WorldWideScience

Sample records for bohrium 274

  1. Bohrium-A New Element in the Periodic Table

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 5; Issue 5. Bohrium - A New Element in the Periodic Table. Srinivasan Natarajan. Research News Volume 5 Issue 5 May 2000 pp 95-100. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/reso/005/05/0095-0100 ...

  2. Properties of an α Particle in a Bohrium 270 Nucleus under the Generalized Symmetric Woods-Saxon Potential

    Directory of Open Access Journals (Sweden)

    Bekir Can LÜTFÜOĞLU

    2017-04-01

    Full Text Available The energy eigenvalues and the wave functions of an α particle in a Bohrium 270 nucleus have been calculated by solving Schrödinger equation for Generalized Symmetric Woods-Saxon potential. Using the energy spectrum by excluding and including the quasi-bound eigenvalues, entropy, internal energy, Helmholtz energy, and specific heat, as functions of reduced temperature have been calculated. Stability and emission characteristics have been interpreted in terms of the wave and thermodynamic functions. The kinetic energy of a decayed α particle was calculated using the quasi-bound states, which has been found close to the experimental value.

  3. 33 CFR 274.3 - References.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false References. 274.3 Section 274.3 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE PEST CONTROL PROGRAM FOR CIVIL WORKS PROJECTS Project Operation § 274.3 References. (a) Pub. L. 92-516, Federal...

  4. 7 CFR 274.7 - Coupon management.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Coupon management. 274.7 Section 274.7 Agriculture... FOOD STAMP AND FOOD DISTRIBUTION PROGRAM ISSUANCE AND USE OF COUPONS § 274.7 Coupon management. (a) Coupon inventory management. State agencies shall establish coupon inventory management systems which...

  5. 33 CFR 274.4 - Pesticide management.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Pesticide management. 274.4... DEFENSE PEST CONTROL PROGRAM FOR CIVIL WORKS PROJECTS Project Operation § 274.4 Pesticide management. (a... control management personnel prior to advertisement of the contract and procurement of services. The...

  6. 50 CFR 216.274 - Mitigation.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Mitigation. 216.274 Section 216.274 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION... Deck, since any object or disturbance (e.g., trash, periscope, surface disturbance, discoloration) in...

  7. 8 CFR 274a.4 - Good faith defense.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Good faith defense. 274a.4 Section 274a.4... ALIENS Employer Requirements § 274a.4 Good faith defense. An employer or a recruiter or referrer for a... § 274a.2(b) of this part shall have established a rebuttable affirmative defense that the person or...

  8. 8 CFR 274a.9 - Enforcement procedures.

    Science.gov (United States)

    2010-01-01

    ... complaints. Any person or entity having knowledge of a violation or potential violation of section 274A of... the right to representation by counsel of his or her own choice at no expense to the government; (B... foreign language must be accompanied by an English language translation. A request for a hearing is not...

  9. 27 CFR 25.274 - Bond.

    Science.gov (United States)

    2010-04-01

    ... TREASURY LIQUORS BEER Pilot Brewing Plants § 25.274 Bond. (a) Requirement. Any person requesting authorization to establish a pilot brewing plant under this subpart shall execute and file a brewer's bond, Form... beer brewed, produced, or received on the premises. (Sec. 4, Pub. L. 91-673, 84 Stat. 2057, as amended...

  10. 8 CFR 274a.3 - Continuing employment of unauthorized aliens.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Continuing employment of unauthorized aliens. 274a.3 Section 274a.3 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS CONTROL OF EMPLOYMENT OF ALIENS Employer Requirements § 274a.3 Continuing employment of...

  11. 17 CFR 274.0-1 - Availability of forms.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Availability of forms. 274.0-1 Section 274.0-1 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) FORMS PRESCRIBED UNDER THE INVESTMENT COMPANY ACT OF 1940 § 274.0-1 Availability of forms. (a) This part identifies...

  12. 8 CFR 274.2 - Delegation of authority.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Delegation of authority. 274.2 Section 274.2 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS SEIZURE AND FORFEITURE OF CONVEYANCES § 274.2 Delegation of authority. All powers provided to Fines, Penalties and Forfeitures Officers in 19 CFR parts 162 and 171 are...

  13. 12 CFR 27.4 - Inquiry/Application Log.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Inquiry/Application Log. 27.4 Section 27.4... SYSTEM § 27.4 Inquiry/Application Log. (a) The Comptroller, among other things, may require a bank to maintain a Fair Housing Inquiry/Application Log (“Log”), based upon, but not limited to, one or more of the...

  14. 7 CFR 274.6 - Replacement issuances to households.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Replacement issuances to households. 274.6 Section 274... Replacement issuances to households. (a) Providing replacement issuance. (1) Subject to the restrictions in paragraph (b) of this section, State agencies shall provide replacement issuances to a household when the...

  15. Command and Control Career Ladder, AFSC 274X0.

    Science.gov (United States)

    1987-04-01

    I COMMAND AND CONTROL CAREER LADDER AFSC 274X0 AFPT 90-274-774 APRIL 1987 OCCUPATIONAL ANALYSIS PROGRAM USAF OCCUPATIONAL MEASUREMENT CENTER AIR...3 HQ TAC/TTGT 1 1 HQ USAF/XODRF 1 1 HQ USAF/ MPPT 1 1 HQ USAFE/DPAT 3 3 HQ USAFE/TTGT 1 1 HO USMC (CODE TPI) 1 NODAC 1 3300 TCHTW/TTGX (KEESLER AFB MS...Command and Control career ladder (AFSC 274X0). This survey was requested by the Training Development Services Division of the USAF Occupa- tional

  16. 7 CFR 274.1 - State agency issuance responsibility.

    Science.gov (United States)

    2010-01-01

    ..., DEPARTMENT OF AGRICULTURE FOOD STAMP AND FOOD DISTRIBUTION PROGRAM ISSUANCE AND USE OF COUPONS § 274.1 State..., the Postal Service, community action and migrant service agencies, and other commercial businesses...

  17. Test report - 241-AN-274 Caustic Pump Control Building

    International Nuclear Information System (INIS)

    Paintner, G.P.

    1995-05-01

    This Acceptance Test Report documents the test results of test procedure WHC-SD-WM-ATP-135 'Acceptance Test Procedure for the 241-AN- 274 Caustic Pump Control Building.' The objective of the test was to verify that the 241-AN-274 Caustic Pump Control Building functions properly based on design specifications per applicable H-2-85573 drawings and associated ECN's. The objective of the test was met

  18. 33 CFR 274.7 - Authorization of pesticide use.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Authorization of pesticide use... of pesticide use. (a) Programs approved in § 274.6(b) must be those as described on the pesticide label. Pesticide uses which are different from the registered use, require amendment of the label...

  19. 8 CFR 274a.12 - Classes of aliens authorized to accept employment.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Classes of aliens authorized to accept employment. 274a.12 Section 274a.12 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS CONTROL OF EMPLOYMENT OF ALIENS Employment Authorization § 274a.12 Classes of aliens authorized to...

  20. 48 CFR 236.274 - Restriction on acquisition of steel for use in military construction projects.

    Science.gov (United States)

    2010-10-01

    ... of steel for use in military construction projects. 236.274 Section 236.274 Federal Acquisition....274 Restriction on acquisition of steel for use in military construction projects. In accordance with..., Division E), do not acquire, or allow a contractor to acquire, steel for any construction project or...

  1. 28 CFR 68.56 - Judicial review of a final agency order in cases arising under section 274A or 274C.

    Science.gov (United States)

    2010-07-01

    ... ADMINISTRATIVE LAW JUDGES IN CASES INVOLVING ALLEGATIONS OF UNLAWFUL EMPLOYMENT OF ALIENS, UNFAIR IMMIGRATION-RELATED EMPLOYMENT PRACTICES, AND DOCUMENT FRAUD § 68.56 Judicial review of a final agency order in cases... in cases arising under section 274A or 274C. 68.56 Section 68.56 Judicial Administration DEPARTMENT...

  2. 33 CFR Appendix A to Part 274 - Preventive Safety Measures in Handling of Pesticides

    Science.gov (United States)

    2010-07-01

    ... Handling of Pesticides A Appendix A to Part 274 Navigation and Navigable Waters CORPS OF ENGINEERS... Appendix A to Part 274—Preventive Safety Measures in Handling of Pesticides 1. Follow the label on each... permitted while pesticides are being handled. 4. All pesticides must be handled in well-vetilated areas to...

  3. 38 CFR 3.274 - Relationship of net worth to pension entitlement.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Relationship of net worth to pension entitlement. 3.274 Section 3.274 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS ADJUDICATION Pension, Compensation, and Dependency and Indemnity Compensation Regulations...

  4. 17 CFR 274.129 - Form N-PX, annual report of proxy voting record of registered management investment company.

    Science.gov (United States)

    2010-04-01

    ... proxy voting record of registered management investment company. 274.129 Section 274.129 Commodity and... COMPANY ACT OF 1940 Forms for Reports § 274.129 Form N-PX, annual report of proxy voting record of... company's proxy voting record for the most recent twelve-month period ended June 30, pursuant to section...

  5. Bohrium-A New Element in the Periodic Table

    Indian Academy of Sciences (India)

    The periodic table of elements, the basic and most important component of research in chemistry and physics is growing continu- ously. It is interesting to note that until the. 16th century, only a handful of elements have been known to mankind (10, to be pre- cise) and during the 18th century, 10 more elements have been ...

  6. 27 CFR 24.274 - Failure to timely pay tax or file a return.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Failure to timely pay tax... Taxpaid Removals § 24.274 Failure to timely pay tax or file a return. Penalties for failure to pay tax at the time required, for willful refusal to pay the tax and for fraudulent nonpayment of tax are...

  7. 47 CFR 25.274 - Procedures to be followed in the event of harmful interference.

    Science.gov (United States)

    2010-10-01

    ... Commission's Columbia Operations Center in Columbia, Maryland, to assist in resolving the matter. This office...) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Technical Operations § 25.274 Procedures to be followed...'s network that could be causing the harmful interference to ensure that none of the licensee's earth...

  8. 26 CFR 1.274-2 - Disallowance of deductions for certain expenses for entertainment, amusement, recreation, or travel.

    Science.gov (United States)

    2010-04-01

    ... room maintained by an employer for lodging of his employees while in business travel status, or (c) an... for entertainment, amusement, recreation, or travel. 1.274-2 Section 1.274-2 Internal Revenue INTERNAL..., or travel. (a) General rules—(1) Entertainment activity. Except as provided in this section, no...

  9. 26 CFR 1.274-7 - Treatment of certain expenditures with respect to entertainment-type facilities.

    Science.gov (United States)

    2010-04-01

    ..., DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Items Not Deductible § 1.274-7... (for example, a residence) which is regarded as used partly for business and partly for personal...

  10. Clasificación del traumatismo del bazo: Estudio de 274 pacientes

    Directory of Open Access Journals (Sweden)

    Eddy Sierra Enrique

    1997-08-01

    Full Text Available Se revisaron 274 historias clínicas que presentaron traumatismo del bazo, en el Hospital Militar "Comandante Manuel Fajardo Rivero" y Hospital Provincial Clinicoquirúrgico Docente, ambos de Santa Clara, durante los años 1988-1994. Se describe la clasificación del trauma esplénico grado 1, con 97 pacientes; grado 2, 53 pacientes; grado 3, 71 pacientes, los grados 2A,33 pacientes y grado 3B, 20 pacientes. Las complicaciones en los esplenectomizados fueron 40, para una morbilidad del 22,3 % y hubo 2 complicaciones en los pacientes a quienes se les realizó cirugía conservadora, para el 2,1 %. No hubo mortalidad en la cirugía conservadora, pero es de señalar que ocurrieron en los traumas de menor cuantía, los grados 1 y 2. Hubo 5 pacientes fallecidos en los esplenectomizados para el 2,7 % de mortalidad, y fue la mortalidad asociada de 9,8 %A number of 274 medical histories presenting with spleen injuries were revised at "Comandante Manuel Fajardo Rivero" Military Hospital, and at the Teaching and Provincial Clinico surgical Hospital of Santa Clara during 1988-1994. The classification of splenic trauma grade 1 with 97 patients; grade 2 with 53 patients; grade 3 with 71 patients, grade 2 A with 33 patients, and grade 3 B with 20 patients, is described. Complications in splectomized patients were found to be 40 accounting for a morbidity of 22.3 %. There were 2 complications in patients who underwent a conservative surgical procedure, accounting for 2.1 %. There was no mortality rate regarding conservative surgery, but injuries less severe grades 1 and 2 occurred. Five patients died in the group of splectomized patients accounting for 2.7 % of mortality; the associated mortality was 9.8 %

  11. 48 CFR 211.274-4 - Policy for reporting of Government-furnished equipment in the DoD Item Unique Identification...

    Science.gov (United States)

    2010-10-01

    ... DEFENSE ACQUISITION PLANNING DESCRIBING AGENCY NEEDS Using and Maintaining Requirements Documents 211.274... contract state otherwise; (b) Government-furnished material; (c) Reparables; (d) Contractor-acquired...

  12. 76 FR 9320 - Foreign-Trade Zone 274-Butte-Silver Bow, MT; Application for Manufacturing Authority REC Silicon...

    Science.gov (United States)

    2011-02-17

    ...-Silver Bow, MT; Application for Manufacturing Authority REC Silicon (Polysilicon and Silane Gas) Butte... County of Butte-Silver Bow, grantee of FTZ 274, requesting manufacturing authority on behalf of REC... and silane gas for the photovoltaic industry using domestic and imported silicon metal (duty rate 5.3...

  13. 20 CFR 667.274 - What health and safety standards apply to the working conditions of participants in activities...

    Science.gov (United States)

    2010-04-01

    ... WIA? (a) Health and safety standards established under Federal and State law otherwise applicable to... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false What health and safety standards apply to the... I OF THE WORKFORCE INVESTMENT ACT Administrative Rules, Costs and Limitations § 667.274 What health...

  14. Survey of 274 patients with conjunctival neoplastic lesions in Farabi Eye Hospital, Tehran 2006-2012.

    Science.gov (United States)

    Asadi-Amoli, Fahimeh; Ghanadan, Alireza

    2015-01-01

    To evaluate conjunctival epithelial neoplastic lesions in a 7-year period. The data of all primary cases of conjunctival neoplasia diagnosed in the Pathology Department of Farabi Eye Hospital were analyzed. The patient group consisted of 179 (65.3%) males and 95 (34.6%) females, with an age range of 14-90 years and a mean age of 57.9 years. The most common primary conjunctival epithelial neoplastic lesion was invasive squamous cell carcinoma (SCC) (40.8%), followed by dysplasia (17%), papilloma (16.4%), In situ SCC (16%), actinic keratosis (7.3%), basal cell carcinoma (0.7%), xeroderma pigmentosum (0.7%), and mucoepidermoid carcinoma (0.3%). Of 274 lesions, 47 (17.1%) were benign, 159 (58%) were malignant, and 68 (24.8%) were precancerous. Compared to the results of a previous study of this center (1990-2004), the incidence of precancerous lesions has slightly increased whereas the incidence of SCC has decreased (22.1% vs. 24.8% and 59% vs. 40.8%, respectively). SCC is the most common conjunctival epithelial neoplasm in this study, and its prevalence in males is nearly two times higher than in females. The high percentage of squamous cell carcinoma can likely be attributed to elevated sun exposure and ultraviolet light in Iran.

  15. Clinical features and evolution of oral cancer: A study of 274 cases in Buenos Aires, Argentina.

    Science.gov (United States)

    Brandizzi, Daniel; Gandolfo, Mariana; Velazco, María Lucia; Cabrini, Rómulo Luis; Lanfranchi, Hector Eduardo

    2008-09-01

    Oral Squamous Cell Carcinoma has a low survival rate, 34 to 66% five-year survival after initial diagnosis, due to late diagnosis. The aim of the present study was to examine the clinical features and evolution of oral cancer in the University of Buenos Aires. 274 patients with primary oral carcinoma, over the 1992-2000 period were included in the study. The survival rate of this population was 80% at 12 months, 60% at 24 months, 46% at 36 months, 40% at 48 months, and 39% at 60 months (5 years). The tumor localizations with worse prognosis were floor of mouth and tongue, with survival rates of 19% and 27% respectively. Sixty-five percent of the oral carcinomas evaluated were diagnosed at advanced stages (III and IV). The patients under study exhibited the lowest survival rate described for oral cancer (34% five-year survival after initial diagnosis). The population included in this study can be considered representative of the Argentine population. This bad prognosis would be mainly due to the large number of oral cancer cases that were diagnosed at advanced stages.

  16. Genome Sequencing and Comparative Analysis of the Biocontrol Agent Trichoderma harzianum sensu stricto TR274

    Energy Technology Data Exchange (ETDEWEB)

    Steindorff, Andrei S.; Noronha, Elilane F.; Ulhoa, Cirano J.; Kuo, Alan; Salamov, Asaf A.; Haridas, Sajeet; Riley, Robert W.; Druzhinina, Irina S.; Kubicek, Christian P.; Grigoriev, Igor V.

    2015-03-17

    Biological control is a complex process which requires many mechanisms and a high diversity of biochemical pathways. The species of Trichoderma harzianum are well known for their biocontrol activity against many plant pathogens. To gain new insights into the biocontrol mechanism used by T. harzianum, we sequenced the isolate TR274 genome using Illumina. The assembly was performed using AllPaths-LG with a maximum coverage of 100x. The assembly resulted in 2282 contigs with a N50 of 37033bp. The genome size generated was 40.8 Mb and the GC content was 47.7%, similar to other Trichoderma genomes. Using the JGI Annotation Pipeline we predicted 13,932 genes with a high transcriptome support. CEGMA tests suggested 100% genome completeness and 97.9% of RNA-SEQ reads were mapped to the genome. The phylogenetic comparison using orthologous proteins with all Trichoderma genomes sequenced at JGI, corroborates the Trichoderma (T. asperellum and T. atroviride), Longibrachiatum (T. reesei and T. longibrachiatum) and Pachibasium (T. harzianum and T. virens) section division described previously. The comparison between two Trichoderma harzianum species suggests a high genome similarity but some strain-specific expansions. Analyses of the secondary metabolites, CAZymes, transporters, proteases, transcription factors were performed. The Pachybasium section expanded virtually all categories analyzed compared with the other sections, specially Longibrachiatum section, that shows a clear contraction. These results suggests that these proteins families have an important role in their respective phenotypes. Future analysis will improve the understanding of this complex genus and give some insights about its lifestyle and the interactions with the environment.

  17. Multi-scalar influences on mortality change over time in 274 European cities.

    Science.gov (United States)

    Richardson, Elizabeth A; Moon, Graham; Pearce, Jamie; Shortt, Niamh K; Mitchell, Richard

    2017-04-01

    Understanding determinants of urban health is of growing importance. Factors at multiple scales intertwine to influence health in cities but, with the growing autonomy of some cities from their countries, city population health may be becoming more a matter for city-level rather than national-level policy and action. We assess the importance of city, country, and macroregional (Western and East-Central Europe) scales to mortality change over time for 274 cities (population 80 million) from 27 European countries. We then investigate whether mortality changes over time are related to changes in city-level affluence. Using Urban Audit data, all-age all-cause standardised mortality ratios (SMRs) for males and females were calculated at three time points (wave one 1999-2002, wave two 2003-2006, and wave three 2007-2009) for each city. Multilevel regression was used to model the SMRs as a function of survey wave and city region gross domestic product (GDP) per 1000 capita. SMRs declined over time and the substantial East-West gap narrowed slightly. Variation at macroregion and country scales characterised SMRs for women in Western and East-Central European cities, and SMRs for men in East-Central European cities. Between-city variation was evident for male SMRs in Western Europe. Changes in city-region GDP per capita were not associated with changes in mortality over the study period. Our results show how geographical scales differentially impact urban mortality. We conclude that changes in urban health should be seen in both city and wider national and macroregional contexts. Copyright © 2017 Elsevier Ltd. All rights reserved.

  18. Prognostic implication of CD274 (PD-L1) protein expression in tumor-infiltrating immune cells for microsatellite unstable and stable colorectal cancer.

    Science.gov (United States)

    Lee, Kyu Sang; Kwak, Yoonjin; Ahn, Soyeon; Shin, Eun; Oh, Heung-Kwon; Kim, Duck-Woo; Kang, Sung-Bum; Choe, Gheeyoung; Kim, Woo Ho; Lee, Hye Seung

    2017-07-01

    In this study, we investigated the clinical relevance of CD274 (PD-L1) protein expression by tumor cells and tumor-infiltrating immune cells in colorectal cancer (CRC). To this end, 186 microsatellite instability-high (MSI-H) and 153 microsatellite stable (MSS) CRCs were subjected to immunohistochemistry (IHC) analysis for the expression of CD274 and mismatch repair proteins. CD274 expression was evaluated in tumor cells at the center (TC) and periphery (TP), and immune cells at the center (IC) and periphery (IP) of CRC. IHC slides stained for CD3 and CD8 were scanned using an Aperio ScanScope for precise calculation of tumor-infiltrating T cell density. Additionally, samples were screened for the B-Raf (BRAF)-V600E mutation using a Cobas 4800 System and IHC. In total, CD274 TC , CD274 TP , CD274 IC , and CD274 IP were observed in 43 (23.1%), 47 (25.3%), 107 (57.5%), and 102 (54.8%) of the MSI-H CRCs examined, and in three (2.0%), four (2.6%), 47 (30.7%), and 56 (36.6%) of the 153 MSS CRCs tested. Meanwhile, intratumoral heterogeneity of CD274 expression in tumor cells and immune cells was detected in 24 (12.9%) and 47 (25.3%) MSI-H CRCs, respectively. Notably, in both MSI-H and MSS CRC, CD274 IC and CD274 IP were independently associated with improved prognosis (P < 0.05), while BRAF mutation was associated with CD274 TP , poor differentiation, sporadic type, and hMLH1(-)/hMSH2(+)/hMSH6(+)/PMS2(-) in MSI-H CRC (P < 0.006). In conclusion, CD274 expression in tumor-infiltrating immune cells was an independent factor for improved prognosis in CRC patients. A deeper understanding of CD274 status may yield improved responses to future CRC immunotherapies.

  19. A measurement of $e^{+}e^{-} \\to$ hadrons at $\\sqrt{s}$=27.4 GeV

    CERN Document Server

    Branson, J.G.; Becker, U.; Benda, H.; Bohm, A.; Bron, J.; Buikman, D.; Burger, J.; Chang, C.C.; Chen, M.; Cheng, D.P.; Chu, Y.S.; Duinker, P.; Fesefeldt, H.; Fong, D.; Fukushima, M.; Ho, M.C.; Hsu, H.K.; Kadel, R.; Luckey, David; Ma, C.M.; Massaro, G.; Matsuda, T.; Newman, H.; Revol, J.P.; Rohde, M.; Rykaczewski, H.; Hsu, T.T.; Tang, H.W.; Ting, S.C.C.; Tung, K.L.; Vannucci, F.; White, M.; Wu, T.W.; Yang, P.C.

    1979-01-01

    During the initial running of PETRA at 27.4 GeV, the authors have measured the reaction e/sup +/e/sup -/ to hadrons using the MARK J detector. They find a value of R of 4.1+or-.5 (statistical) +or-.7 (systematic). Events are analyzed in terms of thrust and spherocity. Overall, they find no evidence for a new threshold in hadron production up to the present energy. (2 refs).

  20. Culture conditions of Roseobacter strain 27-4 affect its attachment and biofilm formation as quantified by real-time PCR

    DEFF Research Database (Denmark)

    Bruhn, Jesper Bartholin; Haagensen, Janus Anders Juul; Bagge-Ravn, D.

    2006-01-01

    The fish probiotic bacterium Roseobacter strain 27-4 grows only as rosettes and produces its antibacterial compound under static growth conditions. It forms three-dimensional biofilms when precultured under static conditions. We quantified attachment of Roseobacter strain 27-4 using a direct real......-time PCR method and demonstrated that the bacteria attached more efficiently to surfaces during static growth than under aerated conditions.......The fish probiotic bacterium Roseobacter strain 27-4 grows only as rosettes and produces its antibacterial compound under static growth conditions. It forms three-dimensional biofilms when precultured under static conditions. We quantified attachment of Roseobacter strain 27-4 using a direct real...

  1. Thromboembolic risk in 16 274 atrial fibrillation patients undergoing direct current cardioversion with and without oral anticoagulant therapy

    DEFF Research Database (Denmark)

    Hansen, Morten Lock; Jepsen, Rikke Malene H G; Olesen, Jonas Bjerring

    2015-01-01

    AIMS: To study the risk of thromboembolism in a nationwide cohort of atrial fibrillation patients undergoing direct current (DC) cardioversion with or without oral anticoagulant coverage. METHODS AND RESULTS: A retrospective study of 16 274 patients in Denmark discharged from hospital after a first...... and by multivariable adjusted Cox proportional-hazard models. During the initial 30 days following discharge, the thromboembolic incidence rate was 10.33 per 100 patient-years for the no prior oral anticoagulant therapy group [n = 5084 (31.2%)], as compared with 4.00 per 100 patient-years for the prior oral...

  2. Core drilling of hydco drillholes ONK-PP262 and ONK-PP274 in ONKALO at Olkiluoto 2010

    Energy Technology Data Exchange (ETDEWEB)

    Toropainen, V. [Suomen Malmi Oy, Espoo (Finland)

    2011-10-15

    Suomen Malmi Oy (Smoy) core drilled two drillholes for HYDCO-program in ONKALO at Eurajoki, Olkiluoto in 2010. The drillhole ONK-PP262 was drilled in May 2010 and the drillhole ONK-PP274 in December 2010. The lengths of the drillholes are 25.02 and 23.88 m respectively. The drillholes are 75.7 mm by diameter. The drillholes were drilled in the investigation niche 4 at the access tunnel chainage 3747. The hydraulic DE 130 drilling rig was used. The drilling water was taken from the ONKALO drilling water pipeline and premixed sodium fluorescein was used as a label agent in the drilling water. The drillholes were measured with EMS deviation survey tool. In addition to drilling the drillcores were logged and reported by geologist. Geological logging included the following parameters: lithology, foliation, fracture parameters, fractured zones, core loss, weathering, fracture frequency, RQD and rock quality. The main rock types in the drillholes are veined gneiss and pegmatitic granite. The average fracture frequencies in both drill cores are 1.4 pcs/m. The average RQD values in the drillcores are 97.2 % (ONK-PP262) and 98.6 % (ONK-PP274). (orig.)

  3. Inhibition of miR-274-3p increases BmCPV replication by regulating the expression of BmCPV NS5 gene in Bombyx mori.

    Science.gov (United States)

    Wu, Ping; Jiang, Xiaoxu; Sang, Qi; Annan, Enoch; Cheng, Tao; Guo, Xijie

    2017-08-01

    Bombyx mori cytoplasmic polyhedrosis virus (BmCPV) is one of the major pathogens that pose a big challenge to the sericulture industry. Growing evidences have shown that microRNAs play key roles in the regulations of host-pathogen interactions in insects. MicroRNAs have been found in silkworms, whether and how they affect the silkworm-BmCPV interactions are still unknown. Here we investigate the effect of miR-274-3p on the BmCPV replication in the BmCPV-infected silkworm larvae. In our study, BmCPV Nonstructural protein 5 (NS5) was identified to be the target of miR-274-3p based on bioinformatics analysis and luciferase reporter assay. The abundance of NS5 was significantly increased in the presence of miR-274-3p inhibitor based on the qRT-PCR and Western blotting results. Further, qRT-PCR results revealed that the expression of polyhedrin gene of BmCPV in the larvae after applying miR-274-3p inhibitor was significantly increased comparing with that of larvae with negative control. Our results suggest that inhibition of miR-274-3p could facilitate BmCPV replication by up-regulating BmCPV NS5 gene expression and are insightful for further exploring the interactions between silkworm and BmCPV.

  4. Competitive Fitness of Influenza B Viruses Possessing E119A and H274Y Neuraminidase Inhibitor Resistance-Associated Substitutions in Ferrets.

    Science.gov (United States)

    Pascua, Philippe Noriel Q; Marathe, Bindumadhav M; Burnham, Andrew J; Vogel, Peter; Webby, Richard J; Webster, Robert G; Govorkova, Elena A

    2016-01-01

    Neuraminidase (NA) inhibitors (NAIs) are the only antiviral drugs recommended for influenza treatment and prophylaxis. Although NAI-resistant influenza B viruses that could pose a threat to public health have been reported in the field, their fitness is poorly understood. We evaluated in ferrets the pathogenicity and relative fitness of reverse genetics (rg)-generated influenza B/Yamanashi/166/1998-like viruses containing E119A or H274Y NA substitutions (N2 numbering). Ferrets inoculated with NAI-susceptible rg-wild-type (rg-WT) or NAI-resistant (rg-E119A or rg-H274Y) viruses developed mild infections. Growth of rg-E119A virus in the nasal cavities was delayed, but the high titers at 3 days post-inoculation (dpi) were comparable to those of the rg-WT and rg-H274Y viruses (3.6-4.1 log10TCID50/mL). No virus persisted beyond 5 dpi and replication did not extend to the trachea or lungs. Positive virus antigen-staining of the nasal turbinate epithelium was intermittent with the rg-WT and rg-H274Y viruses; whereas antigen-staining for the rg-E119A virus was more diffuse. Virus populations in ferrets coinoculated with NAI-susceptible and -resistant viruses (1:1 mixture) remained heterogeneous at 5 dpi but were predominantly rg-WT (>70%). Although the E119A substitution was associated with delayed replication in ferrets, the H274Y substitution did not measurably affect viral growth properties. These data suggest that rg-H274Y has undiminished fitness in single virus inoculations, but neither rg-E119A nor rg-H274Y gained a fitness advantage over rg-WT in direct competition experiments without antiviral drug pressure. Taken together, our data suggest the following order of relative fitness in a ferret animal model: rg-WT > rg-H274Y > rg-E119A.

  5. Oncogenic kinase NPM/ALK induces through STAT3 expression of immunosuppressive protein CD274 (PD-L1, B7-H1)

    DEFF Research Database (Denmark)

    Marzec, Michal; Zhang, Qian; Goradia, Ami

    2008-01-01

    its key signal transmitter, transcription factor STAT3. STAT3 binds to the CD274 gene promoter in vitro and in vivo, as shown in the gel electromobility shift and chromatin immunoprecipitation assays, and is required for the PD-L1 gene expression, as demonstrated by siRNA-mediated STAT3 depletion...

  6. 17 CFR 274.302 - Form N-27I-1, notice of right of withdrawal and refund for variable life insurance...

    Science.gov (United States)

    2010-04-01

    ... for Exemptions § 274.302 Form N-27I-1, notice of right of withdrawal and refund for variable life... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form N-27I-1, notice of right of withdrawal and refund for variable life insurance contractholders required pursuant to Rule 6e-2...

  7. Fitness costs for Influenza B viruses carrying neuraminidase inhibitor-resistant substitutions: underscoring the importance of E119A and H274Y.

    Science.gov (United States)

    Burnham, Andrew J; Baranovich, Tatiana; Marathe, Bindumadhav M; Armstrong, Jianling; Webster, Robert G; Govorkova, Elena A

    2014-05-01

    Influenza B viruses cause annual outbreaks of respiratory illness in humans and are increasingly recognized as a major cause of influenza-associated pediatric mortality. Neuraminidase (NA) inhibitors (NAIs) are the only available therapy for patients infected with influenza B viruses, and the potential emergence of NAI-resistant viruses is a public health concern. The NA substitutions located within the enzyme active site could not only reduce NAI susceptibility of influenza B virus but also affect virus fitness. In this study, we investigated the effect of single NA substitutions on the fitness of influenza B/Yamanashi/166/1998 viruses (Yamagata lineage). We generated recombinant viruses containing either wild-type (WT) NA or NA with a substitution in the catalytic (R371K) or framework (E119A, D198E, D198Y, I222T, H274Y, and N294S) residues. We assessed NAI susceptibility, NA biochemical properties, NA protein expression, and virus replication in vitro and in differentiated normal human bronchial epithelial (NHBE) cells. Our results showed that four NA substitutions (D198E, I222T, H274Y, and N294S) conferred reduced inhibition by oseltamivir and three (E119A, D198Y, and R371K) conferred highly reduced inhibition by oseltamivir, zanamivir, and peramivir. All NA substitutions, except for D198Y and R371K, were genetically stable after seven passages in MDCK cells. Cell surface NA protein expression was significantly increased by H274Y and N294S substitutions. Viruses with the E119A, I222T, H274Y, or N294S substitution were not attenuated in replication efficiency in vitro or in NHBE cells. Overall, viruses with the E119A or H274Y NA substitution possess fitness comparable to NAI-susceptible virus, and the acquisition of these substitutions by influenza B viruses should be closely monitored.

  8. Distal phalanx fractures in horses: a survey of 274 horses with radiographic assessment of healing in 36 horses

    International Nuclear Information System (INIS)

    Honnas, C.M.; O'Brien, T.R.; Linford, R.L.

    1988-01-01

    The case records of 274 horses with fractures of the distal phalanx were reviewed. Fifty-two horses had bilateral forelimb fractures, for a total of 326 distal phalanx fractures. The fractures were classified into one of five previously described types, based on the radiographic anatomic configuration of the fracture. Solar margin fractures, which have been briefly described in other reports and previously classified as type V fractures, were identified in 132 horses. This type of fracture is distinct from other distal phalanx fractures. Due to the high incidence of solar margin fractures, these fractures were classified as a separate type (type VI). Follow-up radiographic examinations to assess fracture healing were available for 36 horses. Twenty-two horses with distal phalanx fractures (three type I, nine type II, two type III, one type IV, one type V, and six type VI) had radiographic evidence of complete bony union of the fracture at a mean of 11 months after injury. Eight horses with conplete type II fractures involving the articular surface had bony union of the body and solar margin, but not the subchondral bone at the articular surface, a mean of 11 months after injury. Six horses (four type II and two type IV) had little radiographic evidence of bony healing during the follow-up period. All fractures that eventually healed had evidence of progression toward bony union by 6 months after injury

  9. 274 REVIEW ARTICLE

    African Journals Online (AJOL)

    boaz

    and platelet count of 260.0 ± 109.1 × 109/L. The mean packed cell volume was 34.1± 5.9 %, haemoglobin 11.3 ± 2.1 g/dl and mean corpuscular haemoglobin concentration .... Neutropenia (Neutrophil count below 1.5 x 109/L may occur in ..... Steinman RM, Granelli–Piperno A,. Pope M. The interaction of immunodeficiency.

  10. Expression of ALCAM (CD166) and PD-L1 (CD274) independently predicts shorter survival in malignant pleural mesothelioma.

    Science.gov (United States)

    Inaguma, Shingo; Lasota, Jerzy; Wang, Zengfeng; Czapiewski, Piotr; Langfort, Renata; Rys, Janusz; Szpor, Joanna; Waloszczyk, Piotr; Okoń, Krzysztof; Biernat, Wojciech; Ikeda, Hiroshi; Schrump, David S; Hassan, Raffit; Miettinen, Markku

    2018-01-01

    Diffuse malignant mesothelioma of the pleura is a highly aggressive tumor typically associated with short survival. ALCAM (CD166), a type I transmembrane protein, is a member of the immunoglobulin superfamily. In normal cells, ALCAM regulates physiological processes such as angiogenesis and immune response. In cancer, it is associated with neoplastic progression, including invasion, migration, and metastasis. Furthermore, ALCAM is considered one of the cancer stem cell markers such as ALDH1 (ALDH1A1) and SALL4. The PD-L1 (CD274)/PD-1 (PDCD1, CD279) pathway is crucial for the modulation of immune responses in normal cells. Nevertheless, pathologic activation of the PD-L1/PD-1 pathway participates in immune evasion by tumor cells. Many PD-L1-expressing tumor cells have been identified in different types of cancer, including malignant mesothelioma. In this study, 175 well-characterized primary diffuse pleural mesotheliomas, including the epithelioid (n = 148), biphasic (n = 15), and sarcomatoid (n = 12) histotypes, were evaluated immunohistochemically for cancer stem cell markers (ALCAM, ALDH1, and SALL4) and PD-L1 expression. Twenty-five percent of the mesotheliomas (43/175) expressed ALCAM, whereas ALDH1 and SALL4 positivity was seen in 1% to 2% of cases. Thirty-three percent of the analyzed tumors (57/175) contained PD-L1-positive cells. Overall survival was significantly decreased in the cohort of patients with ALCAM- or PD-L1-positive tumors (both P < .01). Furthermore, the multivariate Cox hazards regression analysis identified ALCAM and PD-L1 (both P < 0.01) as potential independent risk factors. Thus, a combination of these 2 markers might be useful for prognostication and planning the treatment of patients with malignant pleural mesothelioma. Copyright © 2017 Elsevier Inc. All rights reserved.

  11. Environmental levels of the antiviral oseltamivir induce development of resistance mutation H274Y in influenza A/H1N1 virus in mallards.

    Directory of Open Access Journals (Sweden)

    Josef D Järhult

    Full Text Available Oseltamivir (Tamiflu® is the most widely used drug against influenza infections and is extensively stockpiled worldwide as part of pandemic preparedness plans. However, resistance is a growing problem and in 2008-2009, seasonal human influenza A/H1N1 virus strains in most parts of the world carried the mutation H274Y in the neuraminidase gene which causes resistance to the drug. The active metabolite of oseltamivir, oseltamivir carboxylate (OC, is poorly degraded in sewage treatment plants and surface water and has been detected in aquatic environments where the natural influenza reservoir, dabbling ducks, can be exposed to the substance. To assess if resistance can develop under these circumstances, we infected mallards with influenza A/H1N1 virus and exposed the birds to 80 ng/L, 1 µg/L and 80 µg/L of OC through their sole water source. By sequencing the neuraminidase gene from fecal samples, we found that H274Y occurred at 1 µg/L of OC and rapidly dominated the viral population at 80 µg/L. IC₅₀ for OC was increased from 2-4 nM in wild-type viruses to 400-700 nM in H274Y mutants as measured by a neuraminidase inhibition assay. This is consistent with the decrease in sensitivity to OC that has been noted among human clinical isolates carrying H274Y. Environmental OC levels have been measured to 58-293 ng/L during seasonal outbreaks and are expected to reach µg/L-levels during pandemics. Thus, resistance could be induced in influenza viruses circulating among wild ducks. As influenza viruses can cross species barriers, oseltamivir resistance could spread to human-adapted strains with pandemic potential disabling oseltamivir, a cornerstone in pandemic preparedness planning. We propose surveillance in wild birds as a measure to understand the resistance situation in nature and to monitor it over time. Strategies to lower environmental levels of OC include improved sewage treatment and, more importantly, a prudent use of antivirals.

  12. Competing endogenous RNA network analysis of CD274, IL‑10 and FOXP3 co‑expression in laryngeal squamous cell carcinoma.

    Science.gov (United States)

    Sun, Juan; Lian, Meng; Ma, Hongzhi; Wang, Ru; Ma, Zhihong; Wang, Haizhou; Zhai, Jie; Meng, Lingzhao; Feng, Ling; Bai, Yunfei; Cui, Xiaobo; Fang, Jugao

    2018-03-01

    Laryngeal squamous cell carcinoma (LSCC) is one of the most common types of head and neck malignant tumor; however, there is a lack of effective molecular targets for therapy. The present study detected the expression of three immunity‑associated molecules [forkhead box (FOX)3, interleukin (IL)‑10 and cluster of differentiation (CD)274] in 133 LSCC samples using immunohistochemistry (IHC); subsequently, the association between their expression and the clinical characteristics of LSCC were analyzed. Spearman's rank correlation method, Kaplan‑Meier and Cox regression model were used to analyze the correlations of the three proteins and their clinical significance. StarBase and miRTarBase databases were used to establish the competitive endogenous (ce)RNA network of the three molecules. IHC demonstrated that the positive expression rates of FOXP3, IL‑10 and CD274 were 68.4, 73.7 and 58.6% in 133 LSCC samples, respectively. In addition, it was identified that the expression of the three proteins was closely correlated with the clinical characteristics of LSCC, including lymph node metastasis and prognosis (P<0.05). There was also a significant association of co‑expression between any two proteins (P<0.001). Furthermore, the expression levels of FOXP3, IL‑10 and CD274 were negatively associated with the survival rate of patients with LSCC (P<0.05). The results of a Cox regression model suggested that the three proteins were prognostic risk factors for LSCC (P<0.05). The ceRNA network revealed that 10 microRNAs (miRs; including miR‑16‑5p and miR‑214‑3p), 123 long non‑coding RNAs (including X‑inactive specific transcript, H19 and metastasis associated lung adenocarcinoma transcript 1) and 408 circular RNAs (including ATP‑binding cassette subfamily C member 1 hsa_circ_001569 and ISY1 splicing factor homolog hsa_circ_001859) may regulate the expression of FOXP3, IL‑10 and CD274. The data generated from the present study may increase the

  13. Real-time PCR detection and quantification of fish probiotic Phaeobacter strain 27-4 and fish pathogenic Vibrio in microalgae, rotifer, Artemia and first feeding turbot (Psetta maxima) larvae

    DEFF Research Database (Denmark)

    Prol, M.J.; Bruhn, Jesper Bartholin; Pintado, J.

    2009-01-01

    To develop a SYBR Green quantitative real-time PCR protocol enabling detection and quantification of a fish probiotic and two turbot pathogenic Vibrio spp. in microcosms. Phaeobacter 27-4, Vibrio anguillarum 90-11-287 and Vibrio splendidus DMC-1 were quantified as pure and mixed cultures and in p...

  14. A retrospective study of ketamine administration and the development of acute or post-traumatic stress disorder in 274 war-wounded soldiers.

    Science.gov (United States)

    Mion, G; Le Masson, J; Granier, C; Hoffmann, C

    2017-12-01

    The objective of this study was to explore whether ketamine prevents or exacerbates acute or post-traumatic stress disorders in military trauma patients. We conducted a retrospective study of a database from the French Military Health Service, including all soldiers surviving a war injury in Afghanistan (2010-2012). The diagnosis of post-traumatic stress disorder was made by a psychiatrist and patients were analysed according to the presence or absence of this condition. Analysis included the following covariables: age; sex; acute stress disorder; blast injury; associated fatality; brain injury; traumatic amputation; Glasgow coma scale; injury severity score; administered drugs; number of surgical procedures; physical, neurosensory or aesthetic sequelae; and the development chronic pain. Covariables related to post-traumatic and acute stress disorders with a p ≤ 0.10 were included in a multivariable logistic regression model. The data from 450 soldiers were identified; 399 survived, of which 274 were analysed. Among these, 98 (36%) suffered from post-traumatic stress disorder and 89 (32%) had received ketamine. Fifty-four patients (55%) in the post-traumatic stress disorder group received ketamine vs. 35 (20%) in the no PTSD group (p development of post-traumatic stress disorder. In this retrospective study, ketamine administration was not a risk factor for the development of post-traumatic stress disorder in the military trauma setting. © 2017 The Association of Anaesthetists of Great Britain and Ireland.

  15. Korean Affairs Report, Number 274.

    Science.gov (United States)

    1983-03-23

    to Soviet officials verbally during his visit to the Soviet Union in late February. No Soviet reaction, however, has been reported yet. At present...question, holding aloft the banner of the three revolutions, ideological, technical and cultura . CSO: 4100/122 203 N. KOREA/ECONOMY ’KCNA’ REPORTS

  16. Neutron Diffraction Studies of a Class A beta-Lactamase Toho-1 E166A/R274N/R276N Triple Mutant

    International Nuclear Information System (INIS)

    Blakeley, Matthew P.; Chen, Yu; Afonine, Pavel

    2010-01-01

    beta-Lactam antibiotics have been used effectively over several decades against many types of bacterial infectious diseases. However, the most common cause of resistance to the beta-lactam antibiotics is the production of beta-lactamase enzymes that inactivate beta-lactams by rapidly hydrolyzing the amide group of the beta-lactam ring. Specifically, the class A extended-spectrum beta-lactamases (ESBLs) and inhibitor-resistant enzymes arose that were capable of hydrolyzing penicillins and the expanded-spectrum cephalosporins and monobactams in resistant bacteria, which lead to treatment problems in many clinical settings. A more complete understanding of the mechanism of catalysis of these ESBL enzymes will impact current antibiotic drug discovery efforts. Here, we describe the neutron structure of the class A, CTX-M-type ESBL Toho-1 E166A/R274N/R276N triple mutant in its apo form, which is the first reported neutron structure of a beta-lactamase enzyme. This neutron structure clearly reveals the active-site protonation states and hydrogen-bonding network of the apo Toho-1 ESBL prior to substrate binding and subsequent acylation. The protonation states of the active-site residues Ser70, Lys73, Ser130, and Lys234 in this neutron structure are consistent with the prediction of a proton transfer pathway from Lys73 to Ser130 that is likely dependent on the conformation of Lys73, which has been hypothesized to be coupled to the protonation state of Glu166 during the acylation reaction. Thus, this neutron structure is in agreement with a proposed mechanism for acylation that identifies Glu166 as the general base for catalysis.

  17. Neutron diffraction studies of a class A beta-lactamase Toho-1 E166A/R274N/R276N triple mutant.

    Science.gov (United States)

    Tomanicek, Stephen J; Blakeley, Matthew P; Cooper, Jonathan; Chen, Yu; Afonine, Pavel V; Coates, Leighton

    2010-03-05

    beta-Lactam antibiotics have been used effectively over several decades against many types of bacterial infectious diseases. However, the most common cause of resistance to the beta-lactam antibiotics is the production of beta-lactamase enzymes that inactivate beta-lactams by rapidly hydrolyzing the amide group of the beta-lactam ring. Specifically, the class A extended-spectrum beta-lactamases (ESBLs) and inhibitor-resistant enzymes arose that were capable of hydrolyzing penicillins and the expanded-spectrum cephalosporins and monobactams in resistant bacteria, which lead to treatment problems in many clinical settings. A more complete understanding of the mechanism of catalysis of these ESBL enzymes will impact current antibiotic drug discovery efforts. Here, we describe the neutron structure of the class A, CTX-M-type ESBL Toho-1 E166A/R274N/R276N triple mutant in its apo form, which is the first reported neutron structure of a beta-lactamase enzyme. This neutron structure clearly reveals the active-site protonation states and hydrogen-bonding network of the apo Toho-1 ESBL prior to substrate binding and subsequent acylation. The protonation states of the active-site residues Ser70, Lys73, Ser130, and Lys234 in this neutron structure are consistent with the prediction of a proton transfer pathway from Lys73 to Ser130 that is likely dependent on the conformation of Lys73, which has been hypothesized to be coupled to the protonation state of Glu166 during the acylation reaction. Thus, this neutron structure is in agreement with a proposed mechanism for acylation that identifies Glu166 as the general base for catalysis. (c) 2010 Elsevier Ltd. All rights reserved.

  18. ‘What is that to us? See to it yourself’ (Mt 27:4: Making atonement and the Matthean portrait of the Jewish chief priests

    Directory of Open Access Journals (Sweden)

    Dorothy Jean Weaver

    2014-10-01

    Full Text Available To read the Gospel of Matthew within its 1st century religious context is to read an intensely Jewish narrative. Central to the world of this Gospel are the Jerusalem temple, its administrators, the chief priests, and the sacrificial system which they are charged by Jewish law to officiate. This article assesses the Matthean portrait of the Jewish chief priests of Jesus’ day against the scriptural backdrop which lays out their prominent role within Jewish religious life, namely ‘making atonement’ before God for the ‘sins’ of the people. In section one I sketch out the Matthean portrait of the scripturally assigned role of the priests, connecting this portrait to its biblical antecedents. In section two I assess the overall performance of the Matthean chief priests against the backdrop of their assigned role. In section three I address the question of atonement. Crucial here is 27:3–10, the account of Judas Iscariot, who returns his 30 silver coins to the chief priests and says (27:4a; emphasis mine, ‘I have sinned, because I have handed over innocent blood’. Here I highlight Matthew’s ironic modus operandi as he portrays the chief priests’ non-priestly response to Judas. Additionally, I contrast Matthew’s portrait of the Jewish chief priests with a brief portrait of Jesus’ own ministry within the Jewish community, a ministry which fulfils the priestly role abandoned by the chief priests. I conclude my article in section four with brief reflections on the rhetorical impact of Matthew’s portrait of the Jewish chief priests within his overall narrative.

  19. Synthesis, characterization, and bonding of indium cluster phases: Na15In27.4, a network of In16 and In11 clusters; Na2In with isolated indium tetrahedra

    International Nuclear Information System (INIS)

    Sevov, S.C.; Corbett, J.D.

    1993-01-01

    The remaining phases in the Na-In system have been identified and characterized. The indium-richest is Na 15 In 27.4 , with a structure containing novel closo-In 16 clusters interconnected to two kinds of nido-In 11 units and isolated, 4-bonded atoms (Cmcm, Z = 8, a = 16.108 (4) Angstrom, b = 35.279 (8) Angstrom, c = 15.931 (3) Angstrom, R/R w = 0.041/0.044 at the indium-rich limits Na 15 In 27.54 ). Fractional occupancy of two atoms in cluster chain positions were found, one as a function of a narrow nonstoichiometry. The structure is related to that recently established for Na 7 In 11.8 . Resistivity and magnetic properties are consistent with a small (0.5-3.2%) excess of electrons relative to the calculated bonding requirements. The sodium-richest phase is the stable, diamagnetic, and weakly metallic Na 2 In, isostructural with Na 2 Tl (C222 1 , Z = 16, a = 13.855 (1) Angstrom, b = 8.836 (1) Angstrom, c = 11.762 (1) Angstrom, R/R w = 0.030/0.034). A corrected phase diagram is given. 21 refs., 5 figs., 5 tabs

  20. A Novel Heme Pocket Hemoglobin Variant Associated with Normal Hematology: Hb Zara or α91(FG3)Leu→Ile (α2) (HBA2: c.274C > A).

    Science.gov (United States)

    Trova, Sandro; Mereu, Paolo; Decandia, Luca; Cocco, Elena; Masala, Bruno; Manca, Laura; Pirastru, Monica

    2015-08-13

    We report a new hemoglobin (Hb) variant on the HBA2 gene, Hb Zara [α91(FG3)Leu→Ile (α2); HBA2: c.274C > A], which was found in a Caucasian man from Croatia. It was observed by routine cation exchange chromatography as an abnormal 21.8% fraction overlapping Hb A 2 , and associated with normal hematology. It was slightly unstable by the standard isopropanol precipitation test. DNA analysis revealed the CTT > ATT mutation at codon 91 on an α2 gene of a normal α-globin gene arrangement. This new variant represents the sixth described mutation at codon α91 and fourth on the α2 locus. As a result of the slight instability due to the significant role of the α91 residue in the α1β2 contact, the level of the Hb Zara variant was lower than levels observed for several stable variants codified by the α2 locus.

  1. Incidence and causes of lower-limb amputations in the city of Ribeirão Preto from 1985 to 2008: evaluation of the medical records from 3,274 cases

    Directory of Open Access Journals (Sweden)

    Bruna Maria Bueno Barbosa

    Full Text Available ABSTRACT: Objective: It was to identify trends of traumatic and non-traumatic causes of lower limb amputations, as well as the role played by population aging, traffic violence increase, public health policy of diabetes control program and drivers anti-alcohol laws on these amputations. Method: Hospitalization data recorded in the discharge forms of 32 hospitals located in the region of Ribeirão Preto, Brazil, from 1985 to 2008 were analyzed. Result: A total of 3,274 lower-limb amputations were analyzed, of which 95.2% were related to non-traumatic causes, mainly infectious and ischemic complications of diabetes mellitus. Cancer (2.8% and congenital (1.3% causes were included in this group. Only 4.8% were related to traumatic causes. Traumatic amputation average rate was 1.5 amputations in 100,000 habitants with a slight tendency of increase in the last 5 years. Non-traumatic causes showed an average rate of 30.0 amputations for 100,000 habitants and remained relatively constant during the whole period. Non-traumatic were much more predominant in patients older than 60 years and traumatic amputations occurred more frequently in patients younger than 39 years. Conclusion: The overall rates of amputation and the rates of traumatic and non-traumatic amputations remained nearly constant during the study period. The impact of diabetes control policies and the introduction of traffic safety laws could not be identified on the amputation rates.

  2. 21 CFR 558.274 - Hygromycin B.

    Science.gov (United States)

    2010-04-01

    ... Tylosin 4 to 50 Chickens: Control of infestations of large roundworms (Ascaris galli), cecal worms... tylosin phosphate; withdraw 3 days before slaughter 000986 (ii) 12 Swine: control of infestation of large... slaughter. Tylosin 10 to 100 Swine: Control of infestations of large roundworms (Ascaris suis), nodular...

  3. Publications | Page 274 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Development research in Kenya. Kenya's 2002 general election, replacing a notoriously corrupt regime with a coalition government committed to reform, was seen as a landmark event in the country's history. IDRC, active in Kenya for some 30 years by then,.

  4. Reference: 274 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available henotype indistinguishable from that of the rpn1a single mutant. Thus, despite their largely overlapping expression patterns in flowe...rs and developing seeds, the two isoforms do not share redundant functions during g

  5. Publications | Page 274 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded ...

  6. 7 CFR 274.3 - Issuance systems.

    Science.gov (United States)

    2010-01-01

    ... intermediary document, such as an ATP, may be distributed on a monthly basis to each household and surrendered... number; (ii) Case name and address; (iii) Case number; (iv) Allotment amount; (v) Benefit month or...

  7. BDML Metadata: 274 [SSBD[Archive

    Lifescience Database Archive (English)

    Full Text Available wt_N2_030116_02/ http://ssbd.qbic.riken.jp/data/bdml/Ce_KK_P002/wt_N2_030116_02.bdml0.15.xml... http://ssbd.qbic.riken.jp/data/pdpml/Ce_KK_P002.pdpml0.05.xml http://ssbd.qbic.riken.jp/search/0

  8. 48 CFR 211.274-1 - General.

    Science.gov (United States)

    2010-10-01

    ...-1 General. Unique item identification and valuation is a system of marking and valuing items delivered to DoD that will enhance logistics, contracting, and financial business transactions supporting... reliable accountability of property and asset visibility throughout the life cycle; and (d) Reduce the...

  9. Publications | Page 274 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Tapping into community resources in China. In remote highland villages in Guizhou — one of China's poorest provinces — villagers have solved a problem that had existed for 200 years. Working with researchers from the Guizhou Academy of Agricultural Sciences (GAAS), with support.

  10. 8 CFR 274a.1 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... methods, and are subject to control only as to results. Whether an individual or entity is an independent... not be inferred from an employee's foreign appearance or accent. Nothing in this definition should be...

  11. 48 CFR 211.274-3 - Policy for valuation.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF DEFENSE ACQUISITION PLANNING DESCRIBING AGENCY NEEDS Using and Maintaining Requirements... the time of delivery; and (3) For items delivered under a time-and-materials contract, the contractor...

  12. Dicty_cDB: VHH274 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1( AY081315 |pid:none) Arabidopsis thaliana 4-alpha-gluca... 88 8e-17 FJ664262_1( FJ664262 |pid:none) Anno...na cherimola disproportionatin... 87 1e-16 AE005176_696( AE005176 |pid:none) Lactoc

  13. Dicty_cDB: CFH274 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ry Canis familiaris genomic, genomic survey sequence. 40 0.11 2 BQ507132 |BQ507132.2 EST614547 Generation of...sequence, mRNA sequence. 42 0.33 2 BQ507131 |BQ507131.1 EST614546 Generation of a set of potato cDNA clones

  14. 38 CFR 21.274 - Revolving fund loan.

    Science.gov (United States)

    2010-07-01

    ... Evaluation Plan, or Individualized Independent Living Plan has been prepared; and (2) The veteran and VA... the terms and conditions for repayment; or (iii) Will not be eligible in the future for payments of... installments from future VA payments for compensation, pension, subsistence allowance, educational assistance...

  15. 77 FR 274 - Combined Notice of Filings #1

    Science.gov (United States)

    2012-01-04

    ... Partners IV, LLC, AES Laurel Mountain LLC. Description: AES MBR Affiliates Market Power Analysis for the... Genco LLC. Description: Rhode Island LFG Genco LLC MBR Tariff to be effective 2/20/2012. Filed Date: 12...: Brea Power II LLC MBR Tariff to be effective 2/20/ 2012. Filed Date: 12/22/11. Accession Number...

  16. 40 CFR 52.274 - California air pollution emergency plan.

    Science.gov (United States)

    2010-07-01

    ... the following schedule: (i) For sources with emissions of hydrocarbons (HC) or nitrogen oxides (NOX... definitions apply: (i) “Ppm” means parts per million by volume. (ii) “COH” means coefficient of haze. (iii... purposes of this regulation the following definitions apply: (i) “Administrator” means the Administrator of...

  17. 28 CFR 2.74 - Decision of the Commission.

    Science.gov (United States)

    2010-07-01

    ... PRISONERS, YOUTH OFFENDERS, AND JUVENILE DELINQUENTS District of Columbia Code: Prisoners and Parolees § 2... Commissioner votes shall be required if the decision differs from the decision recommended by the examiner... and reparole made pursuant to § 2.105(c), shall be based on the vote of one Commissioner, except as...

  18. All projects related to | Page 274 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2017-06-02

    Canadian researchers analyzing the causes of food insecurity in India and the use of new technologies to address food shortages aim to improve access to food supplies in India and elsewhere. End Date: June 2, 2017. Topic: AGRICULTURAL WASTES, BIOMASS, ENERGY TECHNOLOGY, INFORMATION TECHNOLOGY, ...

  19. 48 CFR 1816.405-274 - Award fee evaluation factors.

    Science.gov (United States)

    2010-10-01

    ... measurement of the contractor's performance against the negotiated estimated cost of the contract. This... contractor performance in other evaluation factors, when there is a major breach of safety or security. (i... classified information, illegal technology transfer, workplace violence resulting in criminal conviction...

  20. 26 CFR 1.274-5T - Substantiation requirements (temporary).

    Science.gov (United States)

    2010-04-01

    ... the daily cost of the traveler's own breakfast, lunch, and dinner and of expenditures incidental to... portions of a taxable year and use that record to substantiate the business/investment use of listed property for all or a portion of the taxable year if the taxpayer can demonstrate by other evidence that...

  1. 49 CFR 178.274 - Specifications for UN portable tanks.

    Science.gov (United States)

    2010-10-01

    ... the material of construction. (5) When steel is used, that has characteristics other than that of... approval plate. (2) In recognition of scientific and technological advances, the technical requirements... of the insulation system. Leakage test means a test using gas to subject the shell and its service...

  2. Dicty_cDB: VFA274 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available xr rs*pr*tn*rsn*khssnhlgq*nrn*rstrchrrnr*r*ngksl*ksyrcsittss*tx yqrlpprssskrcxfvnsfkp Translated Amino Acid ...incwsrfxys wslccrlksrwygcfrrqxsw*irr*mv*sw*wsnhfrngylslcrslyv*sryhlxxxr rs*pr*tn*...rsn*khssnhlgq*nrn*rstrchrrnr*r*ngksl*ksyrcsittss*tx yqrlpprssskrcxfvnsfkp Homology vs CSM-cDNA Score E Seque

  3. 40 CFR 408.274 - Pretreatment standards for existing sources.

    Science.gov (United States)

    2010-07-01

    ... source subject to this subpart that introduces process wastewater pollutants into a publicly owned... subpart. Pollutant or pollutant property Pretreatment standard BOD5 No limitation. TSS Do. pH Do. Oil and grease Do. [40 FR 55794, Dec. 1, 1975, as amended at 60 FR 33947, June 29, 1995] ...

  4. Translations on Narcotics and Dangerous Drugs, Number 274

    Science.gov (United States)

    1976-12-02

    and Document Analysis. 17a. Descriptors Narcotics Drug Addiction Law (Jurisprudence) Law Enforcement 17b. Identifiers /Open-Ended Terms...of No k first grade heroin to police disguised as buyers behind the King Rama VI statue, near Lumphini Park. CSO: 5300 35 THAILAND BRIEFS...will shelter him from compulsions and stigmas prejudicial to his rehabilitation. Meanwhile, the legislators did not wish to stop at the potential

  5. 40 CFR 180.274 - Propanil; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... (3, 4-DCA) in or on the following food commodities: Commodity Parts per million Cattle, fat 0.10 Cattle, meat 0.05 Cattle, meat byproducts 1.0 Crayfish 0.05 Egg 0.30 Goat, fat 0.10 Goat, meat 0.05 Goat....05 Horse, meat byproducts 1.0 Milk 0.05 Poultry, fat 0.05 Poultry, meat 0.10 Poultry, meat byproducts...

  6. 47 CFR 27.4 - Terms and definitions.

    Science.gov (United States)

    2010-10-01

    ... and 793-798 MHz bands in accordance with the Commission's rules. Advanced wireless service (AWS). A... half-wave dipole in a given direction. Equivalent Isotropically Radiated Power (EIRP). The product of... propagation properties of radio waves. Radiolocation. Radiodetermination used for purposes other than those of...

  7. Dicty_cDB: CHR274 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EF*snqsrpl*sfvnnivfknkkvknfvnky Frame B: ***f*kik***n*w***ckynkrws*fsftinknnksn*kyik***w*ck*yky*wy*ww ck*yky...ky**wyrttsttnl*rtkctkrsimeg*rcyf*w**yc***fr*n*frisyfsr kyynnnnnynnnynk*tkny*t*i**

  8. 26 CFR 1.274-5A - Substantiation requirements.

    Science.gov (United States)

    2010-04-01

    ... spent on business; (iii) Place. Destinations or locality of travel, described by name of city or town or other similar designation; and (iv) Business purpose. Business reason for travel or nature of the business benefit derived or expected to be derived as a result of travel. (3) Entertainment in general...

  9. 26 CFR 1.274-5 - Substantiation requirements.

    Science.gov (United States)

    2010-04-01

    ... expenditures for business travel if it contains the following: name, location, date, and separate amounts for... travel expenses as well as the time, place, and business purpose of the travel. See paragraphs (b)(2) and... other travel expenses as well as the time, place, and business purpose of the travel. (k)-(l) [Reserved...

  10. Dicty_cDB: SLF274 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 5215 |pid:none) Lymphocytic choriomeningitis virus... 39 0.20 AE014187_324( AE014187 |pid:none) Plasmodium f...alciparum 3D7 chromo... 37 0.75 EU480452_2( EU480452 |pid:none) Lymphocytic choriomeningitis... virus... 36 1.3 AF325214_2( AF325214 |pid:none) Lymphocytic choriomeningitis virus... 36 1.7 ( P...09992 ) RecName: Full=Nucleoprotein; AltName: Full=Nucleocapsid... 35 2.2 Y16308_1( Y16308 |pid:none) Lymphocytic choriomeningitis

  11. BPU Simulator

    DEFF Research Database (Denmark)

    Rehr, Martin; Skovhede, Kenneth; Vinter, Brian

    2013-01-01

    in that process. Our goal is to support all execution platforms, and in this work we introduce the Bohrium Processing Unit, BPU, which will be the FPGA backend for Bohrium. The BPU is modeled as a PyCSP application, and the clear advantages of using CSP for simulating a new CPU is described. The current Py......CSP simulator is able to simulate 220 Monte Carlo simulations in less than 35 seconds in the smallest BPU simulation....

  12. 17 CFR 274.128 - Form N-CSR, certified shareholder report.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form N-CSR, certified... Form N-CSR, certified shareholder report. This form shall be used by registered management investment... Form N-CSR, see the List of CFR Sections Affected, which appears in the Finding Aids section of the...

  13. 7 CFR 274.12 - Electronic Benefit Transfer issuance system approval standards.

    Science.gov (United States)

    2010-01-01

    ... processors, to a store's host computer or point of sale (POS) device. These adjustments may occur after the... documentation, operating procedures or the State agency Security Program: (A) Computer hardware controls that... testing, security testing, recovery testing, controls testing, stress and throughput performance testing...

  14. Comparative genomics of 274 Vibrio cholerae genomes reveals mobile functions structuring three niche dimensions

    NARCIS (Netherlands)

    Dutilh, Bas E; Thompson, Cristiane C; Vicente, Ana C P; Marin, Michel A; Lee, Clarence; Silva, Genivaldo G Z; Schmieder, Robert; Andrade, Bruno G N; Chimetto, Luciane; Cuevas, Daniel; Garza, Daniel R; Okeke, Iruka N; Aboderin, Aaron Oladipo; Spangler, Jessica; Ross, Tristen; Dinsdale, Elizabeth A; Thompson, Fabiano L; Harkins, Timothy T; Edwards, Robert A

    2014-01-01

    BACKGROUND: Vibrio cholerae is a globally dispersed pathogen that has evolved with humans for centuries, but also includes non-pathogenic environmental strains. Here, we identify the genomic variability underlying this remarkable persistence across the three major niche dimensions space, time, and

  15. Corrigendum to “Geometric Arveson–Douglas conjecture” [Adv. Math. 274 (2015) 606–630

    Czech Academy of Sciences Publication Activity Database

    Engliš, Miroslav; Eschmeier, J.

    2015-01-01

    Roč. 278, June (2015), s. 254 ISSN 0001-8708 Institutional support: RVO:67985840 Keywords : Arveson-Douglas conjecture * generalized Toeplitz operator Subject RIV: BA - General Math ematics Impact factor: 1.405, year: 2015 http://www.sciencedirect.com/science/article/pii/S000187081500119X

  16. SU-E-T-274: Monte Carlo Simulations of Output Factors for a Small Animal Irradiator.

    Science.gov (United States)

    Pidikiti, R; Stojadinovic, S; Song, K; Speiser, M; Solberg, T

    2012-06-01

    Measurement of dosimetric parameters of small photon beams, with field sizes as small 1 mm in diameter, is particularly challenging. This work utilizes Monte Carlo techniques to calculate percent depth dose (PDD) and output factors for small photon fields from a kV x-ray based small animal irradiator. Absolute dose calibration of a commercial small animal stereotactic irradiator (XRAD225, Precision X-ray) was performed in accordance with the recommendations of AAPM TG-61 protocol. Both in-air and in-water calibrations were performed at a 30.4 cm source-to-surface distance (SSD) for a reference collimator 50 mm in diameter. The BEAM/EGS was used to model 225 kV photon beams used for most therapeutic applications. The Monte Carlo model was provided good agreement with measured beam characteristics, e.g. PDD and off-axis ratios. Subsequently, output factors for various square and circular applicators were measured using an ionization chamber and radiochromic film, and compared with MC simulations. Directional Bremsstrahlung splitting (DBS) was utilized for variance reduction to improve efficiency of the output factor simulations. The statistical uncertainty on the MC- calculated results is between 0.5% and 1% for most points. The absolute dose measured for reference collimator at 30.4 cm SSD in water and in air is 4.1 and 4.12 Gy/min. The agreement between simulated and measured output factors was excellent, ranging from 1% to 2.84%. The MC- simulated and measured depth dose data, normalized at the surface, show excellent agreement, with a maximum deviation is approximately 2.5 %. Monte Carlo simulation provides an indispensible tool for validating measurements of the smallest field sizes used in preclinical small animal irradiation. © 2012 American Association of Physicists in Medicine.

  17. 8 CFR 274a.2 - Verification of identity and employment authorization.

    Science.gov (United States)

    2010-01-01

    ... the employer or recruiter or referrer for a fee has actual or constructive knowledge that the... recruiter or referrer for a fee, must ensure that the reproduction process maintains the legibility and... processes that: (i) Create the retained Forms I-9; (ii) Modify and maintain the retained Forms I-9; and (iii...

  18. People and things. CERN Courier, May 1987, v. 27(4)

    International Nuclear Information System (INIS)

    Anon.

    1987-01-01

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The XIX General Assembly of the International Union of Pure and Applied Physics (IUPAP) is to be held at the US National Academy of Sciences, Washington DC, from 29 September - 3 October. The theme of the scientific programme will be 'Physics in a Technological World', reflecting the IUPAP General Council's aim of emphasizing the role of industrial physics and improving relations between industrial and academic physics. The CERN Accelerator School is organizing in collaboration with BESSY (the Berlin electron synchrotron radiation centre) the second of its biennial two-week courses on advanced accelerator physics

  19. S. A{r. Tldskr. Veek. 4, 271-274 (1974) NWTSTE ONTWIKKELINGE ...

    African Journals Online (AJOL)

    mineraalvenorging van herkorrcrs in Suid-Afrils in pen- pekf,ief te stel. Mincraalmetabolbrre cn mineraalversorgiag .... aanrullings in die vorm van 'n boenrneel*out lek. Daar was egter pen rcrgelykbare proteienaanwllings nie en geen ... Reed, Elliott & Topps (1965) het bv. gevinddat by voorkraalbeeste op hoe kragvoerdieet ...

  20. 26 CFR 1.274-4 - Disallowance of certain foreign travel expenses.

    Science.gov (United States)

    2010-04-01

    ..., both the day such travel begins and the day such travel ends shall be considered a “business day” or a... his departure shall be considered a business day. On the other hand, if a taxpayer travels by... travels from New York to London to take part in business negotiations beginning on a Wednesday and...

  1. TLR3 triggering regulates PD-L1 (CD274) expression in human neuroblastoma cells

    NARCIS (Netherlands)

    Boes, Marianne; Meyer-Wentrup, Friederike

    2015-01-01

    Neuroblastoma is the most common extracranial solid tumor in children, causing 12% of all pediatric cancer mortality. Neuroblastoma specific T-cells have been detected in patients, but usually fail to attack and eradicate the tumors. Tumor immune evasion may thus play an important role in

  2. : tous les projets | Page 274 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Cette subvention soutiendra l'acquisition d'une expertise relativement aux essais en matière de prévention du VIH/sida au Botswana, en Tanzanie et en Zambie en mettant à profit des collaborations existant déjà entre des pays d'Afrique, le Canada et les États-Unis. Date de début : 1 décembre 2010. End Date: 15 ...

  3. Automatic Parallelization of Scientific Application

    DEFF Research Database (Denmark)

    Blum, Troels

    performance gains. Scientists working with computer simulations should be allowed to focus on their field of research and not spend excessive amounts of time learning exotic programming models and languages. We have with Bohrium achieved very promising results by starting out with a relatively simple approach...... in the cases where we were not able to gain any performance boost by specialization, the added cost, for kernel generation and extra bookkeeping, is minimal. Many of the lessons learned developing and optimizing the Bohrium GPU vector engine has proven to be valuable in a broader perspective, which has made...

  4. Results from a hadron jet experiment at √s = 19.4 and 27.4 GeV

    International Nuclear Information System (INIS)

    Arenton, M.W.; Chen, H.F.; Corcoran, M.

    1984-01-01

    In Fermilab experiment E609 we have studied the production of high p/sub t/ hadron jets by beams of protons at 200 and 400 GeV/c and pions at 200 GeV/c. Results for the single-jet and di-jet cross sections are given and are compared to QCD predictions. Leading-particle charge ratios from di-jet events are given and compared to QCD-motivated predictions. Evidence is presented concerning a higher twist effect in πp interactions as predicted by Berger and Brodsky. Preliminary results on high transverse energy events from nuclear targets are given. Finally, we present comparisons of our pp high E/sub t/ data with predictions from two Monte Carlo models. 12 references

  5. 17 CFR 274.11d - Form N-6, registration statement of separate accounts organized as unit investment trusts that...

    Science.gov (United States)

    2010-04-01

    ... variable life insurance policies. Form N-6 shall be used as the registration statement to be filed pursuant... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form N-6, registration statement of separate accounts organized as unit investment trusts that offer variable life insurance...

  6. 77 FR 28588 - Proposed Priorities-American Overseas Research Centers Program; CFDA Number 84.274A

    Science.gov (United States)

    2012-05-15

    .... scholars conducting overseas research that is vital to understanding the history, culture, economy... offering foreign language courses to enhance career training or preparation for transfer to four-year... obligations of recipients thereof; or (4) Raise novel legal or policy issues arising out of legal mandates...

  7. Monedas de Guerra y triunfo de Octaviano. Las series CAESAR DIVI F e IMP CAESAR (RIC I 250 - 274)

    OpenAIRE

    Marqués González, Néstor F.

    2015-01-01

    En 2014 hemos celebrado el bimilenario de la muerte de Augusto, uno de los personajes más destacados del mundo antiguo. Su política y su moral supusieron un importante cambio para el Estado Romano, gracias en parte a su magistral uso de la propaganda política. Octaviano, desde que su tío-abuelo le convirtiera en su heredero, hizo buen uso de la manipulación pública para conseguir sus fines durante el triunvirato y el conflicto posterior. Presentamos una recopilación de su propaganda política ...

  8. Nuclear Technology. Course 27: Metrology. Module 27-4, Angle Measurement Instruments, Optical Projections and Surface Texture Gages.

    Science.gov (United States)

    Selleck, Ben; Espy, John

    This fourth in a series of eight modules for a course titled Metrology describes the universal bevel protractor and the sine bar, the engineering microscope and optical projector, and several types of surface texture gages. The module follows a typical format that includes the following sections: (1) introduction, (2) module prerequisites, (3)…

  9. Predictors of In-Hospital Mortality After Rapid Response Team Calls in a 274 Hospital Nationwide Sample.

    Science.gov (United States)

    Shappell, Claire; Snyder, Ashley; Edelson, Dana P; Churpek, Matthew M

    2018-01-02

    Despite wide adoption of rapid response teams across the United States, predictors of in-hospital mortality for patients receiving rapid response team calls are poorly characterized. Identification of patients at high risk of death during hospitalization could improve triage to intensive care units and prompt timely reevaluations of goals of care. We sought to identify predictors of in-hospital mortality in patients who are subjects of rapid response team calls and to develop and validate a predictive model for death after rapid response team call. Analysis of data from the national Get with the Guidelines-Medical Emergency Team event registry. Two-hundred seventy four hospitals participating in Get with the Guidelines-Medical Emergency Team from June 2005 to February 2015. 282,710 hospitalized adults on surgical or medical wards who were subjects of a rapid response team call. None. The primary outcome was death during hospitalization; candidate predictors included patient demographic- and event-level characteristics. Patients who died after rapid response team were older (median age 72 vs 66 yr), were more likely to be admitted for noncardiac medical illness (70% vs 58%), and had greater median length of stay prior to rapid response team (81 vs 47 hr) (p rapid response team calls differ significantly from surviving peers. Recognition of these factors could improve postrapid response team triage decisions and prompt timely goals of care discussions.

  10. 20 CFR 404.274 - What are the measuring periods we use to calculate cost-of-living increases?

    Science.gov (United States)

    2010-04-01

    ... ADMINISTRATION FEDERAL OLD-AGE, SURVIVORS AND DISABILITY INSURANCE (1950- ) Computing Primary Insurance Amounts... determine whether there will be an automatic cost-of-living increase and if so, its amount. (b) Measuring... increase is effective; or (ii) The third calendar quarter of any year in which the last automatic increase...

  11. 28 CFR 27.4 - Corrective action and other relief; Director, Office of Attorney Recruitment and Management.

    Science.gov (United States)

    2010-07-01

    ... receipt of any response by the FBI if the Director determines that such a stay would be appropriate. A... determines that such a modification or dissolution is appropriate. (e)(1) The Director shall determine, based upon all the evidence, whether a protected disclosure was a contributing factor in a personnel action...

  12. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    pp 95-100 Research News. Bohrium - A New Element in the Periodic Table · Srinivasan Natarajan · More Details Fulltext PDF. pp 101-102 Book Review. Fixed Points - From Russia with Love - A Primer of Fixed Point Theory · A K Vijaykumar · More Details Fulltext PDF. pp 102-103 Book Review. The Medusa and the Snail.

  13. Srinivasan Natarajan

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. Srinivasan Natarajan. Articles written in Resonance – Journal of Science Education. Volume 5 Issue 5 May 2000 pp 95-100 Research News. Bohrium - A New Element in the Periodic Table · Srinivasan Natarajan · More Details Fulltext PDF ...

  14. Fulltext PDF

    Indian Academy of Sciences (India)

    64 Fulfilling Mendeleev's Dream. A G Samuelson. 67 Glenn Seaborg 1912-1999. Gregory J Butera. RESEARCH EWS. 91 Nobel Prize in Physiology or Medicine 1999. Utpal Tatu. 95 Bohrium - A New Element in the Periodic Table. Srinivasan Natarajan. BO K REV EWS. Fixed Points. From Russia with Love - A Primer of ...

  15. Complexity and document: the hybridization of mediations in areas undergoing rupture - DOI: 10.3395/reciis.v3i3.274en

    Directory of Open Access Journals (Sweden)

    Viviane Couzinet

    2009-09-01

    Full Text Available To complete communication between researchers studies and science popularization studies a new way in scientific communication is open by the author, the one between professionals and researchers. In this exchange area, often considered like a breakdown area, the information science research group of Toulouse University (Franceanalyse the hybridations in the mediations building. This posture allows to analyse numerous phenomenons and to reinvestigate the concept of document as a social construction.

  16. Multibeam collection for TN274: Multibeam data collected aboard Thomas G. Thompson from 2012-01-25 to 2012-02-09, Apra, Guam to Apra, Guam

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  17. Low ascitic fluid total protein levels is not associated to the development of spontaneous bacterial peritonitis in a cohort of 274 patients with cirrhosis

    DEFF Research Database (Denmark)

    Mo, Silje; Bendtsen, Flemming; Wiese, Signe Skovgaard

    2018-01-01

    Background: Spontaneous bacterial peritonitis (SBP) is a complication to decompensated cirrhosis. Fluoroquinolones may prevent SBP. However, predictive markers for SBP are wanted. Guidelines suggest that patients with ascitic fluid protein below 15 g/l receive fluoroquinolones to prevent SBP...

  18. Coins of War and Triumph of Octavian. The CAESAR DIVI F and IMP CAESAR Series (RIC I2 250-274

    Directory of Open Access Journals (Sweden)

    Néstor F. Marqués González

    2015-12-01

    Full Text Available In 2014 we celebrated the bimillennial anniversary of the death of Augustus, one of the most prominent figures of the ancient world. His policy and morals marked a major shift for the Roman State, thanks partly to his masterful use of political propaganda. Octavian, after becoming his great-uncle’s heir, made good use of public manipulation to achieve his goals during the triumvirate and the subsequent conflicts. Now we are presenting a collection of his political and military propaganda in this last period of the Republic in which Rome went from the triumvirate to the civil war and the subsequent proclamation of the young Octavian as Augustus. We deal with war coins minted between the battles of Naulochus and Actium and the representations of the subsequent triumphs that resulted in the final ascent of a young man with pretensions of power who got to rule the world.

  19. A 274µW clock synchronized wireless body area network IC with super-regenerative RSSI for biomedical ad-hoc network system.

    Science.gov (United States)

    Yongsu Lee; Hoi-Jun Yoo

    2017-07-01

    A clock synchronized multi-node wireless body area network (WBAN) transceiver IC with super-regenerative RSSI is proposed for biomedical ad-hoc network system. The ad-hoc network makes stable communication even in the harsh human body channel condition (body channel communication (BCC). In the node IC, it has 2 key building blocks; 1) Injection locking clock synchronization receiver, and 2) Super-regenerative RSSI (SR-RSSI) and OOK receiver. As a result, the 240 MHz clock is exactly synchronized in the node IC with 90 μW power consumption. And a channel-condition-adapted ad-hoc network is constructed based on the SR-RSSI data. SR-RSSI consumes 184 μW concurrent achieving OOK receiver functionality for the ad-hoc network. The proposed WBAN IC is fabricated in 0.18 μm CMOS technology.

  20. SU-E-T-274: Radiation Therapy with Very High-Energy Electron (VHEE) Beams in the Presence of Metal Implants

    Energy Technology Data Exchange (ETDEWEB)

    Jensen, C; Palma, B; Qu, B; Maxim, P; Loo, B; Bazalova, M [Department of Radiation Oncology, Stanford University, Stanford, CA (United States); Hardemark, B; Hynning, E [RaySearch Laboratories, Stockholm (Sweden)

    2014-06-01

    Purpose: To evaluate the effect of metal implants on treatment plans for radiation therapy with very high-energy electron (VHEE) beams. Methods: The DOSXYZnrc/BEAMnrc Monte Carlo (MC) codes were used to simulate 50–150MeV VHEE beam dose deposition and its effects on steel and titanium (Ti) heterogeneities in a water phantom. Heterogeneities of thicknesses ranging from 0.5cm to 2cm were placed at 10cm depth. MC was also used to calculate electron and photon spectra generated by the VHEE beams' interaction with metal heterogeneities. The original VMAT patient dose calculation was planned in Eclipse. Patient dose calculations with MC-generated beamlets were planned using a Matlab GUI and research version of RayStation. VHEE MC treatment planning was performed on water-only geometry and water with segmented prostheses (steel and Ti) geometries with 100MeV and 150MeV beams. Results: 100MeV PDD 5cm behind steel/Ti heterogeneity was 51% less than in the water-only phantom. For some cases, dose enhancement lateral to the borders of the phantom increased the dose by up to 22% in steel and 18% in Ti heterogeneities. The dose immediately behind steel heterogeneity decreased by an average of 6%, although for 150MeV, the steel heterogeneity created a 23% increase in dose directly behind it. The average dose immediately behind Ti heterogeneities increased 10%. The prostate VHEE plans resulted in mean dose decrease to the bowel (20%), bladder (7%), and the urethra (5%) compared to the 15MV VMAT plan. The average dose to the body with prosthetic implants was 5% higher than to the body without implants. Conclusion: Based on MC simulations, metallic implants introduce dose perturbations to VHEE beams from lateral scatter and backscatter. However, when performing clinical planning on a prostate case, the use of multiple beams and inverse planning still produces VHEE plans that are dosimetrically superior to photon VMAT plans. BW Loo and P Maxim received research support from RaySearch laboratories; B Hardemark and E Hynning are employees of RaySearch.

  1. SU-E-T-274: Radiation Therapy with Very High-Energy Electron (VHEE) Beams in the Presence of Metal Implants

    International Nuclear Information System (INIS)

    Jensen, C; Palma, B; Qu, B; Maxim, P; Loo, B; Bazalova, M; Hardemark, B; Hynning, E

    2014-01-01

    Purpose: To evaluate the effect of metal implants on treatment plans for radiation therapy with very high-energy electron (VHEE) beams. Methods: The DOSXYZnrc/BEAMnrc Monte Carlo (MC) codes were used to simulate 50–150MeV VHEE beam dose deposition and its effects on steel and titanium (Ti) heterogeneities in a water phantom. Heterogeneities of thicknesses ranging from 0.5cm to 2cm were placed at 10cm depth. MC was also used to calculate electron and photon spectra generated by the VHEE beams' interaction with metal heterogeneities. The original VMAT patient dose calculation was planned in Eclipse. Patient dose calculations with MC-generated beamlets were planned using a Matlab GUI and research version of RayStation. VHEE MC treatment planning was performed on water-only geometry and water with segmented prostheses (steel and Ti) geometries with 100MeV and 150MeV beams. Results: 100MeV PDD 5cm behind steel/Ti heterogeneity was 51% less than in the water-only phantom. For some cases, dose enhancement lateral to the borders of the phantom increased the dose by up to 22% in steel and 18% in Ti heterogeneities. The dose immediately behind steel heterogeneity decreased by an average of 6%, although for 150MeV, the steel heterogeneity created a 23% increase in dose directly behind it. The average dose immediately behind Ti heterogeneities increased 10%. The prostate VHEE plans resulted in mean dose decrease to the bowel (20%), bladder (7%), and the urethra (5%) compared to the 15MV VMAT plan. The average dose to the body with prosthetic implants was 5% higher than to the body without implants. Conclusion: Based on MC simulations, metallic implants introduce dose perturbations to VHEE beams from lateral scatter and backscatter. However, when performing clinical planning on a prostate case, the use of multiple beams and inverse planning still produces VHEE plans that are dosimetrically superior to photon VMAT plans. BW Loo and P Maxim received research support from RaySearch laboratories; B Hardemark and E Hynning are employees of RaySearch

  2. 17 CFR 274.303 - Form N-27I-2, notice of withdrawal right and statement of charges for variable life insurance...

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form N-27I-2, notice of withdrawal right and statement of charges for variable life insurance contractholders required pursuant to... variable life insurance contractholders required pursuant to Rule 6e-2 (§ 270.6e-2 of this chapter). [41 FR...

  3. Battling memory requirements of array programming through streaming

    DEFF Research Database (Denmark)

    Kristensen, Mads Ruben Burgdorff; Avery, James Emil; Blum, Troels

    2016-01-01

    A barrier to efficient array programming, for example in Python/NumPy, is that algorithms written as pure array operations completely without loops, while most efficient on small input, can lead to explosions in memory use. The present paper presents a solution to this problem using array streaming......, implemented in the automatic parallelization high-performance framework Bohrium. This makes it possible to use array programming in Python/NumPy code directly, even when the apparent memory requirement exceeds the machine capacity, since the automatic streaming eliminates the temporary memory overhead...... streaming, yielding corresponding improvements in speed and utilization of GPGPU-cores. The streaming-enabled Bohrium effortlessly runs programs on input sizes much beyond sizes that crash on pure NumPy due to exhausting system memory....

  4. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    International Nuclear Information System (INIS)

    Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A.

    2000-01-01

    Although originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element 107 Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided

  5. 28 CFR 68.53 - Review of an interlocutory order of an Administrative Law Judge in cases arising under section...

    Science.gov (United States)

    2010-07-01

    ... Administrative Law Judge in cases arising under section 274A or 274C. 68.53 Section 68.53 Judicial Administration... ADMINISTRATIVE LAW JUDGES IN CASES INVOLVING ALLEGATIONS OF UNLAWFUL EMPLOYMENT OF ALIENS, UNFAIR IMMIGRATION... Administrative Law Judge in cases arising under section 274A or 274C. (a) Authority. In a case arising under...

  6. 28 CFR 68.54 - Administrative review of a final order of an Administrative Law Judge in cases arising under...

    Science.gov (United States)

    2010-07-01

    ... an Administrative Law Judge in cases arising under section 274A or 274C. 68.54 Section 68.54 Judicial... BEFORE ADMINISTRATIVE LAW JUDGES IN CASES INVOLVING ALLEGATIONS OF UNLAWFUL EMPLOYMENT OF ALIENS, UNFAIR... an Administrative Law Judge in cases arising under section 274A or 274C. (a) Authority of the Chief...

  7. ORF Alignment: NC_003869 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ENLINVYRKIGYKAVGTSAVTGEGMEELKSYLKDKISFFAGPSGVGKSSLINLIQSNIRL 180 ... Query: 245 NCRFNSCLHVNEPDCAVTEAVDEGIIDRQRY...ISY 278 ... NCRFNSCLHVNEPDCAVTEAVDEGIIDRQRYISY Sbjct: 241 NCRFNSCLHVNEPDCAVTEAVDEGIIDRQRYISY 274

  8. A High Performance Backend for Array-Oriented Programming on Next-Generation Processing Units

    DEFF Research Database (Denmark)

    Lund, Simon Andreas Frimann

    are analyzed and experimentally tested. Resulting in the design and implementation of Bohrium a runtime-system for transforming, scheduling and executing array-oriented programs. Multiple interfaces for existing languages such as Python, C++, C#, and F# have been built which utilize the backend. A suite...... and the efficient execution of them on high performance systems. This work investigates the requirements for, and the implementation of, a high performance backend supporting these goals. This involves an outline of the hardware available today, in the near future and how to program it for high performance....... The main challenge is to bridge the gaps between performance, productivity and portability. A declarative high-level array-oriented programming model is explored to achieve this goal and a backend implemented to support it. Different strategies to the backend design and application of optimizations...

  9. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    Energy Technology Data Exchange (ETDEWEB)

    Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A. [eds.

    2000-07-01

    lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.

  10. What Is Vascular Disease?

    Science.gov (United States)

    ... info@vascularcures.org 274 Redwood Shores Parkway, #717 Redwood City, CA 94065 Sign up for our newsletter Email ... are tax deductible. 274 Redwood Shores Parkway, #717, Redwood City, CA 94065 | info@vascularcures.org | 650.368.6022 ...

  11. Critical Limb Ischemia (CLI)

    Science.gov (United States)

    ... info@vascularcures.org 274 Redwood Shores Parkway, #717 Redwood City, CA 94065 Sign up for our newsletter Email ... are tax deductible. 274 Redwood Shores Parkway, #717, Redwood City, CA 94065 | info@vascularcures.org | 650.368.6022 ...

  12. ORF Alignment: NC_006814 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available EREEAFDKVASQLV Sbjct: 1 ... LPASLISNRYVSDLKPYIGKTMKLKITEIDPNKNRLILSHKDLVEEEREEAFDKVASQLV 60 ... Query: 257 DRHRIS...LSIKQTEPSPFE 274 ... DRHRISLSIKQTEPSPFE Sbjct: 121 DRHRISLSIKQTEPSPFE 138

  13. ORF Alignment: NC_002944 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Sbjct: 121 DMIDVNLNGAWITARVAIPHIMAGKRGGSIVFTSSIGGLRGAENIGNYIASKHGLHGLMR 180 ... Query: 247 YVEPADISNAILFLVSDDA...RYITGVALPVDGGAL 280 ... YVEPADISNAILFLVSDDARYITGVALPVDGGAL Sbjct: 241 YVEPADISNAILFLVSDDARYITGVALPVDGGAL 274

  14. Bajpai, Prof. Sunil

    Indian Academy of Sciences (India)

    ... Paleontology, Biostratigraphy and Paleobiogeography Address: Director, Birbal Sahni Institute of Palaeobotany, 53, University Road, Lucknow 226 007, U.P.. Contact: Office: (0522) 274 0470, (0522) 274 0439. Fax: (0522) 274 0485. Email: directorbsip@gmail.com, director@bsip.res.in. YouTube · Twitter · Facebook ...

  15. Adaptation of Impact Questions from an Existing Toolkit Provided Clear Assessment of Valued Service Elements and Desirable Service Improvements in a Primary Health Care Library and Information Service. A Review of: Urquhart, C., Thomas, R., Ovens, J., Lucking, W., & Villa, J. (2010. Planning changes to health library services on the basis of impact assessment. Health Information and Libraries Journal, 27(4, 277-285. doi: 10.1111/j.1471-1842.2010.00900.x

    Directory of Open Access Journals (Sweden)

    Kate Kelly

    2011-01-01

    Full Text Available Objective – To provide an action plan for the Knowledge, Resource and Information Service (KRIS based on an impact assessment of current services, satisfaction with current services, and views on desirable improvements to service and service delivery.Design – Questionnaire for KRIS service users and interviews with KRIS staff.Setting – Two locations served by KRIS in the north and south of Bristol City in the UK – one a health promotion service and one a National Health Service (NHS teaching hospital.Subjects – A convenience sample of a total of 244 users of the library services at the two locations, 121 users at the health promotion service site and 123 users at the hospital site.Methods – A questionnaire designed for a previous NHS library service impact study was adapted for use with staff other than health workers, since teachers and youth workers, for example, also used the health promotion service. The researchers circulated the questionnaire by mail and email to prospective respondents. The questionnaire asked participants to reflect on the most recent time they had used KRIS services and provide details on the purpose of use, what elements of the service they used, satisfaction with the service or the information provided, the immediate impact on their work, and its probable contribution to future work. It also asked about desirable improvements and how KRIS contributed to the respondents’ work and continuing professional development. The researchers interviewed KRIS staff face to face and asked for their views on the history of the service and future developments.Main Results – The overall response rate was 62.3% (152/244, with similar responses from each site. Community nurses and midwives were the largest group of respondents (n=31, 20.4%, followed by managers and administrators (n=24, 15.8%.Both sites reported health promotion activities as the dominant reason for use. Health promotion leaflets (n=94, 61.8% and resources for loan (n=57, 37.5% were the top two service elements used, with literature searching third (n=46, 30.3%.The service completely met the needs of 93% (n=141 of respondents, with 97.4% (n=148 reporting being wholly satisfied that information was delivered in time.In terms of the immediate cognitive impact of the information obtained, 93% (n=141 reported obtaining relevant information, 76% (n=115 current information, and 72% (n=109 accurate information. Nearly 70% were distributing information or resources to other people, and 68% were sharing or discussing information provided with colleagues. Nobody claimed that they had found little or nothing of value.Advice to patients, clients or carers was the most frequently cited impact category (n=104, 68%, followed by advice to colleagues (n=84, 55.3%.The main strengths of the service were the perceived reliability of the service, the current awareness and alerting service run from one site, and literature searching support for commissioning and public health enquiries. Respondents reported saving time, and the main cognitive impact was the perceived relevance of the information obtained. Service weaknesses identified related to accessibility issues such as parking, opening hours, and staff coverage, and outreach was identified as the main service development opportunity.Conclusion – The adaptation of an existing questionnaire provided a clear assessment of the effectiveness of a primary health care information service to a broad spectrum of users. Respondents identified what they valued about the service and how it could be improved.

  16. Rock Art Glossary: A Multilingual Dictionary, Expanded Second Edition (First Edition 2001. Edited by Robert G. Bednarik, Ahmed Achrati, Tang Huisheng, Alfred Muzzolini, George Dimitriadis, Dario Seglie, Fernando Coimbra, Yakov A. Sher and Mario Consens. Australian Rock Art Research Association, Inc., Melbourne, 2010; 274 Pages, in English, Arabic, Chinese, French, German, Greek, Italian, Portuguese, Russian and Spanish, with Translation Tables. Price $A 38.00, ISBN 978-0-646-53471-8

    Directory of Open Access Journals (Sweden)

    Shu-Kun Lin

    2013-02-01

    Full Text Available This is the first dictionary compiled specifically for rock art research. It follows the publication of an English rock art glossary in the journal Rock Art Research in November 2000. To be adopted by the International Federation of Rock Art Organisations (IFRAO, it has been translated by some of the world’s foremost scholars in the field into Arabic, Chinese, French, German, Greek, Italian, Portuguese, Spanish and Russian. In a discipline that has hitherto been without an agreed terminology, even communication within a single language has been difficult. The proliferation of idiosyncratic terminologies of often academically isolated researchers, many of which have been used by only one scholar, has not only retarded progress and the transference of knowledge, it has led to countless misunderstandings and even personal feuds. The purpose of this dictionary is to create a single terminological standard as well as a cross-lingual uniformity of usage. It focuses particularly on scientific aspects, technical applications and epistemological rigour. It does not set out to create a terminological straitjacket for the discipline, but a common standard of reference, particularly in areas that have in the past been susceptible to greatly differing interpretations. This dictionary comprises sections in ten languages, each listing the same terms alphabetically. It also contains a table interlinking all of these languages, listing all terms explained. This translation table is organised alphabetically according to the English terms. The volume is indispensable for scientific translators, rock art scholars, archaeologists and others concerned with aspects of pre-Historic rock art, and is also intended for the guidance of students and authors working in this field.

  17. Comparative Effect of an Addition of a Surface Term to Woods-Saxon Potential on Thermodynamics of a Nucleon

    Science.gov (United States)

    Lütfüoğlu, B. C.

    2018-01-01

    In this study, we reveal the difference between Woods-Saxon (WS) and Generalized Symmetric Woods-Saxon (GSWS) potentials in order to describe the physical properties of a nucleon, by means of solving Schrödinger equation for the two potentials. The additional term squeezes the WS potential well, which leads an upward shift in the spectrum, resulting in a more realistic picture. The resulting GSWS potential does not merely accommodate extra quasi bound states, but also has modified bound state spectrum. As an application, we apply the formalism to a real problem, an α particle confined in Bohrium-270 nucleus. The thermodynamic functions Helmholtz energy, entropy, internal energy, specific heat of the system are calculated and compared for both wells. The internal energy and the specific heat capacity increase as a result of upward shift in the spectrum. The shift of the Helmholtz free energy is a direct consequence of the shift of the spectrum. The entropy decreases because of a decrement in the number of available states. Supported by the Turkish Science and Research Council (TÜBİTAK) and Akdeniz University

  18. Chemistry of superheavy elements

    International Nuclear Information System (INIS)

    Schaedel, M.

    2012-01-01

    The chemistry of superheavy elements - or transactinides from their position in the Periodic Table - is summarized. After giving an overview over historical developments, nuclear aspects about synthesis of neutron-rich isotopes of these elements, produced in hot-fusion reactions, and their nuclear decay properties are briefly mentioned. Specific requirements to cope with the one-atom-at-a-time situation in automated chemical separations and recent developments in aqueous-phase and gas-phase chemistry are presented. Exciting, current developments, first applications, and future prospects of chemical separations behind physical recoil separators ('pre-separator') are discussed in detail. The status of our current knowledge about the chemistry of rutherfordium (Rf, element 104), dubnium (Db, element 105), seaborgium (Sg, element 106), bohrium (Bh, element 107), hassium (Hs, element 108), copernicium (Cn, element 112), and element 114 is discussed from an experimental point of view. Recent results are emphasized and compared with empirical extrapolations and with fully-relativistic theoretical calculations, especially also under the aspect of the architecture of the Periodic Table. (orig.)

  19. ORF Alignment: NC_005362 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available EREEAF+ VASQLV Sbjct: 1 ... LPASLISNRYVSDLKPYIGKTMKLKITEIDPNKNRLILSHKDLVEEEREEAFDKVASQLV 60 ... Query: 257 XRHRIS...LSIKQTLPSPFE 274 ... RHRISLSIKQT PSPFE Sbjct: 121 DRHRISLSIKQTEPSPFE 138

  20. Protein (Viridiplantae): 746637 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 218 ... 38832:274 ... 38833:414 ... 564608:414 predicted protein Micromonas pusilla CCMP1545 MAQLPSYEVDDGEDSMPGAPGEGPMTDSMQGPPVEVPTSDSM...PGAPGEVPTMDSMHGPPVEVPTMDSMHGAPVEVPMMDSMPGAPVEVPTMDSMQGPPVEVPTMDSMQGAPGEGPMTDSMHGAPGEGPTMDSMNSGNPTKCVVPDWCSTYPPEMQKSKPECQCPDDSHP

  1. 28 CFR 68.57 - Judicial review of the final agency order of an Administrative Law Judge in cases arising under...

    Science.gov (United States)

    2010-07-01

    ... of an Administrative Law Judge in cases arising under section 274B. 68.57 Section 68.57 Judicial... BEFORE ADMINISTRATIVE LAW JUDGES IN CASES INVOLVING ALLEGATIONS OF UNLAWFUL EMPLOYMENT OF ALIENS, UNFAIR... of an Administrative Law Judge in cases arising under section 274B. Any person aggrieved by a final...

  2. 29 CFR 1926.760 - Fall protection.

    Science.gov (United States)

    2010-07-01

    ..., safety net systems, personal fall arrest systems, positioning device systems or fall restraint systems... feet (27.4 m) wide and 90 (27.4 m) feet deep from any leading edge. The CDZ shall be marked by the use... protection equipment. (1) Guardrail systems, safety net systems, personal fall arrest systems, positioning...

  3. Evolution of the Pseudomonas aeruginosa mutational resistome in an international Cystic Fibrosis clone

    DEFF Research Database (Denmark)

    López-Causapé, Carla; Madsen Sommer, Lea Mette; Cabot, Gabriel

    2017-01-01

    ) and resistome of a widespread clone (CC274), in isolates from two highly-distant countries, Australia and Spain, covering an 18-year period. The coexistence of two divergent CC274 clonal lineages was revealed, but without evident geographical barrier; phylogenetic reconstructions and mutational resistome...

  4. Briefly on the GUHA Method of Data Mining

    Czech Academy of Sciences Publication Activity Database

    Hájek, Petr

    -, č. 3 (2003), s. 112-114 ISSN 1509-4553 R&D Projects: GA MŠk OC 274.001 Grant - others:COST(XE) Action 274 TARSKI Institutional research plan: AV0Z1030915 Keywords : GUHA method * data mining * exploratory data analuysis Subject RIV: BA - General Mathematics http://www.nit.eu/czasopisma/JTIT/2003/3/112.pdf

  5. Isotope effect in the Knight shift of potassium

    International Nuclear Information System (INIS)

    Sahm, W.; Schwenk, A.

    1975-01-01

    The Knight shifts of the potassium isotopes 39 K and 41 K were determined with high accuracy: Ksup((39)) = 0.274 35(10)% and Ksup((41)) = 0.274 93(12)%. The relative isotope effect ΔK/K = -0.210 (20)% is in agreement with the hyperfine structure anomaly 39 Δ 41 . (orig.) [de

  6. Short Term Prediction of Highway Travel Time using GUHA Data Mining Method

    Czech Academy of Sciences Publication Activity Database

    Coufal, David; Turunen, E.

    2004-01-01

    Roč. 14, - (2004), s. 221-231 ISSN 1210-0552 R&D Projects: GA MŠk OC 274.001 Grant - others:COST(XE) Action 274 TARSKI Institutional research plan: CEZ:AV0Z1030915 Keywords : data mining * many-valued logic Subject RIV: BA - General Mathematics

  7. Coordination cycles

    Czech Academy of Sciences Publication Activity Database

    Steiner, Jakub

    -, č. 274 (2005), s. 1-26 ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : coordination * crises * cycles and fluctuations Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp274.pdf

  8. EST Table: FS914277 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS914277 E_FL_fufe_31M22_F_0 10/09/28 37 %/274 aa ref|XP_969699.1| PREDICTED: similar to fuzzy.../274 aa gi|91081315|ref|XP_969699.1| PREDICTED: similar to fuzzy CG13396-PA [Tribolium castaneum] CK514734 fufe ...

  9. 77 FR 45480 - Deductions for Entertainment Use of Business Aircraft

    Science.gov (United States)

    2012-08-01

    ... expenses for entertainment travel from disallowance under section 274 when there is a business need to use... purposes. (3) Business entertainment air travel. Business entertainment air travel is any entertainment air... business. See Sec. 1.274-2(a)(1)(i) and (ii). Air travel is not business entertainment air travel merely...

  10. Properties of Group Five and Group Seven transactinium elements

    International Nuclear Information System (INIS)

    Wilk, Philip A.

    2001-01-01

    The detection and positive identification of the short-lived, low cross section isotopes used in the chemical studies of the heaviest elements are usually accomplished by measuring their alpha-decay, thus the nuclear properties of the heaviest elements must be examined simultaneously with their chemical properties. The isotopes 224 Pa and 266,267 Bh have been studied extensively as an integral part of the investigation of the heaviest members of the groups five and seven of the periodic table. The half-life of 224 Pa was determined to be 855 plus/minus19 ms by measuring its alpha-decay using our rotating wheel, solid state detector system at the Lawrence Berkeley National Laboratory 88-Inch Cyclotron. Protactinium was produced by bombardment of a bismuth target. New neutron rich isotopes, 267 Bh and 266 Bh, were produced in bombardments of a 249 Bk target and their decay was observed using the rotating wheel system. The 266 Bh that was produced decays with a half-life of approximately 1 s by emission of alpha particles with an average energy of 9.25 plus/minus 0.03 MeV. 267 Bh was observed to decay with a 17 s half-life by emission of alpha-particles with an average energy of 8.83 plus/minus 0.03 MeV. The chemical behavior of hafnium, Ha (element 105) was investigated using the fast on-line continuous liquid extraction and detection system SISAK-LISSY. Hafnium was not observed in this experiment following transport and extraction. Protactinium was used as on-line test of the apparatus to determine the experimental efficiency of the entire system. Unfortunately, the amount of protactinium observed after the extraction, compared to the amount produced, was extremely small, only 2.5%. The extraction of the protactinium isotope indicated the efficiency of the apparatus was too low to observe the extraction of hafnium. The chemical behavior of oxychloride compounds of bohrium was investigated by isothermal gas adsorption chromatography in a quartz column at 180, 150

  11. Properties of Group Five and Group Seven transactinium elements

    Energy Technology Data Exchange (ETDEWEB)

    Wilk, Philip A. [Univ. of California, Berkeley, CA (United States)

    2001-05-01

    The detection and positive identification of the short-lived, low cross section isotopes used in the chemical studies of the heaviest elements are usually accomplished by measuring their alpha-decay, thus the nuclear properties of the heaviest elements must be examined simultaneously with their chemical properties. The isotopes 224 Pa and 266,267 Bh have been studied extensively as an integral part of the investigation of the heaviest members of the groups five and seven of the periodic table. The half-life of 224 Pa was determined to be 855 ±19 ms by measuring its alpha-decay using our rotating wheel, solid state detector system at the Lawrence Berkeley National Laboratory 88-Inch Cyclotron. Protactinium was produced by bombardment of a bismuth target. New neutron rich isotopes, 267 Bh and 266 Bh, were produced in bombardments of a 249 Bk target and their decay was observed using the rotating wheel system. The 266 Bh that was produced decays with a half-life of approximately 1 s by emission of alpha particles with an average energy of 9.25 plus/minus 0.03 MeV. 267 Bh was observed to decay with a 17 s half-life by emission of alpha-particles with an average energy of 8.83 plus/minus 0.03 MeV. The chemical behavior of hafnium, Ha (element 105) was investigated using the fast on-line continuous liquid extraction and detection system SISAK-LISSY. Hafnium was not observed in this experiment following transport and extraction. Protactinium was used as on-line test of the apparatus to determine the experimental efficiency of the entire system. Unfortunately, the amount of protactinium observed after the extraction, compared to the amount produced, was extremely small, only 2.5%. The extraction of the protactinium isotope indicated the efficiency of the apparatus was too low to observe the extraction of hafnium. The chemical behavior of oxychloride compounds of bohrium was

  12. New elements - approaching Z=114

    Energy Technology Data Exchange (ETDEWEB)

    Hofmann, S.

    1998-03-01

    The search for new elements is part of the broader field of investigations of nuclei at the limits of stability. In two series of experiments at SHIP, six new elements (Z=107-112) were synthesized via fusion reactions using 1n-deexcitation channels and lead or bismuth targets. The isotopes were unambiguously identified by means of {alpha}-{alpha} correlations. Not fission, but alpha decay is the dominant decay mode. The collected decay data establish a means of comparison with theoretical data. This aids in the selection of appropriate models that describe the properties of known nuclei. Predictions based on these models are useful in the preparation of the next generation of experiments. Cross-sections decrease by two orders of magnitude from bohrium (Z=107) to element 112, for which a cross-section of 1 pb was measured. The development of intense beam currents and sensitive detection methods is essential for the production and identification of still heavier elements and new isotopes of already known elements, as well as the measurement of small {alpha}-, {beta}- and fission-branching ratios. An equally sensitive set-up is needed for the measurement of excitation functions at low cross-sections. Based on our results, it is likely that the production of isotopes of element 114 close to the island of spherical super heavy elements (SHE) could be achieved by fusion reactions using {sup 208}Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. (orig.)

  13. New elements - approaching Z=114

    International Nuclear Information System (INIS)

    Hofmann, S.

    1998-03-01

    The search for new elements is part of the broader field of investigations of nuclei at the limits of stability. In two series of experiments at SHIP, six new elements (Z=107-112) were synthesized via fusion reactions using 1n-deexcitation channels and lead or bismuth targets. The isotopes were unambiguously identified by means of α-α correlations. Not fission, but alpha decay is the dominant decay mode. The collected decay data establish a means of comparison with theoretical data. This aids in the selection of appropriate models that describe the properties of known nuclei. Predictions based on these models are useful in the preparation of the next generation of experiments. Cross-sections decrease by two orders of magnitude from bohrium (Z=107) to element 112, for which a cross-section of 1 pb was measured. The development of intense beam currents and sensitive detection methods is essential for the production and identification of still heavier elements and new isotopes of already known elements, as well as the measurement of small α-, β- and fission-branching ratios. An equally sensitive set-up is needed for the measurement of excitation functions at low cross-sections. Based on our results, it is likely that the production of isotopes of element 114 close to the island of spherical super heavy elements (SHE) could be achieved by fusion reactions using 208 Pb targets. Systematic studies of the reaction cross-sections indicate that the transfer of nucleons is an important process for the initiation of fusion. The data allow for the fixing of a narrow energy window for the production of SHE using 1n-emission channels. (orig.)

  14. Ecology, Inhibitory Activity, and Morphogenesis of a Marine Antagonistic Bacterium Belonging to the Roseobacter Clade

    DEFF Research Database (Denmark)

    Bruhn, Jesper Bartholin; Nielsen, Kristian Fog; Hjelm, Mette

    2005-01-01

    Roseobacter strain 27-4 has been isolated from a turbot larval rearing unit and is capable of reducing mortality in turbot egg yolk sac larvae. Here, we demonstrate that the supernatant of Roseobacter 27-4 is lethal to the larval pathogens Vibrio anguillarum and Vibrio splendidus in a buffer system...... compounds was sensitive to heat and was inactivated at 37{degrees}C in less than 2 days and at 25{degrees}C in 8 days. Using Roseobacter 27-4 as a probiotic culture will require that is be established in stagnant or adhered conditions and, due to the temperature sensitivity of the active compound, constant...

  15. 77 FR 45520 - Reimbursed Entertainment Expenses

    Science.gov (United States)

    2012-08-01

    ...) limitation to TLC as the drivers' common law employer subject to section 274(e)(3)(A). The Eighth Circuit.... The revenue ruling clarifies that a party's status as a common law employer is not relevant to the...

  16. South African Journal of Education - Vol 22, No 4 (2002)

    African Journals Online (AJOL)

    Analysing the role of ICT in bridging the digital divide amongst learners · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Marlien Herselman, K.G. Britton, 270-274 ...

  17. Worldwide frequency distribution of the 'Gait keeper' mutation in the DMRT3 gene

    Czech Academy of Sciences Publication Activity Database

    Promerová, M.; Andersson, L.S.; Juras, R.; Penedo, M.C.T.; Reissmann, M.; Tozaki, T.; Bellone, R.; Dunner, S.; Hořín, P.; Imsland, F.; Imsland, P.; Mikko, S.; Modrý, David; Roed, K.H.; Schwochow, D.; Vega-Pla, J.L.; Mehrabani-Yeganeh, H.; Yousefi-Mashouf, N.; Cothran, E.G.; Lindgren, G.; Andersson, L.

    2014-01-01

    Roč. 45, č. 2 (2014), s. 274-282 ISSN 0268-9146 Institutional support: RVO:60077344 Keywords : ambling * domestication * horse * locomotion * pace * running walk Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.207, year: 2014

  18. Response of Vegetation and Fish During an Experimental Drawdown in Three Pools, Upper Mississippi River

    National Research Council Canada - National Science Library

    Wlosinski, Joseph

    2000-01-01

    An experiment to improve ecological conditions while maintaining a 9-foot (2.74-m) navigation channel was continued in 1995 and 1996 on the three pools of the Upper Mississippi River managed by the St...

  19. Profesor Bohumil Ryba, mezi vědou a vězením

    Czech Academy of Sciences Publication Activity Database

    Dvořáčková, Věra

    -, č. 8 (2010), s. 227-274 ISSN 2336-1387 Institutional support: RVO:68378092 Keywords : Bohumil Ryba * linguistics * history * classical philology * political persecution * political trials Subject RIV: AI - Linguistics

  20. Obesity in Pregnancy in Southeast Nigeria

    African Journals Online (AJOL)

    EGOLUM

    2011-12-22

    Rao, AVN. Antihyperglycemic activity of Caralluma attenuata. Fitoterapia 2003; 74:274-9. 13. Vinuthan MK, Kumara G, Narayanaswamya. M and Veenab T. Lipid lowering effect of aqueous leaves extract of Murraya koenigii ...

  1. Fetal Alcohol Exposure

    Science.gov (United States)

    ... before and during pregnancy. Maternal and Child Health Journal . 13(2), 274–285, 2009. 13 Substance Abuse and Mental Health Services Administration, Results from the 2013 National Survey on Drug Use and Health: Summary of National Findings, NSDUH ...

  2. Význam kapra v rybničním hospodářství

    Czech Academy of Sciences Publication Activity Database

    Matěna, Josef; Flajšhans, Martin

    2013-01-01

    Roč. 61, č. 6 (2013), s. 272-274 ISSN 0044-4812 Institutional support: RVO:60077344 ; RVO:67985904 Keywords : Cyprinus carpio * fish production * pond ecosystem * Czech Republic Subject RIV: EH - Ecology, Behaviour

  3. The effect of aggregate type and mix design on the wet skid resistance of bituminous pavement : recommendations for Virginia's Wet Accident Reduction Program.

    Science.gov (United States)

    1995-01-01

    This report (1) identified and characterized Virginia's nonpolishing aggregates in terms of their wet skid resistance, (2) compared the standard ASTM E 274-90 skid test to the British Accelerated Polishing Machine (BAPM) and British PendulumTester (B...

  4. Asset stripping and firm survival in mass privatization: testing the Hoff-Stiglitz and Campos-Giovannoni models in Montenegro

    Czech Academy of Sciences Publication Activity Database

    Koman, M.; Lakićević, M.; Prašnikar, J.; Švejnar, Jan

    2015-01-01

    Roč. 43, č. 2 (2015), s. 274-289 ISSN 0147-5967 Institutional support: PRVOUK-P23 Keywords : asset stripping * mass privatization * firm survival Subject RIV: AH - Economics Impact factor: 1.380, year: 2015

  5. Incidence of PTLD in pediatric renal transplant recipients receiving basiliximab, calcineurin inhibitor, sirolimus and steroids

    NARCIS (Netherlands)

    McDonald, R. A.; Smith, J. M.; Ho, M.; Lindblad, R.; Ikle, D.; Grimm, P.; Wyatt, R.; Arar, M.; Liereman, D.; Bridges, N.; Harmon, W.

    Pediatric renal transplant recipients were enrolled in a multicenter, randomized, double-blind trial of steroid withdrawal. Subjects received basiliximab, calcineurin inhibitor, sirolimus and steroids. Of 274 subjects enrolled, 19 (6.9%) subjects developed posttransplant lymphoproliferative disorder

  6. The influence of intrinsic coagulation pathway on blood platelets activation by oxidized cellulose

    Czech Academy of Sciences Publication Activity Database

    Křížová, P.; Mášová, L.; Salaj, P.; Dyr, J. E.; Homola, Jiří; Pecka, M.

    82A, č. 2 (2007), s. 274-280 ISSN 1549-3296 Institutional research plan: CEZ:AV0Z20670512 Keywords : surface plasmon resonance * biosensors * cellular biophysics Subject RIV: BO - Biophysics Impact factor: 2.612, year: 2007

  7. Data of evolutionary structure change: 1PVDA-1ZPDE [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1PVDA-1ZPDE 1PVD 1ZPD A E SEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEV...HHHHH--HHHHH EEEEE HHHHHHHHHHHHHHH 0 1PVD... A 1PVDA KSFND-NSKIR ALA CA 225 SER CA 274 1PVD... A 1PVDA AKLLQTPID

  8. Perumal Paramasivan Thirumalai Ramachandiran Krishnan Girija ...

    Indian Academy of Sciences (India)

    16]hexadecane]-2'(7'),4', 6',8'-tetraene-2,5,13',15'-tetrone derivatives under solvent-free condition. Perumal Paramasivan Thirumalai Ramachandiran Krishnan Girija Emanathan Muralidharan Doraiswamy. Rapid Communications Volume 127 ...

  9. 10 CFR 8.4 - Interpretation by the General Counsel: AEC jurisdiction over nuclear facilities and materials...

    Science.gov (United States)

    2010-01-01

    ...); (2) The export and import of by-product, source or special nuclear material or production or... is clear from the legislative history of section 274 that control of “operation” of such facilities...

  10. A Theoretical Framework for Turnover Intention of Air Force Enlisted Information Systems Personnel

    Science.gov (United States)

    2003-03-25

    Burnout Measure,” Journal of Occupational and Organizational Psychology, 71: 331-351 (1998). 33. Festinger , Leon . “Informal Social Communication...group” (p. 482; italics in original). Bollen and Hoyle choose to view perceived cohesion from a Festinger -like viewpoint (1950:274) as an...Bollen and Hoyle choose to view perceived cohesion from a Festinger -like viewpoint (1950:274) as an independent construct, i.e., as the resultant of

  11. Analysis of Coniferous Forest Damage: Effects of Trichloroacetic Acid, Sulphur, Fluorine and Chlorine on Needle Loss of Norway Spruce

    Czech Academy of Sciences Publication Activity Database

    Coufal, David; Matucha, P.; Uhlířová, H.; Lomský, B.; Forczek, Sándor; Matucha, Miroslav

    2003-01-01

    Roč. 13, č. 1 (2003), s. 89-102 ISSN 1210-0552 R&D Projects: GA ČR GA522/99/1465; GA MŠk OC 274.001 Grant - others:COST(XE) Action 274 TARSKI Institutional research plan: AV0Z1030915 Keywords : forest decline * polyfactorial problem * monitoring * stress factors * dose/response-relationship Subject RIV: BA - General Mathematics

  12. Coat colour and chromosome variation in cetral European populations of the weasel (Mustela nivalis)

    Czech Academy of Sciences Publication Activity Database

    Zima, Jan; Cenevová, E.

    2002-01-01

    Roč. 51, č. 4 (2002), s. 265-274 ISSN 0139-7893 R&D Projects: GA AV ČR KSK6005114 Institutional research plan: CEZ:AV0Z6093917 Keywords : weasel * pelage coloration * karyotype Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.234, year: 2002 http://www.ivb.cz/folia/51/4/265-274.pdf

  13. Dorje Sherab's Illuminator, a Light of Gnosis

    DEFF Research Database (Denmark)

    Sobisch, Jan-Ulrich

    A faksimile print of a manuscript at the Musee Guimet, Paris, that was dated to 1267-1290. The true color reproduction is high quality, with a forword of 16 pages and 274 photographs.......A faksimile print of a manuscript at the Musee Guimet, Paris, that was dated to 1267-1290. The true color reproduction is high quality, with a forword of 16 pages and 274 photographs....

  14. Palynomorphs, paleoenvironment and sequence stratigraphy in the boreholes of Cenomanian and Lower Turonian age from the Bohemian Cretaceous Basin, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Svobodová, Marcela; Špičáková, Lenka; Uličný, David

    2008-01-01

    Roč. 2008, č. 2 (2008), s. 274-274 ISSN 0946-8978. [International Palynological Congress /12./ ; International Organisation of Palaeobotany Conference /8./. 30.08.2008-05.09.2008, Bonn] R&D Projects: GA ČR(CZ) GA205/06/1823 Institutional research plan: CEZ:AV0Z30130516; CEZ:AV0Z30120515 Keywords : palynology * sequence stratigraphy * lithology Subject RIV: DB - Geology ; Mineralogy

  15. Fast sex identification in wild mammals using PCR amplification of the Sry gene

    Czech Academy of Sciences Publication Activity Database

    Bryja, Josef; Konečný, A.

    2003-01-01

    Roč. 52, č. 3 (2003), s. 269-274 ISSN 0139-7893 R&D Projects: GA ČR GA524/01/1316; GA ČR GP206/02/P068 Institutional research plan: CEZ:AV0Z6093917 Keywords : sex identification * Sry gene * rodents Subject RIV: EG - Zoology Impact factor: 0.494, year: 2003 http://www.ivb.cz/folia/52/3/269-274.pdf

  16. Almost-Measurability Relation Induced by Lattice-Valued Partial Possibilistic Measures

    Czech Academy of Sciences Publication Activity Database

    Kramosil, Ivan

    2004-01-01

    Roč. 33, č. 6 (2004), s. 679-704 ISSN 0308-1079 R&D Projects: GA MŠk OC 274.001 Grant - others:COST(XE) Action 274 TARSKI Institutional research plan: CEZ:AV0Z1030915 Keywords : partially ordered set * complete lattice * partial lattice-valuied possibilistic measure * inner measure * outer measure * measurability in the Lebesgue sense * almost-measurability Subject RIV: BA - General Mathematics Impact factor: 0.509, year: 2004

  17. Rigor cross-bridge state in glycerinated rabbit psoas muscle investigated by X-ray diffraction

    Czech Academy of Sciences Publication Activity Database

    Griffiths, P. J.; Pelc, Radek; Funari, S.; Ashley, C. C.

    2008-01-01

    Roč. 29, 6-8 (2008), s. 274-274 ISSN 0142-4319. [European Muscle Conference of the European Society for Muscle Research /37./. 13.09.2008-16.09.2008, Oxford] R&D Projects: GA MŠk(CZ) LC06063 Grant - others:EC(XE) RII3-CT-2004-506008 Institutional research plan: CEZ:AV0Z50110509 Keywords : cpo1 * cross-bridge * synchrotron radiation * molecular motor Subject RIV: ED - Physiology

  18. Odd-Z Transactinide Compound Nucleus Reactions Including the Discovery of 260Bh

    Energy Technology Data Exchange (ETDEWEB)

    Nelson, Sarah L. [Univ. of California, Berkeley, CA (United States)

    2008-01-01

    Several reactions producing odd-Z transactinide compound nuclei were studiedwith the 88-Inch Cyclotron and the Berkeley Gas-Filled Separator at the Lawrence Berkeley National Laboratory. The goal was to produce the same compound nucleus ator near the same excitation energy with similar values of angular momentum via differentnuclear reactions. In doing so, it can be determined if there is a preference in entrancechannel, because under these experimental conditions the survival portion of Swiatecki, Siwek-Wilcznska, and Wilczynski's"Fusion By Diffusion" model is nearly identical forthe two reactions. Additionally, because the same compound nucleus is produced, theexit channel is the same. Four compound nuclei were examined in this study: 258Db, 262Bh, 266Mt, and 272Rg. These nuclei were produced by using very similar heavy-ion induced-fusion reactions which differ only by one proton in the projectile or target nucleus (e.g.: 50Ti + 209Bi vs. 51V + 208Pb). Peak 1n exit channel cross sections were determined for each reaction in each pair, and three of the four pairs' cross sections were identical within statistical uncertainties. This indicates there is not an obvious preference of entrancechannel in these paired reactions. Charge equilibration immediately prior to fusionleading to a decreased fusion barrier is the likely cause of this phenomenon. In addition to this systematic study, the lightest isotope of element 107, bohrium, was discovered in the 209Bi(52Cr,n) reaction. 260Bh was found to decay by emission of a 10.16 MeV alpha particle with a half-life of 35$+19\\atop{-9}$ ms. The cross section is 59 pb at an excitation energy of 15.0 MeV. The effect of the N = 152 shell is also seen in this isotope's alpha particle energy, the first evidence of such an effect in Bh. All reactions studied are also compared to model predictions by Swiatecki

  19. Antipeptide antibodies that can distinguish specific subunit polypeptides of glutamine synthetase from bean (Phaseolus vulgaris L.)

    Science.gov (United States)

    Cai, X.; Henry, R. L.; Takemoto, L. J.; Guikema, J. A.; Wong, P. P.; Spooner, B. S. (Principal Investigator)

    1992-01-01

    The amino acid sequences of the beta and gamma subunit polypeptides of glutamine synthetase from bean (Phaseolus vulgaris L.) root nodules are very similar. However, there are small regions within the sequences that are significantly different between the two polypeptides. The sequences between amino acids 2 and 9 and between 264 and 274 are examples. Three peptides (gamma 2-9, gamma 264-274, and beta 264-274) corresponding to these sequences were synthesized. Antibodies against these peptides were raised in rabbits and purified with corresponding peptide-Sepharose affinity chromatography. Western blot analysis of polyacrylamide gel electrophoresis of bean nodule proteins demonstrated that the anti-beta 264-274 antibodies reacted specifically with the beta polypeptide and the anti-gamma 264-274 and anti-gamma 2-9 antibodies reacted specifically with the gamma polypeptide of the native and denatured glutamine synthetase. These results showed the feasibility of using synthetic peptides in developing antibodies that are capable of distinguishing proteins with similar primary structures.

  20. [DIO2, TPO, CYP1A1 AND CYP1A2 gene polymorphism in women with thyroid disease].

    Science.gov (United States)

    Kochetova, O V; Gaynullina, M K; Viktorova, T V

    2014-01-01

    The analysis of polymorphisms of genes CYP1A1 (2454A > G,-3798T> C); CYP1A2 (-163C > A,-2467delT); TPO (2173A > C, 769G > T); DIO2 (274A > G) in women from the oil organic synthesis plant and the control group with thyroid disease (autoimmune thyroiditis and nodular goiter) has been performed. Molecular genetic markers of predisposition to the development of thyroid disease are: GG genotype and allele G gene DIO2 (274A > G), CT and CC genotypes of the gene CYP1A1 (-3798T > C), associated with the development of nodular goiter, and DD genotypes TD CYP1A2 gene (-2467delT), associated with the development of autoimmune thyroiditis. There was shown an association of polymorphic variants of the gene DIO2 (274A > G) with elevated levels of antibodies to TPO and TPO gene (2173A > C) with elevated levels of free T4.

  1. Algebraic Structures Related to the Combination of Belief Functions

    Czech Academy of Sciences Publication Activity Database

    Daniel, Milan

    2004-01-01

    Roč. 60, č. 2 (2004), s. 245-255 ISSN 1346-0862 R&D Projects: GA MŠk OC 274.001 Grant - others:COST(XE) Action 274 TARSKI Institutional research plan: CEZ:AV0Z1030915 Keywords : belief functions * Dempster-Shafer theory * combination of belief functions * Dempster's semigroup * uncertainty processing * decision making * expert systems Subject RIV: BA - General Mathematics http://www.jams.or.jp/ scm /contents/Vol-10-5/10-50.pdf

  2. Fuzzy Hypotheses Testing in the Framework of Fuzzy Logic

    Czech Academy of Sciences Publication Activity Database

    Holeňa, Martin

    2004-01-01

    Roč. 145, - (2004), s. 229-252 ISSN 0165-0114 R&D Projects: GA AV ČR IAA1030004; GA MŠk OC 274.001 Grant - others:COST(XE) Action 274 TARSKI Institutional research plan: CEZ:AV0Z1030915 Keywords : non-classical logics * fuzzy predicate calculus * basic fuzzy logic * generalized quantifiers * fuzzy statistics and data analysis * vague hypotheses * vague significance level * method Guha Subject RIV: BB - Applied Statistics , Operational Research Impact factor: 0.734, year: 2004

  3. Complete mitochondrial genome of the Easten hulafish, Trachinops taeniatus (Perciformes: Plesiopidae).

    Science.gov (United States)

    Xia, Rong; Fu, Cuizhang

    2015-01-01

    The first complete mitochondrial genome (mitogenome) of Plesiopidae (Teleostei: Perciformes) was determined using the Eastern hulafish Trachinops taeniatus as a representative species of the family. The mitogenome was 16,821 bp in length, including 13 typical vertebrate protein-coding genes, 22 transfer RNA genes, 2 ribosomal RNA genes and 1 control region. The gene arrangement was similar to other fishes except for the reversal position of tRNA(Ala) and tRNA(Asn). The overall base composition was 27.4% for A, 27.5% for C, 27.4% for T and 17.7% for G. This mitogenome should contribute to resolving phylogenetic position of Plesiopidae.

  4. La statistique industrielle de 1861 à 1896

    OpenAIRE

    2011-01-01

       Titre Niveau Documentation Fichier 1 Fichier 2 Statistique industrielle, 1861-1865 Département DS274.pdf DS274.xls Statistique industrielle, 1861-1865 Département DS275.pdf DS275.xls Statistique industrielle, 1861-1865 Chef-Lieu DS276.pdf DS276.xls Statistique industrielle, 1873 Département DS277.pdf DS277.xls Statistique industrielle, 1873 Département DS278.pdf DS278.xls Statistique industrielle, 1896 Département DS301.pdf DS301_1.xls DS301_2.xls Statistique industrielle, 1896 Département...

  5. Is TIMP-1 immunoreactivity alone or in combination with other markers a predictor of benefit from anthracyclines in the BR9601 adjuvant breast cancer chemotherapy trial?

    DEFF Research Database (Denmark)

    Munro, Alison F.; Bartels, Annette; Balslev, Eva

    2013-01-01

    copy number can be used to predict benefit from epirubicin (E) containing chemotherapy compared with cyclophosphamide, methotrexate and fluorouracil (CMF) treatment. METHODS: For the purpose of this study, formalin fixed paraffin embedded tumor tissue from women recruited into the BR9601 clinical trial...... immunoreactive and HER2 negative) and anthracycline responsive (all other cases). RESULTS: In total, 288 tumors were available for TIMP-1 analysis with (183/274) 66.8%, and (181/274) 66.0% being classed as 2T and HT responsive, respectively. TIMP-1 was neither associated with patient prognosis (relapse free...

  6. The Serratia gene cluster encoding biosynthesis of the red antibiotic, prodigiosin, shows species- and strain-dependent genome context variation

    DEFF Research Database (Denmark)

    Harris, Abigail K P; Williamson, Neil R; Slater, Holly

    2004-01-01

    The prodigiosin biosynthesis gene cluster (pig cluster) from two strains of Serratia (S. marcescens ATCC 274 and Serratia sp. ATCC 39006) has been cloned, sequenced and expressed in heterologous hosts. Sequence analysis of the respective pig clusters revealed 14 ORFs in S. marcescens ATCC 274...... from Str. coelicolor A3(2) revealed some important differences. A modified scheme for the biosynthesis of prodigiosin, based on the pathway recently suggested for the synthesis of undecylprodigiosin, is proposed. The distribution of the pig cluster within several Serratia sp. isolates is demonstrated...

  7. An Evaluation of Compressed Work Schedules and Their Impact on Electricity Use

    Science.gov (United States)

    2010-03-01

    chillers cool water to 46 degrees Fahrenheit ; the water flows through coils in the air handlers. Thermostat settings in individual rooms dictate demand...will temporarily reduce the load; however, the increased energy necessary to return the water to 46 degrees Fahrenheit will offset some, if not all, of...290 361 431 285 331 447 273 303 438 21:30 290 353 424 289 358 424 280 330 451 274 301 428 22:00 290 352 417 289 356 422 280 329 439 274 300 425 22:30

  8. Shaping Air and Sea Power for the Asia Pivot: Military Planning to Support Limited Geopolitical Objectives

    Science.gov (United States)

    2013-01-01

    and After, 45–69. 10. Dilip Hiro , After Empire: The Birth of a Multipolar World (New York: Nation Books, 2010), 274–75; and Avery Goldstein, Rising to...2011), 94–98, 101–2. 13. Hiro , After Empire, 274–75; and Geis, “Harmonious Discordance,” 99–100. 14. The converse is true for the traditional Western...Col Blaine D. Holt and Col John P. Geis II, “Harmonious Society: Rise of the New Boxers,” in Discord or “Harmonious Society”? 40; see also Hiro

  9. Air & Space Power Journal. Volume 19, Number 3, Fall 2005

    Science.gov (United States)

    2005-09-01

    use of the Internet , audio- and videotapes released to the media by al-Qaeda leaders, or even through more creative means. However, as...2. Tom Clancy with Chuck Horner, Every Man a Tiger (New York: Putnam, 1999), 274–75. 3. Ibid., 274. 4. See Comodoro Rubén Oscar Moro, Historia ... del Conflicto del Atlántico Sur (La Guerra Inaudita II) (Buenos Aires, Argentina: Air War School, August 1997). 5. Ibid., 4. 6. See Comodoro José C

  10. Fuzzy Class Theory

    Czech Academy of Sciences Publication Activity Database

    Běhounek, Libor; Cintula, Petr

    2005-01-01

    Roč. 154, - (2005), s. 34-55 ISSN 0165-0114 R&D Projects: GA AV ČR IAA1030004; GA MŠk OC 274.001 Grant - others:COST(EU) Action 274 TARSKI Institutional research plan: CEZ:AV0Z10300504 Keywords : formal fuzzy logic * fuzzy set * foundations of fuzzy mathematics * LPi logic * higher-order fuzzy logic * fuzzy type theory * multi-sorted fuzzy logic Subject RIV: BA - General Mathematics Impact factor: 1.039, year: 2005

  11. Inferentializing Semantics

    Czech Academy of Sciences Publication Activity Database

    Peregrin, Jaroslav

    2010-01-01

    Roč. 39, č. 3 (2010), s. 255-274 ISSN 0022-3611 R&D Projects: GA ČR(CZ) GA401/07/0904 Institutional research plan: CEZ:AV0Z90090514 Keywords : inference * proof theory * model theory * inferentialism * semantics Subject RIV: AA - Philosophy ; Religion

  12. Methods applied for the characterization of Si:H thin films with embedded nanoparticles

    Czech Academy of Sciences Publication Activity Database

    Stuchlíková, The-Ha; Remeš, Zdeněk; Purkrt, Adam; Stuchlík, Jiří; Král, Karel

    2015-01-01

    Roč. 7, č. 4 (2015), s. 270-274 ISSN 2164-6627 R&D Projects: GA MŠk LH12236 Institutional support: RVO:68378271 Keywords : electrical conductivity * activation energy * CPM * SEM * I - V characteristics * nanoparticles Subject RIV: BM - Solid Matter Physics ; Magnetism

  13. Genetic diversity and molecular discrimination of wild tea plants from ...

    African Journals Online (AJOL)

    To efficiently assess and discriminate wild tea germplasms, inter-simple sequence repeats (ISSR) were used to determine genetic relationships among 40 wild tea plants. A total of 275 bands were generated with 15 ISSR primers, of which 274 (99.6%) were polymorphic. The mean genetic similarity coefficient, the mean ...

  14. Osteosarcoma to the left Heart

    African Journals Online (AJOL)

    Surgical treatment for transvenous tumor extension into the heart: four cases. J Vasc Surg (1998) 27(4): 740 – 744. 7. Daneman A, Martin DJ, Chan HSL. Cardiac metastasis from osteosarcoma. A report of two cases. JCAT (1983);7:41 – 43. 8. Petropoulakis PN,Steriotis JD,Melanidis JG, Metastatic malignant melanoma as ...

  15. Diffusion-controlled reactions modeling in Geant4-DNA

    Czech Academy of Sciences Publication Activity Database

    Karamitros, M.; Luan, S.; Bernal, M. A.; Allison, J.; Baldacchino, G.; Davídková, Marie; Francis, Z.; Friedland, W.; Ivanchenko, A.; Ivanchenko, V.; Mantero, A.; Nieminen, P.; Santin, G.; Tran, H. N.; Stepan, V.; Incerti, S.

    2014-01-01

    Roč. 274, OCT (2014), s. 841-882 ISSN 0021-9991 Institutional support: RVO:61389005 Keywords : chemical kinetics simulation * radiation chemistry * Fokker-Planck equation * Smoluchowski diffusion equation * Brownian bridge * dynamical time step s * k-d tree * radiolysis * radiobiology * Geant4-DNA * Brownian dynamics Subject RIV: BO - Biophysics Impact factor: 2.434, year: 2014

  16. EST Table: FS835826 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS835826 E_FL_fmgV_49K21_R_0 10/09/28 32 %/274 aa ref|XP_001868268.1| thymus-specif...ic serine protease [Culex quinquefasciatus] gb|EDS26459.1| thymus-specific serine protease [Culex quinquefas

  17. Revision of the Lauraceae III. The genera Aiouea, Systemonodaphne, Urbanodendron, Mezilaurus; additions and corrections to Licaria and Cryptocarya

    NARCIS (Netherlands)

    Kostermans, A.J.G.H.

    1938-01-01

    Aiouea Aublet, Hist. Guian. I (1775), p. 310; III, t. 120; Scopoli, Introductio Hist. nat. (Pragae 1777), p. 107, n. 277; Lamarck, Encyclop. méthod. I (1783), p. 72 (Ajúvea); Poiret, Encycl., Suppl. I (1890), p. 274, III (1893), p. 317; Illustrat. Genr. II, p. 395 et 367, t. 360; Jussieu, Genera

  18. Prostorová paměť, navigace a mozkové mapy.

    Czech Academy of Sciences Publication Activity Database

    Stuchlík, Aleš

    2017-01-01

    Roč. 96, č. 5 (2017), s. 274-276 ISSN 0042-4544 R&D Projects: GA ČR(CZ) GA17-04047S; GA ČR NV17-30833A Institutional support: RVO:67985823 Keywords : memory * behavior * orientation Subject RIV: FH - Neurology OBOR OECD: Neurosciences (including psychophysiology

  19. Perception on Adoption and Application of Web 2.0 Technologies in ...

    African Journals Online (AJOL)

    wemafr

    .000] between awareness and use of Web 2.0 technologies in non-library operations and an insignificant negative correlation ... "Unprecedented developments in the field of information and Communication Technology and the rapid advancements in ...... experiences at Tallinn. University, Estonia", Program, 42, (3), 262 - 274.

  20. Download this PDF file

    African Journals Online (AJOL)

    Department of Human Anatomy, Ahmadu Bello University, Zaria, Nigeria. Reprim requests in: Dr. S. S, Adebisi, Department of Human Anatomy, Altmadu Belle University, Zaria,. Nigeria. li-mail: sanzbisi®abueduJtg. ABSTRACT .... 1968; 274. Olson 1A. The origin of lateral cutaneous nerve of forearm and its implication for.

  1. Maternal and Obstetric Complications among HIV-infected Women ...

    African Journals Online (AJOL)

    2018-01-24

    Jan 24, 2018 ... compared to HIV‑negative women, women receiving HAART prepregnancy remained at risk of infectious morbidity, .... and hypertensive disorders of pregnancy (HDP) (38.4 compared to 17.2 and 27.4 compared ... including full blood count, syphilis serology, and HIV test with CD4 counts where applicable.

  2. Observation of two-photon absorption at UV radiation in ZnS ...

    Indian Academy of Sciences (India)

    2014-02-12

    Feb 12, 2014 ... Normalized transmittance curves for OA Z-scan at 355 nm incident laser radiations for ZnS QDs sample at 27.4 GW/cm2 peak intensity. Symbols are exper- imental points. The solid curve is the theoretically fitted one with 2PA processes in thick media. Left inset shows UV–visible absorption characteristics ...

  3. 75 FR 33445 - U.S. Citizenship and Immigration Services Fee Schedule

    Science.gov (United States)

    2010-06-11

    ... Part IV Department of Homeland Security 8 CFR Parts 103, 204, 244, et al. U.S. Citizenship and..., and 274A [CIS No. 2490-09; DHS Docket No. USCIS-2009-0033] RIN 1615-AB80 U.S. Citizenship and Immigration Services Fee Schedule AGENCY: U.S. Citizenship and Immigration Services, DHS. ACTION: Proposed...

  4. Gould's belt and beyond, comparing models with observations

    Czech Academy of Sciences Publication Activity Database

    Palouš, Jan

    2001-01-01

    Roč. 276, - (2001), s. 359-365 ISSN 0004-640X R&D Projects: GA AV ČR KSK1003601 Institutional research plan: CEZ:AV0Z1003909 Keywords : stars * formation * kinematics * galaxy Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 0.274, year: 2001

  5. A controlled monitoring study of simulated clandestine graves using 3D ground penetrating radar

    CSIR Research Space (South Africa)

    van Schoor, Michael

    2017-06-01

    Full Text Available Surface Geophysics, vol. 15(3): 274-284 A controlled monitoring study of simulated clandestine graves using 3D ground penetrating radar Van Schoor M Nienaber WC Marais-Werner A ABSTRACT: A controlled three-dimensional ground penetrating...

  6. Spin phase-space semiclassics for weak spin-orbit coupling

    International Nuclear Information System (INIS)

    Zaitsev, Oleg

    2002-01-01

    We apply the semiclassical spin coherent state method for the density of states by Pletyukhov et al (2002 Phys. Rev. Lett. 89 116601) in the weak spin-orbit coupling limit and recover the modulation factor in the semiclassical trace formula found by Bolte and Keppeler (1998 Phys. Rev. Lett. 81 1987; 1999 Ann. Phys., NY 274 125). (letter to the editor)

  7. Genetic variation in three Chersina angulata ( angulate tortoise ...

    African Journals Online (AJOL)

    We investigated genetic variation within and among three populations of Chersina angulata; two in the southwestern Cape (West Coast National Park and Dassen Island) of South Africa and Kleinzee in the northwestern parts of the species' range. Mitochondrial DNA sequences (274 base pairs) of the cytochrome b gene of ...

  8. Review of invasive grapevine aphid, Aphis illinoisensis Shimer, and native parasitoids in the Mediterranean (Hemiptera, Aphididae; Hymenoptera, Braconidae, Aphidiinae)

    Czech Academy of Sciences Publication Activity Database

    Havelka, Jan; Shukshuk, A. H.; Ghaliow, M. E.; Laamari, M.; Kavallieratos, N. G.; Tomanović, Ž.; Rakhshani, E.; Pons, X.; Starý, Petr

    2011-01-01

    Roč. 63, č. 1 (2011), s. 269-274 ISSN 0354-4664 Grant - others:Ministry of Science and Technological Development of the Republic of Serbia(CS) 43001 Institutional research plan: CEZ:AV0Z50070508 Keywords : invasions * Aphis illinoisensis * grapevine Subject RIV: EH - Ecology, Behaviour Impact factor: 0.360, year: 2011

  9. ELT Research in Turkey: A Content Analysis of Selected Features of Published Articles

    Science.gov (United States)

    Yagiz, Oktay; Aydin, Burcu; Akdemir, Ahmet Selçuk

    2016-01-01

    This study reviews a selected sample of 274 research articles on ELT, published between 2005 and 2015 in Turkish contexts. In the study, 15 journals in ULAKBIM database and articles from national and international journals accessed according to convenience sampling method were surveyed and relevant articles were obtained. A content analysis was…

  10. Chalcones as novel influenza A (H1N1) neuraminidase inhibitors from Glycyrrhiza inflata

    DEFF Research Database (Denmark)

    Dao, Trong Tuan; Nguyen, Phi Hung; Lee, Hong Sik

    2011-01-01

    -8) chalcones were isolated as active principles from the acetone extract of Glycyrrhiza inflata. Compounds 3 and 6 without prenyl group showed strong inhibitory effects on various neuraminidases from influenza viral strains, H1N1, H9N2, novel H1N1 (WT), and oseltamivir-resistant novel H1N1 (H274Y) expressed...

  11. Antimicrobial, Anthelmintic Activities and Characterisation of Functional Phenolic Acids of Achyranthes aspera Linn.: A Medicinal Plant Used for the Treatment of Wounds and Ringworm in East Africa

    Czech Academy of Sciences Publication Activity Database

    Ndhlala, A.R.; Ghebrehiwot, H.M.; Ncube, B.; Aremu, A.O.; Grúz, Jiří; Šubrtová, Michaela; Doležal, Karel; du Plooy, C.P.; Abdelgadir, H.A.; van Staden, J.

    2015-01-01

    Roč. 6, NOV 23 (2015), s. 274 ISSN 1663-9812 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : Amaranthaceae * chlorogenic acid * genistein Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.418, year: 2015

  12. Genotype variation in grain yield response to basal N fertilizer ...

    African Journals Online (AJOL)

    user

    2012-07-24

    Jul 24, 2012 ... pollution. During the past decades, many investigations have been reported, related to nitrogen efficiency of different plant genotypes (Zhang et al., 1997; .... 274. 411. 548. Gr ai n yi el d wi t hout basal grain yield with basal fertilizer (g/8 plants). I. Ⅱ. (a). -20. -10. 0. 10. 20. -1. 99. 199. Rice variety number. A.

  13. Audiobook Format: A Patron's Choice.

    Science.gov (United States)

    Connors, Kelly C.

    This study examines patron preference for abridged versus unabridged audiobooks, looking at patron usage over time and noting any changes in preference and why they occurred. A survey was conducted at the four branches of the Geauga County Public Library System (Geauga County, Ohio) with a random sample of adult patrons. Of the 274 surveys…

  14. Overweight and obesity among elderly Nigerians | Ochayi | Highland ...

    African Journals Online (AJOL)

    Introduction: A growing health problem, obesity exacerbates decline in physical function. We determined the prevalence of overweight and obesity and associated risk factors among an elderly Nigerian population. Methods: We screened a stratified, random community sample of 274 persons aged 65 years and older for ...

  15. The effects of costless pre-play communication: experimental evidence from games with Pareto-ranked equilibria

    Czech Academy of Sciences Publication Activity Database

    Blume, A.; Ortmann, Andreas

    2007-01-01

    Roč. 132, č. 1 (2007), s. 274-290 ISSN 0022-0531 Institutional research plan: CEZ:MSM0021620846 Keywords : coordination games * order-statistic games * cheap talk Subject RIV: AH - Economics Impact factor: 1.353, year: 2007

  16. A comparison of the intensity contours of fringes due to multiple ...

    Indian Academy of Sciences (India)

    physics pp. 269–274. A comparison of the intensity contours of fringes due to multiple reflection and spatial hole burning in semiclassical theory of laser. RITA MONI BORAH and G D BARUAH. Department of Physics, Dibrugarh University, Dibrugarh 786 004, India. MS received 13 July 1999; revised 24 November 1999.

  17. Geoinformatics for assessing the morphometric control on ...

    Indian Academy of Sciences (India)

    Dury G H (New York: Elsevier. Publishing Co.), pp. 235–274. Coates L 1999 Flood fatalities in Australia, 1788–1996; Aust. Geogr. 30(3) 391–408. Day P R 1965 Particle fractionation and particle-size anal- ysis; In: Methods of soil analysis, Part 1 (ed.) Black C A. (Madison, Wisconsin: American Society of Agronomy,. Inc.), pp.

  18. Perennial legumes on dry lands in the western Highveld region ...

    African Journals Online (AJOL)

    There exists a great need for perennial pasture legumes which are adapted to dryland production in the western Highveld. ... Averaged over two years, three selections yielded more than two tonnes dry material per ha: namely, Desmodium uncinatum 2,78, Medicago sativa 2,74 and Macroptilium atropurpureum 2,10.

  19. 28 CFR 68.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... BEFORE ADMINISTRATIVE LAW JUDGES IN CASES INVOLVING ALLEGATIONS OF UNLAWFUL EMPLOYMENT OF ALIENS, UNFAIR... law by an Administrative Law Judge or the Chief Administrative Hearing Officer; Document fraud cases...; Final agency order is an Administrative Law Judge's final order, in cases arising under sections 274A...

  20. Fathering and Attachment in the USA and Taiwan: Contextual Predictors and Child Outcomes

    Science.gov (United States)

    Newland, Lisa A.; Coyl, Diana D.; Chen, Hui-Hua

    2010-01-01

    This study examined connections between fathering context (stress, social support, and fathers' internal working models), fathering dimensions, children's attachment to fathers, and children's social-emotional and academic outcomes within two culturally diverse samples in the USA and Taiwan. Participants included 274 fathers and their eight- to…

  1. Reduction of ploidy level by androgenesis in intergeneric Lolium-Festuca hybrids for turf grass breeding

    Czech Academy of Sciences Publication Activity Database

    Kopecký, David; Lukaszewski, A.J.; Gibeault, V.

    2005-01-01

    Roč. 45, č. 1 (2005), s. 274-281 ISSN 0011-183X Institutional research plan: CEZ:AV0Z50380511 Keywords : anther culture * pentaploid hybrids * perenne L. Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.925, year: 2005

  2. On the pumping effect in a pipe/tank flow configuration with friction

    Czech Academy of Sciences Publication Activity Database

    Cid, J.A.; Propst, G.; Tvrdý, Milan

    273-274, April (2014), s. 28-33 ISSN 0167-2789 R&D Projects: GA ČR(CZ) GA14-06958S Institutional support: RVO:67985840 Keywords : valveless pumping * singular problem * periodic solution Subject RIV: BA - General Mathematics Impact factor: 1.636, year: 2014 http://www.sciencedirect.com/science/article/pii/S0167278914000190

  3. A Review of Breast Calcifications on Mammography in a Tertiary ...

    African Journals Online (AJOL)

    Biopsies were performed where indicated and histology results were compared with radiological findings. Data was analyzed using the Epi-info statistical software. Results Out of the 248 patients assessed, the predominant presenting symptoms were breast pain (30.2%) and breast lump (27.4%). While assessing the ...

  4. Latino Adolescents' Mental Health: Exploring the Interrelations among Discrimination, Ethnic Identity, Cultural Orientation, Self-Esteem, and Depressive Symptoms

    Science.gov (United States)

    Umana-Taylor, Adriana J.; Updegraff, Kimberly A.

    2007-01-01

    Guided by a risk and resilience framework, the current study used cross-sectional data to examine the degree to which Latino adolescents' (N=274; M age=16.3; 47.1% female) self-esteem, ethnic identity, and cultural orientations mediated or moderated the relation between perceived discrimination and depressive symptoms. Utilizing a multiple group…

  5. Associations between pathogen-specific clinical mastitis and somatic cell count patterns

    NARCIS (Netherlands)

    Haas, de Y.; Veerkamp, R.F.; Barkema, H.W.; Gröhn, Y.T.; Schukken, Y.H.

    2004-01-01

    Associations were estimated between pathogen-specific cases of clinical mastitis (CM) and somatic cell count (SCC) patterns based on deviations from the typical curve for SCC during lactation and compared with associations between pathogen-specific CM and lactation average SCC. Data from 274 Dutch

  6. Radial redistribution of gas connected to a distant galaxy versus galaxy encounter

    Czech Academy of Sciences Publication Activity Database

    Palouš, Jan; Jungwiert, Bruno; Jáchym, Pavel; Růžička, Adam

    2001-01-01

    Roč. 277, - (2001), s. 489 ISSN 0004-640X R&D Projects: GA AV ČR KSK1003601; GA AV ČR IAA3003705 Institutional research plan: CEZ:AV0Z1003909 Keywords : N-body codes * kinematics and dynamics ISM * galaxies * interactions Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 0.274, year: 2001

  7. Nonlinear ultrasonic spectroscopy and acoustic emission in SHM of aircrafts

    Czech Academy of Sciences Publication Activity Database

    Převorovský, Zdeněk; Chlada, Milan; Krofta, Josef

    2012-01-01

    Roč. 2012, SI (2012), s. 36-40 ISSN 1213-3825 R&D Projects: GA MPO(CZ) FR-TI1/274 Institutional support: RVO:61388998 Keywords : NDT * structural health monitoring * acoustic emission * nonlinear elastic wave spectroscopy * time reversal mirrors Subject RIV: BI - Acoustics

  8. Indicators of functional differentiation of the chick embryonic kidney

    Czech Academy of Sciences Publication Activity Database

    Zemanová, Zdeňka; Ujec, Evžen; Jirsová, Z.; Maňáková, E.

    2002-01-01

    Roč. 131, č. 4 (2002), s. 847-860 ISSN 1095-6433 R&D Projects: GA ČR GA304/98/0604 Institutional research plan: CEZ:AV0Z5011922 Keywords : Chick embryo * Mesonephros * Glomerular filtration Subject RIV: ED - Physiology Impact factor: 1.274, year: 2002

  9. Journal of Agriculture and Social Research (JASR) Vol. 16, No. 2 ...

    African Journals Online (AJOL)

    user

    respondents were involved in problem identification and research planning activities. Mean of 2.74, 2.68 ... Cassava is one of the major food crops grown in Nigeria with annual production output of 45 million metric tons .... (54.84%) of respondents have their master degree (M.Sc) whereas many 35.48% have their. Ph.D. the ...

  10. The influence of prior knowledge on the retrieval-directed function of note taking in prior knowledge activation

    NARCIS (Netherlands)

    Wetzels, Sandra; Kester, Liesbeth; Van Merriënboer, Jeroen; Broers, Nick

    2010-01-01

    Wetzels, S. A. J., Kester, L., Van Merriënboer, J. J. G., & Broers, N. J. (2011). The influence of prior knowledge on the retrieval-directed function of note taking in prior knowledge activation. British Journal of Educational Psychology, 81(2), 274-291. doi: 10.1348/000709910X517425

  11. Ca2plus responses to thyrotropin-releasing hormone and angiotensin II: the role of plasma membrane integrity and effect of G11 protein overexpression on homologous and heterologous desensitization

    Czech Academy of Sciences Publication Activity Database

    Ostašov, Pavel; Krůšek, Jan; Durchánková, Dana; Svoboda, Petr; Novotný, Jiří

    2008-01-01

    Roč. 26, č. 2 (2008), s. 264-274 ISSN 0263-6484 R&D Projects: GA MŠk(CZ) LC554; GA ČR(CZ) GA309/06/0121 Institutional research plan: CEZ:AV0Z50110509 Keywords : calcium response * cholesterol depletion * desensitization Subject RIV: CE - Biochemistry Impact factor: 1.333, year: 2008

  12. Deformation and strain distribution in plasma sprayed nickel-aluminum coating loaded by a spherical indenter

    Czech Academy of Sciences Publication Activity Database

    Prchlík, L.; Písačka, Jan; Sampath, S.

    2003-01-01

    Roč. 360, 1-2 (2003), s. 264-274 ISSN 0921-5093 R&D Projects: GA AV ČR KSK1010104 Keywords : indentation, stress-strain relationship, plasma spray Subject RIV: JJ - Other Materials Impact factor: 1.365, year: 2003

  13. Attacks by “Anonymous‿ WikiLeaks Proponents not Anonymous

    NARCIS (Netherlands)

    Pras, Aiko; Sperotto, Anna; Moreira Moura, Giovane; Drago, Idilio; Barbosa, R.R.R.; Sadre, R.; de Oliveira Schmidt, R.; Hofstede, R.J.; Hofstede, Rick

    2010-01-01

    On November 28, 2010, the world started watching the whistle blower website WikiLeaks to begin publishing part of the 250,000 US Embassy Diplomatic cables. These confidential cables provide an insight on U.S. international affairs from 274 different embassies, covering topics such as analysis of

  14. Magnetic properties of ball-milled TbFe2 and TbFe2B

    Indian Academy of Sciences (India)

    Unknown

    Saitovitch E 1998 J. Alloys and Compounds 274. 23. Lee S J, Lange R J, Canfield P C, Harmon B N and Lynch D W. 2000 Phys. Rev. B61 9669. Modder I W, Bakker H and Zhou G F 1999 Physica B262 141. Ren W J, Zhang Z D, Markosyan A S, ...

  15. Professionalism Among Criminal Justice Educators.

    Science.gov (United States)

    Regoli, Robert M.; Miracle, Andrew W., Jr.

    Professionalism and its relationship to scholarly productivity was studied. Specific areas of analysis were the degree of professionalism of criminal justice educators, rankings of a series of selected publications, and the relationship between professionalism level and journal productivity. Data were derived from responses by 1,028 of 1,274

  16. Jairajpuri, Prof. Mohammad Shamim

    Indian Academy of Sciences (India)

    Ph.D. and D.Sc. (Aligarh), D.Litt. (h.c.), FNA, FNASc, FNAAS, F.I.Biol. (London), FTWAS. Date of birth: 8 April 1942. Specialization: Plant Protection, Nematology, Biological Control, Parasitology and Biological Diversity Address: Flat No. 104, I Floor, Block B, 274, Aslam Manzil, Jamia Magar (Okhla), New Delhi 110 025, U.T.

  17. 77 FR 30998 - Information Collection Requirement; Defense Federal Acquisition Regulation Supplement; Government...

    Science.gov (United States)

    2012-05-24

    ..., Government Property, DFARS section 211.274, Reporting of Government-Furnished Equipment in the DoD Item... surplus Government property. Under paragraph (b), a contractor may be directed by the plant clearance... plant clearance officer to purchase or retain Government property at less than cost if the plant...

  18. Quarter Dates Location(s) Purpose Transportation and Travel ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC CRDI

    Dates. Location(s). Purpose. Transportation and Travel. Accommodation,. Meals and Other. Hospitality. Total. Expenses. Quarter 1. May 15. Ottawa, ON. Meetings. May 20 to 21. Washington DC. Conference. 11,364.93. 3,274.71. 53.50. 14,693.14. May 5 to June 5. Kenya and England. Meetings. June 18 to 21. Winnipeg, MB.

  19. Disease: H00259 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available y Apparent mineralocorticoid excess (AME) syndrome is characterized by hypertension, low plasma renin and al...: E27.4 I15.2 OMIM: 218030 207765 PMID:16980198 ... AUTHORS ... Hammer F, Stewart PM ... TITLE ... Cortisol metabolism in hypertension

  20. Placení záloh je bariérou v podnikání matek po rodičovské

    Czech Academy of Sciences Publication Activity Database

    Křížková, Alena

    2016-01-01

    Roč. 12, č. 1 (2016) ISSN 1802-7202 Grant - others:Norway Grants(NO) 274 Institutional support: RVO:68378025 Keywords : mothers after parental leave * entrepreneurship context Subject RIV: AO - Sociology, Demography http://zpravodaj.genderstudies.cz/cz/clanek/placeni-zaloh-je-barierou-v-podnikani-matek-po-rodicovske

  1. Creep deformation and microstructural examination of a prior thermally exposed nickel base superalloy

    Czech Academy of Sciences Publication Activity Database

    Zrník, J.; Strunz, Pavel; Vrchovinský, V.; Muránsky, O.; Horňák, P.; Wiedenmann, A.

    2004-01-01

    Roč. 274 (2004), s. 925-930 ISSN 1013-9826 R&D Projects: GA AV ČR KSK1010104 Keywords : superalloy * thermal exposition * creep Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.278, year: 2004

  2. Factors That Impact Nurses’ Utilization of Electronic Mail (E-Mail).

    Science.gov (United States)

    1998-05-21

    e-mail (Hebda, Czar, & Mascara , 1998; Holtzclaw et al., 1993; Murray, 1996; Staggers, 1996). Staggers (1989) identified nurses as primary processors...pp. 247-274). St. Louis: Mosby-Year Book. Hebda, T., Czar, P., & Mascara , C. (1998). Handbook of informatics for nurses and health care

  3. An Analysis of the Relationship between Organizational Communication and Organizational Cynicism According to Teachers' Perceptions in Turkey

    Science.gov (United States)

    Ayik, Ahmet

    2015-01-01

    In this study, the relations between organizational communication and organizational cynicism have been analyzed. The sample of the study consists of 274 teachers working in state secondary schools in Palandöken County of Erzurum, in 2013-2014 academic year. "Organizational Cynicism Scale" and "Organizational Communication…

  4. Handbook of Accelerator Physics and Engineering (sections 2.7.1 - 2.7.5 and 7.6.2)

    International Nuclear Information System (INIS)

    Roser, T.

    1999-01-01

    The sections written by this author are: 2.7.1- Thomas - BMT equation; 2.2.2- Spinor Algebra; 2.7.3- Spin Rotators and Siberian Snakes; 2.7.4- Ring with Spin Rotator and Siberian Snakes; 2.7.5- Depolarizing Resonances and Spin Flippers; ampersand 7.6.2- Proton Beam Polarimeters

  5. Slovensko-česká a česko-slovenská dvojjazyčná lexikografia. Vývinový prehľad od 19. storočia po súčasnosť. Časť 1

    Czech Academy of Sciences Publication Activity Database

    Gajdošová, Katarína

    2014-01-01

    Roč. 79, 5/6 (2014), s. 274-303 ISSN 0037-6981 R&D Projects: GA ČR GAP406/11/2304 Institutional support: RVO:68378092 Keywords : dictionary * lexicography * bilingual * Slovak * Czech Subject RIV: AI - Linguistics

  6. Effect of Fire on Pools of Mercury in Forest Soil, Central Europe

    Czech Academy of Sciences Publication Activity Database

    Navrátil, Tomáš; Hojdová, Maria; Rohovec, Jan; Penížek, V.; Vařilová, Z.

    2009-01-01

    Roč. 83, č. 2 (2009), s. 269-274 ISSN 0007-4861 R&D Projects: GA ČR GP526/07/P170 Institutional research plan: CEZ:AV0Z30130516 Keywords : Hg distribution in soil * Hg emissions * Hg soi pools Subject RIV: DD - Geochemistry Impact factor: 0.992, year: 2009

  7. Effect of humidity on cultivar water permeability of isolated cuticular membranes and leaf disks

    Czech Academy of Sciences Publication Activity Database

    Schreiber, L.; Skrabs, M.; Hartmann, K. D.; Diamantopoulos, P.; Šimáňová, E.; Šantrůček, Jiří

    2001-01-01

    Roč. 214, - (2001), s. 274-282 ISSN 0032-0935 R&D Projects: GA AV ČR IAA6051002 Institutional research plan: CEZ:MSM 123100004 Keywords : leaf disks * physiology Subject RIV: ED - Physiology Impact factor: 3.349, year: 2001

  8. Precise, contactless measurements of the surface tension of picolitre aerosol droplets

    Czech Academy of Sciences Publication Activity Database

    Bzdek, B. R.; Power, R. M.; Simpson, Stephen Hugh; Reid, J. P.; Royall, C. P.

    2016-01-01

    Roč. 7, č. 1 (2016), s. 274-285 ISSN 2041-6520 R&D Projects: GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : hygroscopicity model framework * organic-compounds * inorganic-compounds Subject RIV: BH - Optics, Masers, Lasers Impact factor: 8.668, year: 2016

  9. Cloning and characterization of cDNA encoding xyloglucan ...

    African Journals Online (AJOL)

    Jane

    2011-08-22

    Aug 22, 2011 ... construction and restructuring of xyloglucan cross-links, thereby controlling the mechanical properties of cell wall. We cloned complete cDNA of an ..... are marked by horizontal lines. The conserved cysteine residues (amino acids 220, 229, 274 and 288 in P. glaucum) are marked by vertical blue arrows.

  10. Heterozygous STAT1 gain-of-function mutations underlie an unexpectedly broad clinical phenotype

    NARCIS (Netherlands)

    Toubiana, J.; Okada, S.; Hiller, J.; Oleastro, M.; Lagos Gomez, M.; Aldave Becerra, J.C.; Ouachee-Chardin, M.; Fouyssac, F.; Girisha, K.M.; Etzioni, A.; Montfrans, J. van; Camcioglu, Y.; Kerns, L.A.; Belohradsky, B.; Blanche, S.; Bousfiha, A.; Rodriguez-Gallego, C.; Meyts, I.; Kisand, K.; Reichenbach, J.; Renner, E.D.; Rosenzweig, S.; Grimbacher, B.; Veerdonk, F.L. van de; Traidl-Hoffmann, C.; Picard, C.; Marodi, L.; Morio, T.; Kobayashi, M.; Lilic, D.; Milner, J.D.; Holland, S.; Casanova, J.L.; Puel, A.

    2016-01-01

    Since their discovery in patients with autosomal dominant (AD) chronic mucocutaneous candidiasis (CMC) in 2011, heterozygous STAT1 gain-of-function (GOF) mutations have increasingly been identified worldwide. The clinical spectrum associated with them needed to be delineated. We enrolled 274

  11. Neonatal Morbidity And Mortality In Calabar, Nigeria: A Hospital ...

    African Journals Online (AJOL)

    Background: The morbidity and mortality pattern amongst neonates admitted into the University of Calabar Teaching Hospital were reviewed from 1st June 2003 to 30th November 2004. Results: The major indications for admission for inborn babies were infections (27.4%), jaundice (21%) and low birth weight (LBW) ...

  12. Kuidas kirjutatakse ajalugu? / Roger Chartier ; interv. Marek Tamm

    Index Scriptorium Estoniae

    Chartier, Roger

    2007-01-01

    Kirjanduslikest tekstidest sotsiaalajaloo uurimisallikana, juhuse ja paratamatuse vahekorrast ajaloos ja Prantsuse revolutsiooni käsitlusest Pariisi õppe- ja teaduskeskuse Ecole des Hautes Etudes en Sciences Sociales professori R. Chartier'i teostes. Varem ilm.: Tekstid, praktikad ja lugejad : intervjuu Roger Chartier'ga // Chartier, Roger. Prantsuse revolutsiooni kultuurilised lätted. - Tallinn, 2002. - Lk. 274-290

  13. Military Base Realignments and Closures: More Guidance and Information Needed to Take Advantage of Opportunities to Consolidate Training

    Science.gov (United States)

    2016-02-01

    eliminating excess capacity and realizing cost savings, BRAC 2005 was conducted in a global security environment characterized by increasing defense...GAO recommendation Original DOD response DOD actions GAO-15-274—Military Base Realignments and Closures: Process for Reusing Property for Homeless ...Assistance Needs Improvements (Mar. 16, 2015). Update the Base Realignment and Closure (BRAC) homeless assistance regulations to require that

  14. 78 FR 4766 - Adoption of Updated EDGAR Filer Manual

    Science.gov (United States)

    2013-01-23

    ... SECURITIES AND EXCHANGE COMMISSION 17 CFR Parts 232, 239, 249, 269, 274 [Release Nos. 33-9382; 34-68644; 39-2488; IC-30348] Adoption of Updated EDGAR Filer Manual AGENCY: Securities and Exchange... EDGAR Filer Manual, Volume II: EDGAR Filing should then be followed. Along with the adoption of the...

  15. Photo-production of neutral kaons on C-12 in the threshold region

    Czech Academy of Sciences Publication Activity Database

    Watanabe, T.; Bydžovský, Petr; Dobashi, K.; Endo, S.; Fujii, Y.; Hashimoto, O.; Ishikawa, T.; Itoh, K.; Kanda, H.

    2007-01-01

    Roč. 651, č. 4 (2007), s. 269-274 ISSN 0370-2693 R&D Projects: GA ČR GA202/05/2142 Institutional research plan: CEZ:AV0Z10480505 Keywords : photo-production * neutral kaon * quasi-free reaction Subject RIV: BE - Theoretical Physics Impact factor: 4.189, year: 2007

  16. (G /G)-expansion method

    Indian Academy of Sciences (India)

    social phenomena and systems. Nonlinear wave phenomena appear in ... partial differential equation play an important role in nonlinear science, especially they may provide us much physical ...... [28] A Polyanin and V F Zaitsev, Handbook of nonlinear partial differential equations (CRC Press,. Boca Raton, FL, 2004). 274.

  17. Just health: meeting health needs fairly

    National Research Council Canada - National Science Library

    Daniels, Norman

    2008-01-01

    ... Protection Medical Professionalism and the Care We Should Get 7 8 161 191 218 part iii uses 9 Fairness in Health Sector Reform Accountability for Reasonableness in Developing Countries: Two Applications Reducing Health Disparities: No Simple Matter Priority Setting and Human Rights 10 11 12 243 274 297 313 vP1: KAE CUNY1073-FM CUNY1073/Daniels 978 0 52...

  18. Community Based Health Insurance Schemes and Protection of the ...

    African Journals Online (AJOL)

    The objectives of this study are two folds: firstly to explore the magnitude of catastrophic expenditure, and secondly to determine its contributing factor,s including the protective impact of the voluntary community based health insurance schemes in Tanzania. The study covered 274 respondents. Study findings have shown ...

  19. Recognition of online handwritten Gurmukhi characters based on ...

    Indian Academy of Sciences (India)

    Karun Verma

    Department of Computer Science and Engineering, Thapar University, Patiala 47004, India e-mail: karun.verma@thapar.edu; rksharma@thapar.edu .... classification of characters using decision trees. Pechwitz and Mдrgner [15] proposed a baseline ...... recognition using set theory. Int. J. Pattern Recognit. Artif. Intell. 27(4): ...

  20. Non-stationarity of the quasi-perpendicular bow shock: comparison between Cluster observations and simulations

    Czech Academy of Sciences Publication Activity Database

    Comisel, H.; Scholer, M.; Souček, Jan; Matsukiyo, S.

    2011-01-01

    Roč. 29, č. 2 (2011), s. 263-274 ISSN 0992-7689 Institutional research plan: CEZ:AV0Z30420517 Keywords : bow shock * Cluster * plasma waves * shock waves Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.842, year: 2011 http://www.ann-geophys.net/29/263/2011/angeo-29-263-2011.pdf

  1. Optimization of Catalysts Using Specific, Description-Based Genetic Algorithms

    Czech Academy of Sciences Publication Activity Database

    Holeňa, Martin; Čukić, T.; Rodemerck, U.; Linke, D.

    2008-01-01

    Roč. 48, č. 2 (2008), s. 274-282 ISSN 1549-9596 R&D Projects: GA ČR GA201/08/1744 Institutional research plan: CEZ:AV0Z10300504 Keywords : optimization of catalytic materials * genetic algorithm s * mixed optimization * constrained optimization Subject RIV: IN - Informatics, Computer Science Impact factor: 3.643, year: 2008

  2. Solvent extraction of microamounts of strontium and barium from water into nitrobenzene using hydrogen dicarbollylcobaltate in the presence of benzo-18-crown-6

    Czech Academy of Sciences Publication Activity Database

    Makrlík, E.; Vančura, P.; Selucký, P.; Hálová, Jaroslava

    2007-01-01

    Roč. 274, č. 3 (2007), s. 625-629 ISSN 0236-5731 Institutional research plan: CEZ:AV0Z40320502 Keywords : unex proces * dicarbolide * separation Subject RIV: CA - Inorganic Chemistry Impact factor: 0.499, year: 2007

  3. Larvae of trombiculid mites (Acarina: Trombiculidae) in wild birds in Slovak and Polish Carpathians

    Czech Academy of Sciences Publication Activity Database

    Literák, I.; Honza, Marcel; Pinowska, B.; Haman, A.

    2001-01-01

    Roč. 70, č. 4 (2001), s. 479-483 ISSN 0001-7213 Institutional research plan: CEZ:MSM 161700001 Keywords : Passerines * parasites * Trombiculidae Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.274, year: 2001 http://vfu-www.vfu.cz/acta-vet/vol70/pdf/70_479.pdf

  4. Avipoxvirus infection in wild birds: new findings from Slovakia and Poland

    Czech Academy of Sciences Publication Activity Database

    Literák, I.; Halouzka, R.; Hromádko, M.; Honza, Marcel; Pinowska, B.; Haman, A.

    2001-01-01

    Roč. 70, č. 3 (2001), s. 339-344 ISSN 0001-7213 Institutional research plan: CEZ:MSM 161700001 Keywords : cutaneous lesion Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.274, year: 2001 http://vfu-www.vfu.cz/acta-vet/vol70/pdf/70_339.pdf

  5. Concentration of phytic acid in faeces of calves fed starter diets

    Czech Academy of Sciences Publication Activity Database

    Dušková, Dagmar; Dvořák, R.; Rada, V.; Doubek, J.; Marounek, Milan

    2001-01-01

    Roč. 70, č. 4 (2001), s. 381-385 ISSN 0001-7213 R&D Projects: GA ČR GA524/99/0101; GA AV ČR KSK5020115 Keywords : nutrition * concentrated feed * phosphorus Subject RIV: ED - Physiology Impact factor: 0.274, year: 2001

  6. Beyond the fetishism of Gross Domestic Product: (Mis)governance ...

    African Journals Online (AJOL)

    While the national rate of unemployment is about 27.4 per cent, youth unemployment is well over 60 per cent. At the root of this disconnect between growth and development are governance challenges in the form of corruption, state capture by corrupt elites and misdirected policies. This article examines the link between ...

  7. Cytokinin Dynamics during the Response to Nitrogen in Two Contrasting Plectranthus Genotypes

    Czech Academy of Sciences Publication Activity Database

    Paparozzi, E.T.; Chahal, J.K.; Dobrev, Petre; Claassen, E.A.; Stroup, W.W.; Vaňková, Radomíra

    2016-01-01

    Roč. 141, č. 3 (2016), s. 264-274 ISSN 0003-1062 Institutional support: RVO:61389030 Keywords : ZEATIN-TYPE CYTOKININS * ARABIDOPSIS-THALIANA * ABSCISIC-ACID Subject RIV: EF - Botanics Impact factor: 1.125, year: 2016 http://journal.ashspublications.org/content/141/3/264.abstract

  8. Relationship between starch and lipid accumulation induced by nutrient depletion and replenishment in the microalga Parachlorella kessleri

    Czech Academy of Sciences Publication Activity Database

    Fernandes, B.; Teixeira, J.; Dragone, G.; Vicente, A. A.; Kawano, S.; Bišová, Kateřina; Přibyl, Pavel; Zachleder, Vilém; Vítová, Milada

    2013-01-01

    Roč. 144, SEP 2013 (2013), s. 268-274 ISSN 0960-8524 R&D Projects: GA MŠk LH12145; GA TA ČR TE01020080 Institutional support: RVO:61388971 ; RVO:67985939 Keywords : Lipids * Nutrient depletion * Nutrient replenishment Subject RIV: EE - Microbiology, Virology Impact factor: 5.039, year: 2013

  9. Electrochemical Doping of Double Walled Carbon Nanotubes: An In situ Raman Spectroelectrochemical Study

    Czech Academy of Sciences Publication Activity Database

    Kavan, Ladislav; Kalbáč, Martin; Zukalová, Markéta; Krause, M.; Dunsch, L.

    2004-01-01

    Roč. 5, č. 2 (2004), s. 274-277 ISSN 1439-4235 R&D Projects: GA AV ČR IAA4040306; GA AV ČR KSK4040110 Keywords : Raman spectroscopy * fullerenes * spectroelectrochemistry Subject RIV: CG - Electrochemistry Impact factor: 3.596, year: 2004

  10. 10 CFR 150.7 - Persons in offshore waters not exempt.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Persons in offshore waters not exempt. 150.7 Section 150.7... AGREEMENT STATES AND IN OFFSHORE WATERS UNDER SECTION 274 Continued Commission Regulatory Authority in Offshore Waters § 150.7 Persons in offshore waters not exempt. Persons in offshore waters are not exempt...

  11. Functional comparison of Cnh1 antiporters from different Candida species

    Czech Academy of Sciences Publication Activity Database

    Krauke, Yannick; Zimmermannová, Olga; Sychrová, Hana

    2007-01-01

    Roč. 274, Suppl.1 (2007), s. 127-127 ISSN 1742-464X. [FEBS Congress Molecular Machines /32./. 07.07.2007-12.07.2007, Vienna] Institutional research plan: CEZ:AV0Z50110509 Keywords : cpo1 * Na/H antiporter * Candida * plasma membrane Subject RIV: EE - Microbiology, Virology

  12. Interaction of Silver Nanopowder with Cooper Substrate

    Czech Academy of Sciences Publication Activity Database

    Sopoušek, J.; Buršík, Jiří; Zálešák, J.; Buršíková, V.; Brož, P.

    2011-01-01

    Roč. 43, - (2011), s. 33-38 ISSN 0350-820X R&D Projects: GA ČR(CZ) GA106/09/0700 Institutional research plan: CEZ:AV0Z20410507 Keywords : silver * copper * sintering Subject RIV: JG - Metallurgy Impact factor: 0.274, year: 2011

  13. Geometric Arveson–Douglas conjecture

    Czech Academy of Sciences Publication Activity Database

    Engliš, Miroslav; Eschmeier, J.

    2015-01-01

    Roč. 274, April (2015), s. 606-630 ISSN 0001-8708 Institutional support: RVO:67985840 Keywords : Arveson-Douglas conjecture * generalized Toeplitz operator Subject RIV: BA - General Math ematics Impact factor: 1.405, year: 2015 http://www.sciencedirect.com/science/article/pii/S0001870815000328

  14. Organisational age cultures : The interplay of chief executive officers age and attitudes toward younger and older employees

    NARCIS (Netherlands)

    Zacher, Hannes; Gielnik, Michael M.

    This article investigates the interactive effects of chief executive officer (CEO) age and CEO attitudes toward younger and older employees on organisational age cultures. Data was collected from 66 CEOs of small and medium-sized businesses and 274 employees. Results were consistent with

  15. Hydrogeochemical and anthropogenic influence on the quality of ...

    African Journals Online (AJOL)

    Sixty percent (60%) of the groundwater samples were slightly acidic (5.5-6.4) and were different from the WHO (2004) standard for drinking water. Electrical conductivity values (3-274 μS/cm) and total dissolved solids (7.66 to 248.30 mg/l) for groundwater sources were low and signified low mineralisation and freshwater ...

  16. Welfare Status of Rural Women Agro-processors' Participants in the ...

    African Journals Online (AJOL)

    User

    Development Partnership in Higher Education Project in Osun and Oyo States, .... Islam. Traditional. 58.3. 39.4. 2.3. Educational status. No formal education. Adult education. Vocational. Primary. Secondary. Tertiary. 27.4. 3.4. 10.0. 57.2. 1.0. 1.0 ... participation in revolving loan might be because of limited amount of loan.

  17. Copper(II) complexes derived from substituted 2,2 '-bis-(4-isopropyl-4-methyl-4,5-dihydro-1H-imidazol-5-one) ligands: Synthesis, structure and catalytic activity

    Czech Academy of Sciences Publication Activity Database

    Drabina, P.; Valenta, P.; Jansa, Petr; Růžička, A.; Hanusek, J.; Sedlák, M.

    2008-01-01

    Roč. 27, č. 1 (2008), s. 268-274 ISSN 0277-5387 Institutional research plan: CEZ:AV0Z40550506 Keywords : enantioselective Henry reactions * asymmetric catalysis * NMR spectra * density Subject RIV: CC - Organic Chemistry Impact factor: 1.801, year: 2008

  18. Temporal variation of trace elements in waters polluted by municipal solid waste landfill leachate

    Czech Academy of Sciences Publication Activity Database

    Ettler, V.; Mihaljevič, M.; Matura, M.; Skalková, M.; Šebek, O.; Bezdička, Petr

    2008-01-01

    Roč. 80, č. 3 (2008), s. 274-279 ISSN 0007-4861 R&D Projects: GA AV ČR KJB3111402 Institutional research plan: CEZ:AV0Z40320502 Keywords : trace elements * landfill leachate * temporal variation Subject RIV: DD - Geochemistry Impact factor: 0.609, year: 2008

  19. Fungal diversity notes 111-252-taxonomic and phylogenetic contributions to fungal taxa

    Czech Academy of Sciences Publication Activity Database

    Ariyawansa, H. A.; Hyde, K. D.; Jayasiri, C.; Buyck, B.; Thilini Chethana, K. W.; Dai, D. Q.; Dai, Y. C.; Daranagama, D. A.; Jayawardena, R. S.; Lücking, R.; Ghobad-Nejhad, M.; Niskanen, T.; Thambugala, K. M.; Voigt, K.; Zhao, R. L.; Li, G. J.; Doilom, M.; Boonmee, S.; Yang, Z. L.; Cai, Q.; Cui, Y. Y.; Bahkali, A. H.; Chen, J.; Cui, B.K.; Chen, J.; Dayarathne, M. C.; Dissanayake, A. J.; Ekanayaka, A. H.; Hashimoto, A.; Hongsanan, S.; Gareth Jones, E. B.; Larsson, E.; Li, W. J.; Li, Q. R.; Liu, J. K.; Luo, Z. L.; Maharachchikumbura, S.S.; Mapook, A.; McKenzie, E.; Norphanphoun, C.; Konta, S.; Pang, K. L.; Perera, R. H.; Phookamsak, R.; Phukhamsakda, C.; Pinruan, U.; Randrianjohany, E.; Singtripop, C.; Tanaka, K.; Tian, C. M.; Tibpromma, S.; Abdel-Wahab, M. A.; Wanasinghe, N. N.; Zhang, J. F.; Zhang, H.; Abdel-Aziz, F. A.; Wedin, M.; Westberg, M.; Ammirati, J. F.; Bulgakov, T. S.; Lima, D. X.; Callaghan, T. M.; Callac, P.; Chang, C. H.; Coca, L. F.; Dal-Forno, M.; Dollhofer, V.; Fliegerová, Kateřina; Greiner, K.; Griffith, G. W.; Ho, H.M.; Hofstetter, V.; Jeewon, R.; Kang, J. C.; Wen, T. C.; Kirk, P.M.; Kytövuori, I.; Lawrey, J. D.; Xing, J. P.; Li, H.; Liu, X.; Liimatainen, K.; Thorsten Lumbsch, H.; Matsumura, M.; Moncada, B.; Nuankaew, S.; Parnmen, S.; de Azevedo Santiago, A. L. C. M.; Sommai, S.; Song, Y.; de Souza, C. A. F.; de Souza-Motta, C. M.; Su, H. Y.; Suetrong, S.; Wang, Y.; Wei, S. F.; Wen, T. Ch.; Yuan, H. S.; Zhou, L. W.; Réblová, Martina; Fournier, J.; Camporesi, E.; Luangsa-ard, J. J.; Tasanathai, K.; Khonsanit, A.; Thanakitpipattana, D.; Somrithipol, S.; Diederich, P.; Millanes, A. M.; Common, R. S.; Stadler, M.; Yan, J. Y.; Li, X. H.; Lee, H. W.; Nguyen, T. T. T.; Lee, H. B.; Battistin, E.; Marsico, O.; Vizzini, A.; Vila, J.; Ercole, E.; Eberhardt, U.; Simonini, G.; Wen, H. A.; Chen, X. H.; Miettinen, O.; Spirin, V.; Hernawati, Dr.

    2015-01-01

    Roč. 75, č. 1 (2015), s. 27-274 ISSN 1560-2745 R&D Projects: GA ČR GAP506/12/0038 Institutional support: RVO:67985904 ; RVO:67985939 Keywords : fungi * taxonomy * new genus Subject RIV: EE - Microbiology, Virology; EF - Botanics (BU-J) Impact factor: 6.991, year: 2015

  20. A constructive approach to boundary value problems with state-dependent impulses

    Czech Academy of Sciences Publication Activity Database

    Rachůnková, I.; Rachůnek, L.; Rontó, András; Rontó, M.

    2016-01-01

    Roč. 274, February (2016), s. 726-744 ISSN 0096-3003 Institutional support: RVO:67985840 Keywords : non-linear system of differential equation * impulse effect * parameterization * successive approximations Subject RIV: BA - General Mathematics Impact factor: 1.738, year: 2016 http://www.sciencedirect.com/science/article/pii/S0096300315015234

  1. Maternal diabetes alters transcriptional programs in the developing embryo

    Czech Academy of Sciences Publication Activity Database

    Pavlínková, Gabriela; Salbaum, M.; Kappen, C.

    2009-01-01

    Roč. 10, č. 274 (2009), s. 1-12 ISSN 1471-2164 Institutional research plan: CEZ:AV0Z50520701 Keywords : Diabetic embryopathy * microarray * hypoxia Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.759, year: 2009

  2. Electrical devices based on organic materials

    Czech Academy of Sciences Publication Activity Database

    Bednář, P.; Zmeškal, O.; Weiter, M.; Vala, M.; Vyňuchal, J.; Toman, Petr

    2007-01-01

    Roč. 13, SI 6 (2007), s. 270-274 ISSN 1335-1532 R&D Projects: GA AV ČR IAA401770601 Institutional research plan: CEZ:AV0Z40500505 Keywords : electrical devices * derivatives Subject RIV: CD - Macromolecular Chemistry

  3. Cold exposure and associated metabolic changes in adult tropical beetles exposed to fluctuating thermal regimes

    Czech Academy of Sciences Publication Activity Database

    Lalouette, L.; Košťál, Vladimír; Colinet, H.; Gagneul, D.; Renault, D.

    2007-01-01

    Roč. 274, č. 7, (2007), s. 1759-1767 ISSN 1742-464X Grant - others: Biodiversity Research Centre of the Université Catholique de Louvain(BE) BRC 111 Institutional research plan: CEZ:AV0Z50070508 Keywords : amino acid * fluctuating thermal regime * insect Subject RIV: ED - Physiology Impact factor: 3.396, year: 2007

  4. Seroprevalence of Neospora spp. in horses from Central Province of ...

    African Journals Online (AJOL)

    HP

    2013-02-27

    Feb 27, 2013 ... Vet. Parasitol. 79:269-274. Hoane JS, Gennari SM, Dubey JP, Ribeiro MG, Borges AS Yai, LE,. Aguiar DM, Cavalcante GT, Bonesi GL, Howe DK (2006). Prevalence of Sarcocystis neurona and Neospora spp. infection in horses from. Brazil based on presence of serum antibodies to parasite surface antigen.

  5. Attachment Style, Social Support, and Coping as Psychosocial Correlates of Happiness in Persons with Spinal Cord Injuries

    Science.gov (United States)

    Wilson, Lisa; Catalano, Denise; Sung, Connie; Phillips, Brian; Chou, Chih-Chin; Chan, Jacob Yui Chung; Chan, Fong

    2013-01-01

    Objective: To examine the roles of attachment, social support, and coping as psychosocial correlates in predicting happiness in people with spinal cord injuries. Design: Quantitative descriptive research design using multiple regression and correlation techniques. Participants: 274 individuals with spinal cord injuries. Outcome Measures: Happiness…

  6. Multimammate rat (Mastomys natalensis), Tristram's jird (Meriones tristrami) and Wagner's gerbil (Gerbillus dasyurus) as laboratory models of acute neosporosis

    Czech Academy of Sciences Publication Activity Database

    Hůrková-Hofmannová, L.; Václavek, P.; Škorič, M.; Fictum, P.; Modrý, David

    2007-01-01

    Roč. 82, č. 3 (2007), s. 377-381 ISSN 0034-5288 R&D Projects: GA ČR GD524/03/H133 Institutional research plan: CEZ:AV0Z60220518 Keywords : Neosporosis * Apicomplexa * rodents * multimammate rat * jird * gerbil Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.274, year: 2007

  7. Proceedings – Mathematical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Proceedings – Mathematical Sciences; Volume 119; Issue 3. Issue front cover thumbnail. Volume 119, Issue 3. June 2009, pages 267-410. pp 267-274. A Finer Classification of the Unit Sum Number of the Ring of Integers of Quadratic Fields and Complex Cubic Fields · Nahid Ashrafi · More Details Abstract ...

  8. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences; Volume 119; Issue 3. Issue front cover thumbnail. Volume 119, Issue 3. May 2007, pages 219-274. pp 219-230. Engineering macrocyclic figure-eight motif · V Haridas Harinder Singh Yogesh K Sharma Kashmiri Lal · More Details Abstract Fulltext PDF. The design and ...

  9. Handbook of Accelerator Physics and Engineering (sections 2.7.1 - 2.7.5 and 7.6.2)

    Energy Technology Data Exchange (ETDEWEB)

    Roser, T.

    1999-04-19

    The sections written by this author are: 2.7.1- Thomas - BMT equation; 2.2.2- Spinor Algebra; 2.7.3- Spin Rotators and Siberian Snakes; 2.7.4- Ring with Spin Rotator and Siberian Snakes; 2.7.5- Depolarizing Resonances and Spin Flippers; & 7.6.2- Proton Beam Polarimeters

  10. Psychosocial and Psychophysiological Strain in Extended Spaceflight Simulation

    Czech Academy of Sciences Publication Activity Database

    Šolcová, Iva

    2004-01-01

    Roč. 46, č. 3 (2004), s. 179-186 ISSN 0039-3320 R&D Projects: GA ČR GA406/03/1168 Institutional research plan: CEZ:AV0Z7025918 Keywords : spaceflight simulation * enforced confinement * psychosocial burden Subject RIV: AN - Psychology Impact factor: 0.274, year: 2004

  11. Německé podnikání Baťova koncernu. Studie k hospodářským a sociálním dějinám hornoslezského továrního města Ottmuth (Otmęt)

    Czech Academy of Sciences Publication Activity Database

    Jemelka, M.; Ševeček, Ondřej

    2013-01-01

    Roč. 111, č. 2 (2013), s. 237-274 ISSN 0037-6833 R&D Projects: GA ČR(CZ) GAP410/10/1995 Institutional support: RVO:67985955 Keywords : Baťa concern * Upper Silesia * Ottmuth (Otmęt) * shoe Industry Subject RIV: AB - History

  12. Modelling of Effects of Operating Conditions and Coal Reactivity on Temperature of Burning Particles in Fluidized Bed Combustion

    Czech Academy of Sciences Publication Activity Database

    Svoboda, Karel; Hartman, Miloslav; Pohořelý, Michael; Trnka, Otakar

    2004-01-01

    Roč. 1, č. 2 (2004), s. 261-274 ISSN 1211-1910 R&D Projects: GA AV ČR IAA4072201; GA AV ČR IAA4072001 Institutional research plan: CEZ:AV0Z4072921 Keywords : fluidized bed combustion * char temperature * modelling Subject RIV: DI - Air Pollution ; Quality

  13. Nebraska's forests, 2005: statistics, methods, and quality assurance

    Science.gov (United States)

    Patrick D. Miles; Dacia M. Meneguzzo; Charles J. Barnett

    2011-01-01

    The first full annual inventory of Nebraska's forests was completed in 2005 after 8,335 plots were selected and 274 forested plots were visited and measured. This report includes detailed information on forest inventory methods, and data quality estimates. Tables of various important resource statistics are presented. Detailed analysis of the inventory data are...

  14. Untitled

    African Journals Online (AJOL)

    hypermobility of the urethra and intrinsic sphincter deficiency (ISD).1°'“ The main indication for TVT and ... posterior colporrhaphy and Burch colposuspension. (N: 29; 27.4%). ' Burch colposuspension (N = 16; ... tape (2 and 1, respectively), and posterior colporrhaphy. (1 and 0, respectively), sacrocolpopexy for prolapse.

  15. Victimization and Suicidality Among Dutch Lesbian, Gay, and Bisexual Youths

    NARCIS (Netherlands)

    van Bergen, Diana; Bos, Henny M.W.; van Lisdonk, jantine; Keuzenkamp, S; Sandfort, T.G.M

    2013-01-01

    We examined Netherlands Institute for Social Research data, collected between May and August 2009, on 274 Dutch lesbian, gay, and bisexual youths. The data showed that victimization at school was associated with suicidal ideation and actual suicide attempts. Homophobic rejection by parents was also

  16. Assessment of physical facilities and users' satisfaction: a case study ...

    African Journals Online (AJOL)

    But in contrast, most of the respondents, 398 (47.72%) were very dissatisfied with the strength of the furniture and noise level from ring tones and phone conversations 351 (42.08%). They were also dissatisfied with the size of the reading space 344 (41.24%); brightness of the library when there is no electricity light 274 ...

  17. Download this PDF file

    African Journals Online (AJOL)

    User

    Tan WC, Tan LK, Tan HK, Tan AS : 25. Prabulos AM, Philpson EH : 26. 27. Kanana B, Sheiner E, Levy A, Lazer S, Mazor. M. 28. Murphy D, Mackenzie IZ. Risk factors and perinatal outcomes associated with umbilical cord prolapse. Arch Gynecol Obstet, 2006. ;274(2):104-107. Prolapse and presentation of the umbilical cord ...

  18. Phosphorylation of Type IA restriction-modification complex enzyme EcoKI on the HsdR subunit

    Czech Academy of Sciences Publication Activity Database

    Cajthamlová, Kamila; Šišáková, Eva; Weiser, Jaroslav; Weiserová, Marie

    2007-01-01

    Roč. 270, - (2007), s. 171-177 ISSN 0378-1097 R&D Projects: GA ČR GA204/07/0325; GA ČR GA310/03/0292 Institutional research plan: CEZ:AV0Z50200510 Keywords : protein phosphorylation * restriction-modification * subcellular fraction Subject RIV: EE - Microbiology, Virology Impact factor: 2.274, year: 2007

  19. Stoats (Mustela erminea) provide evidence of natural overland colonization of Ireland

    Czech Academy of Sciences Publication Activity Database

    Martínková, Natália; McDonald, R. A.; Searle, J. B.

    2007-01-01

    Roč. 274, č. 1616 (2007), s. 1387-1393 ISSN 0962-8452 Institutional research plan: CEZ:AV0Z60930519 Keywords : cytochrome b * D-loop * last glacial maximum * mitochondrial DNA * phylogeography Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.112, year: 2007

  20. Morphometric and molecular characterization of Parapharyngodon echinatus (Nematoda, Pharyngodonidae) from the Senegal gecko ( Tarentola parvicarinata )

    Czech Academy of Sciences Publication Activity Database

    Mašová, Š.; Baruš, Vlastimil; Hodová, I.; Matějusová, I.; Koubek, Petr; Koubková, B.

    2008-01-01

    Roč. 53, č. 3 (2008), s. 274-283 ISSN 1230-2821 R&D Projects: GA AV ČR IAA6093404 Institutional research plan: CEZ:AV0Z60930519 Keywords : Nematoda * Senegal gecko * West Africa Subject RIV: EG - Zoology Impact factor: 0.748, year: 2008

  1. Convention on the physical protection of nuclear material

    International Nuclear Information System (INIS)

    1991-09-01

    The document refers to the Convention on the Physical Protection of Nuclear Material (IAEA-INFCIRC-274). Part I contains the status list as of September 6, 1991; Part II contains the texts of reservations/declarations made upon expressing consent to be bound; Part III contains the texts of reservations/declarations made upon signature

  2. Directionality of large-scale resting-state brain networks during eyes open and eyes closed conditions

    NARCIS (Netherlands)

    Zhang, Delong; Liang, Bishan; Wu, Xia; Wang, Zengjian; Xu, Pengfei; Chang, Song; Liu, Bo; Liu, Ming; Huang, Ruiwang

    2015-01-01

    The present study examined directional connections in the brain among resting-state networks (RSNs) when the participant had their eyes open (E0) or had their eyes closed (EC). The resting state fMRI data were collected from 20 healthy participants (9 males, 20.17 +/- 2.74 years) under the EO and EC

  3. Properties of pyranose dehydrogenase purified from the litter-degrading fungus Agaricus xanthoderma

    Czech Academy of Sciences Publication Activity Database

    Kujawa, M.; Volc, Jindřich; Halada, Petr; Sedmera, Petr; Divne, Ch.; Sygmund, Ch.; Leitner, CH.; Peterbauer, C.; Haltrich, D.

    2007-01-01

    Roč. 274, č. 3 (2007), s. 879-894 ISSN 1742-464X R&D Projects: GA MŠk LC545 Institutional research plan: CEZ:AV0Z50200510 Keywords : covalent flavinylation * lignocellulose degradation * letter-degrading fungi Subject RIV: EE - Microbiology, Virology Impact factor: 3.396, year: 2007

  4. Sahni, Prof. Ashok

    Indian Academy of Sciences (India)

    ... Vertebrate Palaeontology, Palaeobiogeography and Electron Microscope Applications to Biomineralization Address: 98, Mahatma Gandhi Marg, Lucknow 226 001, U.P.. Contact: Office: (0522) 274 0051. Residence: (0522) 223 5385. Mobile: 99560 29934. Email: ashok.sahni@gmail.com. YouTube · Twitter · Facebook ...

  5. Science Teachers' Perception on Multicultural Education Literacy and Curriculum Practices

    Science.gov (United States)

    Huang, Hsiu-Ping; Cheng, Ying-Yao; Yang, Cheng-Fu

    2017-01-01

    This study aimed to explore the current status of teachers' multicultural education literacy and multicultural curriculum practices, with a total of 274 elementary school science teachers from Taitung County as survey participants. The questionnaire used a Likert-type four-point scale which content included the teachers' perception of…

  6. Beckova škála deprese BDI-II - standardizace a využití v praxi

    Czech Academy of Sciences Publication Activity Database

    Ptáček, R.; Raboch, J.; Vňuková, M.; Hlinka, Jaroslav; Anders, M.

    2016-01-01

    Roč. 112, č. 6 (2016), s. 270-274 ISSN 1212-0383 Grant - others:1 LF(CZ) PRVOUK Institutional support: RVO:67985807 Keywords : BDI-II * depression * standards * validity * reliability Subject RIV: FL - Psychiatry, Sexuology OBOR OECD: Psychiatry http://www.cspsychiatr.cz/detail.php?stat=1121

  7. On adaptive time stepping for large-scale parabolic problems: Computer simulation of heat and mass transfer in vacuum freeze-drying

    Czech Academy of Sciences Publication Activity Database

    Georgiev, K.; Kosturski, N.; Margenov, S.; Starý, Jiří

    2009-01-01

    Roč. 226, č. 2 (2009), s. 268-274 ISSN 0377-0427 Institutional research plan: CEZ:AV0Z30860518 Keywords : Vacuum freeze drying * Zeolites * Heat and mass transfer * Finite element method * MIC(0) preconditioning Subject RIV: BA - General Mathematics Impact factor: 1.292, year: 2009 http://apps.isiknowledge.com

  8. A 2-years description of traumatic brain injury admissions in Tikur ...

    African Journals Online (AJOL)

    A 2-years description of traumatic brain injury admissions in Tikur Anbessa Specialized Hospital. ... Of the 165 operations performed for patients with head injury, 53 (26.4%) were craniotomy and evacuation of hematoma; 55 (27.4%) elevation of the depressed skull fracture, senior resident involvement as a first surgeon ...

  9. Perceptions and Beliefs of University and College students ... - Lusaka

    African Journals Online (AJOL)

    Esem

    trials have been conducted in Orange Farm; South Africa,. Kisumu; Kenya ... The South Africa Orange Farm trial, which enrolled 3,274 uncircumcised .... Sometimes our girl friends are the ones that advise us the guys to go for circumcision.”-(Male respondent 24 yrs). Others still want to do it for “macho” reasons. It is evident.

  10. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science. I Suresh. Articles written in Journal of Earth System Science. Volume 116 Issue 3 June 2007 pp 261-274. Improved bathymetric datasets for the shallow water regions in the Indian Ocean · B Sindhu I Suresh A S Unnikrishnan N V Bhatkar S Neetu G S Michael · More Details ...

  11. Victimization and suicidality among Dutch lesbian, gay and bisexual youths

    NARCIS (Netherlands)

    van Bergen, D.D.; Bos, H.M.W.; van Lisdonk, J.; Keuzenkamp, S.; Sandfort, T.G.M.

    2013-01-01

    We examined Netherlands Institute for Social Research data, collected between May and August 2009, on 274 Dutch lesbian, gay, and bisexual youths. The data showed that victimization at school was associated with suicidal ideation and actual suicide attempts. Homophobic rejection by parents was also

  12. 78 FR 29155 - National Register of Historic Places; Notification of Pending Nominations and Related Actions

    Science.gov (United States)

    2013-05-17

    ... NEW JERSEY Essex County Pleasant Days, 274 Old Short Hills Rd., Millburn, 13000354 Mercer County... Spring Rd., Sterling, 13000363 Winchester Independent city Hawthorne and Old Town Spring, 610 & 730... County Moose Addition Neighborhood Historic District, Roughly bounded by W. Valley, S. Moose, Green...

  13. Medical Informatics Impact of Information Society in Health Care Development

    Czech Academy of Sciences Publication Activity Database

    Zvárová, Jana

    2005-01-01

    Roč. 9, - (2005), s. 269-274 ISSN 1335-2393. [YBERC 2005. Young Biomedical Engineers and Researchers Conference. Stará Lesná, 13.07.2005-15.07.2005] Institutional research plan: CEZ:AV0Z10300504 Keywords : medical informatics * information society * telemedicine * education * research and development Subject RIV: BD - Theory of Information

  14. Krátkodobé práce matek a dělba rolí mezi partnery

    Czech Academy of Sciences Publication Activity Database

    Hašková, Hana

    2016-01-01

    Roč. 12, č. 1 (2016) ISSN 1802-7202 Grant - others:Norway Grants(NO) 274 Institutional support: RVO:68378025 Keywords : precarious work * motherhood * gender roles Subject RIV: AO - Sociology, Demography http://zpravodaj. gender studies.cz/cz/clanek/kratkodobe-prace-matek-a-delba-roli-mezi-partnery.

  15. Burnout and Competency Development in Pre-Service Teacher Training

    Science.gov (United States)

    Rodríguez-Hidalgo, Antonio J.; Calmaestra, Juan; Dios, Irene

    2014-01-01

    Introduction: The burnout syndrome negatively affects the students' academic performance. The relation between academic burnout and the self-perception of skills in initial teacher training is subjected to analysis. Method: A sample of 274 students (average age = 20,61 years old) from the Bachelor Degree in Early Childhood Education and the…

  16. Phaeobacter piscinae sp. nov., a species of the Roseobacter group and potential aquaculture probiont

    DEFF Research Database (Denmark)

    Sonnenschein, Eva Christina; Phippen, Christopher Broughton William; Nielsen, Kristian Fog

    2017-01-01

    Four heterotrophic, antimicrobial, motile, marine bacterial strains, 27-4T, 8-1, M6-4.2 and S26, were isolated from aquaculture units in Spain, Denmark and Greece. All four strains produced the antibiotic compound tropodithietic acid, which is a key molecule in their antagonism against fish...

  17. Eating extra calories when you are sick - adults

    Science.gov (United States)

    ... CL, Doyle C, Demark-Wahnefried W, et al. Nutrition and physical activity guidelines for cancer survivors. CA Cancer J Clin . 2012;62(4):243-274. PMID 22539238 www.ncbi.nlm.nih.gov/pubmed/22539238 . Read More Alzheimer disease Bone marrow transplant Dementia Mastectomy Parkinson disease ...

  18. Do Physical and Relational Aggression Explain Adolescents' Friendship Selection? The Competing Roles of Network Characteristics, Gender, and Social Status

    NARCIS (Netherlands)

    Dijkstra, Jan Kornelis; Berger, Christian; Lindenberg, Siegwart

    2011-01-01

    The role of physical and relational aggression in adolescents' friendship selection was examined in a longitudinal sample of 274 Chilean students from 5th and 6th grade followed over 1 year. Longitudinal social network modeling (SIENA) was used to study selection processes for aggression while

  19. Perturbation of m-isometries by nilpotent operators

    Czech Academy of Sciences Publication Activity Database

    Bermúdez, T.; Martinón, A.; Müller, Vladimír; Noda, J. A.

    2014-01-01

    Roč. 2014, September (2014), s. 745479 ISSN 1085-3375 R&D Projects: GA ČR(CZ) GA14-07880S Institutional support: RVO:67985840 Keywords : pertubation * m-isometries Subject RIV: BA - General Mathematics Impact factor: 1.274, year: 2013 http://www.hindawi.com/journals/aaa/2014/745479/

  20. Cultural Identity and Peer Influence as Predictors of Substance Use among Culturally Diverse Australian Adolescents

    Science.gov (United States)

    Gazis, Nicki; Connor, Jason P.; Ho, Robert

    2010-01-01

    This study investigated cultural identity and peer influence on tobacco, alcohol, and cannabis use in a culturally diverse sample of Northern Australian adolescents. Middle school students (n = 274) completed the Multigroup Ethnic Identity Measure (MEIM) and measures of their own and perceived friends' substance use. Higher scores on the full…

  1. A Middle Pennsylvanian (Bolsovian) peat-forming forest preserved in situ in volcanic ash of the Whetstone Horizon in the Radnice Basin, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Opluštil, S.; Pšenička, J.; Libertín, M.; Bashforth, A. R.; Šimůnek, Z.; Drábková, J.; Dašková, Jiřina

    2009-01-01

    Roč. 155, 3-4 (2009), s. 234-274 ISSN 0034-6667 R&D Projects: GA ČR GA205/05/0105 Institutional research plan: CEZ:AV0Z30130516 Keywords : Pennsylvanian * tuff * in situ * plant taphonomy * palaeoecology * peat-forming mires Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.145, year: 2009

  2. Toward a Balanced View of Charismatic Leadership

    Science.gov (United States)

    2015-06-12

    Army is another matter. Some units have historical appeal that distinguish them from others, such as being the Band of Brothers , and others have unique...Scientific Study of Religion 20, no. 3 (September): 274-284. 56 Burke, W. Warner 2008. Organizational Change: Theory and Practice. Thousand Oaks

  3. Realisations of a single high tone in Northern Sotho | Zerbian ...

    African Journals Online (AJOL)

    The segmental make-up of the tone-bearing syllable leads to systematic surface variation in tone realisation. By collecting controlled acoustic data on tone realisation, this study provides a ground for cross-dialectal comparison of Southern Bantu tone. Southern African Linguistics and Applied Language Studies 2009, 27(4): ...

  4. 75 FR 60573 - Federal Employees' Group Life Insurance Program: Miscellaneous Changes, Clarifications, and...

    Science.gov (United States)

    2010-10-01

    ... is based on the combined salaries. However, if an employee accepts a temporary position while in nonpay status from a covered position, the amount of insurance is based on whichever salary is higher. We... District of Columbia, as provided by Public Law 105-274 (112 Stat. 2419). (4) A teacher in a Department of...

  5. The Study of Relationship between Organizational Culture and Organizational Belonging in Employees of Varamin County Office of Education

    Science.gov (United States)

    Tabatabaee, Seyed Mahmoud; Koohi, Amirhasan; Ghandali, Abbas; Tajik, Tayebeh

    2016-01-01

    The purpose of the present research is to study the relationship between organizational culture and organizational belonging among employees of Varamin County ministry of education. This is a descriptive-survey study. The statistical population is consisted of all 274 official and contract employees of ministry of education in Varamin County of…

  6. 77 FR 54917 - Findings of Research Misconduct

    Science.gov (United States)

    2012-09-06

    ... sounds that followed grammatical structure and then exposed to stimuli that conformed to or violated that structure, Respondent (1) provided an incorrect description of the coding methodology by claiming in the... gestures of a human agent.'' Proceedings of the Royal Society B 274:1913-1918, 2007, Respondent falsely...

  7. Influence of the dislocation core on the glide of the 1/2 < 111 >{110} edge dislocation in bcc-iron: An embedded atom method study

    Czech Academy of Sciences Publication Activity Database

    Haghighat, S.M.H.; von Pezold, J.; Race, C. P.; Kormann, F.; Friák, Martin; Neugebauer, J.; Raabe, D.

    2014-01-01

    Roč. 87, MAY (2014), s. 274-282 ISSN 0927-0256 Institutional support: RVO:68081723 Keywords : Molecular dynamics * Edge dislocation * Core structure * Dislocation glide * Iron Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.131, year: 2014

  8. Technologické využití elektronového svazku

    Czech Academy of Sciences Publication Activity Database

    Zobač, Martin; Zobačová, Jitka; Vlček, Ivan

    2012-01-01

    Roč. 57, č. 10 (2012), s. 270-274 ISSN 0447-6441 Institutional support: RVO:68081731 Keywords : focused intense electron beam * welding * machining * heat treatment * surface modifica­tion * engraving * texturing * additive manufactu­ring Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  9. HIV and TB co-infection in South Sudan: a three year retrospective ...

    African Journals Online (AJOL)

    Kenneth L L Subea, Oromo F Serianoa, Salvador Jajaa, Rose P Gorea, Richard L L Lorob, Emmanuel Oryemb, Opiaka. A Serianoc ... these, 27.4% were seen in 2011, 34.1% in 2012 and 38.5% in 2013. ... Distribution (number and %) of sexes among patients attending the HIV clinic in JTH during 2011, 2012 and 2013.

  10. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Reaction probabilities are reported up to a total energy of ∼ 3.0 eV, slightly above the energetic minimum of the seam of conical intersections at ∼ 2.74 eV. Reaction probabilities are calculated up to the total angular momentum, = 20 and for each value of , the projection quantum number is varied from 0 to min (, ...

  11. An evaluation of creep behavior in ultrafine-grained aluminum alloys processed by ECAP

    Czech Academy of Sciences Publication Activity Database

    Kawasaki, M.; Sklenička, Václav; Langdon, T. G.

    2010-01-01

    Roč. 45, č. 1 (2010), s. 271-274 ISSN 0022-2461 Institutional research plan: CEZ:AV0Z20410507 Keywords : creep * ultrafine-grained material * severe plastic deformation * equal-channel angular pressing Subject RIV: JG - Metallurgy Impact factor: 1.855, year: 2010

  12. Evaluation of Pediatric Patients with Orbital and Preseptal Cellulitis

    Directory of Open Access Journals (Sweden)

    Eren Cagan

    2015-06-01

    Conclusion: Preseptal cellulitis is more frequently observed than orbital cellulitis. The most important predisposing factor for orbital cellulitis is sinusitis. Patients with preseptal cellulitis suspected clinically may be diagnosed with orbital cellulitis radiologically. As a result radiological imaging of preseptal cellulitis patients should be considered. [Cukurova Med J 2015; 40(2.000: 267-274

  13. The Effects of Behavioral Change in Response to Acoustic Disturbance on the Health of the Population of Blainville’s Beaked Whales (Mesoplodon densirostris) in the Tongue of the Ocean

    Science.gov (United States)

    2013-09-30

    foraging dives rather than the numerous shallow/short recovery dives; the intention is to yield improved data throughput and provide consistent data as to...physiological migrations?," Biology Letters, vol. 8, no. 2, pp. 274-277, 2012. 20 [13] D. Johnson, J. London and J. Durban, " Continuos -time

  14. Knowledge workers' creativity and the role of the physical work environment

    NARCIS (Netherlands)

    J. Dul (Jan); C. Ceylan (Canan); F.P.H. Jaspers (Ferdinand)

    2011-01-01

    textabstractABSTRACT The present study examines the effect of the physical work environment on the creativity of knowledge workers, compared with the effects of creative personality and the social-organizational work environment. Based on data from 274 knowledge workers in 27 SMEs, we conclude that

  15. 10 CFR 150.15a - Continued Commission authority pertaining to byproduct material.

    Science.gov (United States)

    2010-01-01

    ..., maintenance and emergency measures as are necessary to protect the public health and safety and other actions... REGULATORY AUTHORITY IN AGREEMENT STATES AND IN OFFSHORE WATERS UNDER SECTION 274 Continued Commission Regulatory Authority in Agreement States § 150.15a Continued Commission authority pertaining to byproduct...

  16. ORF Alignment: NC_003155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003155 gi|29827678 >1bt3A 46 336 1 274 3e-43 ... dbj|BAC68847.1| putative tyrosinase... [Streptomyces avermitilis MA-4680] ... dbj|BAB69175.1| tyrosinase [Streptomyces avermitilis] ... ... ... ref|NP_822312.1| putative tyrosinase [Streptomyces ... avermitilis MA-4680] ... Length =

  17. IDRC in the Philippines

    International Development Research Centre (IDRC) Digital Library (Canada)

    Migrant workers access reproductive health care. □ Filipinos benefit from modern communication technologies. □ People worldwide enjoy community Internet access. Total IDRC support. 274 activities worth CA$39 million since 1972. Research has improved the working conditions and general well-being of rice farmers.

  18. Performance of first-trimester combined test for Down syndrome in different maternal age groups: reason for adjustments in screening policy?

    NARCIS (Netherlands)

    Engels, Melanie A. J.; Heijboer, A. C.; Blankenstein, Marinus A.; van Vugt, John M. G.

    2011-01-01

    To evaluate the performance of the first-trimester combined test (FCT) in different maternal age groups and to discuss whether adjustments in screening policies should be made. In this retrospective study data (n = 26 274) from a fetal medicine center on FCT (maternal age, fetal NT, free β-human

  19. 76 FR 34109 - Proposed Collection; Comment Request

    Science.gov (United States)

    2011-06-10

    ... companies, other than small business investment companies registered on Form N-5 (17 CFR 239.24 and 274.5...) Whether the proposed collection of information is necessary for the proper performance of the functions of... General Green Way, Alexandria, VA 22312; or send an e-mail to: [email protected] . Dated: June 6, 2011...

  20. Cigarette smoking and khat chewing among University instructors in ...

    African Journals Online (AJOL)

    The high schools and colleges should inform their students about the health and socioeconomic problems associated with cigarette smoking and khat chewing. Additionally, college students need counseling service on ways of coping with their problems. (East African Medical Journal: 2002 79(5): 274-278) ...

  1. Motivational strategies of sport coaches in South Africa | Le Roux ...

    African Journals Online (AJOL)

    The purpose of this investigation was to establish what techniques or strategies are used by sports coaches in South Africa to motivate their athletes/players. Altogether 780 questionnaires were distributed to sports coaches, of which 274 were used for the interpretation of the data collected. A factor analysis showed that ...

  2. Objective of the regulatory system for the physical protection of facilities and nuclear materials

    International Nuclear Information System (INIS)

    Polo, Rolando

    1996-01-01

    During the work that is developed in our country in order to have a regulatory system, recommendation on the issue have been considered. Such recommendation are gathered in the informative regulation 225 rev, 3 of the IAEA and the requirements are collected in the Informative Regulation 274 rev 1 of the IAEA, as well as the good national and international practices

  3. On the Gause predator-prey model with a refuge: A fresh look at the history

    Czech Academy of Sciences Publication Activity Database

    Křivan, Vlastimil

    2011-01-01

    Roč. 274, č. 1 (2011), s. 67-73 ISSN 0022-5193 Grant - others:Department of Agriculture(US) EF-0832858 Institutional research plan: CEZ:AV0Z50070508 Keywords : discontinuous differential equations * Filippov solution * holling functional response Subject RIV: EH - Ecology, Behaviour Impact factor: 2.208, year: 2011

  4. 76 FR 28823 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2011-05-18

    ..., depositary, management personnel, compensation, and financial statements. The Commission uses the information... Copies Available From: Securities and Exchange Commission, Office of Investor Education and Advocacy... information discussed below. Form N-8B-4 (17 CFR 274.14) is the form used by face-amount certificate companies...

  5. KLE Translog production function and total factor productivity

    Czech Academy of Sciences Publication Activity Database

    Klacek, J.; Vošvrda, Miloslav; Schlosser, Š.

    2007-01-01

    Roč. 87, č. 4 (2007), s. 261-274 ISSN 0322-788X Institutional research plan: CEZ:AV0Z10750506 Keywords : total factor productivity * translog production function * aggregate production function * least squares method * ridge regression Subject RIV: AH - Economics

  6. Letter to the Editor

    Directory of Open Access Journals (Sweden)

    Thomas K. Karikari

    2015-02-01

    Full Text Available This article is a reaction to a previously published article in the Journal of Microbiology & Biology Education, “Gamification of the Laboratory Experience to Encourage Student Engagement” by Kevin Drace (JMBE 14(2:273–274, 2013.

  7. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. ZAKI ABU RABI. Articles written in Journal of Biosciences. Volume 42 Issue 2 June 2017 pp 265-274 Article. Interleukin 8 in progression of hormone-dependent early breast cancer · JELENA MILOVANOVIĆ NATAŠA TODOROVIĆ-RAKOVIĆ TIJANA VUJASINOVIĆ ZAKI ABU RABI.

  8. Asset stripping and firm survival in mass privatization: testing the Hoff-Stiglitz and Campos-Giovannoni models in Montenegro

    Czech Academy of Sciences Publication Activity Database

    Koman, M.; Lakićević, M.; Prašnikar, J.; Švejnar, Jan

    2015-01-01

    Roč. 43, č. 2 (2015), s. 274-289 ISSN 0147-5967 R&D Projects: GA ČR(CZ) GA15-24642S Institutional support: RVO:67985998 Keywords : asset stripping * mass privatization * firm survival Subject RIV: AH - Economics Impact factor: 1.380, year: 2015

  9. 78 FR 38203 - Refunds and Exchanges

    Science.gov (United States)

    2013-06-26

    .... Adhesive stamps, unless mistakes were made in buying (9.1.4), stamps were defective, stamps are affixed to... Support Manual 274). b. The item was delayed due to strike or work stoppage. c. The item was delayed... control of USPS or air carriers; war, insurrection, or civil disturbance; delay or cancellation of flights...

  10. Aporia in the information-processing paradigm of contemporary cognitive psychology

    Czech Academy of Sciences Publication Activity Database

    Sedláková, Miluše

    1999-01-01

    Roč. 41, č. 4 (1999), s. 274-279 ISSN 0039-3320 R&D Projects: GA AV ČR KSK3077601 Keywords : information-processing approach * paradigm * cognitive psychology Subject RIV: AN - Psychology Impact factor: 0.115, year: 1999

  11. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. G Anandalingam. Articles written in Sadhana. Volume 30 Issue 2-3 April-June 2005 pp 257-274. Pricing strategies for information goods · Siva Viswanathan G Anandalingam · More Details Abstract Fulltext PDF. Digital or information goods are becoming the norm across a wide variety of ...

  12. Well Tempered Tuning Cannot Account for Low Purity Ratings of Isolated Voice Parts

    NARCIS (Netherlands)

    Schotanus, Yke

    2016-01-01

    Since Western people usually hear melodies in well tempered tunings, it is doubtful whether laymen would use a pure tuning as a reference when asked to judge whether a certain melody is sung in tune or not. In an earlier class room experiment among approximately 274 pupils (average age 15.6; SD 0.9)

  13. Přerov (okr. Přerov). Záchranné výzkumy a povrchové průzkumy 1999 – 2005

    Czech Academy of Sciences Publication Activity Database

    Drechsler, A.; Procházka, Rudolf; Schenk, Z.

    2006-01-01

    Roč. 47, - (2006), s. 274-278 ISSN 1211-7250 R&D Projects: GA ČR(CZ) GA404/03/0722 Institutional research plan: CEZ:AV0Z80010507 Keywords : Early Middle Age * Moravia, Přerov * archaeological research Subject RIV: AC - Archeology, Anthropology, Ethnology

  14. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. Siva Viswanathan. Articles written in Sadhana. Volume 30 Issue 2-3 April-June 2005 pp 257-274. Pricing strategies for information goods · Siva Viswanathan G Anandalingam · More Details Abstract Fulltext PDF. Digital or information goods are becoming the norm across a wide variety of ...

  15. Sources, Organization, Utilization of International Documentation; Proceedings of the International Symposium on the Documentation of the United Nations and Other Intergovernmental Organizations (Geneva, 21-23 August 1972).

    Science.gov (United States)

    International Federation for Documentation, The Hague (Netherlands).

    The symposium, organized by the United Nations Institute for Training and Research (UNITAR) with the cooperation of the Association of International Libraries (AIL), International Federation of Library Associations (IFLA), and International Federation for Documentation (FID), brought together 274 participants having a professional interest in the…

  16. Investigating Forest Inventory and Analysis-collected tree-ring data from Utah as a proxy for historical climate

    Science.gov (United States)

    R. Justin DeRose; W. Shih-Yu (Simon) Wang; John D. Shaw

    2012-01-01

    Increment cores collected as part of the periodic inventory in the Intermountain West were examined for their potential to represent growth and be a proxy for climate (precipitation) over a large region (Utah). Standardized and crossdated time-series created from pinyon pine (n=249) and Douglas-fir (n=274) increment cores displayed spatiotemporal patterns in growth...

  17. College Students' Compensatory Eating and Behaviors in Response to Alcohol Consumption

    Science.gov (United States)

    Bryant, Judith B.; Darkes, Jack; Rahal, Collin

    2012-01-01

    Objective: This study investigates college students' behaviors in response to the calories ingested by drinking alcohol. Participants and Methods: A sample of 274 nonclinical undergraduate alcohol drinkers completed an online survey asking about behaviors that students employed to make up for calories in alcohol or to get drunk more effectively.…

  18. Cancellative Residuated Lattices Arising on 2-Generated Submonoids of Natural Numbers

    Czech Academy of Sciences Publication Activity Database

    Horčík, Rostislav

    2010-01-01

    Roč. 63, 2-3 (2010), s. 261-274 ISSN 0002-5240 R&D Projects: GA AV ČR KJB100300701 Institutional research plan: CEZ:AV0Z10300504 Keywords : residuated lattice * cancellative commutative residuated lattice * subvariety lattice * submonoid of natural numbers Subject RIV: BA - General Mathematics Impact factor: 0.479, year: 2010

  19. Spin Rate of Asteroid (54509) 2000 PH5 Increasing Due to the YORP Effect

    Czech Academy of Sciences Publication Activity Database

    Taylor, P.A.; Margot, J. L.; Vokrouhlický, D.; Scheeres, D.J.; Pravec, Petr; Lowry, S.C.; Fitzsimmons, A.; Nolan, M. C.; Ostro, S. J.; Benner, L. A. M.; Giorgini, J. D.; Magri, C.

    2007-01-01

    Roč. 316, č. 5822 (2007), s. 274-277 ISSN 0036-8075 Grant - others:GA ČR(CZ) GA205/99/0255 Institutional research plan: CEZ:AV0Z10030501 Keywords : asteroids rotation * near- Earth objects * radar observations Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 26.372, year: 2007

  20. Direct Detection of the Asteroidal YORP Effect

    Czech Academy of Sciences Publication Activity Database

    Lowry, S.C.; Fitzsimmons, A.; Pravec, Petr; Vokrouhlický, D.; Boehnhardt, H.; Taylor, P.A.; Margot, J. L.; Galád, Adrián; Irwin, M.; Irwin, J.; Kušnirák, Peter

    2007-01-01

    Roč. 316, č. 5822 (2007), s. 272-274 ISSN 0036-8075 R&D Projects: GA AV ČR IAA3003204 Institutional research plan: CEZ:AV0Z10030501 Keywords : asteroids rotation * near- Earth objects Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 26.372, year: 2007

  1. Research funding systems in Australia, New Zealand and the UK

    DEFF Research Database (Denmark)

    Lewis, Jenny; Ross, S

    2011-01-01

    . This article reports on a study involving interviews with 274 academics at universities in Australia (Melbourne), New Zealand (Auckland) and the UK (Birmingham). Perceptions of the three research funding systems demonstrated significant differences across universities, and some interesting gender and seniority...

  2. 77 FR 39899 - Technical Corrections

    Science.gov (United States)

    2012-07-06

    ... requirements, Source material, Special nuclear material, Waste treatment and disposal. 10 CFR Part 21 Nuclear... Atomic Energy Act sec. 274 (42 U.S.C. 2021) and under Nuclear Waste Policy Act sec. 121 (42 U.S.C. 10141... NUCLEAR REGULATORY COMMISSION 10 CFR Chapter I [NRC-2012-0092] RIN 3150-AJ16 Technical Corrections...

  3. 75 FR 5561 - Notice of Funds Availability (NOFA) Inviting Applications for the Specialty Crop Block Grant...

    Science.gov (United States)

    2010-02-03

    ... the number of people or operations affected, the intended beneficiaries of each project, and/or... (36) North Carolina $1,139,042.15 (37) North Dakota $661,274.92 (38) Northern Mariana Islands $182,642...) South Dakota $208,568.67 (47) Tennessee $517,731.71 (48) Texas $1,785,844.77 (49) Utah $308,658.51 (50...

  4. The effect of diazinon on haematological indices of common carp (Cyprinus carpio L.)

    Czech Academy of Sciences Publication Activity Database

    Svoboda, M.; Lusková, Věra; Drastichová, J.; Žlábek, V.

    2001-01-01

    Roč. 70, č. 4 (2001), s. 457-465 ISSN 0001-7213 Institutional research plan: CEZ:MSM 162700004 Keywords : common carp * acute toxicity * haematology Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.274, year: 2001 http://vfu-www.vfu.cz/acta-vet/vol70/pdf/70_457.pdf

  5. Impairment of mitochondrial function of rat hepatocytes by high fat diet and oxidative stress

    Czech Academy of Sciences Publication Activity Database

    Garnol, T.; Endlicher, R.; Kučera, O.; Drahota, Zdeněk; Červinková, Z.

    2014-01-01

    Roč. 63, č. 2 (2014), s. 271-274 ISSN 0862-8408 R&D Projects: GA MŠk(CZ) LL1204 Grant - others:Univerzita Karlova(CZ) PRVOUK P37/02 Institutional support: RVO:67985823 Keywords : hepatocytes * high fat diet * mitochondrial activities * ROS Subject RIV: ED - Physiology Impact factor: 1.293, year: 2014

  6. Early Medieval gombiky from the “Lumbe Garden” cemetery, Prague Castle

    Czech Academy of Sciences Publication Activity Database

    Ottenwelter, Estelle; Děd, J.; Barčáková, Ludmila

    2017-01-01

    Roč. 32, 7-8 (2017), s. 836-849 ISSN 1042-6914 R&D Projects: GA ČR GAP405/12/2195 Institutional support: RVO:67985912 Keywords : gombiky * Bohemia * jewels * manufacture Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Archaeology Impact factor: 2.274, year: 2016

  7. Role of t-tubules in the control of trans-sarcolemmal ion flux and intracellular Ca2+ in a model of the rat cardiac ventricular myocyte

    Czech Academy of Sciences Publication Activity Database

    Pásek, Michal; Šimurda, J.; Orchard, C.

    2012-01-01

    Roč. 41, č. 6 (2012), s. 491-503 ISSN 0175-7571 Institutional research plan: CEZ:AV0Z20760514 Keywords : t-tubules * rat * cardiac myocyte * computer model * calcium Subject RIV: BO - Biophysics Impact factor: 2.274, year: 2012

  8. Expressivity of apomixis in 2n + n hybrids from an apomictic and a sexual parent: insights into variation detected in Pilosella (Asteraceae: Lactuceae)

    Czech Academy of Sciences Publication Activity Database

    Krahulcová, Anna; Krahulec, František; Rosenbaumová, R.

    2011-01-01

    Roč. 24, č. 1 (2011), s. 263-274 ISSN 0934-0882 R&D Projects: GA ČR GA206/08/0890 Institutional research plan: CEZ:AV0Z60050516 Keywords : inheritance of apomixis * residual sexuality * unreduced hybrids Subject RIV: EF - Botanics Impact factor: 1.869, year: 2011

  9. A Static Model of Abiotic Predictors and Forest Ecosystem Receptor Designed Using Dimensionality Reduction and Regression Analysis

    Czech Academy of Sciences Publication Activity Database

    Samec, P.; Rychtecká, P.; Tuček, P.; Bojko, J.; Zapletal, Miloš; Cudlín, Pavel

    2016-01-01

    Roč. 22, č. 2 (2016), s. 259-274 ISSN 1392-1355 R&D Projects: GA MŠk(CZ) LO1415 Institutional support: RVO:67179843 Keywords : forest state monitoring * EMEP-LRTAP * floodplain * mountain forests * canonical correlation analysis Subject RIV: EH - Ecology, Behaviour Impact factor: 0.635, year: 2016

  10. Is the golden hour optimally used in South Africa for children ...

    African Journals Online (AJOL)

    Results. Fifty-five children were included in the final analysis. The median duration of stay in the Trauma Unit was 205 minutes (interquartile range 135 - 274). Conclusion. Several factors were identified that unnecessarily prolonged the time that patients stayed in the trauma unit following arrival in hospital for polytrauma ...

  11. Point defects in hard-sphere crystals

    NARCIS (Netherlands)

    Pronk, S.; Frenkel, D.

    2001-01-01

    We report numerical calculations of the concentration of interstitials in hard-sphere crystals. We find that in a three-dimensional fcc hard-sphere crystal at the melting point, the concentration of interstitials is 2.7(4) × 10-8. This is some 3 orders of magnitude lower than the concentration of

  12. Personality correlates of self-esteem and life satisfaction

    Czech Academy of Sciences Publication Activity Database

    Blatný, Marek; Jelínek, Martin; Blížkovská, J.; Klimusová, Helena

    2004-01-01

    Roč. 46, č. 2 (2004), s. 97-104 ISSN 0039-3320 Institutional research plan: CEZ:AV0Z7025918 Keywords : self - esteem * five-factor model * life satisfaction Subject RIV: AN - Psychology Impact factor: 0.274, year: 2004

  13. Academic Self-Concept Structure of Higher Education Students.

    Science.gov (United States)

    Lau, Ivy Cheuk-yin; Yeung, Alexander Seeshing; Jin, Putai

    The structure of academic self-concept of university students in Hong Kong (n=274) was examined using the English, math, school, and general self-concept scales of Marsh's Academic Self Description Questionnaire and an additional Chinese self-concept scale. Confirmatory factor analysis clearly defined the a priori factors, even when both verbal…

  14. 75 FR 80426 - Defense Federal Acquisition Regulation Supplement; Reporting of Government-Furnished Property

    Science.gov (United States)

    2010-12-22

    ..., progress, or performance-based payments; (4) Intellectual property or software; and (5) Real property. 4... American Act--Free Trade Agreements--Balance of Payments Program Certificate. (ii) Use the provision at 252....274-6. (E) Use the provision at 252.225-7010, Commercial Derivative Military Article--Specialty Metals...

  15. Influence of Adolescent Social Crowds on the Development of Vocational Identity.

    Science.gov (United States)

    Johnson, John A.

    1987-01-01

    Examined relationship between membership in adolescent social crowds and vocational identity in early adulthood. In four samples (N=274), membership in five junior high school crowds (Motorheads, Brains, Freaks, Politicos, Conformists) was associated with higher scores on Realistic, Investigative, Artistic, Enterprising, and Conventional scales,…

  16. Landforms and Landform Evolution in West Germany: International Conference on Geomorphology (2nd) Held in Frankfurt am Main on 3-9 September 1989. CATENA Supplement 15

    Science.gov (United States)

    1989-01-01

    LEHMANN, H. (1970): Ober verzauberte Stiidte in Carbonatgesteinen Suidwesteuropas. Sitzung- benich! der Wiss. Gesell . a.d. J.-W. Goethe Universitdt, Bd 8... Arnold , London, 274 pp. RAUSCH, R. (1962): Wasserhaushalt, Feststoff- und Losungsaustrag im Einzugsgebiet der Aich. Dissertation, University of

  17. Upstream-downstream gradient in infection levels by fish parasites: a common river pattern?

    Czech Academy of Sciences Publication Activity Database

    Blasco-Costa, Maria Isabel; Koehler, A.V.; Martin, A.; Poulin, R.

    2013-01-01

    Roč. 140, č. 2 (2013), s. 266-274 ISSN 0031-1820 Institutional support: RVO:60077344 Keywords : trematode abundance * unidirectional river flow * infection patterns * disease * River Continuum Concept * freshwater * Coitocaecum parvum * Telogaster opisthorchis * Stegodexamene anguillae * Apatemon sp. Subject RIV: EH - Ecology, Behaviour Impact factor: 2.350, year: 2013

  18. Sokoto Journal of Veterinary Sciences: Submissions

    African Journals Online (AJOL)

    If necessary trade names may be given in brackets: e.g., “. . . diminazene aceturate (Berenil®, HOECHST, Munich). . .” ... 2.7.3 References to study design and statistical methods should be to standard works (with pages) rather than to papers in which the designs or methods were originally reported. 2.7.4 All statistical terms, ...

  19. The Connor-Davidson Resilience Scale as a Positive Psychology Measure for People with Spinal Cord Injuries

    Science.gov (United States)

    Fujikawa, Mayu; Lee, Eun-Jeong; Chan, Fong; Catalano, Denise; Hunter, Celeste; Bengtson, Kevin; Rahimi, Maryam

    2013-01-01

    The main objective of this study is to evaluate the measurement structure of the Connor-Davidson Resilience Scale (CD-RISC) as a positive psychology measure for people with spinal cord injuries (SCIs) using confirmatory factor analysis. The participants consisted of 274 Canadians with SCI living in the community. The result indicated that the…

  20. File list: NoD.Neu.05.AllAg.Brain [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available NoD.Neu.05.AllAg.Brain mm9 No description Neural Brain ERX161927,ERX161926,ERX16192...274,SRX298040,ERX402277,ERX402292,ERX402281 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/NoD.Neu.05.AllAg.Brain.bed ...

  1. X-ray crystal structure of divalent metal-activated ß-xyloisdase, RS223BX

    Science.gov (United States)

    We report the first X-ray structure of a glycoside hydrolase family 43 ß-xylosidase, RS223BX, which is strongly activated by the addition of divalent metal cations. The 2.69 Å structure reveals that the Ca2+ cation is located at the back of the active site pocket. The Ca2+ coordinates to H274 to sta...

  2. 10 CFR 150.33 - Criminal penalties.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Criminal penalties. 150.33 Section 150.33 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) EXEMPTIONS AND CONTINUED REGULATORY AUTHORITY IN AGREEMENT STATES AND IN OFFSHORE WATERS UNDER SECTION 274 Enforcement § 150.33 Criminal penalties. (a) Section 223 of the Atomic...

  3. A stochastic differential equation model for drug dissolution and its parameters

    Czech Academy of Sciences Publication Activity Database

    Lánský, Petr; Lánská, V.; Weiss, M.

    2004-01-01

    Roč. 100, č. 2 (2004), s. 267-274 ISSN 0168-3659 R&D Projects: GA MZd NR7795 Grant - others:DE - CZ(CZ) CZE 01/034 Institutional research plan: CEZ:AV0Z5011922 Keywords : dissolution * stochastic differential equation Subject RIV: FR - Pharmacology ; Medidal Chemistry Impact factor: 3.297, year: 2004

  4. school-based survey of adolescents' opinion on premarital sex in ...

    African Journals Online (AJOL)

    PROF. BARTH EKWEME

    premarital sex to be carried out in schools for these adolescents that are at risk of exposure to pre marital sex. ... time premarital is associated with high risk sexual ..... Sexual risk behaviour of street youths in South West. Nigeria. East Afr. J. Public Health, 6, (1): 274 –. 279. Potdar, R and Mmari, K., 2010. Factors influencing.

  5. Tolerance to acute ischemia in adult male and female spontaneously hypertensive rats

    Czech Academy of Sciences Publication Activity Database

    Bešík, J.; Szárszoi, Ondrej; Kuneš, Jaroslav; Netuka, I.; Malý, J.; Kolář, František; Pirk, J.; Ošťádal, Bohuslav

    2007-01-01

    Roč. 56, č. 3 (2007), s. 267-274 ISSN 0862-8408 R&D Projects: GA MŠk(CZ) 1M0510; GA MZd ND7607 Institutional research plan: CEZ:AV0Z50110509 Keywords : cardiac tolerance * ischemia injury * gender differences Subject RIV: ED - Physiology Impact factor: 1.505, year: 2007

  6. Nutritional value of raw soybeans, extruded soybeans, roasted ...

    African Journals Online (AJOL)

    Thirty multiparous Holstein cows (29.8 ± 4.01days in milk; 671.6 ± 31.47 kg of body weight) were used in a completely randomized design to compare nutritional value of four fat sources including tallow, raw soybeans, extruded soybeans and roasted soybeans for 8 weeks. Experimental diets were a control containing 27.4 ...

  7. Capillary electrophoresis in an extended nanospray tip-electrospray as an electrophoretic column

    Czech Academy of Sciences Publication Activity Database

    Týčová, Anna; Foret, František

    2015-01-01

    Roč. 1388, APR (2015), s. 274-279 ISSN 0021-9673 R&D Projects: GA ČR(CZ) GBP206/12/G014 Institutional support: RVO:68081715 Keywords : mass spectrometry * interface * separation * capillary electrophoresis Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 3.926, year: 2015

  8. Compositional variations of chromiferous spinel in Mg-rich rocks of ...

    Indian Academy of Sciences (India)

    basalts of Gujarat (India); Lithos 89 259–274. Melluso L, Morra V and Fedele L 2006b An overview of phase chemistry and magmatic evolution in the Cre- taceous flood basalt province of northern Madagascar;. Periodico di Mineralogia 75 175–188. Melluso L and Sethna S F 2010 Mineral composition of the Deccan Trap ...

  9. Role of Proinflammatory Cytokines in Thermal Activation of Lymphocyte Recruitment to Breast Tumor Microvessels

    Science.gov (United States)

    2007-03-01

    Chem. 274:264–269. Delaet, I., Boeye, A. (1993). Monoclonal antibodies that disrupt poliovirus only at fever temperatures. J. Virol. 67:5299–5302...during the diversification of vertebrate species. A growing body of evidence indicates that conventional mechanisms are not responsible for thermal

  10. The effect of Bt-corn on soil invertebrates, soil microbial community and decomposition rates of corn post-harvest residues under field and laboratory conditions

    Czech Academy of Sciences Publication Activity Database

    Frouz, Jan; Elhottová, Dana; Helingerová, M.; Kocourek, F.

    2008-01-01

    Roč. 32, č. 4 (2008), s. 645-655 ISSN 1044-0046 Institutional research plan: CEZ:AV0Z60660521 Keywords : Bt corn * soil biology * decomposition Subject RIV: EH - Ecology, Behaviour Impact factor: 0.274, year: 2008

  11. Morphogenesis and bone integration of the mouse mandibular third molar

    Czech Academy of Sciences Publication Activity Database

    Chlastáková, Ivana; Lungová, V.; Wells, K.; Tucker, A. S.; Radlanski, R.J.; Míšek, Ivan; Matalová, Eva

    2011-01-01

    Roč. 119, č. 4 (2011), s. 265-274 ISSN 0909-8836 R&D Projects: GA AV ČR IAA600450904; GA ČR GC524/08/J032 Institutional research plan: CEZ:AV0Z50450515 Keywords : 3D models * apoptosis * osteoclast activity Subject RIV: ED - Physiology Impact factor: 1.878, year: 2011

  12. 32 CFR 291.8 - Exemptions.

    Science.gov (United States)

    2010-07-01

    ... exclusively at private expense, and technical or scientific data developed in part with Federal funds and in... Supplement (DFARS), subpart 27.4. Technical data developed exclusively with Federal funds may be withheld... needs of a litigant, balanced against the interests of the agency in maintaining its confidentiality...

  13. Quantitative real-time PCR identifies a critical region of deletion on 22q13 related to prognosis in oral cancer

    DEFF Research Database (Denmark)

    Reis, Patricia P; Rogatto, Silvia R; Kowalski, Luiz P

    2002-01-01

    Quantitative real time PCR was performed on genomic DNA from 40 primary oral carcinomas and the normal adjacent tissues. The target genes ECGFB, DIA1, BIK, and PDGFB and the microsatellite markers D22S274 and D22S277, mapped on 22q13, were selected according to our previous loss of heterozygosity.......0018) for patients with DIA1 gene loss. Relative copy number losses detected in these sequences may be related to disease progression and a worse prognosis in patients with oral cancer....... System (PE Applied Biosystems). Losses in the sequences D22S274 (22q13.31) and in the DIA1 (22q13.2-13.31) gene were detected in 10 out of 40 cases (25%) each. Statistically significant correlations were observed for patients with relative copy number loss of the marker D22S274 and stages T3-T4......Quantitative real time PCR was performed on genomic DNA from 40 primary oral carcinomas and the normal adjacent tissues. The target genes ECGFB, DIA1, BIK, and PDGFB and the microsatellite markers D22S274 and D22S277, mapped on 22q13, were selected according to our previous loss of heterozygosity...

  14. Degradation of polycyclic aromatic hydrocarbons by hydrogen peroxide catalyzed by heterogeneous polymeric metal chelates

    Czech Academy of Sciences Publication Activity Database

    Baldrian, Petr; Cajthaml, Tomáš; Merhautová, Věra; Gabriel, Jiří; Nerud, František; Stopka, P.; Hrubý, Martin; Beneš, Milan J.

    2005-01-01

    Roč. 59, - (2005), s. 267-274 ISSN 0926-3373 R&D Projects: GA AV ČR IBS5020306; GA ČR GA203/01/0944 Institutional research plan: CEZ:AV0Z7090911 Keywords : degradation * polycyclic aromatic hydrocarbon * hydrogen peroxide Subject RIV: EE - Microbiology, Virology Impact factor: 3.809, year: 2005

  15. Regional unemployment and human capital in transition economies

    Czech Academy of Sciences Publication Activity Database

    Jurajda, Štěpán; Terrell, K.

    2009-01-01

    Roč. 17, č. 2 (2009), s. 241-274 ISSN 0967-0750 R&D Projects: GA MŠk LC542 Institutional research plan: CEZ:AV0Z70850503 Keywords : unemployment * human capital * regional labour markets Subject RIV: AH - Economics Impact factor: 0.774, year: 2009

  16. Strategie "zeleného růstu" a trh práce

    Czech Academy of Sciences Publication Activity Database

    Tošovská, Eva

    2011-01-01

    Roč. 59, č. 10 (2011), s. 987-1004 ISSN 0013-3035 Institutional research plan: CEZ:AV0Z70850503 Keywords : green growth strategy * environmental policy * employment Subject RIV: AH - Economics Impact factor: 0.274, year: 2011

  17. School Processes That Can Drive Scaling-Up of an Innovation or Contribute to Its Abandonment

    Science.gov (United States)

    Newman, Denis; Zacamy, Jenna; Lazarev, Valeriy; Lin, Li

    2017-01-01

    This five-year study focused on school processes that promoted the scaling-up of a high school academic literacy framework, Reading Apprenticeship, developed by WestEd's Strategic Literacy Initiative (SLI). Implementing an innovative strategy for scaling-up involving school-based cross-disciplinary teacher teams, SLI brought the framework to 274

  18. 47 CFR 27.1315 - Establishment, execution, and application of the network sharing agreement.

    Science.gov (United States)

    2010-10-01

    ... within 10 business days of the commencement of the negotiation period certifying that active and good... later than five business days after the six-month period for negotiation has expired, they must submit... are defined in § 27.4. (b) Requirement of negotiation. Negotiation of an NSA between the winning...

  19. Czech way to broadband

    Czech Academy of Sciences Publication Activity Database

    Kuchar, Anton; Peterka, J.; Hrstka, J.; Hankiewiczová, H.

    -, August (2006), s. 274-278 ISSN 1106-2975. [FITCE Congress /45./. Athens, 30.08.2006-02.09.2006] Grant - others:BReATH Consortium EU(XE) EC FP6 1ST Programme Institutional research plan: CEZ:AV0Z20670512 Keywords : telecommunication networks * Internet * broadband networks Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  20. 76 FR 11825 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2011-03-03

    ... 274.127d-1) is entitled ``Accounting of Segregated Trust Account.'' Rule 27d-1 requires the depositor... make an accounting of their segregated trust accounts on Form N-27D-1, which is intended to facilitate... number. The public may view the background documentation for this information collection at the following...

  1. Characterizing Lenses and Lensed Stars of High-magnification Single-lens Gravitational Microlensing Events with Lenses Passing over Source Stars

    DEFF Research Database (Denmark)

    Choi, J.-Y; Park, S.-Y; Han, C.

    2012-01-01

    -source effect. For seven events, we measure the Einstein radii and the lens-source relative proper motions. Among them, five events are found to have Einstein radii of less than 0.2 mas, making the lenses very low mass star or brown dwarf candidates. For MOA-2011-BLG-274, especially, the small Einstein radius...

  2. Some physical characteristics of the Antarctic and western Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    RamaRaju, D.V.; Somayajulu, Y.K.

    .5 degrees C and sigma t between 27 and 27.4 shows characteristics of a mixture of Persian Gulf and Red Sea waters. At depths of about 1500m and below the waters on the eastern side of the Andaman Islands are warmer than on the western side. The general...

  3. Some physical characteristics of Andaman sea waters during winter

    Digital Repository Service at National Institute of Oceanography (India)

    RamaRaju, D.V.; Gouveia, A.D.; Murty, C.S.

    .5 degrees C and sigma t between 27 and 27.4 shows characteristics of a mixture of Persian Gulf and Red Sea waters At depths of about 1500m and below the waters on the eastern side of the Andaman Islands are warmer than on the western side The general...

  4. Evaluation of Interleukin 8 gene polymorphism for predicting ...

    African Journals Online (AJOL)

    Rajasree Shanmuganathan

    2016-07-09

    Jul 9, 2016 ... Hacking D, Knight JC, Rockett K, Brown H, Frampton J, et al. Increased in vivo transcription of an IL-8 haplotype associated · with respiratory syncytial virus disease-susceptibility. Genes · Immun 2004;5:274–82. 10. Michaud DS, Daugherty SE, Berndt SI, Platz EA, Yeager M, et al. Genetic polymorphisms of ...

  5. 75 FR 10059 - Money Market Fund Reform

    Science.gov (United States)

    2010-03-04

    ....\\17\\ The Federal Reserve Board announced the creation of its Asset-Backed Commercial Paper Money... Part III Securities and Exchange Commission 17 CFR Parts 270 and 274 Money Market Fund Reform...; File Nos. S7-11-09, S7-20-09] RIN 3235-AK33 Money Market Fund Reform AGENCY: Securities and Exchange...

  6. Dispersion-managed semiconductor mode-locked ring laser.

    Science.gov (United States)

    Resan, Bojan; Archundia, Luis; Delfyett, Peter J; Alphonse, Gerard

    2003-08-01

    A novel breathing-mode external sigma-ring-cavity semiconductor mode-locked laser is developed. Intracavity pulse compression and stretching produce linearly chirped pulses with an asymmetric exponential temporal profile. External dispersion compensation reduces the pulse duration to 274 fs (within 10% of the bandwidth limit).

  7. Effect of oxygen intercalation on properties of sputtered CuYO2 for ...

    Indian Academy of Sciences (India)

    WINTEC

    at room temperature. The positive sign of Seebeck coefficient (+274 μVK. –1. ) ... et al 1997). This has generated much interest in p-type conducting transparent thin films (Thomas 1997; Banerjee and Chattopadhyay 2005). p-Type conductivity was found in a number of ... fect chemistry plays an important role. This deviation.

  8. 75 FR 873 - Extramural Support Reimbursement of Travel and Subsistence Expenses Toward Living Organ Donation...

    Science.gov (United States)

    2010-01-06

    ... Support Reimbursement of Travel and Subsistence Expenses Toward Living Organ Donation Program AGENCY... of making living donations of their organs. For example, if the community thinks lost wages and... donation of the organ.'' 42 U.S.C. 274e(c)(2). As the Secretary considers rulemaking, she will consider...

  9. 75 FR 18377 - Supplemental Nutrition Assistance Program, Regulation Restructuring: Issuance Regulation Update...

    Science.gov (United States)

    2010-04-12

    ... that significantly change the architecture of issuing benefits electronically. Nomenclature Changes The.... List of Subjects in 7 CFR part 274 Food stamps, Grant programs-social programs, Reporting and... to subcontract assigned issuance responsibilities. (1) Any assignment of issuance functions shall...

  10. Download this PDF file

    African Journals Online (AJOL)

    GB

    Ethiop J Health Sci. Vol. 24, No. 3. July2014. 274 of maxillary central incisor, which is attributed as very rare 'U-shape' morphology to the tooth. CASE REPORT. A 15 years old male patient reported with missing upper front teeth on left side. His mother revealed he had history of trauma when he was 4 years old. The trauma ...

  11. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    pp 185-194 Perspectives. The history of vitamin C research in India · I B Chatterjee .... pp 263-274 Articles. Variations in morphological and life-history traits under extreme temperatures in Drosophila ananassae · Seema Sisodia B N Singh .... pp 321-331 Review. Living with urea stress · Laishram R Singh Tanveer Ali Dar ...

  12. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. B N Singh. Articles written in Journal of Biosciences. Volume 34 Issue 2 June 2009 pp 263-274 Articles. Variations in morphological and life-history traits under extreme temperatures in Drosophila ananassae · Seema Sisodia B N Singh · More Details Abstract Fulltext PDF.

  13. 78 FR 22332 - Notice of Quarterly Report (October 1, 2012-December 31, 2012)

    Science.gov (United States)

    2013-04-15

    .... Wastewater Network Project...... $54,274,261 Improve the overall $5,013,881 Sewer blockage events waste water... Increase the volume $19,819,887 Treated wastewater used Plant Expansion Project. of treated waste in... disbursed. Energy and Environmental Project $45,266,205 Increased wealth $37,626,540 Households purchasing...

  14. Defining pottery use and animal management at the Neolithic site of Bylany (Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Mátlová, V.; Roffet-Salque, M.; Pavlů, Ivan; Kyselka, J.; Sedlářová, I.; Filip, V.; Evershed, R. P.

    2017-01-01

    Roč. 14, August (2017), s. 262-274 ISSN 2352-409X Institutional support: RVO:67985912 Keywords : LBK pottery * organic residue analysis * gas chromatography * fatty acids * stable carbon isotope analyse * vessel use * porosity Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Archaeology

  15. New sections in Taraxacum

    Czech Academy of Sciences Publication Activity Database

    Kirschner, Jan; Štěpánek, Jan

    2004-01-01

    Roč. 39, č. 3 (2004), s. 259-274 ISSN 0015-5551 R&D Projects: GA AV ČR KSK6005114; GA ČR GA206/02/0346 Institutional research plan: CEZ:AV0Z6005908 Keywords : Asteraceae * Compositae * Lactuceae Subject RIV: EF - Botanics Impact factor: 0.968, year: 2004

  16. The impact and cost-effectiveness of the Amref Health Africa-Smile ...

    African Journals Online (AJOL)

    Introduction: Cleft lip with or without cleft palate (CLP) is a congenital malformation that causes significant morbidity in low and middle income countries. Amref Health Africa has partnered with Smile Train to provide CLP surgeries since 2006. Methods: We analyzed anonymized data of 37,274 CLP patients from the Smile ...

  17. Language Learning Strategies of Language e-Learners in Turkey

    Science.gov (United States)

    Solak, Ekrem; Cakir, Recep

    2015-01-01

    The purpose of this study was to determine the use of language learning strategies of e-learners and to understand whether there were any correlations between language learning strategies and academic achievement. Participants of the study were 274?e-learners, 132 males and 142 females, enrolled in an e-learning program from various majors and…

  18. Dawn of Science

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 16; Issue 3. Dawn of Science - The Role of Modern Medicine. T Padmanabhan. Series Article Volume 16 Issue 3 March 2011 pp 274-278. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/reso/016/03/0274-0278 ...

  19. Supervision Anxiety as a Predictor for Organizational Cynicism in Teachers

    Science.gov (United States)

    Gündüz, Hasan Basri; Ömür, Yunus Emre

    2016-01-01

    The purpose of this is study is to reveal how the anxiety that the teachers who work in the Beyoglu district of Istanbul experience, due to the supervision process, predict their organizational cynicism levels. With this respect, the study was conducted on 274 teachers with the relational screening model. The "Supervision Anxiety Scale"…

  20. Research

    African Journals Online (AJOL)

    abp

    16 mars 2016 ... seulement d'épargner de l'argent mais aussi de réduire de 40 à 42% le risque de contracter le paludisme [20]. La participation des parents dans les interventions de ..... Determinants of hanging and use of ITNs in the context of near universal coverage in Zambia. Health Policy. Plan. 2012; 27(4): 316-25.

  1. Investigations into the Nature of Halogen Bonding Including Symmetry Adapted Perturbation Theory Analyses

    Czech Academy of Sciences Publication Activity Database

    Riley, Kevin Eugene; Hobza, Pavel

    2008-01-01

    Roč. 4, č. 2 (2008), s. 232-242 ISSN 1549-9618 R&D Projects: GA MŠk LC512; GA AV ČR IAA400550510 Institutional research plan: CEZ:AV0Z40550506 Keywords : halogen bonding * SAPT * molecular complexes Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.274, year: 2008

  2. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Nine hundred and fifty-one samples were analysed for the presence of 12 MEFV mutations by PCR and reverse-hybridization (FMF StripAssay, ViennaLab, Vienna, Austria). Confirmatory dideoxy sequencing of allMEFV gene exons was performed for 39 patients. Fifty-seven (27.4%) healthy individual carried mutant MEFV ...

  3. SPIDIA-DNA: An External Quality Assessment for the pre-analytical phase of blood samples used for DNA-based analyses

    Czech Academy of Sciences Publication Activity Database

    Malentacchi, F.; Pazzagli, M.; Simi, L.; Orlando, C.; Wyrich, R.; Hartmann, C.C.; Verderio, P.; Pizzamiglio, S.; Ciniselli, C.M.; Tichopád, Aleš; Kubista, Mikael; Gelmini, S.

    -, č. 424 (2013), s. 274-286 ISSN 0009-8981 Institutional research plan: CEZ:AV0Z50520701 Keywords : Pre-analytical phase * DNA quality * Blood samples Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.764, year: 2013

  4. Metallographic examination and reconstruction of the 6th century lombardic sword from Kyjov

    Czech Academy of Sciences Publication Activity Database

    Hošek, Jiří; Bárta, P.; Šmerda, J.

    2017-01-01

    Roč. 32, 7-8 (2017), s. 885-899 ISSN 1042-6914 R&D Projects: GA ČR GAP405/12/2289 Institutional support: RVO:67985912 Keywords : sword * Kyjov * metallography * Lombards Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Archaeology Impact factor: 2.274, year: 2016

  5. Different habitats within a region contain evolutionary heritage from different epochs depending on the abiotic environment

    Czech Academy of Sciences Publication Activity Database

    Bartish, Igor V.; Ozinga, W.A.; Bartish, M. I.; Wamelink, G. W. W.; Hennekens, S.M.; Prinzing, A.

    2016-01-01

    Roč. 25, č. 3 (2016), s. 274-285 ISSN 1466-822X Grant - others:AV ČR(CZ) Fellowship J. E. Purkyně Institutional support: RVO:67985939 Keywords : museums and cradles of diversity * palaeoecology * macroevolutionary ecology Subject RIV: EH - Ecology, Behaviour Impact factor: 6.045, year: 2016

  6. Heavy metal concentrations in, and human health risk assessment ...

    African Journals Online (AJOL)

    Water, sediment and fish samples were collected for six months and heavy metals were determined using an Atomic Absorption Spectrometer. Fe ranked highest in water and sediment, with concentrations of 2.74 mg l−1 and 61.60 mg kg−1, respectively. Metals followed the magnitude of Fe > Mn > Ni > V > Pb in the water ...

  7. Temperature, salinity and transmissivity data from the Alpha Helix in the Arctic Ocean, 2000 - 2004 (NODC Accession 0059005)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This is calibrated CTD downcast data from five Alpha Helix cruises: HX235, 8/1/2000 - 9/30/2000 HX250, 9/1/2001 - 9/30/2001 HX260, 6/1/2002 - 6/30/2002 HX274,...

  8. H II Regions Within a Compact High Velocity Cloud. A Nearly Starless Dwarf Galaxy?

    NARCIS (Netherlands)

    Bellazzini, M.; Magrini, L.; Mucciarelli, A.; Beccari, G.; Ibata, R.; Battaglia, G.; Martin, N.; Testa, V.; Fumana, M.; Marchetti, A.; Correnti, M.; Fraternali, F.

    Within the SECCO survey we identified a candidate stellar counterpart to the Ultra Compact High Velocity Cloud (UCHVC) HVC274.68+74.70-123 that was suggested by Adams et al. to be a possible mini halo within the Local Group of galaxies. The spectroscopic follow-up of the brightest sources within the

  9. Enantiomeric composition of germacrene D in .I.Aesculus hippocastanum./I..

    Czech Academy of Sciences Publication Activity Database

    Kalinová, Blanka; Borg-Karlson, A. K.; Svatoš, Aleš

    2003-01-01

    Roč. 97, - (2003), s. s273-s274 ISSN 0009-2770. [Conference on Isoprenoids /20./. 12.09.2003-18.09.2003, Liberec] Institutional research plan: CEZ:AV0Z4055905 Keywords : germacrene D * .I.Aesculus hippocastanum./I. * .I.Cameraria ohridella./I. Subject RIV: CC - Organic Chemistry

  10. A catalogue of the Coelenterate type specimens of the Zoological Museum of Amsterdam. IV. Gorgonacea, Actiniaria, Scleractinia

    NARCIS (Netherlands)

    Soest, van R.W.M.

    1979-01-01

    This final part of the Coelenterate type catalogue lists 274 nominal types (183 Gorgonacea, 9 Actiniaria and 82 Scleractinia). Six not previously depicted types are represented by photographic illustrations of their habit. Furthermore lists are provided of schizotypes, i.e. fragments of types housed

  11. Using brothel leadership to promote condom use among brothel-based female sex workers in Abuja, Nigeria : study protocol for a cluster randomized pilot trial

    NARCIS (Netherlands)

    Okafor, Uchenna; Crutzen, Rik; Okekearu, Ifeanyi; Adebajo, Sylvia; Uzoh, Adaora; Awo, Egbe Aneotah; Chima, Chukwuemeka; Agwagwa, Ogechukwu; Van Den Borne, Bart

    2017-01-01

    Background The HIV prevalence among female populations involved in sex work in Nigeria has heightened interest in HIV prevention programming for this sub-population with brothel-based female sex workers (BB FSWs) having a prevalence of 27.4%, six times higher than the prevalence in the general

  12. Influenza virus resistance to oseltamivir: what are the implications?

    NARCIS (Netherlands)

    Fleming, D.M.; Elliot, A.J.; Meijer, A.; Paget, W.J.

    2009-01-01

    Influenza caused by an oseltamivir-resistant influenza A(H1N1) virus was widespread across Europe during the 2007–08 winter. About 25% of A(H1N1) viruses tested in the European Influenza Surveillance Scheme (EISS) were resistant with an H274Y mutation in the neuraminidase glycoprotein. Early

  13. Can war foster cooperation?

    Czech Academy of Sciences Publication Activity Database

    Bauer, Michal; Blattman, C.; Chytilová, Julie; Henrich, J.; Miguel, E.; Mitts, T.

    2016-01-01

    Roč. 30, č. 3 (2016), s. 249-274 ISSN 0895-3309 R&D Projects: GA ČR(CZ) GBP402/12/G130 Institutional support: RVO:67985998 Keywords : war * conflict * cooperation Subject RIV: AH - Economics Impact factor: 5.727, year: 2016

  14. Metallographic examination of two medieval knives from Kobilić (Republic of Croatia)

    Czech Academy of Sciences Publication Activity Database

    Thiele, Á.; Hošek, Jiří; Antonić, N.; Rácz, T. Á.

    2017-01-01

    Roč. 32, 7-8 (2017), s. 867-875 ISSN 1042-6914 Institutional support: RVO:67985912 Keywords : knife * Kobilić * metallography * Middle Ages Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Archaeology Impact factor: 2.274, year: 2016

  15. Pharmacological and Behavioral Enhancement of Neuroplasticity in the MPTP-Lesioned Mouse and Nonhuman Primate

    Science.gov (United States)

    2009-05-01

    in adults where serotonin levels remain unchanged (Branchi et al., 2008; Snyder et al., 1986; Stachowiak et al., 1986). On the other hand, MPTP...245, 274–281. Stachowiak , M.K., Stricker, E.M., Jacoby, J.H., Zigmond, M.J., 1986. Increased tryptophan hydroxylase activity in serotonergic nerve

  16. Social Concepts and Judgments: A Semantic Differential Analysis of the Concepts Feminist, Man, and Woman

    Science.gov (United States)

    Pierce, W. David; Sydie, R. A.; Stratkotter, Rainer

    2003-01-01

    Male and female participants (N = 274) made judgments about the social concepts of "feminist," "man," and "woman" on 63 semantic differential items. Factor analysis identified three basic dimensions termed evaluative, potency, and activity as well as two secondary factors called expressiveness and sexuality. Results for the evaluative dimension…

  17. Programmable Surfaces

    Science.gov (United States)

    2014-03-30

    Griffith, IEEE Transactions on Robotics (27:4), pp. 718-729 (2011)], electropermanent actuators for high torque at low RPM with static holding...active cylinders in an engine or fibers in a muscle . Fan array number and orientation dependence The next question addressed was the aerodynamic

  18. Application of model studies for quality control of bottom pressure based GLOSS sea level gauge at Takoradi Harbour (Ghana, West Africa)

    Digital Repository Service at National Institute of Oceanography (India)

    Joseph, A.; Mehra, P.; Desai, R.G.P.; Dotse, J.; Odammetey, J.T.; Nkebi, E.K.; VijayKumar, K.; Prabhudesai, S.

    on the optimal quantum of tide-staff measurements to be used, or the most appropriate sequence of such measurements in relation to spring/neap cycles for the purpose PROCEEDINGS OF SYMPOL-2005 274 of the best possible utilization of tide-staff measurements...

  19. Carl Napoleon Balling. Kvasný chemik a cukrovarník

    Czech Academy of Sciences Publication Activity Database

    Jindra, Jiří

    2018-01-01

    Roč. 112, č. 4 (2018), s. 274 ISSN 0009-2770 Institutional support: RVO:68378114 Keywords : Carl Napoleon Balling * chemistry * sugar industry Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings) Impact factor: 0.387, year: 2016

  20. Large-scale meta-analysis of genome-wide association data identifies six new risk loci for Parkinson's disease

    NARCIS (Netherlands)

    Nalls, Mike A.; Pankratz, Nathan; Lill, Christina M.; Do, Chuong B.; Hernandez, Dena G.; Saad, Mohamad; DeStefano, Anita L.; Kara, Eleanna; Bras, Jose; Sharma, Manu; Schulte, Claudia; Keller, Margaux F.; Arepalli, Sampath; Letson, Christopher; Edsall, Connor; Stefansson, Hreinn; Liu, Xinmin; Pliner, Hannah; Lee, Joseph H.; Cheng, Rong; Ikram, M. Arfan; Ioannidis, John P. A.; Hadjigeorgiou, Georgios M.; Bis, Joshua C.; Martinez, Maria; Perlmutter, Joel S.; Goate, Alison; Marder, Karen; Fiske, Brian; Sutherland, Margaret; Xiromerisiou, Georgia; Myers, Richard H.; Clark, Lorraine N.; Stefansson, Kari; Hardy, John A.; Heutink, Peter; Chen, Honglei; Wood, Nicholas W.; Houlden, Henry; Payami, Haydeh; Brice, Alexis; Scott, William K.; Gasser, Thomas; Bertram, Lars; Eriksson, Nicholas; Foroud, Tatiana; Singleton, Andrew B.; Plagnol, Vincent; Sheerin, Una-Marie; Simón-Sánchez, Javier; Lesage, Suzanne; Sveinbjörnsdóttir, Sigurlaug; Barker, Roger; Ben-Shlomo, Yoav; Berendse, Henk W.; Berg, Daniela; Bhatia, Kailash; de Bie, Rob M. A.; Biffi, Alessandro; Bloem, Bas; Bochdanovits, Zoltan; Bonin, Michael; Bras, Jose M.; Brockmann, Kathrin; Brooks, Janet; Burn, David J.; Charlesworth, Gavin; Chinnery, Patrick F.; Chong, Sean; Clarke, Carl E.; Cookson, Mark R.; Cooper, J. Mark; Corvol, Jean Christophe; Counsell, Carl; Damier, Philippe; Dartigues, Jean-François; Deloukas, Panos; Deuschl, Günther; Dexter, David T.; van Dijk, Karin D.; Dillman, Allissa; Durif, Frank; Dürr, Alexandra; Edkins, Sarah; Evans, Jonathan R.; Foltynie, Thomas; Dong, Jing; Gardner, Michelle; Gibbs, J. Raphael; Gray, Emma; Guerreiro, Rita; Harris, Clare; van Hilten, Jacobus J.; Hofman, Albert; Hollenbeck, Albert; Holton, Janice; Hu, Michele; Huang, Xuemei; Wurster, Isabel; Mätzler, Walter; Hudson, Gavin; Hunt, Sarah E.; Huttenlocher, Johanna; Illig, Thomas; Jónsson, Pálmi V.; Lambert, Jean-Charles; Langford, Cordelia; Lees, Andrew; Lichtner, Peter; Limousin, Patricia; Lopez, Grisel; Lorenz, Delia; McNeill, Alisdair; Moorby, Catriona; Moore, Matthew; Morris, Huw R.; Morrison, Karen E.; Mudanohwo, Ese; O'Sullivan, Sean S.; Pearson, Justin; Pétursson, Hjörvar; Pollak, Pierre; Post, Bart; Potter, Simon; Ravina, Bernard; Revesz, Tamas; Riess, Olaf; Rivadeneira, Fernando; Rizzu, Patrizia; Ryten, Mina; Sawcer, Stephen; Schapira, Anthony; Scheffer, Hans; Shaw, Karen; Shoulson, Ira; Sidransky, Ellen; Smith, Colin; Spencer, Chris C. A.; Stefánsson, Hreinn; Bettella, Francesco; Stockton, Joanna D.; Strange, Amy; Talbot, Kevin; Tanner, Carlie M.; Tashakkori-Ghanbaria, Avazeh; Tison, François; Trabzuni, Daniah; Traynor, Bryan J.; Uitterlinden, André G.; Velseboer, Daan; Vidailhet, Marie; Walker, Robert; van de Warrenburg, Bart; Wickremaratchi, Mirdhu; Williams, Nigel; Williams-Gray, Caroline H.; Winder-Rhodes, Sophie; Stefánsson, Kári; Hardy, John; Factor, S.; Higgins, D.; Evans, S.; Shill, H.; Stacy, M.; Danielson, J.; Marlor, L.; Williamson, K.; Jankovic, J.; Hunter, C.; Simon, D.; Ryan, P.; Scollins, L.; Saunders-Pullman, R.; Boyar, K.; Costan-Toth, C.; Ohmann, E.; Sudarsky, L.; Joubert, C.; Friedman, J.; Chou, K.; Fernandez, H.; Lannon, M.; Galvez-Jimenez, N.; Podichetty, A.; Thompson, K.; Lewitt, P.; Deangelis, M.; O'Brien, C.; Seeberger, L.; Dingmann, C.; Judd, D.; Marder, K.; Fraser, J.; Harris, J.; Bertoni, J.; Peterson, C.; Rezak, M.; Medalle, G.; Chouinard, S.; Panisset, M.; Hall, J.; Poiffaut, H.; Calabrese, V.; Roberge, P.; Wojcieszek, J.; Belden, J.; Jennings, D.; Marek, K.; Mendick, S.; Reich, S.; Dunlop, B.; Jog, M.; Horn, C.; Uitti, R.; Turk, M.; Ajax, T.; Mannetter, J.; Sethi, K.; Carpenter, J.; Dill, B.; Hatch, L.; Ligon, K.; Narayan, S.; Blindauer, K.; Abou-Samra, K.; Petit, J.; Elmer, L.; Aiken, E.; Davis, K.; Schell, C.; Wilson, S.; Velickovic, M.; Koller, W.; Phipps, S.; Feigin, A.; Gordon, M.; Hamann, J.; Licari, E.; Marotta-Kollarus, M.; Shannon, B.; Winnick, R.; Simuni, T.; Videnovic, A.; Kaczmarek, A.; Williams, K.; Wolff, M.; Rao, J.; Cook, M.; Fernandez, M.; Kostyk, S.; Hubble, J.; Campbell, A.; Reider, C.; Seward, A.; Camicioli, R.; Carter, J.; Nutt, J.; Andrews, P.; Morehouse, S.; Stone, C.; Mendis, T.; Grimes, D.; Alcorn-Costa, C.; Gray, P.; Haas, K.; Vendette, J.; Sutton, J.; Hutchinson, B.; Young, J.; Rajput, A.; Klassen, L.; Shirley, T.; Manyam, B.; Simpson, P.; Whetteckey, J.; Wulbrecht, B.; Truong, D.; Pathak, M.; Frei, K.; Luong, N.; Tra, T.; Tran, A.; Vo, J.; Lang, A.; Kleiner- Fisman, G.; Nieves, A.; Johnston, L.; So, J.; Podskalny, G.; Giffin, L.; Atchison, P.; Allen, C.; Martin, W.; Wieler, M.; Suchowersky, O.; Furtado, S.; Klimek, M.; Hermanowicz, N.; Niswonger, S.; Shults, C.; Fontaine, D.; Aminoff, M.; Christine, C.; Diminno, M.; Hevezi, J.; Dalvi, A.; Kang, U.; Richman, J.; Uy, S.; Sahay, A.; Gartner, M.; Schwieterman, D.; Hall, D.; Leehey, M.; Culver, S.; Derian, T.; Demarcaida, T.; Thurlow, S.; Rodnitzky, R.; Dobson, J.; Lyons, K.; Pahwa, R.; Gales, T.; Thomas, S.; Shulman, L.; Weiner, W.; Dustin, K.; Singer, C.; Zelaya, L.; Tuite, P.; Hagen, V.; Rolandelli, S.; Schacherer, R.; Kosowicz, J.; Gordon, P.; Werner, J.; Serrano, C.; Roque, S.; Kurlan, R.; Berry, D.; Gardiner, I.; Hauser, R.; Sanchez-Ramos, J.; Zesiewicz, T.; Delgado, H.; Price, K.; Rodriguez, P.; Wolfrath, S.; Pfeiffer, R.; Davis, L.; Pfeiffer, B.; Dewey, R.; Hayward, B.; Johnson, A.; Meacham, M.; Estes, B.; Walker, F.; Hunt, V.; O'Neill, C.; Racette, B.; Swisher, L.; Dijamco, Cheri; Conley, Emily Drabant; Dorfman, Elizabeth; Tung, Joyce Y.; Hinds, David A.; Mountain, Joanna L.; Wojcicki, Anne; Lew, M.; Klein, C.; Golbe, L.; Growdon, J.; Wooten, G. F.; Watts, R.; Guttman, M.; Goldwurm, S.; Saint-Hilaire, M. H.; Baker, K.; Litvan, I.; Nicholson, G.; Nance, M.; Drasby, E.; Isaacson, S.; Burn, D.; Pramstaller, P.; Al-hinti, J.; Moller, A.; Sherman, S.; Roxburgh, R.; Slevin, J.; Perlmutter, J.; Mark, M. H.; Huggins, N.; Pezzoli, G.; Massood, T.; Itin, I.; Corbett, A.; Chinnery, P.; Ostergaard, K.; Snow, B.; Cambi, F.; Kay, D.; Samii, A.; Agarwal, P.; Roberts, J. W.; Higgins, D. S.; Molho, Eric; Rosen, Ami; Montimurro, J.; Martinez, E.; Griffith, A.; Kusel, V.; Yearout, D.; Zabetian, C.; Clark, L. N.; Liu, X.; Lee, J. H.; Taub, R. Cheng; Louis, E. D.; Cote, L. J.; Waters, C.; Ford, B.; Fahn, S.; Vance, Jeffery M.; Beecham, Gary W.; Martin, Eden R.; Nuytemans, Karen; Pericak-Vance, Margaret A.; Haines, Jonathan L.; DeStefano, Anita; Seshadri, Sudha; Choi, Seung Hoan; Frank, Samuel; Psaty, Bruce M.; Rice, Kenneth; Longstreth, W. T.; Ton, Thanh G. N.; Jain, Samay; van Duijn, Cornelia M.; Verlinden, Vincent J.; Koudstaal, Peter J.; Singleton, Andrew; Cookson, Mark; Hernandez, Dena; Nalls, Michael; Zonderman, Alan; Ferrucci, Luigi; Johnson, Robert; Longo, Dan; O'Brien, Richard; Traynor, Bryan; Troncoso, Juan; van der Brug, Marcel; Zielke, Ronald; Weale, Michael; Ramasamy, Adaikalavan; Dardiotis, Efthimios; Tsimourtou, Vana; Spanaki, Cleanthe; Plaitakis, Andreas; Bozi, Maria; Stefanis, Leonidas; Vassilatis, Dimitris; Koutsis, Georgios; Panas, Marios; Lunnon, Katie; Lupton, Michelle; Powell, John; Parkkinen, Laura; Ansorge, Olaf

    2014-01-01

    We conducted a meta-analysis of Parkinson's disease genome-wide association studies using a common set of 7,893,274 variants across 13,708 cases and 95,282 controls. Twenty-six loci were identified as having genome-wide significant association; these and 6 additional previously reported loci were

  1. Molecular cloning, expression analysis and sequence prediction of ...

    African Journals Online (AJOL)

    ajl yemi

    2011-11-28

    Nov 28, 2011 ... Besides, one basic leucine zipper domain (bZIP) in amino acid area from 274 to 337 was found, concurring with the main characteristic of C/EBPs. Homologous comparison of the amino acid sequences from C/EBPβ cloned in this study and those from different species indicated C/EBPβ gene of Qinchuan ...

  2. Parachanna obscura

    African Journals Online (AJOL)

    (2 g/day), few bones, and tasty flesh, accepts high stocking density and can ... biology of african Snakehead parachanna obscura in itu-cross river ..... (2012) on biology and ecology characterization of P. obscura in South of. Benin where the regression coefficient were. 2.74 and 2.66 in two regions without sexual difference.

  3. Influence of diethyldithiocarbamate on cadmium and copper toxicity ...

    African Journals Online (AJOL)

    drinie

    Daphnia magna. Environ. Technol. Lett. 5 109-120. ROBERT W (1984) The toxicity and bioaccumulation of cadmium and copper as affected by humic acid. Aquat. Toxicol. 5 267-274. WHITTON B and SHEHATA F (1982) Influence of cobalt, nickel, copper and cadmium on blue green alga Anacystis nidulans. Environ. Pollut.

  4. Dicty_cDB: Contig-U14809-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) Plasmodium falciparum adhesive-like protein pseud... 40 0.10 2 ( CU302368 ) Pig...4B16 in... 36 0.10 4 ( AC079638 ) Genomic sequence for Mus musculus, clone RP23-274... 40 0.10 2 ( AF324831

  5. 5 CFR 330.1106 - Appointment.

    Science.gov (United States)

    2010-01-01

    ... Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS RECRUITMENT, SELECTION, AND PLACEMENT (GENERAL) Federal Employment Priority Consideration Program for Displaced Employees of the... under Public Law 105-274. For employees appointed before October 21, 1998, the conversion will be...

  6. Role of traditions in tourism development in the Czech part of the Bohemian Forest

    Czech Academy of Sciences Publication Activity Database

    Kušová, Drahomíra; Těšitel, Jan; Bartoš, Michael

    2002-01-01

    Roč. 8, - (2002), s. 265-274 ISSN 1211-7420 Grant - others:GA-(EU) QLK5-CT-2000-01211-SPRITE; 960 72(US) RSS 358/1999 Institutional research plan: CEZ:AV0Z3042911 Keywords : rural tourism * Šumava Mts. region * traditions Subject RIV: AO - Sociology, Demography

  7. Genetic control of plasticity in root morphology and anatomy of rice in response to water deficit

    NARCIS (Netherlands)

    Kadam, Niteen N.; Tamilselvan, Anandhan; Lawas, Lovely M.F.; Quinones, Cherryl; Bahuguna, Rajeev N.; Thomson, Michael J.; Dingkuhn, Michael; Muthurajan, Raveendran; Struik, Paul C.; Yin, Xinyou; Jagadish, Krishna S.V.

    2017-01-01

    Elucidating the genetic control of rooting behavior under water-deficit stress is essential to breed climate-robust rice (Oryza sativa) cultivars. Using a diverse panel of 274 indica genotypes grown under control and water-deficit conditions during vegetative growth, we phenotyped 35 traits, mostly

  8. Assessment of the level of farm labor availability and productivity in ...

    African Journals Online (AJOL)

    Assessment of the level of farm labor availability and productivity in Imo state, Nigeria. OC Korie. Abstract. No Abstract. International Journal of Tropical Agriculture and Food Systems Vol. 1 (3) 2007: pp. 270-274. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.

  9. The Minimum Wage: Labor Market Consequences in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Fialová, K.; Mysíková, Martina

    2009-01-01

    Roč. 59, č. 3 (2009), s. 255-274 ISSN 0015-1920 R&D Projects: GA ČR GA403/08/1369 Institutional research plan: CEZ:AV0Z70280505 Keywords : minimum wage * employment probability * unemployment Subject RIV: AH - Economics Impact factor: 0.264, year: 2009

  10. The Manufacture of the Grinding Wheels Based on the Ca–K Geopolymer Matrix

    Czech Academy of Sciences Publication Activity Database

    Perná, Ivana; Hanzlíček, Tomáš; Boura, P.; Lučaník, A.

    2016-01-01

    Roč. 31, č. 5 (2016), s. 667-672 ISSN 1042-6914 Institutional support: RVO:67985891 Keywords : geopolymer * grinding * wheel * low-temperature * industrial * manufacturing * technology Subject RIV: DM - Solid Waste and Recycling Impact factor: 2.274, year: 2016

  11. Developments for transactinide chemistry experiments behind the gas-filled separator TASCA

    International Nuclear Information System (INIS)

    Even, Julia

    2011-01-01

    synthesised carbonyl complexes were identified by nuclear decay spectroscopy. Some complexes were studied with isothermal chromatography or thermochromatography methods. The chromatograms were compared with Monte Carlo Simulations to determine the adsorption enthalpyrnon silicon dioxide and on gold. These simulations based on existing codes, that were modified for the different geometries of the chromatography channels. All observed adsorption enthalpies (on silcon oxide as well as on gold) are typical for physisorption. Additionally, the thermalstability of some of the carbonyl complexes was studied. This showed that at temperatures above 200 C therncomplexes start to decompose. It was demonstrated that carbonyl-complex chemistry is a suitable method to study rutherfordium, dubnium, seaborgium, bohrium, hassium, and meitnerium. Until now, only very simple, thermally stable compounds have been synthesized in the gas-phase chemistry of the transactindes. With the synthesis of transactinide-carbonyl complexes a new compound class would be discovered. Transactinide chemistry would reach the border between inorganic and metallorganic chemistry. Furthermore, the in-situ synthesised carbonyl complexes would allow nuclear spectroscopy studies under low background conditions making use of chemically prepared samples. [de

  12. MicroSISAK. Continuous liquid-liquid extractions of radionuclides at {>=} 0.2 mL/min

    Energy Technology Data Exchange (ETDEWEB)

    Hild, D.; Eberhardt, K.; Kratz, J.V.; Wiehl, N. [Mainz Univ. (Germany). Inst. fuer Kernchemie; Even, J. [Mainz Univ. (Germany). Inst. fuer Kernchemie; Helmholtz-Institut Mainz, Mainz (Germany); Loeb, P.; Werner, B.; Hofmann, C. [Institut fuer Mikrotechnik Mainz GmbH, Mainz (Germany)

    2013-07-01

    extraction yield determined as the ratio of the Tc {gamma}-ray activities in both detectors was 76 {+-} 1%. With this experiment, it was demonstrated that MicroSISAK is in principle ready for an on-line experiment for the chemical characterization of the superheavy element bohrium, element 107. However, the detection of a-particle activities by liquid scintillation counting still needs to be worked out. (orig.)

  13. Acetylated tau destabilizes the cytoskeleton in the axon initial segment and is mislocalized to the somatodendritic compartment.

    Science.gov (United States)

    Sohn, Peter Dongmin; Tracy, Tara E; Son, Hye-In; Zhou, Yungui; Leite, Renata E P; Miller, Bruce L; Seeley, William W; Grinberg, Lea T; Gan, Li

    2016-06-29

    Neurons are highly polarized cells in which asymmetric axonal-dendritic distribution of proteins is crucial for neuronal function. Loss of polarized distribution of the axonal protein tau is an early sign of Alzheimer's disease (AD) and other neurodegenerative disorders. The cytoskeletal network in the axon initial segment (AIS) forms a barrier between the axon and the somatodentritic compartment, contributing to axonal retention of tau. Although perturbation of the AIS cytoskeleton has been implicated in neurological disorders, the molecular triggers and functional consequence of AIS perturbation are incompletely understood. Here we report that tau acetylation and consequent destabilization of the AIS cytoskeleton promote the somatodendritic mislocalization of tau. AIS cytoskeletal proteins, including ankyrin G and βIV-spectrin, were downregulated in AD brains and negatively correlated with an increase in tau acetylated at K274 and K281. AIS proteins were also diminished in transgenic mice expressing tauK274/281Q, a tau mutant that mimics K274 and K281 acetylation. In primary neuronal cultures, the tauK274/281Q mutant caused hyperdynamic microtubules (MTs) in the AIS, shown by live-imaging of MT mobility and fluorescence recovery after photobleaching. Using photoconvertible tau constructs, we found that axonal tauK274/281Q was missorted into the somatodendritic compartment. Stabilizing MTs with epothilone D to restore the cytoskeletal barrier in the AIS prevented tau mislocalization in primary neuronal cultures. Together, these findings demonstrate that tau acetylation contributes to the pathogenesis of neurodegenerative disease by compromising the cytoskeletal sorting machinery in the AIS.

  14. Results from PLUTO at PETRA

    CERN Document Server

    Blobel, Volker

    1979-01-01

    Results obtained at the e/sup +/e/sup -/ storage ring PETRA by the PLUTO collaboration at c.m. energies of 13, 17 and 27.4 GeV are presented. New limits on QED cut-off parameters are determined from Bhabha scattering; at 27.4 GeV the limits are Lambda /sub +/>38 GeV and Lambda /sub -/>60 GeV. The measured values of the total hadronic cross section, and the study of the jet character of the hadronic events are well consistent with the expected production of b mesons (with q/sub b/=1/3), but do not require additional new quarks with charge 2/3. Hadronic events from two-photon exchange processes are observed with comparable rates as events from one-photon exchange. First results on the hadronic cross section in gamma gamma collisions are given. (8 refs).

  15. Zoonimia y vernácula en Yucuna

    Directory of Open Access Journals (Sweden)

    Defler Thomas R.

    1999-11-01

    Full Text Available A glossary of animal names in the Yucuna language from the region of the lower Caquetá river, Mirití-Paraná and the lower Apaporis river (Amazonas and Vaupés departments, Colombia is presented along with their scientifie binomials. The list includes 274 names and variations for 218 animals of the region.Se presenta una lista de nombres vernáculos de animales en lengua Yucuna de la región del bajo río Caquetá, Mirití-Paraná, bajo río Apaporis (Departamentos de Amazonas y Vaupés, Colombia, con sus correspondientes binomios científicos. Se incluyen 274 nombres para 218 animales de la región.

  16. Clinical impact of endoscopic ultrasound-guided fine needle aspiration biopsy in patients with upper gastrointestinal tract malignancies. A prospective study

    DEFF Research Database (Denmark)

    Mortensen, M B; Pless, T; Durup, J

    2001-01-01

    cancer patients. In this consecutive and prospective study, EUS-FNAB was only performed if a positive malignant finding would change the therapeutic strategy. PATIENTS AND METHODS: Between 1997 and 1999, 307 consecutive patients were referred for EUS with a diagnosis or strong suspicion of esophageal......, gastric or pancreatic cancer; 274 patients were potential candidates for surgical treatment and had EUS. According to predefined impact criteria, 27% (75/274) of the patients had EUS-FNAB for staging or diagnostic reasons. RESULTS: The overall clinical impact of EUS-FNAB was 13%, 14%, and 30......% in esophageal, gastric, and pancreatic cancer, respectively. The staging-related clinical impact was similar for all three types of cancer (11-12.5%), whereas the diagnosis-related impact was highest in pancreatic cancer patients (86%). EUS-FNAB was inadequate in 13% and gave false-negative results in 5...

  17. Quantum chaos on discrete graphs

    Energy Technology Data Exchange (ETDEWEB)

    Smilansky, Uzy [Department of Physics of Complex Systems, Weizmann Institute of Science, Rehovot 76100 (Israel); Isaac Newton Institute for Mathematical Sciences, 20 Clarkson Road, Cambridge CB3 0EH (United Kingdom)

    2007-07-06

    Adapting a method developed for the study of quantum chaos on quantum (metric) graphs (Kottos and Smilansky 1997 Phys. Rev. Lett. 79 4794, Kottos and Smilansky 1999 Ann. Phys., NY 274 76), spectral {zeta} functions and trace formulae for discrete Laplacians on graphs are derived. This is achieved by expressing the spectral secular equation in terms of the periodic orbits of the graph and obtaining functions which belong to the class of {zeta} functions proposed originally by Ihara (1966 J. Mat. Soc. Japan 18 219) and expanded by subsequent authors (Stark and Terras 1996 Adv. Math. 121 124, Kotani and Sunada 2000 J. Math. Sci. Univ. Tokyo 7 7). Finally, a model of 'classical dynamics' on the discrete graph is proposed. It is analogous to the corresponding classical dynamics derived for quantum graphs (Kottos and Smilansky 1997 Phys. Rev. Lett. 79 4794, Kottos and Smilansky 1999 Ann. Phys., NY 274 76). (fast track communication)

  18. The Active Site Protonation States of the class A CTX-M-type perdeuterated Toho-1 -lactamase Determined by Neutron Diffraction Support a Role for Glu166 as the General Base in Acylation

    Energy Technology Data Exchange (ETDEWEB)

    Coates, Leighton [ORNL; Cooper, Jon [University of Southampton, England; Tomanicek, Stephen J [ORNL; Blakeley, Matthew P. [Institut Laue-Langevin (ILL); Chen, Yu [University of South Florida; Wang, Kathy K [ORNL

    2010-01-01

    Room temperature neutron diffraction data of the fully perdeuterated Toho-1 R274N/R276N double mutant {beta}-lactamase in the apo form were used to visualize deuterium atoms within the active site of the enzyme. This perdeuterated neutron structure of the Toho-1 R274N/R276N reveals the clearest picture yet of the ground-state active site protonation states and the complete hydrogen-bonding network in a {beta}-lactamase enzyme. The ground-state active site protonation states detailed in this neutron diffraction study are consistent with previous high-resolution X-ray studies that support the role of Glu166 as the general base during the acylation reaction in the class A {beta}-lactamase reaction pathway.

  19. The active site protonation states of perdeuterated Toho-1 beta-lactamase determined by neutron diffraction support a role for Glu166 as the general base in acylation

    Energy Technology Data Exchange (ETDEWEB)

    Tomanicek, Stephen J [ORNL; Wang, Kathy K [ORNL; Weiss, Kevin L [ORNL; Blakeley, Matthew P. [Institut Laue-Langevin (ILL); Cooper, Jon [University of Southampton, England; Coates, Leighton [ORNL; Chen, Yu [University of South Florida

    2011-01-01

    Room temperature neutron diffraction data of the fully perdeuterated Toho-1 R274N/R276N double mutant {beta}-lactamase in the apo form were used to visualize deuterium atoms within the active site of the enzyme. This perdeuterated neutron structure of the Toho-1 R274N/R276N reveals the clearest picture yet of the ground-state active site protonation states and the complete hydrogen-bonding network in a {beta}-lactamase enzyme. The ground-state active site protonation states detailed in this neutron diffraction study are consistent with previous high-resolution X-ray studies that support the role of Glu166 as the general base during the acylation reaction in the class A {beta}-lactamase reaction pathway.

  20. Planck intermediate results XXXI. Microwave survey of Galactic supernova remnants

    DEFF Research Database (Denmark)

    Arnaud, M.; Ashdown, M.; Atrio-Barandela, F.

    2016-01-01

    The all-sky Planck survey in 9 frequency bands was used to search for emission from all 274 known Galactic supernova remnants. Of these, 16 were detected in at least two Planck frequencies. The radio-through-microwave spectral energy distributions were compiled to determine the mechanism for micr......The all-sky Planck survey in 9 frequency bands was used to search for emission from all 274 known Galactic supernova remnants. Of these, 16 were detected in at least two Planck frequencies. The radio-through-microwave spectral energy distributions were compiled to determine the mechanism...... for microwave emission. In only one case, IC 443, is there high-frequency emission clearly from dust associated with the supernova remnant. In all cases, the low-frequency emission is from synchrotron radiation. As predicted for a population of relativistic particles with energy distribution that extends...

  1. Message amplification phenotyping of an inherited delta-aminolevulinate dehydratase deficiency in a family with acute hepatic porphyria.

    Science.gov (United States)

    Ishida, N; Fujita, H; Noguchi, T; Doss, M; Kappas, A; Sassa, S

    1990-10-15

    The molecular basis of the enzymatic defect responsible for acute hepatic porphyria due to delta-aminolevulinate dehydratase (ALAD) deficiency was investigated in a family including a proband with the acute disease. In order to delineate the mutation in the proband, cDNA for deficient ALAD was synthesized from the proband's cells. The ALAD phenotype was studied by message amplification phenotyping with total RNA extracted from lymphoblastoid cells of the proband and his family members. Two independent mutant alleles of ALAD were identified in the proband's cells. One mutant allele was shown to result in an amino acid substitution at residue 274 (Ala274----Thr). Message amplification phenotyping studies have also permitted us to define the ALAD phenotype of each subject in the family. This is the first mutation to be recognized in the human ALAD gene.

  2. Fabrication of in-situ grown graphene reinforced Cu matrix composites

    Science.gov (United States)

    Chen, Yakun; Zhang, Xiang; Liu, Enzuo; He, Chunnian; Shi, Chunsheng; Li, Jiajun; Nash, Philip; Zhao, Naiqin

    2016-01-01

    Graphene/Cu composites were fabricated through a graphene in-situ grown approach, which involved ball-milling of Cu powders with PMMA as solid carbon source, in-situ growth of graphene on flaky Cu powders and vacuum hot-press sintering. SEM and TEM characterization results indicated that graphene in-situ grown on Cu powders guaranteed a homogeneous dispersion and a good combination between graphene and Cu matrix, as well as the intact structure of graphene, which was beneficial to its strengthening effect. The yield strength of 244 MPa and tensile strength of 274 MPa were achieved in the composite with 0.95 wt.% graphene, which were separately 177% and 27.4% enhancement over pure Cu. Strengthening effect of in-situ grown graphene in the matrix was contributed to load transfer and dislocation strengthening. PMID:26763313

  3. A novel relapsing fever Borrelia sp. infects the salivary glands of the molted hard tick, Amblyomma geoemydae.

    Science.gov (United States)

    Takano, Ai; Sugimori, Chieko; Fujita, Hiromi; Kadosaka, Teruki; Taylor, Kyle R; Tsubota, Toshio; Konnai, Satoru; Tajima, Tomoko; Sato, Kozue; Watanabe, Haruo; Ohnishi, Makoto; Kawabata, Hiroki

    2012-09-01

    A novel relapsing fever Borrelia sp. was found in Amblyomma geoemydae in Japan. The novel Borrelia sp. was phylogenetically related to the hard (ixodid) tick-borne relapsing fever Borrelia spp. Borrelia miyamotoi and B. lonestari. The novel relapsing fever Borrelia sp. was detected in 39 A. geoemydae (39/274: 14.2%), of which 14 (14/274: 5.1%) were co-infected with the novel relapsing fever Borrelia sp. and Borrelia sp. tAG, one of the reptile-associated borreliae. Transstadial transmission of the novel relapsing fever Borrelia sp. occurred in the tick midgut and the salivary glands, although Borrelia sp. tAG was only detected in the tick midgut. The difference of the borrelial niche in molted ticks might be associated with borrelial characterization. Copyright © 2012. Published by Elsevier GmbH.

  4. Short-term insulin treatment prevents the diabetogenic action of streptozotocin in rats

    DEFF Research Database (Denmark)

    Thulesen, J; Orskov, C; Holst, J J

    1997-01-01

    Streptozotocin, which induces diabetes mellitus in experimental animals, has been reported to be taken up by beta-cells by means of the glucose transporter 2 (GLUT2) and then reduce the cellular level of NAD+, leading to necrosis of the beta-cells. We investigated the effect of insulin pretreatment...... on the diabetogenic action of streptozotocin (60 mg/kg). Four groups of rats were studied: 1) a group that received streptozotocin (STZ), 2) a group that received insulin pretreatment and streptozotocin (INS + STZ), 3) a group that received insulin (INS), and 4) a control group (CTRL). Insulin treatment reduced...... rats [plasma, 274.3 +/- 101.9 vs. 1078.8 +/- 254.9 pmol/liter (P 1 vs. 274.3 +/- 101...

  5. The effect of sex, slaughter weight and weight gains in PEN-AR-LAN ...

    African Journals Online (AJOL)

    The aim of the study was to determine the effect of sex, body weight and growth rates on basic fattening and slaughter indexes in PEN-AR-LAN fatteners. The research was conducted on 274 PEN-ARLAN hybrid fatteners coming from sows of the Naïma maternal line and was sired by boars of the P-76 meat line. Recorded ...

  6. Proceedings of the DOD (Department of Defense) Standardization and Data Management Conference Supporting the Acquisition Process Held in Linthicum, Maryland on August 22-24, 1988

    Science.gov (United States)

    1988-01-01

    LtCol Jack Steele AFLC/QA -- Mr John Berg AFLC/PMMO -- Major Daugherty and Mr Jim Mathenia AFSC/PLEQ -- Mr Keith Payne ASD/EN(PA) -- Mr George Thielen...VA 22041-3466 ALEXANDRIA VA 22304-6100 (70) 756-271C.) (202) 274-6781 289-2210 284-6781 MR. JOSE D. FONSECA MRS. CECILIA M. FLEMING HO AMC ELECTRONIC

  7. AFOSR/ONR (Air Force Office of Scientific Research/Office of Naval Research) Contractors’ Meeting - Combustion Rocket Propulsion Diagnostics of Reacting Flow Held in Ann Arbor, Michigan on June 19-23, 1989

    Science.gov (United States)

    1989-06-19

    4. Stufflebeam , J. H., CARS Measurements in Solid Propellant Flames, 25th JANNAF Comb. Mig, 1988. 5. Hatch, R. L., 23rd jANNAF Comb. Mtg, Vol. I, pp...ciple:t thermometry has been demonstrated previously by Melton and coworl.ers.1 Recent work by Stufflebeam has confirmed that spatially precise...Sprays", Appl. Opt., 24, 2783 (1985). 2. J. H. Stufflebeam , "Exciplex Fluorescence Thermometry of Liquid Fuel", Appl. Spectroscopy, 43, 274 (1989). 278

  8. Valence-shell photoionization of the Cl-like ion Ar{sup +}: Experiment and theory

    Energy Technology Data Exchange (ETDEWEB)

    Covington, A M; Covington, I R; Shirley, C A; Phaneuf, R A [Department of Physics, University of Nevada, Reno, NV 89557 (United States); Aguilar, A; Schlachter, A S [Advanced Light Source, Lawrence Berkeley National Laboratory, Berkeley, CA 94720 (United States); Hinojosa, G; Alvarez, I; Cisneros, C; Dominguez-Lopez, I [Instituto de Ciencias Fisicas, Universidad Nacional Autonoma de Mexico, Cuernavaca, Mor. 62210 (Mexico); Sant' Anna, M M [Instituto do Fisica, Universidade Federal do Rio de Janerio, Caixa Postal 68528, 21945-970, Rio de Janerio RJ (Brazil); Ballance, C P [Department of Physics, Auburn University, Auburn AL 36840 (United States); McLaughlin, B M, E-mail: acovington@unr.ed, E-mail: b.mclaughlin@qub.ac.u [ITAMP, Harvard-Smithosian Center for Astrophysics, Cambridge, MA 02138 (United States)

    2009-11-01

    Absolute photoionization cross-section measurements for Ar{sup +} ions and theoretical calculations performed within the semi-relativistic Breit-Pauli R-matrix approximation are reported for the photon energy range 27.4 eV to 60.0 eV. The resonance features are assigned spectroscopically, and their energies and quantum defects tabulated with excellent agreement being obtained between experiment and theory.

  9. Prevalence of intolerance to food additives among Danish school children

    DEFF Research Database (Denmark)

    Fuglsang, G.; Madsen, C.; Saval, P.

    1993-01-01

    The prevalence of intolerance to food additives was assessed in a group of unselected school children aged 5-16 years. A study group of 271 children was selected on the basis of the results of a questionnaire on atopic disease answered by 4,274 (86%) school children in the municipality of Viborg...... clinics, the prevalence of intolerance to food additives in school children is estimated to be 1-2%....

  10. Governance by Diffusion: Transnational Municipal Networks and the Spread of Local Climate Strategies in Europe

    OpenAIRE

    Lukas Hakelberg

    2014-01-01

    Cities have become crucial actors for the global governance of climate change. Their increased activity in this field is reflected by the rising number of adoptions of local climate strategies in an original sample of 274 European cities from 1992 to 2009. Using event history analysis, I find that this spread is promoted by transnational municipal networks (TMNs) successfully deploying strategies for governance by diffusion, their impact exceeding that of most alternative explanatory factors ...

  11. Psychological type profile of religiously committed male and female Canadian Baptist youth: a study among participants at tidal impact

    OpenAIRE

    Fawcett, Bruce G.; Francis, Leslie J.; Robbins, Mandy

    2009-01-01

    A sample of 479 female and 274 male religiously committed Canadian youth over the age of 11 years completed the Adolescent Form of the Francis Psychological Type Scales (FPTSA) within the context of a weeklong mission and service event sponsored by the Convention of Atlantic Baptist Churches. The data demonstrated strong preferences for intuition among both males (75%) and females (66%), and strong preferences for feeling among both males (86%) and females (92%). Females demonstrated stronger...

  12. Lighting a Fire Under Public Health and Safety Education: Influence Through Rational Choice, Reasoned Behavior, and Behavioral Economics

    Science.gov (United States)

    2016-09-01

    274. 39 Icek Ajzen and Martin Fishbein, “The Influence of Attitudes on Behavior,” in The Handbook of Attitudes, ed. Dolores Albarracín, Blair...ROBERTSON ET AL. 1. Description Robertson et al. attempted to evaluate the efficacy of television commercial campaigns to encourage seat belt use.296...This study was conducted in a community whose television cable system had been modified to permit controlled marketing studies.297 All 13,800 homes

  13. Spectrum of GJB2 mutations in Cypriot nonsyndromic hearing loss ...

    Indian Academy of Sciences (India)

    Cyprus (40/146 of tested subjects with SNHL were identi- fied with one or two mutations in the GJB2 gene, i.e. 27.4%) is similar to that reported in the neighbouring country of. Lebanon (33%) (Mustapha et al. 2001). A relatively lower c.35delG allele frequency among those with GJB2 mutations. 472. Journal of Genetics, Vol.

  14. Effects of sesame and bitter almond seed oils on mycelium growth of Agaricus bisporus (Lange) Sing.

    OpenAIRE

    kalyoncu, Ismail Hakki; KaSik, Giyaseddin; Özcan, Musa; Özturk, Celaleddin

    1999-01-01

    Secondary mycelium growth of Agaricus bisporus from Nigde University Mushroom Research Centre (Aksaray-Nigde) was monitored in malt extract agar medium containing sesame or bitter almond seed oils. With 1 % sesame oil, highest growth was established and less growth period was determined as 27.4 days. All of the samples with sesame oil showed better growth according to the control, being the stimulative effect of sesame oil higher than that of bitter almond oil.
    <...

  15. Promoter-Based Theranostics for Prostate Cancer

    Science.gov (United States)

    2015-10-01

    Goals: The overall goal is to have a fully validated probe ready for human administration and to file a FDA Investigational New Drug (IND) application...Funding: $249,274 Description of Goals: The goal is to develop a new nicotinic receptor-based PET agent that enables imaging of extrathalamic sites...optimized for local nanoparticle-based chemotherapy. (B) To test imaging after local and systemic administration . New Title: PSMA Directed

  16. Imaging Prostate Cancer Microenvironment by Collagen Hybridization

    Science.gov (United States)

    2015-10-01

    Description of Goals: The overall goal is to have a fully validated probe ready for human administration and to file a FDA Investigational New Drug (IND...Level of Funding: $249,274 Description of Goals: The goal is to develop a new nicotinic receptor-based PET agent that enables imaging of...drug carriers optimized for local nanoparticle-based chemotherapy. (B) To test imaging after local and systemic administration . New Title: PSMA

  17. Direct Test for Neuroinflammation with [11C]DAP-713-PET Scanning

    Science.gov (United States)

    2015-10-01

    Investigator Description of Goals: The overall goal is to have a fully validated probe ready for human administration and to file a FDA...1/2011-8/31/2015 Level of Funding: $249,274 Description of Goals: The goal is to develop a new nicotinic receptor-based PET agent that enables...systemic administration . New Title: PSMA Directed Imaging of Prostate Cancer Focus on Androgen Receptor Dynamics Time Commitments: 1.35 Supporting

  18. Conformational changes of the cytoplasmic part of Na+/K+-ATPase induced by the ligand binding

    Czech Academy of Sciences Publication Activity Database

    Kubala, Martin; Gryčová, Lenka; Lánský, Zdeněk; Otyepka, M.

    2007-01-01

    Roč. 274, Suppl.1 (2007), s. 127-127 ISSN 1742-464X. [FEBS Congress Molecular Machines /32./. 07.07.2007-12.07.2007, Vienna] R&D Projects: GA ČR(CZ) GA203/07/0564 Institutional research plan: CEZ:AV0Z50110509 Keywords : cpo1 * Na+/K+- ATPase * molecular dynamic simulations * fluorescence quenching Subject RIV: BO - Biophysics

  19. Turkish ELT students' willingness to communicate in English

    OpenAIRE

    Şener, Sabriye

    2014-01-01

    This paper aims to present the willingness to communicate (WTC) in English of the English Language Teaching Department (ELT) students of Çanakkale Onsekiz Mart University inside and outside the class. Additionally, the relationships among students’ willingness to communicate in English, their linguistic self-confidence, motivation, attitudes toward international community, and personality will be presented. To this end, quantitative data were gathered from 274 students studying at the departm...

  20. On-Line Assessment of Expertise

    Science.gov (United States)

    1994-01-07

    However, if assessment must be rapid or must follow the student through hundreds of problems, the assessor will want to 94 1 13 028 94-01535 choose...S~0 AD-NIA274 746 Prof. Kurt VanLehn Dr. Joel Martin Learning Research and Development Center University of Pittsburgh Pittsburgh, PA 15260 January 7...quite large and intractable with non-toy knowledge bases. We have three approaches for handling this problem: * We improved our algorithm that builds

  1. 非行少年と一般少年の比較 : 性格,親子関係に関して

    OpenAIRE

    高木, 秀明

    1985-01-01

    The purpose of this study is to investigate the causes of juvenile delinquency by comparing juvenile delinquents and nondelinquents with respect to their character and their relationship with their parents. The subjects were 274 juvenile delinquents, that is juveniles who had received warnings from policemen, were sent to child consultation centers or a juvenile classification home, or were enrolled in a juvenile reform school, and 1,188 nondelinquent high school students. The following resul...

  2. Dynamique de structuration spatio-temporelle des populations de ...

    African Journals Online (AJOL)

    SARAH

    30 juin 2014 ... Station VI. Fev Mar Avr Mai Jui Jul Fev Mar Avr Mai Jui Jul Fev Mar Avr Mai Jui Jul Fev Mar Avr Mai Jui Jul. Coléoptères. Hydrophilidae. 512 311 355 356 511 17 47 469 188 608 600 0 0 165 182 149 0 13 299 0 234 54 13 7. Dytiscidae. 274 279 183 120 109 28 320 250 148 221 108 0 0 183 193 224 85 15 ...

  3. A quasiclassical trajectory analysis of stereodynamics of the H + FCl ...

    Indian Academy of Sciences (India)

    10. Beadle P, Dunn M R, Jonathan N B H, Liddy J P and. Naylor J C 1978 J. Chem. Soc., Faraday Trans. 274. 2170. 11. Wьrzberg E and Houston P L 1980 J. Chem. Phys. 72 5915. 12. Merritt J M, Kьpper J and Miller R E 2005 Phys. Chem. Chem. Phys. 7 67. 13. Zolot A M and Nesbitt D J 2007 J. Chem. Phys. 127. 114319.

  4. Novel flavonolignan hybrid antioxidants: From enzymatic preparation to molecular rationalization

    Czech Academy of Sciences Publication Activity Database

    Vavříková, Eva; Křen, Vladimír; Ježová-Kalachová, Lubica; Biler, M.; Chantemargue, B.; Pyszková, M.; Riva, S.; Kuzma, Marek; Valentová, Kateřina; Ulrichová, J.; Vrba, J.; Trouillas, P.; Vacek, J.

    2017-01-01

    Roč. 127, FEB 15 (2017), s. 263-274 ISSN 0223-5234 R&D Projects: GA MŠk(CZ) LD14096; GA MŠk(CZ) LD15084; GA ČR(CZ) GA15-03037S Institutional support: RVO:61388971 Keywords : Silybin * Vitamin C * Enzymatic coupling Subject RIV: CE - Biochemistry OBOR OECD: Biochemistry and molecular biology Impact factor: 4.519, year: 2016

  5. Vitamin C Supplementation Does not Improve Hypoxia-Induced Erythropoiesis

    OpenAIRE

    Martinez-Bello, Vladimir E.; Sanchis-Gomar, Fabian; Martinez-Bello, Daniel; Olaso-Gonzalez, Gloria; Gomez-Cabrera, Mari Carmen; Viña, Jose

    2012-01-01

    Martinez-Bello,Vladimir E., Fabian Sanchis-Gomar, Daniel Martinez-Bello, Gloria Olaso-Gonzalez, Mari Carmen Gomez-Cabrera, and Jose Viña. Vitamin C Supplementation Does Not Improve Hypoxia-Induced Erythropoiesis. High Alt Med Biol 13:269–274, 2012.—Hypoxia induces reactive oxygen species production. Supplements with antioxidant mixtures can compensate for the decline in red cell membrane stability following intermittent hypobaric hypoxia by decreasing protein and lipid oxidation. We aimed to ...

  6. 21 CFR 558.625 - Tylosin.

    Science.gov (United States)

    2010-04-01

    ... combination with: (i) Decoquinate and monensin as in § 558.195. (ii) Hygromycin B as in § 558.274. (iii) Melengestrol acetate alone or in combination with certain ionophores as in § 558.342. (iv) Monensin as in § 558.355. (v) Narasin as in § 558.363. (vi) Pyrantel tartrate as in § 558.485. (vii) Ractopamine alone or...

  7. Non-linear time reversal ultrasonic pseudo-tomography

    Czech Academy of Sciences Publication Activity Database

    Převorovský, Zdeněk; Vejvodová, Šárka; Krofta, Josef; Převorovský, David

    2011-01-01

    Roč. 6, 3/4 (2011), s. 206-213 ISSN 1741-8410. [NDT in Progress. Praha, 05.11.2007-07.11.2007] R&D Projects: GA MPO(CZ) FR-TI1/274 Institutional research plan: CEZ:AV0Z20760514 Keywords : NDT * nonlinear elastic wave spectroscopy * time reversal mirrors * ultrasonic pseudo-tomography Subject RIV: BI - Acoustics http://www.inderscience.com/offer.php?id=43216

  8. Broad economic impact of nuclear power

    International Nuclear Information System (INIS)

    1992-01-01

    The decision to adopt, expand or reject a nuclear programme has implications that go beyond economic considerations limited to the cost of electricity produced. This report attempts to illustrate the treatment of macroeconomic factors in the decision-making process of various countries, and discusses the macroeconomic impacts of nuclear power, such as employment, balance of payments, security of supply, as well as environmental, health and socio-cultural issues. 274 refs., 14 figs., 14 tabs., 9 appendices

  9. Porta-enxertos para a produção de mudas de cajueiro

    Directory of Open Access Journals (Sweden)

    Luiz Augusto Lopes Serrano

    2013-09-01

    Full Text Available O objetivo deste trabalho foi avaliar clones de cajueiro como porta-enxertos para quatro genótipos-copa. Foram avaliados como porta-enxertos os clones CCP 06, CCP 09, CCP 76, CCP 1001, Embrapa 50, Embrapa 51, BRS 189, BRS 226, BRS 253, BRS 265, BRS 274 e BRS 275 e, como copas, os clones CCP 76, BRS 189, BRS 226 e BRS 274. Aos 60 dias após a semeadura, os porta-enxertos foram avaliados quanto às características biométricas e quanto às taxas de germinação e de aptidão à enxertia. Aos 80 dias após a enxertia, foram avaliadas as taxas de sucesso da enxertia, a aptidão para o plantio e as características biométricas das mudas. Houve correlação negativa entre massa de semente e taxas de germinação e de aptidão à enxertia. BRS 226, BRS 253 e BRS 274 apresentaram taxas insatisfatórias de germinação e de aptidão à enxertia. As maiores taxas de plantas aptas ao plantio, para a copa CCP 76, ocorreram nos porta-enxertos CCP 06, CCP 76 e CCP 1001; para BRS 189, destacou-se o CCP 06; para BRS 226, destacaram-se CCP 06, Embrapa 50, Embrapa 51, BRS 189 e BRS 265; e, para BRS 274, os porta-enxertos CCP 06, CCP 76, CCP 1001, Embrapa 50, Embrapa 51 e BRS 189.

  10. Digital Libraries / The Fourth ACM Conference on Digital Libraries, August 11-14, 1999, Berkeley, CA.

    OpenAIRE

    Rowe, Neil C.

    1999-01-01

    The Fourth ACM Conference on Digital Libraries, August 11-14, 1999, Berkeley, CA. New York, NY: Association for Computing Machinery, 1999, 274+12 pages, ISBN 1-58113-145-3. Digital libraries are the digital counterparts of traditional libraries of books and periodicals. They hold digital representations in minimally structured formats for all kinds of archival human-readable information ("documents"). Primarily they contain text, but now increasingly they include multimedia data lik...

  11. Iran: The Next Nuclear Threshold State?

    Science.gov (United States)

    2014-09-01

    potential effectiveness of submarines conjures up memories of the 1982 Falkland/Malvinas War, in which a British sub not only sank the Argentine General...274 Robert Litwak, Iran’s Nuclear Chess : Calculating America’s Moves (Washington, DC: Woodrow Wilson Center, Middle East Program...January 7, 2014. http://www.foreignaffairs.com/articles/ 140632/matthew-kroenig/still-time-to-attack-iran. Litwak, Robert. Iran’s Nuclear Chess

  12. Facebook Addiction Levels of Students in the Physical Education and Sport Department

    OpenAIRE

    Cetin YAMAN

    2016-01-01

    Time spent using various technological equipment increases every day with rapid technology development. Unfortunately, technology addiction is becoming an important issue. Especially with the development and ubiquity of mobile technologies, social media addiction is expanding. The aim of this study is to measure the Facebook addiction levels of 274 students at the Physical Education and Sports Teaching Department in a public university in Turkey and to examine their Facebook ad...

  13. Magnetic fluid modified peanut husks as an adsorbent for organic dyes removal

    Czech Academy of Sciences Publication Activity Database

    Šafařík, Ivo; Šafaříková, Miroslava

    2010-01-01

    Roč. 2010, č. 9 (2010), s. 274-278 ISSN 1875-3892. [12th International Conference on Magnetic Fluids. Sendai, 01.08.2010-05.08.2010] R&D Projects: GA MŠk OC09052; GA MPO(CZ) 2A-1TP1/094 Institutional research plan: CEZ:AV0Z60870520 Keywords : magnetic fluid * peanut husks * dyes adsorption Subject RIV: JI - Composite Materials

  14. Babesia microti (Piroplasmida: Babesiidae) in nymphal Ixodes ricinus (Acari: Ixodidae) in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Rudolf, Ivo; Golovchenko, Maryna; Šikutová, Silvie; Rudenko, Natalia; Grubhoffer, Libor; Hubálek, Zdeněk

    2005-01-01

    Roč. 52, č. 3 (2005), s. 274-276 ISSN 0015-5683 R&D Projects: GA ČR(CZ) GA206/03/0726 Institutional research plan: CEZ:AV0Z60930519; CEZ:AV0Z60220518 Keywords : Babesia microti * Ixodes ricinus Subject RIV: EE - Microbiology, Virology Impact factor: 1.138, year: 2005 http://folia.paru.cas.cz/pdfs/showpdf.php?pdf=20766

  15. Expression of Toll-like receptor 2 (TLR2), TLR4, and CD14 in biopsy samples of patients with inflammatory bowel diseases: upregulated expression of TLR2 in terminal ileum of patients with ulcerative colitis

    Czech Academy of Sciences Publication Activity Database

    Frolová, Lenka; Drastich, P.; Rossmann, Pavel; Klimešová, Klára; Tlaskalová, Helena

    2008-01-01

    Roč. 56, č. 3 (2008), s. 267-274 ISSN 0022-1554 R&D Projects: GA ČR GD310/03/H147; GA ČR GA303/06/0974; GA AV ČR 1QS500200572; GA MŠk 2B06155 Institutional research plan: CEZ:AV0Z50200510 Keywords : toll-like receptors * gut mucosa * intestinal inflammation Subject RIV: EC - Immunology Impact factor: 2.823, year: 2008

  16. Sample Set (SE): SE37 [Metabolonote[Archive

    Lifescience Database Archive (English)

    Full Text Available SE37 Medicago truncatula shoot metabolite analysis using stable isotopes Metabolite...s in the Medicago truncatula shoot are investigated by using stable isotope labelings. This analysis was per...formed to estimate the elemental composition with high reliability using the number of stable isotopes incor...nces by comparing the mass spectra of isotope-labeled and unlabeled data sets. Plant Biotechnology (2014) 3: 269-274 ...

  17. A Compact Review of Multi-criteria Decision Analysis Uncertainty Techniques

    Science.gov (United States)

    2013-02-01

    Vincke, P. Pseudo-orders: Definition, Properties and Numerical Representation. Mathematical Social Sciences 1987, 14 (3), 263–274. 15. Vincke, P...2003, 144 (3), 513–529. 73. Roy, B.; Benayoun, R.; Sussman, B. ELECTRE: Une Methodé Pour Guider Le Choix en Presence de Points de Vue Multiples. in...Note de travail 49, SEMA-METRA International, Direction Scientifique. 1966. 74. Figueira, J. ELECTRE Methods, in Multiple Criteria Decision

  18. CYCLIC STRAIN LOCALIZATION IN CAST NICKEL BASED SUPERALLOY INCONEL 792-5A AT ROOM TEMPERATURE

    Czech Academy of Sciences Publication Activity Database

    Petrenec, Martin; Man, Jiří; Obrtlík, Karel; Polák, Jaroslav

    308/2005, č. 86 (2005), s. 269-274 ISSN 1429-6055. [Metody oceny struktury oraz wlasności materialów i wyrobów. Ustroń-Jaszowiec, 07.12.2005-09.12.2005] Institutional research plan: CEZ:AV0Z20410507 Keywords : low cycle fatigue * superalloy * cyclic strain localization Subject RIV: JL - Materials Fatigue, Friction Mechanics

  19. Screening and Selection of New Antagonists of the RING-Mediated Hdm2/Hdmx Interaction

    Science.gov (United States)

    2013-05-01

    AG, Craik DJ. Backbone cyclised peptides from plants show molluscicidal activity against the rice pest Pomacea canaliculata ( golden apple snail). J...Kossiakoff AA. Biosynthetic phage display: a novel protein engineering tool combining chemical and genetic diversity. Chem Biol. 2000; 7:263–274. [PubMed...polypeptides in genetically engineered plants in the near future. The production of circular polypeptides using standard bio- logical expression systems

  20. Investigation of molybdenum content reduction in uranium Leach Liquor by using activated Charcoal in Bandar Abbas plant

    International Nuclear Information System (INIS)

    Ghadiri, A.; Daneshvar, Gh.; Nozari, N.; Moghtaderi, Sh.

    2010-01-01

    In this work, the possibilities of molybdenum content reduction in uranium leach liquor was investigated by adsorption techniques. Several activated charcoals were used as adsorbents. Under the optimized condition, 83.59% of molybdenum was adsorbed with N orit PK 0.25-1 a ctivated charcoal. Since the low uranium adsorption is the aim of this work, by performing the optimization conditions, the uranium adsorption with activated charcoal was determined to be 2.74%.