGMVGTITVQ 125 >tr|Q4R1A7|Q4R1A7_PEDDU Plastocyanin OS=Pediastrum duplex
Nikolakis, Vladimiros A; Exarchou, Vassiliki; Jakusch, Tamás; Woolins, J Derek; Slawin, Alexandra M Z; Kiss, Tamás; Kabanos, Themistoklis A
2010-10-14
The treatment of the trichloro-1,3,5-triazine with N-methylhydroxylamine hydrochloride results in the replacement of the three chlorine atoms of the triazine ring with the function -N(OH)CH(3) yielding the symmetrical tris-(hydroxyamino)triazine ligand H(3)trihyat. Reaction of the ligand H(3)trihyat with NaV(V)O(3) in aqueous solution followed by addition of Ph(4)PCl gave the mononuclear vanadium(V) compound Ph(4)P[V(V)O(2)(Htrihyat)] (1). The structure of compound 1 was determined by X-ray crystallography and indicates that this compound has a distorted square-pyramidal arrangement around vanadium. The ligand Htrihyat(2-) is bonded to vanadium atom in a tridentate fashion at the triazine ring nitrogen atom and the two deprotonated hydroxylamido oxygen atoms. The high electron density of the triazine ring nitrogen atoms, which results from the resonative contribution of electrons of exocyclic nitrogen atoms, leads to a very strong V-N bond. The cis-[V(V)O(2)(Htrihyat)](-) species exhibits high hydrolytic stability in aqueous solution over a wide pH range, 2.5-11.5, as was evidenced by potentiometry.
Color-Space-Based Visual-MIMO for V2X Communication.
Kim, Jai-Eun; Kim, Ji-Won; Park, Youngil; Kim, Ki-Doo
2016-04-23
In this paper, we analyze the applicability of color-space-based, color-independent visual-MIMO for V2X. We aim to achieve a visual-MIMO scheme that can maintain the original color and brightness while performing seamless communication. We consider two scenarios of GCM based visual-MIMO for V2X. One is a multipath transmission using visual-MIMO networking and the other is multi-node V2X communication. In the scenario of multipath transmission, we analyze the channel capacity numerically and we illustrate the significance of networking information such as distance, reference color (symbol), and multiplexing-diversity mode transitions. In addition, in the V2X scenario of multiple access, we may achieve the simultaneous multiple access communication without node interferences by dividing the communication area using image processing. Finally, through numerical simulation, we show the superior SER performance of the visual-MIMO scheme compared with LED-PD communication and show the numerical result of the GCM based visual-MIMO channel capacity versus distance.
Mode modernitātē: estētiskie un temporālie aspekti
Bērtule, Elīna
2015-01-01
Darbā aplūkots apģērba modes fenomens un tā attīstība modernajā laikmetā. Modes un modernitātes ciešā saikne ļauj modi skatīt kā modernitātes pilnīgāko ekspresiju. Ņemot vērā modes uzmanību pret izskatu un skaistumu un galvenokārt pamatojoties uz tādu autoru kā Bodlēra, Barta, Zimmela un Malarmē koncepcijām, tiek pētītas modes skaistuma atklāšanas iespējas un estētiskas vērtības nozīmju radīšana. Respektējot apģērba modes piesaistītību ķermenim, darbā uzmanība tiek veltīta arī drēbēm un ķerme...
Support calculations for management of PRISE leakage accidents
Energy Technology Data Exchange (ETDEWEB)
Matejovic, P.; Vranka, L. [Nuclear Power Plants Research Inst. Vuje, Trnava (Slovakia)
1997-12-31
Accidents involving primary-to-secondary leakage (PRISE) caused by rupture of one or a few tubes are well known design basis events in both, western and VVER NPPs. Operating experience and in-service inspections of VVER-440 units have demonstrated also the potential for large PRISE leaks in the case of the steam generator (SG) primary collector cover lift-up (Rovno NPP). Without performing any countermeasure for limitation of SG collector cover lift-up, a full opening results in PRISE leak with an equivalent diameter 107 mm. Although this accident was not considered in the original design, this event is usually analysed as DBA too. Different means are available for detection and mitigation of PRISE leakage in NPPs currently in operation (J.Bohunice V-1 and V-2) or under construction (Mochovce) in Slovakia. 8 refs.
Support calculations for management of PRISE leakage accidents
Energy Technology Data Exchange (ETDEWEB)
Matejovic, P; Vranka, L [Nuclear Power Plants Research Inst. Vuje, Trnava (Slovakia)
1998-12-31
Accidents involving primary-to-secondary leakage (PRISE) caused by rupture of one or a few tubes are well known design basis events in both, western and VVER NPPs. Operating experience and in-service inspections of VVER-440 units have demonstrated also the potential for large PRISE leaks in the case of the steam generator (SG) primary collector cover lift-up (Rovno NPP). Without performing any countermeasure for limitation of SG collector cover lift-up, a full opening results in PRISE leak with an equivalent diameter 107 mm. Although this accident was not considered in the original design, this event is usually analysed as DBA too. Different means are available for detection and mitigation of PRISE leakage in NPPs currently in operation (J.Bohunice V-1 and V-2) or under construction (Mochovce) in Slovakia. 8 refs.
Directory of Open Access Journals (Sweden)
Yueting Dai
2017-11-01
Full Text Available Identification of monokaryons and their mating types and discrimination of hybrid offspring are key steps for the crossbreeding of Pleurotus tuoliensis (Bailinggu. However, conventional crossbreeding methods are troublesome and time consuming. Using RNA-seq technology, we developed new expressed sequence tag-simple sequence repeat (EST-SSR markers for Bailinggu to easily and rapidly identify monokaryons and their mating types, genetic diversity and hybrid offspring. We identified 1110 potential EST-based SSR loci from a newly-sequenced Bailinggu transcriptome and then randomly selected 100 EST-SSRs for further validation. Results showed that 39, 43 and 34 novel EST-SSR markers successfully identified monokaryons from their parent dikaryons, differentiated two different mating types and discriminated F1 and F2 hybrid offspring, respectively. Furthermore, a total of 86 alleles were detected in 37 monokaryons using 18 highly informative EST-SSRs. The observed number of alleles per locus ranged from three to seven. Cluster analysis revealed that these monokaryons have a relatively high level of genetic diversity. Transfer rates of the EST-SSRs in the monokaryons of closely-related species Pleurotus eryngii var. ferulae and Pleurotus ostreatus were 72% and 64%, respectively. Therefore, our study provides new SSR markers and an efficient method to enhance the crossbreeding of Bailinggu and closely-related species.
Dai, Yueting; Su, Wenying; Song, Bing; Li, Yu; Fu, Yongping
2017-01-01
Identification of monokaryons and their mating types and discrimination of hybrid offspring are key steps for the crossbreeding of Pleurotus tuoliensis (Bailinggu). However, conventional crossbreeding methods are troublesome and time consuming. Using RNA-seq technology, we developed new expressed sequence tag-simple sequence repeat (EST-SSR) markers for Bailinggu to easily and rapidly identify monokaryons and their mating types, genetic diversity and hybrid offspring. We identified 1110 potential EST-based SSR loci from a newly-sequenced Bailinggu transcriptome and then randomly selected 100 EST-SSRs for further validation. Results showed that 39, 43 and 34 novel EST-SSR markers successfully identified monokaryons from their parent dikaryons, differentiated two different mating types and discriminated F1 and F2 hybrid offspring, respectively. Furthermore, a total of 86 alleles were detected in 37 monokaryons using 18 highly informative EST-SSRs. The observed number of alleles per locus ranged from three to seven. Cluster analysis revealed that these monokaryons have a relatively high level of genetic diversity. Transfer rates of the EST-SSRs in the monokaryons of closely-related species Pleurotus eryngii var. ferulae and Pleurotus ostreatus were 72% and 64%, respectively. Therefore, our study provides new SSR markers and an efficient method to enhance the crossbreeding of Bailinggu and closely-related species. PMID:29149037
Esplenectomía incidental: ¿Está justificada?
Directory of Open Access Journals (Sweden)
Eddy Sierra Enrique
1997-12-01
Full Text Available Se revisaron 77 historias clínicas de pacientes que presentaban lesiones incidentales del bazo ocurridas entre 1985 y 1994, durante operaciones intraabdominales y por examen laparoscópico. Las funciones inmunológicas del bazo y su papel contra las infecciones están bien definidas, por lo cual al ser suprimido este órgano a consecuencia de lesiones incidentales, favorecen las infecciones en dichos pacientes de por vida. De las 77 lesiones incidentales se realizaron 47(61 % esplenectomías incidentales y 30(39 % cirugías conservadoras. La úlcera duodenal y la hernia hiatal son las causas principales de esplenectomía incidental. Se presentaron 11 infecciones (23,4 % y 1 fallecido (2,1 % en la esplenectomía incidental contra 1 infección (3,3 % y ningún fallecido en la cirugía conservadora. Se llega a la conclusión de que la esplenectomía no está justificada dadas las desventajas que presenta77 medical histories of patients who presented incidental injuries of the spleen occurred between 1985 and 1994, during intraabdominal operations and by laparoscopic examination, were reviewed. The immunological functions of the spleen and its role against infections are well defined, so the removal of this organ due to incidental injuries favors the appearance of infections in these patients for the rest of their lives. Of the 77 incidental injuries 47 (61 % incidental splenectomies and 30 (39 % conservative surgeries were performed. Duodenal ulcer and hiatal hernia proved to be the main causes of incidental splenectomy. There were 11 infections (23.4 % and 1 death (2.1 % in the incidental splenectomy compared with 1 infection (3.3 % and no death in the conservative surgery. It is concluded that splenectomy is not justified because of its disadvantages
Directory of Open Access Journals (Sweden)
Mario Madroñero Morillo
2014-06-01
Full Text Available La reflexión sobre la posibilidad de unas estéticas regionales contemporáneas pretende poner en escena —y en abismo— problemáticas referidas a la concepción del arte, la teoría estética, la enseñanza del arte y las acciones artísticas en un contexto regional. Ella trae, además, la posibilidad de un manifiesto por el "derecho de artes" que implica la comprensión del arte como acontecer político en diferencia. Este derecho conllevaría una concepción de creación anterior a la ley en cuanto técnica (por lo tanto an-árquica que permitiría la comprensión de la estética de la existencia y de la libertad del arte.ABSTRACTThe reflection on the possibility of contemporary regional aesthetics aims to put on stage problems related to the concepts of art, aesthetic theory, art education and artistic activities in a regional context. It also brings about the possibility of a manifesto for the "Right of Arts" which involves the understanding of art as a political event "in difference". This right would entail a conception of creation anteceding law as technique (hence an-archic that would in turn allow an understanding of the aesthetics of existence and the freedom of art.RÉSUMÉLa réflexion sur la possibilité d’esthétiques régionales contemporaines vise à mettre en scène -et en abime- les problématiques liées à la conception de l’art, la théorie esthétique, l’enseignement de l’art et les actions artistiques dans un contexte régional. Elle apporte, également, la possibilité d’un manifeste pour le «droit des arts» qui implique la compréhension de l’art comme événement politique différencié. Ce droit entraînerait une conception de création antérieure à la loi en tant que technique (d’où an-archique qui permettrait la compréhension de l’esthétique de l’existence et de la liberté de l’art.RESUMOA reflexão sobre a possibilidade de umas estéticas regionais contemporâneas pretende pôr em
Mane, A. A.; Suryawanshi, M. P.; Kim, J. H.; Moholkar, A. V.
2017-05-01
The V2O5 nanorods have been successfully spray deposited at optimized substrate temperature of 400 °C onto the glass substrates using vanadium trichloride (VCl3) solution of different concentrations. The effect of solution concentration on the physicochemical and NO2 gas sensing properties of sprayed V2O5 nanorods is studied at different operating temperatures and gas concentrations. The XRD study reveals the formation of V2O5 having an orthorhombic symmetry. The FE-SEM micrographs show the nanorods-like morphology of V2O5. The AFM micrographs exhibit a well covered granular surface topography. For direct allowed transition, the band gap energy values are found to be decreased from 2.45 eV to 2.42 eV. The nanorods deposited with 30 mM solution concentration shows the maximum response of 24.2% for 100 ppm NO2 gas concentration at an operating temperature of 200 °C with response and recovery times of 13 s and 140 s, respectively. Finally, the chemisorption mechanism of NO2 gas on the V2O5 nanorods is discussed.
Directory of Open Access Journals (Sweden)
Marcílio Hubner de Miranda Neto
2004-04-01
Full Text Available O objetivo do trabalho foi comparar o perfil dos corpos celulares dos neurônios mioentéricos NADH-diaforase positivos do estômago de ratos. Utilizou-se 10 animais (Rattus norvegicus, provenientes dos grupos: a controle (n=5, que durante 210 dias receberam, ad libitum, dieta com teor protéico normal (22% e água; e b experimental (n = 5, que durante 210 dias receberam, ad libitum, ração com teor protéico normal (22% e aguardente-de-cana diluída a 30 Gay Lussac (30º v/v. Os estômagos coletados foram submetidos à técnica de evidenciação neuronal. A mensuração do perfil dos corpos celulares dos neurônios (n = 1.000 foi através de um Sistema Computadorizado de Análise de Imagem. O perfil dos corpos celulares dos neurônios do grupo controle ficou entre 60,16 a 638,64 µm2. No grupo experimental variou de 40,84 a 599,15 µm2. Constatamos redução significante no tamanho do corpo celular, aumento de neurônios pequenos e diminuição de neurônios grandesThe purpose of this work was to compare the profile of the cell body of the NADH-diaphorase positive myenteric neurons from the stomach of rats. It was used 10 animals (Rattus norvegicus, from groups a control (n = 5, that during 210 days had ad libitum supply of chow with normal protein level (22% and water; and b experimental (n = 5, that during 210 days had ad libitum supply of chow with normal protein level (22% and sugar cane brandy diluted to 30 Gay Lussac (30o v/v. The stomachs collected and subjected to the technique for neuronal staining. The cell body of the neurons (n = 1.000 was measured through a computerized system of image analysis. The profile of the neurons from the control rats ranged from 60.16 and 638.64 µm2. In the experimental group the values ranged from 40.84 to 599.15 µm2. We observed a significant decrease on the cell body size, increase of the small neurons and decrease of the large neurons
Energy Technology Data Exchange (ETDEWEB)
Xu Yuntao; Xiong Bo; Chang, Yih Chung; Ng, C. Y. [Department of Chemistry, University of California, Davis, California 95616 (United States)
2012-12-28
By employing the newly established vacuum ultraviolet laser pulsed field ionization-photoion (PFI-PI) double quadrupole-double octopole ion guide apparatus, we have measured the rovibrationally selected absolute total cross sections of the ion-molecule reaction H{sub 2}O{sup +}(X{sup 2}B{sub 1}; v{sub 1}{sup +}v{sub 2}{sup +}v{sub 3}{sup +}= 000; N{sup +}{sub Ka+Kc+)}+ D{sub 2}{yields} H{sub 2}DO{sup +}+ D in the center-of-mass collision energy (E{sub cm}) range of 0.05-10.00 eV. The pulsing scheme used for the generation of PFI-PIs has made possible the preparation of reactant H{sub 2}O{sup +}(X{sup 2}B{sub 1}; v{sub 1}{sup +}v{sub 2}{sup +}v{sub 3}{sup +}= 000) ions in single N{sup +}{sub Ka+Kc+} rotational levels with high kinetic energy resolutions. The absolute total cross sections observed in different N{sup +}{sub Ka+Kc+} levels with rotational energies in the range of 0-200 cm{sup -1} were found to exhibit a significant rotational enhancement on the reactivity for the titled reaction. In contrast, the measured cross sections reveal a decreasing trend with increasing E{sub cm}, indicating that the rotational enhancement observed is not a total energy effect, but a dynamical effect. Furthermore, the rotational enhancement is found to be more pronounced as E{sub cm} is decreased. This experiment provided evidence that the coupling of the core rotational angular momentum with the orbital angular momentum could play a role in chemical reactivity, particularly at low E{sub cm}.
The total angular moment selectivity in 7Li(α, α) 7Li(4.63 MeV, 7/2-) reaction at Eα = 27.2 MeV
International Nuclear Information System (INIS)
Dmitrenko, V.N.; Kozyr', Yu.E.
1995-01-01
The DWBA calculation of tensor polarisation of residual nuclei for direct inelastic scattering 7 Li(α, α) 7 Li(4.63 MeV, 7/2 - ) gives the lest approximation to experimental data at selected total angular moment and parity values J π 13/2 + . The microscopic coupled channel calculation also predicts a significant role of total angular moment states with J ≥ 13/2. at E α 27.2 MeV
The dimeric [V2O2F8]4− anion: Structural characterization of a magnetic basic-building-unit
International Nuclear Information System (INIS)
Lu, Hongcheng; Gautier, Romain; Li, Zuo-Xi; Jie, Wanqi; Liu, Zhengtang; Poeppelmeier, Kenneth R.
2013-01-01
New materials built from the [V 2 O 2 F 8 ] 4− anionic basic-building-unit (BBU) exhibit interesting magnetic properties owing to the proximity of the two d 1 V(IV) cations and the orbital interactions of fluoride and oxide ligands. In our search to target such materials, the vanadium oxide–fluoride compound [dpaH 2 ] 2 [V 2 O 2 F 8 ] in which a dimeric anion [V 2 O 2 F 8 ] 4− is isolated in a hydrogen bond network was hydrothermally synthesized (dpa=2,2′-dipyridylamine). This hydrogen bond network is able to stabilize the highly ionic species [V 2 O 2 F 8 ] 4− as demonstrated with bond valence calculations. The coordination of the O 2− /F − ordered ligands was investigated and antiferromagnetic coupling of the isolated BBU was measured. - The new hybrid compound [dpaH 2 ] 2 [V 2 O 2 F 8 ] built from the interesting [V 2 O 2 F 8 ] 4− magnetic basic-building-unit (BBU) was synthesized by the hydrothermal method. The coordination of the O 2− /F − ordered ligands was investigated by BVS calculations and antiferromagnetic coupling was measured. Highlights: ► A new vanadium oxyfluoride was synthesized by hydrothermal method. ► The Dimeric [V 2 O 2 F 8 ] 4− basic building unit is isolated in the hydrogen bond networks. ► The coordination of [V 2 O 2 F 8 ] 4− units to the extended structure is investigated. ► Isolated [V 2 O 2 F 8 ] 4− units exhibit antiferromagnetic coupling
Desalación y emisiones de CO2: vínculos y soluciones
Directory of Open Access Journals (Sweden)
Montaño Sanz, Borja
2008-11-01
Full Text Available En este artículo se analizan las distintas formas existentes de desalinizar sin emitir CO2 a la atmósfera, y las oportunidades empresariales que han surgido fruto de la preocupación en torno a los efectos medioambientales de la desalación. Las emisiones no derivan del propio proceso de la desalinización, si no que se deben a las fuentes energéticas que son empleadas para llevar a cabo el proceso. En este sentido, si cambiamos el modo de abastecer energéticamente a las desaladoras, podremos evitar las emisiones de CO2. Sin embargo, tal y como se analiza en este artículo, el evitar estas emisiones nos hace incurrir en otros costes. Si bien recurrimos a la energía nuclear, sabemos que existe un riesgo de sufrir un escape, un coste social y que hay que gestionar unos residuos nucleares. Por otro lado, si recurrimos a las energías renovables, hemos de incurrir en un importante coste de inversión. Actualmente en España, la electricidad proviene en distintas proporciones de combustibles fósiles, energía nuclear, y energías renovables.
Lifescience Database Archive (English)
Full Text Available HUMAN cDNA FLJ35079 fis, clone PLACE6005283, hi... 33 7.1 tr|Q7ZZ40|Q7ZZ40_DANRE Novel protein similar to human autism...6 +P+V VS Sbjct: 191 VPKSPSVDKYNVS 203 >tr|Q7ZZ40|Q7ZZ40_DANRE Novel protein similar to human autism-related