WorldWideScience

Sample records for bohrium 273

  1. Atomic Mass and Nuclear Binding Energy for Bh-273 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-273 (Bohrium, atomic number Z = 107, mass number A = 273).

  2. Graphs for Isotopes of 107-Bh (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides a graphic representation of nucleon separation energies and residual interaction parameters for isotopes of the chemical element 107-Bh (Bohrium, atomic number Z = 107).

  3. Chemical characterization of bohrium (element 107)

    Science.gov (United States)

    Eichler; Bruchle; Dressler; Dullmann; Eichler; Gaggeler; Gregorich; Hoffman; Hubener; Jost; Kirbach; Laue; Lavanchy; Nitsche; Patin; Piguet; Schadel; Shaughnessy; Strellis; Taut; Tobler; Tsyganov; Turler; Vahle; Wilk; Yakushev

    2000-09-01

    The arrangement of the chemical elements in the periodic table highlights resemblances in chemical properties, which reflect the elements' electronic structure. For the heaviest elements, however, deviations in the periodicity of chemical properties are expected: electrons in orbitals with a high probability density near the nucleus are accelerated by the large nuclear charges to relativistic velocities, which increase their binding energies and cause orbital contraction. This leads to more efficient screening of the nuclear charge and corresponding destabilization of the outer d and f orbitals: it is these changes that can give rise to unexpected chemical properties. The synthesis of increasingly heavy elements, now including that of elements 114, 116 and 118, allows the investigation of this effect, provided sufficiently long-lived isotopes for chemical characterization are available. In the case of elements 104 and 105, for example, relativistic effects interrupt characteristic trends in the chemical properties of the elements constituting the corresponding columns of the periodic table, whereas element 106 behaves in accordance with the expected periodicity. Here we report the chemical separation and characterization of six atoms of element 107 (bohrium, Bh), in the form of its oxychloride. We find that this compound is less volatile than the oxychlorides of the lighter elements of group VII, thus confirming relativistic calculations that predict the behaviour of bohrium, like that of element 106, to coincide with that expected on the basis of its position in the periodic table. PMID:10993071

  4. Chemical characterization of bohrium (element 107)

    Science.gov (United States)

    Eichler, R.; Brüchle, W.; Dressler, R.; Düllmann, Ch. E.; Eichler, B.; Gäggeler, H. W.; Gregorich, K. E.; Hoffman, D. C.; Hübener, S.; Jost, D. T.; Kirbach, U. W.; Laue, C. A.; Lavanchy, V. M.; Nitsche, H.; Patin, J. B.; Piguet, D.; Schädel, M.; Shaughnessy, D. A.; Strellis, D. A.; Taut, S.; Tobler, L.; Tsyganov, Y. S.; Türler, A.; Vahle, A.; WiIk, P. A.; Yakushev, A. B.

    2000-09-01

    The arrangement of the chemical elements in the periodic table highlights resemblances in chemical properties, which reflect the elements' electronic structure. For the heaviest elements, however, deviations in the periodicity of chemical properties are expected: electrons in orbitals with a high probability density near the nucleus are accelerated by the large nuclear charges to relativistic velocities, which increase their binding energies and cause orbital contraction. This leads to more efficient screening of the nuclear charge and corresponding destabilization of the outer d and f orbitals: it is these changes that can give rise to unexpected chemical properties. The synthesis of increasingly heavy elements, now including that of elements 114, 116 and 118, allows the investigation of this effect, provided sufficiently long-lived isotopes for chemical characterization are available. In the case of elements 104 and 105, for example, relativistic effects interrupt characteristic trends in the chemical properties of the elements constituting the corresponding columns of the periodic table, whereas element 106 behaves in accordance with the expected periodicity. Here we report the chemical separation and characterization of six atoms of element 107 (bohrium, Bh), in the form of its oxychloride. We find that this compound is less volatile than the oxychlorides of the lighter elements of group VII, thus confirming relativistic calculations that predict the behaviour of bohrium, like that of element 106, to coincide with that expected on the basis of its position in the periodic table.

  5. Chemical separation procedure proposed for studies of bohrium

    International Nuclear Information System (INIS)

    Off-line and on-line studies have been performed with radioactive tracers of various elements to develop a chemical separation procedure for bohrium (element 107). The proposed procedure is intended for use in the fast solvent extraction system SISAK. The homologs technetium and rhenium were used to model the chemical behavior of bohrium. The results show that high decontamination factors can be obtained for technetium and rhenium with respect to unwanted contaminants like trivalent actinides, polonium and the Group 5 elements. (author)

  6. From bohrium to copernicium and beyond SHE research at SHIP

    Science.gov (United States)

    Münzenberg, G.

    2015-12-01

    Heavy-element research with SHIP at GSI is reviewed including the discovery of the chemical elements bohrium to copernicium, experimental developments, cold fusion of heavy ions, and the discovery of a shell region around hassium. Elements bohrium and heavier are located beyond the limit of liquid-drop stability. They exist by shell stabilization. A universal, sensitive, and fast method: in-flight separation and identification of single atomic nuclei has been developed with the velocity filter SHIP and the detector system to measure decay sequences of individual atoms. Research with single atomic nuclei including detection methods, identification, and physics results will be discussed. Experiments with actinide targets as well as prospects with NUSTAR at FAIR will be addressed.

  7. Atomic Mass and Nuclear Binding Energy for Bh-318 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-318 (Bohrium, atomic number Z = 107, mass number A = 318).

  8. Atomic Mass and Nuclear Binding Energy for Bh-356 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-356 (Bohrium, atomic number Z = 107, mass number A = 356).

  9. Atomic Mass and Nuclear Binding Energy for Bh-322 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-322 (Bohrium, atomic number Z = 107, mass number A = 322).

  10. Atomic Mass and Nuclear Binding Energy for Bh-351 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-351 (Bohrium, atomic number Z = 107, mass number A = 351).

  11. Atomic Mass and Nuclear Binding Energy for Bh-310 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-310 (Bohrium, atomic number Z = 107, mass number A = 310).

  12. Atomic Mass and Nuclear Binding Energy for Bh-336 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-336 (Bohrium, atomic number Z = 107, mass number A = 336).

  13. Atomic Mass and Nuclear Binding Energy for Bh-299 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-299 (Bohrium, atomic number Z = 107, mass number A = 299).

  14. Atomic Mass and Nuclear Binding Energy for Bh-288 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-288 (Bohrium, atomic number Z = 107, mass number A = 288).

  15. Atomic Mass and Nuclear Binding Energy for Bh-359 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-359 (Bohrium, atomic number Z = 107, mass number A = 359).

  16. Atomic Mass and Nuclear Binding Energy for Bh-343 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-343 (Bohrium, atomic number Z = 107, mass number A = 343).

  17. Atomic Mass and Nuclear Binding Energy for Bh-304 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-304 (Bohrium, atomic number Z = 107, mass number A = 304).

  18. Atomic Mass and Nuclear Binding Energy for Bh-280 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-280 (Bohrium, atomic number Z = 107, mass number A = 280).

  19. Atomic Mass and Nuclear Binding Energy for Bh-349 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-349 (Bohrium, atomic number Z = 107, mass number A = 349).

  20. Atomic Mass and Nuclear Binding Energy for Bh-325 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-325 (Bohrium, atomic number Z = 107, mass number A = 325).

  1. Atomic Mass and Nuclear Binding Energy for Bh-332 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-332 (Bohrium, atomic number Z = 107, mass number A = 332).

  2. Atomic Mass and Nuclear Binding Energy for Bh-306 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-306 (Bohrium, atomic number Z = 107, mass number A = 306).

  3. Atomic Mass and Nuclear Binding Energy for Bh-324 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-324 (Bohrium, atomic number Z = 107, mass number A = 324).

  4. Atomic Mass and Nuclear Binding Energy for Bh-293 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-293 (Bohrium, atomic number Z = 107, mass number A = 293).

  5. Atomic Mass and Nuclear Binding Energy for Bh-327 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-327 (Bohrium, atomic number Z = 107, mass number A = 327).

  6. Atomic Mass and Nuclear Binding Energy for Bh-350 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-350 (Bohrium, atomic number Z = 107, mass number A = 350).

  7. Atomic Mass and Nuclear Binding Energy for Bh-308 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-308 (Bohrium, atomic number Z = 107, mass number A = 308).

  8. Atomic Mass and Nuclear Binding Energy for Bh-358 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-358 (Bohrium, atomic number Z = 107, mass number A = 358).

  9. Atomic Mass and Nuclear Binding Energy for Bh-321 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-321 (Bohrium, atomic number Z = 107, mass number A = 321).

  10. Atomic Mass and Nuclear Binding Energy for Bh-345 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-345 (Bohrium, atomic number Z = 107, mass number A = 345).

  11. Atomic Mass and Nuclear Binding Energy for Bh-286 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-286 (Bohrium, atomic number Z = 107, mass number A = 286).

  12. Atomic Mass and Nuclear Binding Energy for Bh-307 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-307 (Bohrium, atomic number Z = 107, mass number A = 307).

  13. Atomic Mass and Nuclear Binding Energy for Bh-303 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-303 (Bohrium, atomic number Z = 107, mass number A = 303).

  14. Atomic Mass and Nuclear Binding Energy for Bh-312 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-312 (Bohrium, atomic number Z = 107, mass number A = 312).

  15. Atomic Mass and Nuclear Binding Energy for Bh-294 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-294 (Bohrium, atomic number Z = 107, mass number A = 294).

  16. Atomic Mass and Nuclear Binding Energy for Bh-326 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-326 (Bohrium, atomic number Z = 107, mass number A = 326).

  17. Atomic Mass and Nuclear Binding Energy for Bh-284 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-284 (Bohrium, atomic number Z = 107, mass number A = 284).

  18. Atomic Mass and Nuclear Binding Energy for Bh-315 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-315 (Bohrium, atomic number Z = 107, mass number A = 315).

  19. Atomic Mass and Nuclear Binding Energy for Bh-328 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-328 (Bohrium, atomic number Z = 107, mass number A = 328).

  20. Atomic Mass and Nuclear Binding Energy for Bh-311 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-311 (Bohrium, atomic number Z = 107, mass number A = 311).

  1. Atomic Mass and Nuclear Binding Energy for Bh-353 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-353 (Bohrium, atomic number Z = 107, mass number A = 353).

  2. Atomic Mass and Nuclear Binding Energy for Bh-348 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-348 (Bohrium, atomic number Z = 107, mass number A = 348).

  3. Atomic Mass and Nuclear Binding Energy for Bh-360 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-360 (Bohrium, atomic number Z = 107, mass number A = 360).

  4. Atomic Mass and Nuclear Binding Energy for Bh-347 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-347 (Bohrium, atomic number Z = 107, mass number A = 347).

  5. Atomic Mass and Nuclear Binding Energy for Bh-277 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-277 (Bohrium, atomic number Z = 107, mass number A = 277).

  6. Atomic Mass and Nuclear Binding Energy for Bh-309 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-309 (Bohrium, atomic number Z = 107, mass number A = 309).

  7. Atomic Mass and Nuclear Binding Energy for Bh-340 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-340 (Bohrium, atomic number Z = 107, mass number A = 340).

  8. Atomic Mass and Nuclear Binding Energy for Bh-285 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-285 (Bohrium, atomic number Z = 107, mass number A = 285).

  9. Atomic Mass and Nuclear Binding Energy for Bh-341 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-341 (Bohrium, atomic number Z = 107, mass number A = 341).

  10. Atomic Mass and Nuclear Binding Energy for Bh-283 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-283 (Bohrium, atomic number Z = 107, mass number A = 283).

  11. Atomic Mass and Nuclear Binding Energy for Bh-305 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-305 (Bohrium, atomic number Z = 107, mass number A = 305).

  12. Atomic Mass and Nuclear Binding Energy for Bh-331 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-331 (Bohrium, atomic number Z = 107, mass number A = 331).

  13. Atomic Mass and Nuclear Binding Energy for Bh-342 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-342 (Bohrium, atomic number Z = 107, mass number A = 342).

  14. Atomic Mass and Nuclear Binding Energy for Bh-300 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-300 (Bohrium, atomic number Z = 107, mass number A = 300).

  15. Atomic Mass and Nuclear Binding Energy for Bh-330 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-330 (Bohrium, atomic number Z = 107, mass number A = 330).

  16. Atomic Mass and Nuclear Binding Energy for Bh-296 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-296 (Bohrium, atomic number Z = 107, mass number A = 296).

  17. Atomic Mass and Nuclear Binding Energy for Bh-338 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-338 (Bohrium, atomic number Z = 107, mass number A = 338).

  18. Atomic Mass and Nuclear Binding Energy for Bh-270 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-270 (Bohrium, atomic number Z = 107, mass number A = 270).

  19. Atomic Mass and Nuclear Binding Energy for Bh-320 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-320 (Bohrium, atomic number Z = 107, mass number A = 320).

  20. Atomic Mass and Nuclear Binding Energy for Bh-346 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-346 (Bohrium, atomic number Z = 107, mass number A = 346).

  1. Atomic Mass and Nuclear Binding Energy for Bh-274 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-274 (Bohrium, atomic number Z = 107, mass number A = 274).

  2. Atomic Mass and Nuclear Binding Energy for Bh-357 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-357 (Bohrium, atomic number Z = 107, mass number A = 357).

  3. Atomic Mass and Nuclear Binding Energy for Bh-319 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-319 (Bohrium, atomic number Z = 107, mass number A = 319).

  4. Atomic Mass and Nuclear Binding Energy for Bh-337 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-337 (Bohrium, atomic number Z = 107, mass number A = 337).

  5. Atomic Mass and Nuclear Binding Energy for Bh-329 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-329 (Bohrium, atomic number Z = 107, mass number A = 329).

  6. Atomic Mass and Nuclear Binding Energy for Bh-276 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-276 (Bohrium, atomic number Z = 107, mass number A = 276).

  7. Atomic Mass and Nuclear Binding Energy for Bh-335 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-335 (Bohrium, atomic number Z = 107, mass number A = 335).

  8. Atomic Mass and Nuclear Binding Energy for Bh-314 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-314 (Bohrium, atomic number Z = 107, mass number A = 314).

  9. Atomic Mass and Nuclear Binding Energy for Bh-281 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-281 (Bohrium, atomic number Z = 107, mass number A = 281).

  10. Atomic Mass and Nuclear Binding Energy for Bh-282 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-282 (Bohrium, atomic number Z = 107, mass number A = 282).

  11. Atomic Mass and Nuclear Binding Energy for Bh-339 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-339 (Bohrium, atomic number Z = 107, mass number A = 339).

  12. Atomic Mass and Nuclear Binding Energy for Bh-275 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-275 (Bohrium, atomic number Z = 107, mass number A = 275).

  13. Atomic Mass and Nuclear Binding Energy for Bh-289 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-289 (Bohrium, atomic number Z = 107, mass number A = 289).

  14. Atomic Mass and Nuclear Binding Energy for Bh-316 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-316 (Bohrium, atomic number Z = 107, mass number A = 316).

  15. Atomic Mass and Nuclear Binding Energy for Bh-354 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-354 (Bohrium, atomic number Z = 107, mass number A = 354).

  16. Atomic Mass and Nuclear Binding Energy for Bh-355 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-355 (Bohrium, atomic number Z = 107, mass number A = 355).

  17. Atomic Mass and Nuclear Binding Energy for Bh-295 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-295 (Bohrium, atomic number Z = 107, mass number A = 295).

  18. Atomic Mass and Nuclear Binding Energy for Bh-272 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-272 (Bohrium, atomic number Z = 107, mass number A = 272).

  19. Atomic Mass and Nuclear Binding Energy for Bh-334 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-334 (Bohrium, atomic number Z = 107, mass number A = 334).

  20. Atomic Mass and Nuclear Binding Energy for Bh-279 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-279 (Bohrium, atomic number Z = 107, mass number A = 279).

  1. Atomic Mass and Nuclear Binding Energy for Bh-323 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-323 (Bohrium, atomic number Z = 107, mass number A = 323).

  2. Atomic Mass and Nuclear Binding Energy for Bh-352 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-352 (Bohrium, atomic number Z = 107, mass number A = 352).

  3. Atomic Mass and Nuclear Binding Energy for Bh-298 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-298 (Bohrium, atomic number Z = 107, mass number A = 298).

  4. Atomic Mass and Nuclear Binding Energy for Bh-317 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-317 (Bohrium, atomic number Z = 107, mass number A = 317).

  5. Atomic Mass and Nuclear Binding Energy for Bh-344 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-344 (Bohrium, atomic number Z = 107, mass number A = 344).

  6. Atomic Mass and Nuclear Binding Energy for Bh-302 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-302 (Bohrium, atomic number Z = 107, mass number A = 302).

  7. Atomic Mass and Nuclear Binding Energy for Bh-292 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-292 (Bohrium, atomic number Z = 107, mass number A = 292).

  8. Atomic Mass and Nuclear Binding Energy for Bh-287 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-287 (Bohrium, atomic number Z = 107, mass number A = 287).

  9. Atomic Mass and Nuclear Binding Energy for Bh-301 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-301 (Bohrium, atomic number Z = 107, mass number A = 301).

  10. Atomic Mass and Nuclear Binding Energy for Bh-291 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-291 (Bohrium, atomic number Z = 107, mass number A = 291).

  11. Atomic Mass and Nuclear Binding Energy for Bh-278 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-278 (Bohrium, atomic number Z = 107, mass number A = 278).

  12. Atomic Mass and Nuclear Binding Energy for Bh-290 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-290 (Bohrium, atomic number Z = 107, mass number A = 290).

  13. Atomic Mass and Nuclear Binding Energy for Bh-333 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-333 (Bohrium, atomic number Z = 107, mass number A = 333).

  14. Atomic Mass and Nuclear Binding Energy for Bh-268 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-268 (Bohrium, atomic number Z = 107, mass number A = 268).

  15. Atomic Mass and Nuclear Binding Energy for Bh-313 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-313 (Bohrium, atomic number Z = 107, mass number A = 313).

  16. Atomic Mass and Nuclear Binding Energy for Bh-271 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-271 (Bohrium, atomic number Z = 107, mass number A = 271).

  17. Atomic Mass and Nuclear Binding Energy for Bh-269 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-269 (Bohrium, atomic number Z = 107, mass number A = 269).

  18. Atomic Mass and Nuclear Binding Energy for Bh-297 (Bohrium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Bh-297 (Bohrium, atomic number Z = 107, mass number A = 297).

  19. 40 CFR 265.273 - Waste analysis.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Waste analysis. 265.273 Section 265.273 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED... FACILITIES Land Treatment § 265.273 Waste analysis. In addition to the waste analyses required by §...

  20. 29 CFR 1952.273 - Developmental schedule.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 9 2010-07-01 2010-07-01 false Developmental schedule. 1952.273 Section 1952.273 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR (CONTINUED) APPROVED STATE PLANS FOR ENFORCEMENT OF STATE STANDARDS Vermont § 1952.273 Developmental...

  1. 39 CFR 273.10 - Reports.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Reports. 273.10 Section 273.10 Postal Service... REMEDIES ACT § 273.10 Reports. (a) Not later than October 31 of each year, the Postmaster General shall prepare and transmit to the appropriate committees and subcommittees of the Congress an annual...

  2. 46 CFR 199.273 - Immersion suits.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Immersion suits. 199.273 Section 199.273 Shipping COAST... SYSTEMS FOR CERTAIN INSPECTED VESSELS Additional Requirements for Cargo Vessels § 199.273 Immersion suits. (a) Each cargo vessel must carry an immersion suit approved under approval series 160.171 of...

  3. Dicty_cDB: VHD273 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHD273 (Link to dictyBase) - - - Contig-U16379-1 VHD273P (Link to Original site) VHD2...73F 596 VHD273Z 684 VHD273P 1260 - - Show VHD273 Library VH (Link to library) Clone ID VHD2...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHD2-D/VHD273Q.Seq.d/ Representative seq. ID VHD2...73P (Link to Original site) Representative DNA sequence >VHD273 (VHD273Q) /CSM/VH/VHD2-D/VHD2...ore E Sequences producing significant alignments: (bits) Value VHD273 (VHD273Q) /CSM/VH/VHD2-D/VHD273Q.Seq.d

  4. 48 CFR 538.273 - Contract clauses.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Contract clauses. 538.273... Schedules 538.273 Contract clauses. (a) Multiple award schedules. Insert in solicitations and contracts: (1) 552.238-70, Identification of Electronic Office Equipment Providing Accessibility for the...

  5. 25 CFR 273.31 - Distribution formula.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Distribution formula. 273.31 Section 273.31 Indians... formula. (a) Funds shall be distributed to eligible contractors based upon the number of eligible Indian... formula. (b) The Assistant Secretary may make exceptions to the provisions of paragraph (a) of...

  6. 43 CFR 27.3 - Discrimination prohibited.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Discrimination prohibited. 27.3 Section 27... ISSUED UNDER TITLE II OF PUBLIC LAW 93-153 § 27.3 Discrimination prohibited. (a) General. No person shall... through contractual or other arrangements, subject an individual to discrimination on the grounds of...

  7. 40 CFR 273.16 - Employee training.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Employee training. 273.16 Section 273.16 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED... Employee training. A small quantity handler of universal waste must inform all employees who handle or...

  8. 40 CFR 273.36 - Employee training.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Employee training. 273.36 Section 273.36 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED... Employee training. A large quantity handler of universal waste must ensure that all employees...

  9. 3C 273 - half a century later

    OpenAIRE

    Slavcheva-Mihova, L.; Mihov, B.; I. Iliev

    2013-01-01

    We have presented an optical monitoring of 3C 273, the first quasar discovered fifty years ago. It does not show variability both on intra-night and long-term time scales. To facilitate the further monitoring of 3C 273, we compiled the available calibrations of the comparison stars in its field into a mean sequence.

  10. 25 CFR 273.45 - Indian preference.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Indian preference. 273.45 Section 273.45 Indians BUREAU... preference. (a) Any contract made by the Bureau with a State, school district or Indian corporation shall provide that the contractor shall, to the greatest extent feasible, give preference in and...

  11. Theoretical predictions on the low-lying excitation structure of super-heavy element bohrium (Z=107)

    International Nuclear Information System (INIS)

    The success of theoretical and experimental study of fermium (Z=100) enlightened authors to perform further investigation of heavy elements. The authors studied some low-lying absorption spectroscopy and the resonant absorption probability of bohrium (Z=107) by using MCDF method which included the correlation effects and relativistic effects systematically. The authors hope the results will be useful for the further experiments

  12. Theoretical predications on the low-lying excitation structure of super-heavy element bohrium (Z=107)

    International Nuclear Information System (INIS)

    The success of theoretical and experimental study of fermium (z=100) enlightened us to perform further investigation of heavy elements. We studied some low-lying absorption spectroscopy and the resonant absorption probability of bohrium (Z=107) by using MCDF method which considered the correlation effects and relativistic effects systematically. We hope our results will be useful for the further experiments. (authors)

  13. A Supernova Factory in Mrk 273?

    CERN Document Server

    Bondi, M; Dallacasa, D; Muxlow, T W B

    2005-01-01

    We report on 1.6 and 5.0 GHz observations of the ultraluminous infrared galaxy (ULIRG) Mrk 273, using the European VLBI Network (EVN) and the Multi-Element Radio-Linked Interferometer Network (MERLIN). We also make use of published 1.4 GHz VLBA observations of Mrk 273 by Carilli & Taylor (2000). Our 5 GHz images have a maximum resolution of 5-10 mas, which corresponds to linear resolutions of 3.5-7 pc at the distance of Mrk 273, and are the most sensitive high-resolution radio observations yet made of this ULIRG. Component N1, often pinpointed as a possible AGN, displays a steep spectral index ($\\alpha = 1.2 \\pm 0.1; S_\

  14. BATSE observations of 3C273

    Science.gov (United States)

    Paciesas, W.S.; Mallozzi, R. S.; Pendleton, G. N.; Harmon, B. A.; Wilson, C. A.; Zhang, S. N.; Fishman, G. J.

    1994-01-01

    The quasar 3C273 has been detected by all instruments on CGRO. The emission from this source is monitored continuously by BATSE using Earth occultation. We present results of a preliminary analysis of BATSE data, including light curves of the 3C273 flux covering approximately 150 days in the interval April-August 1991 and approximately 350 days in the interval July 1992-April 1993. The source intensity in the energy range 50-300 keV is typically approx. 0.002 ph cm(exp -2)s(exp -1). We find weak evidence for variations of as much as a factor of 3 in the intensity. We derive spectral parameters of 3C273 during the intervals TJD 8422-8435 (15-28 June 1991) and TJD 8532-8546 (3-17 October 1991) for comparison with other CGRO instruments.

  15. The Bright Quasar 3C 273

    OpenAIRE

    Courvoisier, Thierry J. -L.

    1998-01-01

    We review the observed properties of the bright quasar 3C~273 and discuss the implications of these observations for the emission processes and in view of gaining a more global understanding of the object. Continuum and line emission are discussed. The emission from the radio domain to gamma rays are reviewed. Emphasis is given to variability studies across the spectrum as a means to gain some understanding on the relationships between the emission components. 3C~273 has a small scale jet and...

  16. 7 CFR 273.7 - Work provisions.

    Science.gov (United States)

    2010-01-01

    ... eligibility requirements listed in § 273.5. A student will remain exempt during normal periods of class attendance, vacation, and recess. If the student graduates, enrolls less than half-time, is suspended or... accordance with the Child Care and Development Block Grant provisions of 45 CFR 98.43, and based on...

  17. 40 CFR 273.56 - Exports.

    Science.gov (United States)

    2010-07-01

    ... countries specified in 40 CFR 262.58(a)(1) (in which case the transporter is subject to the requirements of 40 CFR part 262, subpart H) may not accept a shipment if the transporter knows the shipment does not... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Exports. 273.56 Section...

  18. 7 CFR 273.1 - Household concept.

    Science.gov (United States)

    2010-01-01

    .... Editorial Note: For Federal Register citations affecting § 273.1, see the List of CFR Sections Affected... under 22 years of age who is living with his or her natural or adoptive parent(s) or step-parent(s); and (iii) A child (other than a foster child) under 18 years of age who lives with and is under...

  19. 7 CFR 273.14 - Recertification.

    Science.gov (United States)

    2010-01-01

    ... recertification process, the State agency must conduct a face-to-face interview with a member of the household or... requirement for a face-to-face interview once every 12 months may be waived in accordance with § 273.2(e)(2...-month period, the State agency may choose to conduct a face-to-face interview with that household...

  20. 25 CFR 273.2 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... may have resulted from socio-economic conditions of the parents, from cultural or language differences or other factors, and as provided by § 273.34(b). (u) “Tribal government,” “tribal governing body.... (e) “Economic enterprise” means any commercial, industrial, agricultural, or business activity...

  1. Radio jet of 3C273

    International Nuclear Information System (INIS)

    Radio observation at 408 MHz of 3C273 are reported which show that the brightness of the postulated counter-jet is <1/100 of the brightness of the visible jet. Possible explanations of these observations are discussed. (U.K.)

  2. IRIS photometry of 3C273

    International Nuclear Information System (INIS)

    Twenty-seven blue plates of 3C 273 originally measured by Zwicky, Karpowicz, and Rudnicki using the Argelander method and measurement of image diameters were remeasured on an iris photometer to improve their precision. These measures, including two later observations, have an accuracy approximately +-0.1m. Some errors in the Julian day numbers given in the earlier study are corrected

  3. IRIS photometry of 3C273

    Energy Technology Data Exchange (ETDEWEB)

    Lanning, H.H.

    1976-04-01

    Twenty-seven blue plates of 3C 273 originally measured by Zwicky, Karpowicz, and Rudnicki using the Argelander method and measurement of image diameters were remeasured on an iris photometer to improve their precision. These measures, including two later observations, have an accuracy approximately +-0.1m. Some errors in the Julian day numbers given in the earlier study are corrected.

  4. 48 CFR 719.273-6 - Application process.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Application process. 719.273-6 Section 719.273-6 Federal Acquisition Regulations System AGENCY FOR INTERNATIONAL DEVELOPMENT...égé Program 719.273-6 Application process. Entities interested in becoming a Mentor firm...

  5. 14 CFR 21.273 - Airworthiness certificates other than experimental.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Airworthiness certificates other than experimental. 21.273 Section 21.273 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF... Procedures § 21.273 Airworthiness certificates other than experimental. (a) The manufacturer may issue...

  6. 27 CFR 27.3 - Delegations of the Administrator.

    Science.gov (United States)

    2010-04-01

    ....27, Delegation of the Administrator's Authorities in 27 CFR Part 27, Importation of Distilled Spirits... Administrator. 27.3 Section 27.3 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... § 27.3 Delegations of the Administrator. The regulatory authorities of the Administrator contained...

  7. 7 CFR 273.20 - SSI cash-out.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false SSI cash-out. 273.20 Section 273.20 Agriculture... FOOD STAMP AND FOOD DISTRIBUTION PROGRAM CERTIFICATION OF ELIGIBLE HOUSEHOLDS § 273.20 SSI cash-out. (a) Ineligibility. No individual who receives supplemental security income (SSI) benefits and/or State...

  8. 3q27.3 microdeletional syndrome

    DEFF Research Database (Denmark)

    Thevenon, Julien; Callier, Patrick; Poquet, Hélène;

    2014-01-01

    BACKGROUND: Since the advent of array-CGH, numerous new microdeletional syndromes have been delineated while others remain to be described. Although 3q29 subtelomeric deletion is a well-described syndrome, there is no report on 3q interstitial deletions. METHODS: We report for the first time seven...... patients with interstitial deletions at the 3q27.3q28 locus gathered through the Decipher database, and suggest this locus as a new microdeletional syndrome. RESULTS: The patients shared a recognisable facial dysmorphism and marfanoid habitus, associated with psychosis and mild to severe intellectual...... disability (ID). Most of the patients had no delay in gross psychomotor acquisition, but had severe impaired communicative and adaptive skills. Two small regions of overlap were defined. The first one, located on the 3q27.3 locus and common to all patients, was associated with psychotic troubles and mood...

  9. Superluminal expansion of quasar 3C273

    International Nuclear Information System (INIS)

    Using the very long baseline interferometry technique observations of the radio structure of the quasar 3C273 have been obtained from mid-1977 to mid-1980 at 10.65 and 5.0 GHz. Maps based on the 10.65 GHz results are presented which provide unambiguous evidence of superluminal expansion. It is argued that the apparent constant velocity of 9.6c observed in this period is an important constraint on superluminal expansion theories. (U.K.)

  10. The radio jet of 3C273

    International Nuclear Information System (INIS)

    Most radio sources are two-sided and a minority are one-sided. The first-known and brightest example is 3C273, a high-luminosity QSO, showing 'super-luminal' proper motions in the core. The explanation of such one-sided sources may follow one of two lines: on the one hand, the ejection of material from the central object may truly be one-sided, while on the other hand the ejection may be two-sided but at a relativistic speed, so that the receding half is hidden by Doppler beaming. (Auth.)

  11. Properties of an $\\alpha$ particle in a Bohrium $270$ Nucleus under the Generalized Symmetric Woods-Saxon Potential

    CERN Document Server

    Lütfüoğlu, B C

    2016-01-01

    The energy eigenvalues and the wave functions of an $\\alpha$ particle in a Bohrium $270$ nucleus were calculated by solving Schr\\"odinger equation for Generalized Symmetric Woods-Saxon potential. Using the energy spectrum by excluding and including the quasi-bound eigenvalues, entropy, internal energy, Helmholtz energy, and specific heat, as functions of reduced temperature were calculated. Stability and emission characteristics are interpreted in terms of the wave and thermodynamic functions. The kinetic energy of a decayed $\\alpha$ particle was calculated using the quasi-bound states, which is found close to the experimental value.

  12. Inner radio jet of 3C273

    Energy Technology Data Exchange (ETDEWEB)

    Zensus, J.A.; Cohen, M.H.; Baaaath, L.B.; Nicolson, G.D.

    1988-08-04

    Radio maps of 3C273 obtained with very long baseline interferometry (VLBI) have been limited by low dynamic range and poor north-south resolution resulting from the low declination of this quasar. Dramatic improvement can now be achieved using larger arrays and antennas in the Southern Hemisphere. A new VLBI map, made at 5 GHz with angular resolution and dynamic range unsurpassed at this frequency for this source, shows a narrow jet extending to a projected distance lsub(proj) approx. 125 h/sup -1/ parsecs from the core. Superluminal motion exists out to at least lsub(proj) ''approx ='' 46 h/sup -1/ parsecs. Successive superluminal components emerge from the core and appear to move on a fixed curved path with similar speeds of about 1 milliarcseconds per year.

  13. 48 CFR 719.273-10 - Internal controls.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Internal controls. 719.273...égé Program 719.273-10 Internal controls. (a) OSDBU will oversee the Program and will work in... objectives. OSDBU will establish internal controls as checks and balances applicable to the Program....

  14. 48 CFR 852.273-70 - Late offers.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Late offers. 852.273-70... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 852.273-70 Late offers. As prescribed in 873.110(a), insert the following provision: Late Offers (JAN 2003) This provision...

  15. Dicty_cDB: SSD273 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSD273 (Link to dictyBase) - G02144 DDB0231105 Contig-U12265-1 SSD273E (Lin ... ' polyadenylated late RNA transcribed from the DNA resolution ... sequences at the terminal hairpin loop region of t ... ' polyadenylated late RNA transcribed from the DNA resolution ... sequences at the terminal hairpin loop region of t ...

  16. 40 CFR 273.4 - Applicability-Mercury-containing equipment.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Applicability-Mercury-containing... WASTES (CONTINUED) STANDARDS FOR UNIVERSAL WASTE MANAGEMENT General § 273.4 Applicability—Mercury-containing equipment. (a) Mercury-containing equipment covered under this part 273. The requirements of...

  17. 40 CFR 273.2 - Applicability-batteries.

    Science.gov (United States)

    2010-07-01

    ... under 40 CFR part 273. (1) The requirements of this part apply to persons managing batteries, as... which are not managed under 40 CFR part 266, subpart G, are subject to management under this part. (b) Batteries not covered under 40 CFR part 273. The requirements of this part do not apply to persons...

  18. 39 CFR 273.6 - Evaluation by reviewing official.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Evaluation by reviewing official. 273.6 Section... PROGRAM FRAUD CIVIL REMEDIES ACT § 273.6 Evaluation by reviewing official. (a) Based upon the investigatory report prepared by the Investigating Official, the Reviewing Official shall determine...

  19. Chaotic Feature in the Light Curve of 3C 273

    OpenAIRE

    Liu, Lei

    2006-01-01

    Some nonlinear dynamical techniques, including state-space reconstruction and correlation integral, are used to analyze the light curve of 3C 273. The result is compared with a chaotic model. The similarity between them suggests that there is a low-dimensional chaotic attractor in the light curve of 3C 273.

  20. Dicty_cDB: SSC273 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC273 (Link to dictyBase) - - - Contig-U07980-1 SSC273F (Link to Original ... ents: (bits) Value EU276418_1( EU276418 |pid:none) Olive ... flounder iridovirus strain O... 36 0.47 AB043979_1 ...

  1. Radio jet of the quasar 3C273

    Energy Technology Data Exchange (ETDEWEB)

    Flatters, C.; Conway, R.G.

    1985-04-04

    Although 3C273 was one of the first quasars to be identified, the extended feature 3C273A, which can be detected at radio, optical and X-ray wavelengths, remains an enigma. The source is an extreme example of a one-sided radio source (3C273A has no detectable counter component) and this fact, coupled with the presence of the optical emission, makes it unlikely that 3C273A is a normal (slow-moving) radio lobe. Superluminal transverse motion at milliarc second scales shows that relativistic velocities occur within the quasar itself, 3C273B; it is an open question whether these velocities persist out to 3C273A. It has been widely suggested that Doppler beaming causes the one-sidedness of this and similar sources by suppressing the receding half of the source, but there are no spectral lines by which the Doppler shift of 3C273A could be directly measured. Thus, any (indirect) indication of the velocity is of interest. Here new MERLIN observations of the brightness and polarization of the radio jet of 3C273 at a resolution of 0.35 arc s are presented. One of the most marked features of the new map, the high polarization found within the head of the source, is hard to explain. If the motion is indeed fast, then relativistic aberration should be taken into account; it suggests that this leads to a natural explanation of the high observed polarization. 18 references, 1 figure, 1 table.

  2. A Modified Stratified Model for 3C 273 Jet

    OpenAIRE

    Liu, Wen-Po; Shen, Zhi-Qiang

    2008-01-01

    We present a modified stratified jet model to interpret the observed spectral energy distributions of knots in 3C 273 jet. Based on the hypothesis of the single index of the particle energy spectrum at injection and identical emission processes among all the knots, the observed difference of spectral shape among different 3C273 knots can be understood as a manifestation of deviation of the equivalent Doppler factor of stratified emission regions in individual knot from a characteristic one. T...

  3. A Modified Stratified Model for 3C 273 Jet

    CERN Document Server

    Liu, Wen-Po

    2008-01-01

    We present a modified stratified jet model to interpret the observed spectral energy distributions of knots in 3C 273 jet. Based on the hypothesis of the single index of the particle energy spectrum at injection and identical emission processes among all the knots, the observed difference of spectral shape among different 3C273 knots can be understood as a manifestation of deviation of the equivalent Doppler factor of stratified emission regions in individual knot from a characteristic one. The summed spectral energy distribution of all the ten knots in 3C 273 jet can be well fitted by two components, low-energy (radio to optical) component dominated by the synchrotron radiation and high-energy component (UV, X-ray and $\\gamma$-ray) dominated by the inverse Compton scattering of the cosmic microwave background. This gives a consistent spectral index of $\\alpha=0.88$ ($S_\

  4. Optical variability of PHL 1811 and 3C 273

    Science.gov (United States)

    Fan, J. H.; Kurtanidze, O.; Liu, Y.; Yuan, Y. H.; Hao, J. M.; Cai, W.; Xiao, H. B.; Pei, Z. Y.

    2015-03-01

    In this work, we reported the optical photometry monitoring results for two brightest nearby quasars, PHL 1811 and 3C 273 using the ST-6 camera at Abastumani Observatory, Georgia. For PHL 1811, we found 3 microvariability events with time scale of ΔT = 6.0 min. For 3C273, we found that the largest variations are ΔV = 0.369 +/- 0.028 mag, ΔR = 0.495 +/- 0.076 mag, and ΔI = 0.355 +/- 0.009 mag. When periodicity analysis methods are adopted to the available data, a period of p = 5.80 +/- 1.12 years is obtained for PHL 1811, and p = 21.10 +/- 0.14, 10.00 +/- 0.14, 7.30 +/- 0.09, 13.20 +/- 0.09, 2.10 +/- 0.06, and 0.68 +/- 0.05 years are obtained for 3C 273.

  5. New infrared spectral component of the quasar 3C273

    Energy Technology Data Exchange (ETDEWEB)

    Robson, E.I.; Gear, W.K.; Brown, L.M.J.; Courvoisier, T.J.-L.; Smith, M.G.; Griffin, M.J.; Blecha, A.

    1986-09-11

    Following the dramatic infrared to millimetre-wavelength flare seen in the quasar 3C273 during 1983, the authors have continued to monitor its overall continuum emission. Recent measurements show that the 10-..mu..m to 3-mm emission has decayed to a level well below any seen previously, while the 1-4-..mu..m emission has remained relatively constant. This behaviour has revealed the presence of an apparently non-variable component which dominates the near-infrared emission in 3C273 and includes the small 'bump' at approx. 3.5 ..mu..m in the power-law continuum.

  6. On the Jet Activity in 3C 273

    OpenAIRE

    Stawarz, L.

    2004-01-01

    In this paper we comment on the possibility for intermittent jet activity in quasar 3C 273 on different time-scales. We propose, that striking morphology of the large-scale radio jet in this source, as well as the apparent lack of its counterpart on the opposite side of the active center, may be explained in a framework of a restarting jet model. In particular, we propose that 3C 273 radio source is intrinsically two-sided, and represents an analogue of double-double radio galaxies, but only ...

  7. The high energy spectrum of 3C 273

    OpenAIRE

    Esposito, V; R. Walter(ISDC); Jean, P.; Tramacere, A.; M. Türler; A. Lähteenmäki(Aalto University Metsähovi Radio Observatory, Kylmälä, Finland); Tornikoski, M.

    2015-01-01

    Aims. The high energy spectrum of 3C 273 is usually understood in terms of inverse-Compton emission in a relativistic leptonic jet. This model predicts variability patterns and delays that could be tested with simultaneous observations from the radio to the GeV range. Methods. The instruments IBIS, SPI, JEM-X on board INTEGRAL, PCA on board RXTE, and LAT on board Fermi have enough sensitivity to follow the spectral variability of 3C 273 from the keV to the GeV. We looked for correlations betw...

  8. 7 CFR 273.4 - Citizenship and alien status.

    Science.gov (United States)

    2010-01-01

    ....” means that the alien is lawfully present as defined at 8 CFR 103.12(a). (b) Reporting illegal aliens. (1... participating in the Program from any demand made under 8 CFR 213a.4(a) for the value of food stamp benefits... 7 Agriculture 4 2010-01-01 2010-01-01 false Citizenship and alien status. 273.4 Section...

  9. Dicty_cDB: CFK273 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFK273 (Link to dictyBase) - - - Contig-U08029-1 - (Link to Original site) ... 152123_6( AC152123 |pid:none) Genomic sequence for broccoli ... [Bra... 99 5e-20 DQ980427_1( DQ980427 |pid:none) P ...

  10. Structure of caesium disulfate at 120 and 273 K

    DEFF Research Database (Denmark)

    Ståhl, Kenny; Berg, Rolf W.; Eriksen, Kim Michael; Fehrmann, Rasmus

    2009-01-01

    The crystal structures of Cs2S2O7 at 120 and 273 K have been determined from X-ray single-crystal data. Caesium disulfate represents a new structure type with a uniquely high number of independent formula units at 120 K: In one part caesium ions form a tube surrounding the disulfate ions, [Cs8(S2...

  11. 7 CFR 273.2 - Office operations and application processing.

    Science.gov (United States)

    2010-01-01

    ... individual participated in that State. The normal processing standards of 7 CFR 273.2(g) apply. The State..., age, religion, political beliefs, or disability. “To file a complaint of discrimination, write USDA... eligibility. The SSA Quarters of Coverage History System (QCHS) is available for purposes of verifying...

  12. Optical polarization in the jet of 3C273

    International Nuclear Information System (INIS)

    A linear polarization map of the optical jet of 3C273 is presented. Along the whole length of the visible jet significant levels of polarization are detected with an orientation approximately perpendicular to the jet axis. The results remove the need to invoke a non-synchrotron contribution to the optical emission from the jet. (author)

  13. Is the 3C273 quasar mach nearer?

    International Nuclear Information System (INIS)

    Effect of ''superlight'' expansion of some quasars resulting from cosmologic interpretation of red shift is considered. Possibility of determining distance to 3C273 quasar, taking account of its expansion angular velocity in frames of Doppler interpretation of quasar red shift value, is discussed

  14. Optical polarization in the jet of 3C273

    Energy Technology Data Exchange (ETDEWEB)

    Scarrott, S.M.; Warren-Smith, R.F.

    1987-10-01

    A linear polarization map of the optical jet of 3C273 is presented. Along the whole length of the visible jet significant levels of polarization are detected with an orientation approximately perpendicular to the jet axis. The results remove the need to invoke a non-synchrotron contribution to the optical emission from the jet.

  15. The jet in the quasar 3C273

    International Nuclear Information System (INIS)

    The quasar 3C273 has been mapped with the six telescope array, MERLIN, at both 408 MHz and 1666 MHz, yielding maps with resolutions of 0.9 and 0.35 arc s. Both maps show evidence for quasi-sinusoidal wiggles. Two models explaining this, are shortly discussed. (Auth.)

  16. 40 CFR 273.3 - Applicability-pesticides.

    Science.gov (United States)

    2010-07-01

    ... collection program. (b) Pesticides not covered under 40 CFR part 273. The requirements of this part do not... are managed by farmers in compliance with 40 CFR 262.70. (40 CFR 262.70 addresses pesticides disposed... label, providing the container is triple rinsed in accordance with 40 CFR 261.7(b)(3)); (2)...

  17. 33 CFR Appendix E to Part 273 - Preventive Safety Measures in Handling of Herbicides

    Science.gov (United States)

    2010-07-01

    ..., DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE AQUATIC PLANT CONTROL Pt. 273, App. E Appendix E to Part 273.... When herbicides or defoliants volatize, the resulting vapors may be poisonous to humans, and they...

  18. 25 CFR 273.42 - Civil Rights Act violations.

    Science.gov (United States)

    2010-04-01

    ...'Malley Act or by any other means authorized by law. As delineated in 43 CFR 17.1, 17.8, and 17.9, such... departments, provide for the conduct of consolidated or joint hearings as prescribed in 43 CFR 17.8(e). ... 25 Indians 1 2010-04-01 2010-04-01 false Civil Rights Act violations. 273.42 Section...

  19. The blue-bump of 3C 273

    OpenAIRE

    Paltani, S.; Courvoisier, T. J-L.; R. Walter(ISDC)

    1998-01-01

    We present optical and ultraviolet observations of 3C273 covering the whole life of the IUE satellite. We analyze the variability properties of the light curves, and find that two variable components, written B and R respectively, must contribute to the blue-bump emission in this object. The B component produces most of the variability in the ultraviolet domain. A maximum time scale of variability of about 2 yr identical at all wavelengths is found. If discrete events produce this component, ...

  20. Delta-function Approximation SSC Model in 3C 273

    Indian Academy of Sciences (India)

    S. J. Kang; Y. G. Zheng; Q. Wu

    2014-09-01

    We obtain an approximate analytical solution using approximate calculation on the traditional one-zone synchrotron self-Compton (SSC) model. In this model, we describe the electron energy distribution by a broken power-law function with a sharp cut-off, and non-thermal photons are produced by both synchrotron and inverse Compton scattering of synchrotron photons. We calculate the radiation energy spectrum of electrons by the function. We apply this model to the multi-wavelength Spectral Energy Distributions (SED) of the 3C 273 in different states, and obtain excellent fits to the observed spectra of this source.

  1. MERLIN radio observations of the quasar 3C 273

    International Nuclear Information System (INIS)

    MERLIN observations of the radio jet of the quasar 3C 273 at 408 and 1666 Mhz are presented. Most of the important features previously seen at 408 MHz are confirmed. The jet extends from 12 to 23 arcsec from the quasar, and has a single bright head at 408 MHz. At the higher resolution of the 1666-MHz map the head is seen to consist of at least three subcomponents, the brightest of which is set back from the outermost point of the jet. The ridgeline of emission shows oscillations from side to side ('wiggles'), the wavelength of which decreases markedly as the bright head is approached. (author)

  2. HST/STIS Spectroscopy of 3C 273

    OpenAIRE

    Heap, S. R.; Williger, G. M.; Dave, R.; Weymann, R. J.; Jenkins, E. B.; Tripp, T. M.

    2001-01-01

    We present preliminary results on the low-redshift Lyman alpha forest as based on STIS spectra of 3C 273. A total of 121 intergalactic Lyman alpha-absorbing systems were detected, of which 60 are above the 3.5 sigma completness limit, log N(HI)~12.3. The median Doppler parameter, b=27 km/s, is similar to that seen at high redshift. However the distribution of HI column densities (dN/dN(HI) propto N(HI)^-beta) has a steeper slope, beta = 2.02 +- 0.21, than is seen at high redshift. Overall, th...

  3. XMM-Newton observations of 3C 273

    OpenAIRE

    Page, K. L.; Turner, M. J. L.; Done, C.; O'Brien, P. T.; Reeves, J. N.; Sembay, S.; Stuhlinger, M

    2003-01-01

    A series of nine XMM-Newton observations of the radio-loud quasar 3C 273 are presented, concentrating mainly on the soft excess. Although most of the individual observations do not show evidence for iron emission, co-adding them reveals a weak, broad line (EW ~ 56 eV). The soft excess component is found to vary, confirming previous work, and can be well fitted with multiple blackbody components, with temperatures ranging between ~40 and ~330 eV, together with a power-law. Alternatively, a Com...

  4. The jet of 3C 273 observed with ROSAT HRI

    OpenAIRE

    Roeser, Hermann-Josef; Meisenheimer, Klaus; Neumann, Martin; Conway, R. G.; Perley, R.A.

    2000-01-01

    ROSAT HRI observations of 3C 273 reveal X-ray emission all along the optically visible jet with the peak of emission at the inner end. Whereas the X-ray emission from the innermost knot A is consistent with a continuation of the radio-to-optical synchrotron continuum, a second population of particles with higher maximum energy has to be invoked to explain the X-ray emission from knots B, C and D in terms of synchrotron radiation. Inverse Compton emission could account for the X-ray flux from ...

  5. The radio jet of the quasar 3C273

    International Nuclear Information System (INIS)

    The authors present here new MERLIN observations of the brightness and polarization of the radio jet of the quasar 3C273 at a resolution of 0.35 arc s. One of the most marked features of the map, the high polarization found within the head of the source, is hard to explain. If the motion is indeed fast, then relativistic aberration should be taken into account; it is suggested that this leads to a natural explanation of the high observed polarization. (author)

  6. The mass of the black hole in 3C 273

    OpenAIRE

    Paltani, S.; Turler, M.

    2005-01-01

    In this paper we apply the reverberation method to determine the mass of the black hole in 3C273 from the Ly a and C iv emission lines using archival IUE observations. Following the standard assumptions of the method, we find a maximum-likelihood estimate of the mass of 6.59 10^9 Mo, with a 1 sigma confidence interval 5.69-8.27 10^9 Mo. This estimate is more than one order of magnitude larger than that obtained in a previous study using Balmer lines. We reanalyze the optical data and show tha...

  7. Rapid variability of 3C273 at 300 GHz

    International Nuclear Information System (INIS)

    With a broadband bolometer mounted on the 3.6 m ESO telescope the authors have measured 3C273 at 300 GHz 6 times in 6 days. During this series of measurements they observed a sudden drop in flux density by 11.6 +- 2.9 Jy (spectral index assumed to be zero, and all known errors included). In an interpretation with the model of bulk relativistic motion the brightness temperature inferred can be combined with the observed superluminal motion, and strict limits on the model parameters can be derived. (Auth.)

  8. The high-energy spectrum of 3C 273

    OpenAIRE

    Esposito, Valentino; Walter, Roland; Jean, Pierre; Tramacere, Andrea

    2013-01-01

    The high energy spectral shape of 3C 273 is usually understood in terms of Inverse-Compton emission in a relativistic leptonic jet. This model predicts variability patterns and delays which could be tested if simultaneous observations are available from the infrared to the GeV range. The instruments IBIS, SPI, JEM-X on board INTEGRAL, PCA on board RXTE and LAT on board Fermi have enough sensitivity to follow the spectral variability from the keV to the GeV and to compare them with model predi...

  9. Ultraviolet spectrum of quasi-stellar object 3C273

    Science.gov (United States)

    Davidsen, A. F.; Hartig, G. F.; Fastie, W. G.

    1977-01-01

    The first direct observation of the ultraviolet spectrum of a quasi-stellar object (QSO) has been made with a rocket-borne telescope. The emission line spectrum of 3C273 is similar to the spectra of high-redshift QSOs, but no absorption is observed. The results provide important new constraints on theoretical models of QSOs, place a severe limit on the density of neutral hydrogen in the intergalactic medium, and suggest a cosmological origin for much of the absorption seen in high-redshift QSOs. Comparison of the ultraviolet spectrophotometry of low- and high-redshift QSOs suggests that the universe is closed, with a deceleration parameter of about 1.

  10. Evolution of 3C 273 at 10.7 GHz

    International Nuclear Information System (INIS)

    The quasar 3C 273 has been observed at 10.7 GHz at three epochs spanning 1984.1-1985.6. Two new superluminal components, C5 and C7a, are separating from the core with apparent transverse velocity v/c = (8.0 + or - 0.2)/h and (5.1 + or - 0.3)/h. The old components C3 and C4 may still be recognizable, with C4 having moved from 2.5 to perhaps 10 mas from the core in 7 yr. Nonmonotonic curvature near the core is confirmed. 8 references

  11. Evolution of 3C 273 at 10. 7 GHz

    Energy Technology Data Exchange (ETDEWEB)

    Cohen, M.H.; Zensus, J.A.; Biretta, J.A.; Comoretto, G.; Kaufmann, P.

    1987-04-01

    The quasar 3C 273 has been observed at 10.7 GHz at three epochs spanning 1984.1-1985.6. Two new superluminal components, C5 and C7a, are separating from the core with apparent transverse velocity v/c = (8.0 + or - 0.2)/h and (5.1 + or - 0.3)/h. The old components C3 and C4 may still be recognizable, with C4 having moved from 2.5 to perhaps 10 mas from the core in 7 yr. Nonmonotonic curvature near the core is confirmed. 8 references.

  12. The Inner Kiloparsec of Mrk 273 with Keck Adaptive Optics

    CERN Document Server

    Vivian, U; Sanders, David; Max, Claire; Armus, Lee; Iwasawa, Kazushi; Evans, Aaron; Kewley, Lisa; Fazio, Giovanni

    2013-01-01

    There is X-ray, optical, and mid-infrared imaging and spectroscopic evidence that the late-stage ultraluminous infrared galaxy merger Mrk 273 hosts a powerful active galactic nucleus (AGN). However, the exact location of the AGN and the nature of the nuclei have been difficult to determine due to dust obscuration and the limited wavelength coverage of available high-resolution data. Here we present near-infrared integral-field spectra and images of the nuclear region of Mrk 273 taken with OSIRIS and NIRC2 on the Keck II Telescope with laser guide star adaptive optics. We observe three spatially resolved components, and analyze the local molecular and ionized gas emission lines and their kinematics. We confirm the presence of the hard X-ray AGN in the southwest nucleus. In the north nucleus, we find a strongly rotating gas disk whose kinematics indicate a central black hole of mass 1.04 +/- 0.1 x 10^9 Msun. The H2 emission line shows an increase in velocity dispersion along the minor axis in both directions, a...

  13. Molecular hydrogen emission from the bright quasar 3C273

    International Nuclear Information System (INIS)

    The discovery of broad emission lines in polarized light from the type 2 Seyfert galaxy NGCl068 led to postulation of the existence of a type 1 Seyfert nucleus shrouded from our direct view by a torus of molecular gas. Theoretical development of this idea included the suggestion that low-angular-momentum clouds in the torus are captured by the central source, fuelling the observed activity. The difficulty in applying this model to all active galactic nuclei (AGNs) is the lack of convincing evidence for molecular gas in 'bare' nucleus objects such as the quasar 3C273, which exhibits a simple power-law continuum and no excess of thermal dust emission. Here we present observations, made during the course of a survey for rotation and vibration lines of H2 emission from type 1 Seyferts and quasars, of molecular hydrogen emission from 3C273. This is the first time such emission has been seen from a radio-loud quasar. (author)

  14. The mass of the black hole in 3C 273

    CERN Document Server

    Paltani, S

    2005-01-01

    In this paper we apply the reverberation method to determine the mass of the black hole in 3C273 from the Ly a and C iv emission lines using archival IUE observations. Following the standard assumptions of the method, we find a maximum-likelihood estimate of the mass of 6.59 10^9 Mo, with a 1 sigma confidence interval 5.69-8.27 10^9 Mo. This estimate is more than one order of magnitude larger than that obtained in a previous study using Balmer lines. We reanalyze the optical data and show that the method applied to the Ha, Hb, and Hg Balmer lines produce mass estimates lower by a factor 2.5, but already much larger than the previous estimate derived from the same lines. The finding of such a high mass in a face-on object is a strong indication that the gas motion is not confined to the accretion disk. The new mass estimate makes 3C273 accreting with an accretion rate about six times lower than the Eddington rate. We discuss the implications of our result for the broad-line-region size and black-hole mass vs l...

  15. Molecular hydrogen emission from the bright quasar 3C273

    Energy Technology Data Exchange (ETDEWEB)

    Kawara, Kimiaki (National Astronomical Observatory, Mitaka, Tokyo (Japan)); Nishida, Minoru (Kyoto Univ. (Japan). Dept. of Physics); Gregory, Brooke (Cerro Tololo Inter-American Observatory, La Serena (Chile) Royal Observatory, Edinburgh (UK))

    1989-09-21

    The discovery of broad emission lines in polarized light from the type 2 Seyfert galaxy NGCl068 led to postulation of the existence of a type 1 Seyfert nucleus shrouded from our direct view by a torus of molecular gas. Theoretical development of this idea included the suggestion that low-angular-momentum clouds in the torus are captured by the central source, fuelling the observed activity. The difficulty in applying this model to all active galactic nuclei (AGNs) is the lack of convincing evidence for molecular gas in 'bare' nucleus objects such as the quasar 3C273, which exhibits a simple power-law continuum and no excess of thermal dust emission. Here we present observations, made during the course of a survey for rotation and vibration lines of H{sub 2} emission from type 1 Seyferts and quasars, of molecular hydrogen emission from 3C273. This is the first time such emission has been seen from a radio-loud quasar. (author).

  16. Milliarcsecond polarization structure of the superluminal quasar 3C 273

    Energy Technology Data Exchange (ETDEWEB)

    Roberts, D.H.; Kollgaard, R.I.; Brown, L.F.; Gabuzda, D.C.; Wardle, J.F. C. (Brandeis Univ., Waltham, MA (USA))

    1990-09-01

    A 2 x 10 marcsec-resolution determination is presented for the total intensity and linear polarization structures of the superluminal quasar 3C 273 at 5 GHz. Substantial polarized flux was detected from several superluminal components of the jet, whose fractional polarization increased symmetrically with distance from the core; the most distant component is highly polarized and exhibits a highly ordered magnetic field. Within a few marcsec of the core, the inferred magnetic field orientation varies rapidly with position along the jet. The primarily longitudinal magnetic field orientation is concluded to become established within 20 marcsec of the core. A highly disorganized magnetic field is the most plausible explanation for the low degree of polarization in the innermost regions of the jet. 48 refs.

  17. Milliarcsecond polarization structure of the superluminal quasar 3C 273

    International Nuclear Information System (INIS)

    A 2 x 10 marcsec-resolution determination is presented for the total intensity and linear polarization structures of the superluminal quasar 3C 273 at 5 GHz. Substantial polarized flux was detected from several superluminal components of the jet, whose fractional polarization increased symmetrically with distance from the core; the most distant component is highly polarized and exhibits a highly ordered magnetic field. Within a few marcsec of the core, the inferred magnetic field orientation varies rapidly with position along the jet. The primarily longitudinal magnetic field orientation is concluded to become established within 20 marcsec of the core. A highly disorganized magnetic field is the most plausible explanation for the low degree of polarization in the innermost regions of the jet. 48 refs

  18. Ultraviolet spectrum of quasi-stellar object 3C273

    International Nuclear Information System (INIS)

    The first direct observation of the ultraviolet spectrum of a quasi-stellar object has been made with a rocket-borne telescope. The emission line spectrum of 3C273 is similar to the spectra of high-redshift QSOs, but no absorption is observed. The results provide important new constraints on theoretical models of QSOs, place a severe limit on the density of neutral hydrogen in the intergalactic medium, and suggest a cosmological origin for much of the absorption seen in high-redshift QSOs. Comparison of the ultraviolet spectrophotometry of low- and high-redshift QSOs suggests that the universe is closed, with the deceleration parameter q0 approximately 1. (author)

  19. The X-ray emission of 3C273

    International Nuclear Information System (INIS)

    The X-ray emission of 3C273 in the 0.2-35 keV band has been studied, with EXOSAT and Ginga, over the period 1983 December to 1988 December. The overall flux is variable on a time-scale of weeks by a factor of 2. The spectral index in the 2-10 keV band (α ∼ 0.5) is significantly different from the 'canonical' AGN index of α = 0.7. There are small but significant variations with time in the spectral index which are not statistically correlated with the overall X-ray flux level. Iron emission with an equivalent width of ∼ 50 eV is detected in one of the Ginga observations. (author)

  20. Ultraviolet emission-line variability in 3C273

    International Nuclear Information System (INIS)

    Evidence is presented for correlated variability between the ultraviolet continuum and the Lyα emission line in the luminous quasar 3C273. Using IUE data covering a period of ∼ 1000 d, Lyα varied by 15 per cent whilst the continuum varied by a factor of 2. A time series analysis gives a lag for Lyα relative to the ultraviolet continuum of 74 ± 33 d. The broad flat-topped shape of the cross-correlation function, and the small amplitude of the Lyα variability, indicate that the derived lag is a measure of the inner radius of a geometrically thick broad-line region. (author)

  1. Ultraviolet continuum variability of the quasar 3C273

    International Nuclear Information System (INIS)

    The authors report the first observations of variability in the ultraviolet spectrum of the quasar 3C273 (redshift, z=0.158) as observed by the International Ultraviolet Explorer in the period 1978-84. The flux at lambdasub(observed)=1,675 A increased by 1.25 between April and June 1982, then decreased by a factor 2 between June 1982 and April 1983. The amplitude of these variations and the constancy of the intensity of the Lyα emission line during the same period are indications that the ultraviolet variations are caused by variations of the black body and/or non-thermal components. The flux variations are accompanied by variations of the spectral shape. An interpretation is presented of the observed variability in terms of a discontinuous and variable distribution of the temperature on the photosphere emitting the ultraviolet continuum. (author)

  2. The X-ray emission of 3C273

    Energy Technology Data Exchange (ETDEWEB)

    Turner, M.J.L.; Williams, O.R. (Leicester Univ. (UK). Dept. of Astronomy); Courvoisier, T.J.-L. (Geneva Observatory (Switzerland)) (and others)

    1990-05-15

    The X-ray emission of 3C273 in the 0.2-35 keV band has been studied, with EXOSAT and Ginga, over the period 1983 December to 1988 December. The overall flux is variable on a time-scale of weeks by a factor of 2. The spectral index in the 2-10 keV band ({alpha} {approx} 0.5) is significantly different from the 'canonical' AGN index of {alpha} = 0.7. There are small but significant variations with time in the spectral index which are not statistically correlated with the overall X-ray flux level. Iron emission with an equivalent width of {approx} 50 eV is detected in one of the Ginga observations. (author).

  3. Ultraviolet emission-line variability in 3C273

    Energy Technology Data Exchange (ETDEWEB)

    O' Brien, P.T.; Harries, T.J. (University Coll., London (UK). Dept. of Physics and Astronomy)

    1991-05-01

    Evidence is presented for correlated variability between the ultraviolet continuum and the Ly{alpha} emission line in the luminous quasar 3C273. Using IUE data covering a period of {approx} 1000 d, Ly{alpha} varied by 15 per cent whilst the continuum varied by a factor of 2. A time series analysis gives a lag for Ly{alpha} relative to the ultraviolet continuum of 74 {+-} 33 d. The broad flat-topped shape of the cross-correlation function, and the small amplitude of the Ly{alpha} variability, indicate that the derived lag is a measure of the inner radius of a geometrically thick broad-line region. (author).

  4. The inner radio jet of 3C273

    International Nuclear Information System (INIS)

    Radio maps of 3C273 obtained with very long baseline interferometry (VLBI) have been limited by low dynamic range and poor north-south resolution resulting from the low declination of this quasar. Dramatic improvement can now be achieved using larger arrays and antennas in the Southern Hemisphere. A new VLBI map, made at 5 GHz with angular resolution and dynamic range unsurpassed at this frequency for this source, shows a narrow jet extending to a projected distance lsub(proj) ∼ 125 h-1 parsecs from the core. Superluminal motion exists out to at least lsub(proj) ''approx ='' 46 h-1 parsecs. Successive superluminal components emerge from the core and appear to move on a fixed curved path with similar speeds of about 1 milliarcseconds per year. (author)

  5. 25 CFR 273.38 - Equal quality and standard of education.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Equal quality and standard of education. 273.38 Section 273.38 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR INDIAN SELF-DETERMINATION AND... Equal quality and standard of education. Contracts with State education agencies or school...

  6. The disc-jet-spin connection: 3C273

    Science.gov (United States)

    Done, C.

    2014-07-01

    Black hole spin is difficult to measure as it leaves an imprint only close to the horizon, but it may be required to produce most dramatic relativistic jets. For stellar mass black holes there are two established methods to measure spin, from the disc continuum peak temperature in disc dominated states, and from the iron line profile in states with more hard X-ray flux. However, these two methods do not always agree! In AGN the higher black hole mass means a lower disc temperature, so the peak is in the unobservable EUV region, and only the iron line method can be used, but in very high mass AGN, the disc temperature is so low that the peak starts to be visible in the far UV. We use archival data from 3C273 where the observed far UV emission clearly requires a disc around a high spin black hole. The accretion flow dissipates all the available accretion energy, yet the jet in this system is known to be as powerful as the observed accretion flow. Since there is no accretion power left, the jet must be powered by another source of energy - and the only one remaining is black hole spin.

  7. The milliarcsecond structure of 3C 273 at 22 GHz

    International Nuclear Information System (INIS)

    The first VLBI images at 22 GHz of the jet in the quasar 3C 273 are presented. In addition to the compact core region, two emission regions can be identified with features seen at lower frequencies; they separate from the core with constant speeds of 0.65 + or - 0.09 and 0.92 + or - 0.11 mas/yr, corresponding to apparent superluminal motion of 4.3 + or - 0.3c and 6.1 + or - 0.3c (for Ho = 100 km/s Mpc, qo = 0.5). The core region brightened at about the estimated epoch of zero separation for the latest superluminal component, suggesting a causal relationship. The curved ridge line of the jet smoothly extends inward towards the core, although no pronounced bends in the range of core distance 0.5-2.5 mas are seen. No significant evidence is found against a common path of subsequent superluminal features. An apparent frequency dependence in the position of one superluminal feature tentatively suggests that opacity effects across the jet direction are present. The results are consistent with an interpretation of the superluminal features as shocks in an underlying relativistic flow, although alternative explanations cannot be ruled out. 43 refs

  8. The milliarcsecond structure of 3C 273 at 22 GHz

    Energy Technology Data Exchange (ETDEWEB)

    Zensus, J.A.; Biretta, J.A.; Unwin, S.C.; Cohen, M.H. (National Radio Astronomy Observatory, Socorro, NM (USA) Owens Valley Radio Observatory, Pasadena, CA (USA))

    1990-12-01

    The first VLBI images at 22 GHz of the jet in the quasar 3C 273 are presented. In addition to the compact core region, two emission regions can be identified with features seen at lower frequencies; they separate from the core with constant speeds of 0.65 + or - 0.09 and 0.92 + or - 0.11 mas/yr, corresponding to apparent superluminal motion of 4.3 + or - 0.3c and 6.1 + or - 0.3c (for Ho = 100 km/s Mpc, qo = 0.5). The core region brightened at about the estimated epoch of zero separation for the latest superluminal component, suggesting a causal relationship. The curved ridge line of the jet smoothly extends inward towards the core, although no pronounced bends in the range of core distance 0.5-2.5 mas are seen. No significant evidence is found against a common path of subsequent superluminal features. An apparent frequency dependence in the position of one superluminal feature tentatively suggests that opacity effects across the jet direction are present. The results are consistent with an interpretation of the superluminal features as shocks in an underlying relativistic flow, although alternative explanations cannot be ruled out. 43 refs.

  9. The blue-bump of 3C 273

    CERN Document Server

    Paltani, S; Walter, R

    1998-01-01

    We present optical and ultraviolet observations of 3C273 covering the whole life of the IUE satellite. We analyze the variability properties of the light curves, and find that two variable components, written B and R respectively, must contribute to the blue-bump emission in this object. The B component produces most of the variability in the ultraviolet domain. A maximum time scale of variability of about 2 yr identical at all wavelengths is found. If discrete events produce this component, the event rate is ~3-30 yr^-1. Assuming an isotropic emission, each event must liberate about 10^51 erg in the form of optical-to-ultraviolet radiation. The spectral properties of the B component suggest that reprocessing on a truncated disk, or partially- thick bremsstrahlung may be the emission mechanism. We find evidence of a lag of a few days between the light curves of the B component at optical and ultraviolet wavelengths. Neither the variability properties, nor the spectral properties of the R component can be accu...

  10. 7 CFR 273.10 - Determining household eligibility and benefit levels.

    Science.gov (United States)

    2010-01-01

    ... Register citations affecting § 273.10, see the List of CFR Sections Affected, which appears in the Finding...) or the Transitional Child Care (TCC) program shall not be deductible. A utility expense which...

  11. An asymmetrical synchrotron model for knots in the 3C 273 jet

    OpenAIRE

    Liu, Wen-Po; Y. J. Chen; Wang, Chun-Cheng

    2015-01-01

    To interpret the emission of knots in the 3C 273 jet from radio to X-rays, we propose a synchrotron model in which, owing to the shock compression effect, the injection spectra from a shock into the upstream and downstream emission regions are asymmetric. Our model could well explain the spectral energy distributions of knots in the 3C 273 jet, and predictions regarding the knots spectra could be tested by future observations.

  12. CKD273, a new proteomics classifier assessing CKD and its prognosis.

    Directory of Open Access Journals (Sweden)

    Ángel Argilés

    Full Text Available National Kidney Foundation CKD staging has allowed uniformity in studies on CKD. However, early diagnosis and predicting progression to end stage renal disease are yet to be improved. Seventy six patients with different levels of CKD, including outpatients and dialysed patients were studied for transcriptome, metabolome and proteome description. High resolution urinary proteome analysis was blindly performed in the 53 non-anuric out of the 76 CKD patients. In addition to routine clinical parameters, CKD273, a urinary proteomics-based classifier and its peptides were quantified. The baseline values were analyzed with regard to the clinical parameters and the occurrence of death or renal death during follow-up (3.6 years as the main outcome measurements. None of the patients with CKD2730.55. Unsupervised clustering analysis of the CKD273 peptides separated the patients into two main groups differing in CKD associated parameters. Among the 273 biomarkers, peptides derived from serum proteins were relatively increased in patients with lower glomerular filtration rate, while collagen-derived peptides were relatively decreased (p<0.05; Spearman. CKD273 was different in the groups with different renal function (p<0.003. The CKD273 classifier separated CKD patients according to their renal function and informed on the likelihood of experiencing adverse outcome. Recently defined in a large population, CKD273 is the first proteomic-based classifier successfully tested for prognosis of CKD progression in an independent cohort.

  13. The exponential law for superluminal expansion of quasar 3C273

    International Nuclear Information System (INIS)

    The radioastronomical technique of VLBI achieves an angular resolution better than 1 marcs, equivalent to a physical resolution of the order of light-years. In even the most distant galaxies such objects can be easily detected. In four extreme cases, three quasars (3C273, 3C279 and 3C345) and one seyfert galaxy (3C120) have been seen to expand with an apparent speed more than twice the speed of light. The evidence for such 'superluminal' expansion has been based on rather limited data, and the interpretation has been uncertain; but the recent development of the VLBI technique of hybrid mapping allows us to map the radio brightness distribution to show the expansion directly and unambiguously. This article uses the data of the quasar 3C273 presented earlier and presents a formula for the observation of superluminal expansion velocity of quasar 3C273. (Auth.)

  14. A flare in the millimetre to IR spectrum of 3C273

    International Nuclear Information System (INIS)

    Over the past two years the millimetre and submillimetre spectrum of 3C273 (ref.1) has been monitored and a quiescent millimetre-to-far-IR spectrum with an index α = -0.7 (Ssubupsilon) is proportional to upsilonsup(α) connecting smoothly to the radio and mid-IR was found and the discovery of a concurrent flare in the IR-to-near-millimetre spectrum of 3C273 implies that the emission over this range of frequency originates in the same region of the source. The flare was seen to propagate to longer wavelengths whilst decaying at shorter wavelengths. The time scale of the flare is suggestive of an event within the central 0.1 pc of the source. Millimetre wavelength variability of 3C273 has been reported but with very little temporal overlap with present data. (author)

  15. Flare in the millimetre to IR spectrum of 3C273

    Energy Technology Data Exchange (ETDEWEB)

    Robson, E.I. (Preston Polytechnic (UK). Div. of Physics and Astronomy); Gear, W.K.; Clegg, P.E.; Ade, P.A.R.; Griffin, M.J. (Queen Mary Coll., London (UK). Dept. of Physics); Smith, M.G. (Royal Observatory, Edinburgh (UK)); Nolt, I.G.; Radostitz, J.V. (Oregon Univ., Eugene (USA). Dept. of Physics); Howard, R.J. (National Radio Astronomy Observatory, Tucson, AR (USA))

    1983-09-15

    Over the past two years the millimetre and submillimetre spectrum of 3C273 (ref.1) has been monitored and a quiescent millimetre-to-far-IR spectrum with an index ..cap alpha.. = -0.7 (Ssubupsilon) is proportional to upsilonsup(..cap alpha..) connecting smoothly to the radio and mid-IR was found and the discovery of a concurrent flare in the IR-to-near-millimetre spectrum of 3C273 implies that the emission over this range of frequency originates in the same region of the source. The flare was seen to propagate to longer wavelengths whilst decaying at shorter wavelengths. The time scale of the flare is suggestive of an event within the central 0.1 pc of the source. Millimetre wavelength variability of 3C273 has been reported but with very little temporal overlap with present data.

  16. Faraday rotation in the MOJAVE blazars: 3C 273 a case study

    OpenAIRE

    Hovatta, T.; Lister, M. L.; Aller, M. F.; H. D. Aller(Astronomy Department, University of Michigan, Ann Arbor); Homan, D. C.; Kovalev, Y.Y.; Pushkarev, A. B.; Savolainen, T.

    2011-01-01

    Radio polarimetric observations of Active Galactic Nuclei can reveal the magnetic field structure in the parsec-scale jets of these sources. We have observed the gamma-ray blazar 3C 273 as part of our multi-frequency survey with the Very Long Baseline Array to study Faraday rotation in a large sample of jets. Our observations re-confirm the transverse rotation measure gradient in 3C 273. For the first time the gradient is seen to cross zero which is further indication for a helical magnetic f...

  17. A new infrared spectral component of the quasar 3C273

    International Nuclear Information System (INIS)

    Following the dramatic infrared to millimetre-wavelength flare seen in the quasar 3C273 during 1983, the authors have continued to monitor its overall continuum emission. Recent measurements show that the 10-μm to 3-mm emission has decayed to a level well below any seen previously, while the 1-4-μm emission has remained relatively constant. This behaviour has revealed the presence of an apparently non-variable component which dominates the near-infrared emission in 3C273 and includes the small 'bump' at approx. 3.5 μm in the power-law continuum. (author)

  18. 2003--2005 INTEGRAL and XMM-Newton observations of 3C 273

    OpenAIRE

    Chernyakova, M.; Neronov, A.; Courvoisier, T. J. -L.; Turler, M.; Soldi, S.; Beckmann, V.; Lubinski, P.; R. Walter(ISDC); Page, K. L.; Stuhlinger, M; Staubert, R.; McHardy, I.M.

    2007-01-01

    The aim of this paper is to study the evolution of the broadband spectrum of one of the brightest and nearest quasars 3C 273. We analyze the data obtained during quasi-simultaneous INTEGRAL and XMM monitoring of the blazar 3C 273 in 2003--2005 in the UV, X-ray and soft gamma-ray bands and study the results in the context of the long-term evolution of the source. The 0.2-100 keV spectrum of the source is well fitted by a combination of a soft cut-off power law and a hard power law. No improvem...

  19. An HST Proper-Motion Study of the Large-scale Jet of 3C273

    OpenAIRE

    Meyer, Eileen T.; Sparks, William B.; Georganopoulos, Markos; Anderson, Jay; van der Marel, Roeland; Biretta, John; Sohn, Sangmo Tony; Chiaberge, Marco; Perlman, Eric; Norman, Colin

    2016-01-01

    The radio galaxy 3C 273 hosts one of the nearest and best-studied powerful quasar jets. Having been imaged repeatedly by the Hubble Space Telescope (HST) over the past twenty years, it was chosen for an HST program to measure proper motions in the kiloparsec-scale resolved jets of nearby radio-loud active galaxies. The jet in 3C 273 is highly relativistic on sub-parsec scales, with apparent proper motions up to 15$c$ observed by VLBI (Lister et al., 2013). In contrast, we find that the kpc-sc...

  20. Simultaneous observations of the quasar 3C 273 with INTEGRAL, XMM-Newton and RXTE

    OpenAIRE

    Courvoisier, T. J. -L.; Beckmann, V.; Bourban, G.; Chenevez, J.; Chernyakova, M.; Deluit, S.; Favre, P; Grindlay, J. E.; Lund, N.; O'Brien, P; Page, K; Produit, N.; M. Türler; Turner, M. J. L.; Staubert, R.

    2003-01-01

    INTEGRAL has observed the bright quasar 3C 273 on 3 epochs in January 2003 as one of the first observations of the open programme. The observation on January 5 was simultaneous with RXTE and XMM-Newton observations. We present here a first analysis of the continuum emission as observed by these 3 satellites in the band from 3 keV to 500 keV. The continuum spectral energy distribution of 3C 273 was observed to be weak and steep in the high energies during this campaign. We present the actual s...

  1. Proton Synchrotron Radiation from Extended Jets of PKS 0637-752 and 3C 273

    OpenAIRE

    Bhattacharyya, Wrijupan; Gupta, Nayantara

    2015-01-01

    Recently, the IC/CMB X-ray mechanism has been strongly disfavoured for 3C 273 and PKS 0637-752 since the anomalously hard and steady gamma-ray emission predicted by such models violates the observational results from Fermi-LAT. Here we propose the proton synchrotron origin of the X ray-gamma ray flux from the knots of PKS 0637-752 with a reasonable budget in luminosity, by considering synchrotron radiation from an accelerated proton population. Moreover, for the source 3C 273, some of the opt...

  2. Simultaneous X-ray and infrared variability in the quasar 3C273

    OpenAIRE

    McHardy, Ian; Lawson, Anthony; Newsam, Andrew; Marscher, Alan; Robson, Ian; Stevens, Jason

    1999-01-01

    From a combination of high quality X-ray observations from the NASA Rossi X-ray Timing Explorer (RXTE), and infrared observations from the UK Infrared Telescope (UKIRT) we show that the medium energy X-ray (3-20 keV) and near infrared fluxes in the quasar 3C273 are highly correlated. It is widely believed that the X-ray emission in quasars like 3C273 arises from Compton scattering of low energy seed photons and our observations provide the first reliable detection of correlated variations in ...

  3. The Low-Redshift Lyman Alpha Forest toward 3C 273

    OpenAIRE

    Williger, G. M.; Carswell, R. F.; Weymann, R. J.; Jenkins, E. B.; Sembach, K. R.; Tripp, T. M.; Davé, R.; Haberzettl, L.; Heap, S. R.

    2010-01-01

    We present an analysis of the Ly-a forest toward 3C 273 from the Space Telescope Imaging Spectrograph at ~7 km/s resolution, along with re-processed data from the Far Ultraviolet Spectroscopic Explorer. The high UV flux of 3C 273 allows us to probe the weak, low z absorbers. The main sample consists of 21 HI absorbers that we could discriminate to a sensitivity of log NHI~ 12.5. The redshift density for absorbers with 13.1

  4. RXTE Observations of 3C273 between 1996 and 2000:Variability Timescale and Jet Power

    OpenAIRE

    Kataoka, Jun; Tanihata, Chiharu; Kawai, Nobuyuki; Takahara, Fumio; Takahashi, Tadayuki; Edwards, Philip G.; Makino, Fumiyoshi

    2002-01-01

    We present the results of a long-look monitoring of 3C273 with RXTE between 1996 and 2000. A total of 230 observations amounts to a net exposure of 845ksec, with this spectral and variability analysis of 3C273 covering the longest observation period available at hard X-ray energies. Flux variations by a factor of 4 have been detected over 4years, whereas less than 30% flux variations have been observed for individual flares on time-scales of 3 days. Two temporal methods, the power spectrum de...

  5. A historic jet-emission minimum reveals hidden spectral features in 3C 273

    OpenAIRE

    Turler, M.; Chernyakova, M.; Courvoisier, T. J. -L.; Foellmi, C.; Aller, M. F.; H. D. Aller(Astronomy Department, University of Michigan, Ann Arbor); Kraus, A.; Krichbaum, T. P.; A. Lahteenmaki(Aalto University Metsahovi Radio Observatory, Kylmala, Finland); Marscher, A.; McHardy, I.M.; O'Brien, P. T.; Page, K. L.; Popescu, L; Robson, E. I.

    2006-01-01

    Aims. The aim of this work is to identify and study spectral features in the quasar 3C 273 usually blended by its strong jet emission. Method. A historic minimum in the sub-millimetre emission of 3C 273 triggered coordinated multi-wavelength observations in June 2004. X-ray observations from the INTEGRAL, XMM-Newton and RXTE satellites are complemented by ground-based optical, infrared, millimetre and radio observations. The overall spectrum is used to model the infrared and X-ray spectral co...

  6. Atomic Mass and NuclearBinding Energy for Uup-273(Ununpentium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Uup-273 (Ununpentium, atomic number Z = 115, mass number A = 273).

  7. The structure of X-ray jet of quasar 3C 273

    International Nuclear Information System (INIS)

    The X-ray internal structure of extragalactic jets is analyzed. The Lucy-Richardson deconvolution algorithm is used to restore the image of X-ray sources. The analysis was done for Chandra observations of core-dominated quasar 3C 273. The transverse profiles are built for the jet knots

  8. 7 CFR 273.23 - Simplified application and standardized benefit projects.

    Science.gov (United States)

    2010-01-01

    ... circumstances warrant, may be required to attend a face-to-face interview on a schedule which would conform to... interview, the household shall be required to complete a modified application and provide additional information in accordance with § 273.2(f). If the household fails to comply with the interview...

  9. 7 CFR 273.11 - Action on households with special circumstances.

    Science.gov (United States)

    2010-01-01

    ... accordance with 7 CFR 273.17 if it is later determined that the reduction in the public assistance grant was... inability or unwillingness to provide documentation of the alien's immigration status, the State agency must... fleeing to avoid prosecution or custody for a crime, or an attempt to commit a crime, that would...

  10. From Centimeter to Millimeter Wavelengths A High Angular Resolution Study of 3C273

    CERN Document Server

    Krichbaum, T P; Zensus, J A

    2001-01-01

    We monitored 3C273 with VLBI at 15-86 GHz since 1990. We discuss component trajectories, opacity effects at the jet base, a rotating and perhaps precessing jet, and outburst-ejection relations from Gamma-ray to radio bands.

  11. A High-Frequency and Multi-Epoch VLBI Study of 3C 273

    OpenAIRE

    Krichbaum, T. P.; Graham, D. A.; Witzel, A.; Zensus, J. A.; Greve, A.; Grewing, M.; Marscher, A.; Beasley, A. J.

    2001-01-01

    We show results from a 7 year VLBI monitoring programme of 3C273 at millimeter wavelengths. We find evidence for component acceleration, motion or rotation of fluid dynamical patterns in the VLBI jet, and evidence for an outburst-ejection relation between Gamma-ray flares and the appearance of new jet components.

  12. RXTE Observations of 3C273 between 1996 and 2000 Variability Timescale and Jet Power

    CERN Document Server

    Kataoka, J; Kawai, N; Takahara, F; Takahashi, T; Edwards, P G; Makino, F; Kataoka, Jun; Tanihata, Chiharu; Kawai, Nobuyuki; Takahara, Fumio; Takahashi, Tadayuki; Edwards, Philip G.; Makino, Fumiyoshi

    2002-01-01

    We present the results of a long-look monitoring of 3C273 with RXTE between 1996 and 2000. A total of 230 observations amounts to a net exposure of 845ksec, with this spectral and variability analysis of 3C273 covering the longest observation period available at hard X-ray energies. Flux variations by a factor of 4 have been detected over 4years, whereas less than 30% flux variations have been observed for individual flares on time-scales of 3 days. Two temporal methods, the power spectrum density (PSD) and the structure function (SF), have been used to study the variability characteristics of 3C273. The hard X-ray photon spectra generally show a power-law shape with a differential photon index of G = 1.6+-0.1. In 10 of 261 data segments, exceptions to power-law behaviour have been found: (i) an additional soft excess below 4keV, and (ii) a broad Fe fluorescent line feature with EW = 100-200 eV. Our new observations of these previously reported X-ray features may imply that 3C273 is a unique object whose hard...

  13. The relationship between the spectrum and flux density of 3C273 and 3C446

    Science.gov (United States)

    Yuan, Yuhai; Fan, Junhui

    2015-06-01

    In the radio band, the relationship between the emission spectrum ( α) and flux density ( F) can demonstrate the emission theory and process. In this paper, we used the radio data of 3C273 and 3C446 from UMRAO (the University of Michigan Radio Observatory) to calculate the spectral indices ( α), and analyzed the relationship between spectral indices ( α) and flux densities ( F). We obtained the following results. (1) There were anti-correlations between α and F, for 3C273, α=-0.024 F 14.5+0.91, with the correlation coefficient r=-0.92, the chance p3C273, the time spans of two α- F circles were 8.43 years and 7.79 years; for 3C446, the time spans of two α- F circles were 5.66 years and 6.64 years. Not only for 3C273, but also for 3C446, the time spans were consistent with the quasi-periodicities calculated from the lightcurve or spectral variance.

  14. 49 CFR 40.273 - What is the effect of a cancelled alcohol test?

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false What is the effect of a cancelled alcohol test? 40... TRANSPORTATION WORKPLACE DRUG AND ALCOHOL TESTING PROGRAMS Problems in Alcohol Testing § 40.273 What is the effect of a cancelled alcohol test? (a) A cancelled alcohol test is neither positive nor negative. (1)...

  15. Simultaneous observations of the quasar 3C 273 with INTEGRAL, XMM-Newton and RXTE

    DEFF Research Database (Denmark)

    Courvoisier, T.J.L.; Beckmann, V.; Bourban, G.; Chenevez, Jérôme; Chernyakova, M.; Deluit, S.; Favre, P.; Grindlay, J.E.; Lund, Niels; O'Brien, P.; Page, K.; Produit, N.; Turler, M.; Turner, M.J.L.; Staubert, R.; Stuhlinger, M.; Walter, Rasmus; Zdziarski, A.A.

    2003-01-01

    INTEGRAL has observed the bright quasar 3C 273 on 3 epochs in January 2003 as one of the first observations of the open programme. The observation on January 5 was simultaneous with RXTE and XMM-Newton observations. We present here a first analysis of the continuum emission as observed by these 3...

  16. 48 CFR 719.273 - The U.S. Agency for International Development (USAID) Mentor-Protégé Program.

    Science.gov (United States)

    2010-10-01

    ... International Development (USAID) Mentor-Protégé Program. 719.273 Section 719.273 Federal Acquisition Regulations System AGENCY FOR INTERNATIONAL DEVELOPMENT SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS The U.S. Agency for International Development (USAID) Mentor-Protégé Program 719.273 The U.S. Agency...

  17. Soft X-ray Variability of the Bright Quasar 3C273

    Indian Academy of Sciences (India)

    Chulhee Kim

    2001-12-01

    We present the results from ROSAT observations of 3C273 in the soft X-ray band. The light variation of 3C273 was investigated for three different energy bands of soft, medium, and hard. The maximum variability with a factor of 2 for 551 dayswas confirmed at all three different bands. This appears to be a periodic variation within the period of roughly 6 months. However, the short-term or micro variation was not so distinct and the light variation of each band did not show any correlation between them. The hardness ratio for hard and soft bands shows irregular variation but there was no correlation between them. There is no distinct variation of the photon index in the case of simple power law model fitting. For power law + free absorption model fitting, the average photon index () is 2.08.

  18. Distribution of X-ray Emission from Jet Knots of 3C273

    CERN Document Server

    Bannikova, E Yu

    2007-01-01

    The jet of the quasar 3C273 is observed at different spectral bands. This jet has a knot structure. Jet radiation in radio and optical bands are connected with synchrotron mechanism, while the emission mechanism producing the X-rays is controversial. We suppose that the X-rays observed for two knots nearest to the quasar can originate from the inverse Compton scattering of external source radiation on relativistic electrons. But in the jet region with constant low X-ray intensity the inverse Compton scattering on cosmic microwave background photons (IC/CMB) is essential because the energy density of external source decreases. Upon this scenario the constraints on the angle between the jet axis and line sight values have been obtained. Also, some physical parameters for two nearest knots of the jet of 3C273 have been estimated.

  19. Simultaneous observations of the quasar 3C 273 with INTEGRAL, XMM-Newton and RXTE

    DEFF Research Database (Denmark)

    Courvoisier, T.J.L.; Beckmann, V.; Bourban, G.; Chenevez, Jérôme; Chernyakova, M.; Deluit, S.; Favre, P.; Grindlay, J.E.; Lund, Niels; O'Brien, P.; Page, K.; Produit, N.; Turler, M.; Turner, M.J.L.; Staubert, R.; Stuhlinger, M.; Walter, Rasmus; Zdziarski, A.A.

    2003-01-01

    INTEGRAL has observed the bright quasar 3C 273 on 3 epochs in January 2003 as one of the first observations of the open programme. The observation on January 5 was simultaneous with RXTE and XMM-Newton observations. We present here a first analysis of the continuum emission as observed by these 3...... satellites in the band from similar or equal to3 keV to similar or equal to500 keV. The continuum spectral energy distribution of 3C 273 was observed to be weak and steep in the high energies during this campaign. We present the actual status of the cross calibrations between the instruments on the three...

  20. Radio emission from the jet and lobe of 3C273

    International Nuclear Information System (INIS)

    New maps of 3C273 at 151 and 408 MHz are presented using the MERLIN interferometer, with dynamic range of 4x103:1 and 104:1, respectively. These show that (1) there is an extended region or lobe to the south of the main jet, (2) the radio emission of the jet is continuous from the core to beyond the limit of the optical jet and (3) no counter-component can be found in the opposite direction to the jet. The ridge-line of the jet shows a 'wiggle', the wavelength (lambda) of which decreases by a factor of 6 along its length. The data suggest that 3C273 is intrinsically one-sided. (author)

  1. 27.3-day and 13.6-day atmospheric tide

    Institute of Scientific and Technical Information of China (English)

    LI; GuoQing; ZONG; HaiFeng

    2007-01-01

    An analysis of time variations in the earth's length of day (LOD) for 25 years (1973-1998) versus atmospheric circulation changes and lunar phase is presented. It is found that, on the average, there is a 27.3-day and 13.6-day period oscillation in global zonal wind speed, atmospheric geopotential height, and LOD following alternating changes in lunar phase. Every 5-9 days (6.8 days on average), the fields of global atmospheric zonal wind and geopotential height and LOD undergo a sudden change in relation to a change in lunar declination. The observed atmospheric oscillation with this time period may be viewed as a type of atmospheric tide.Ten atmospheric tidal cases have been analyzed by comparing changes in LOD, global zonal wind speed and atmospheric geopotential height versus change in lunar declination. Taken together these cases reveal prominent 27.3-day and 13.6-day tides. The lunar forcing on the earth's atmosphere is great and obvious changes occur in global fields of zonal wind speed and atmospheric geopotential height over the equatorial and low latitude areas.The driving force for the 27.3-day and 13.6-day atmospheric tides is the periodic change in lunar forcing during the moon's revolution around the earth. When the moon is located on the celestial equator the lunar declination equals zero and the lunar tidal forcing on the atmosphere reaches its maximum, at this time the global zonal wind speed increases and the earth's rotation rate decreases and LOD increases. Conversely, when the moon reaches its most northern or southern positions the lunar declination is maximized, lunar tidal forcing decreases, global zonal wind speed decreases, earth's rotation rate increases and LOD decreases.27.3-day and 13.6-day period atmospheric tides deserve deeper study. Lunar tidal forcing should be considered in models of atmospheric circulation and in short and medium range weather forecasting.

  2. OPTICAL MONITORING OF TWO BRIGHTEST NEARBY QUASARS, PHL 1811 AND 3C 273

    Energy Technology Data Exchange (ETDEWEB)

    Fan, J. H.; Liu, Y.; Yuan, Y. H. [Center for Astrophysics, Guangzhou University, Guangzhou 510006 (China); Kurtanidze, O.; Chanishvili, R. [Abastumani Observatory, Mt. Kanobili, 0301 Abastumani, Georgia (United States); Richter, G. M. [Astrophysikalisches Institut Potsdam, An der Sternwarte 16, D-14482 Potsdam (Germany)

    2014-08-01

    Variability is one of the most observable characteristics of active galactic nuclei, and it is important when considering the emission mechanism. In this paper, we report optical photometry monitoring of two nearby brightest quasars, PHL 1811 and 3C 273, using the ST-6 camera attached to the Newtonian focus and the Ap6E CCD camera attached to the primary focus of the 70 cm meniscus telescope at the Abastumani Observatory, Georgia. PHL 1811 was monitored during the period from 2002 September to 2012 December, while 3C 273 was monitored during the period from 1998 February to 2008 May. During our monitoring period, the two sources did not show any significant intra-day variability. The largest detected variations are ΔR = 0.112 ± 0.010 mag. for PHL 1811, ΔB = 0.595 ± 0.099 mag, ΔV = 0.369 ± 0.028 mag, ΔR = 0.495 ± 0.076 mag, and ΔI = 0.355 ± 0.009 mag for 3C 273. When the periodicity analysis methods are adopted for the observations of the sources, a period of p = 5.80 ± 1.12 yr is obtained for PHL 1811 in the R light curve in the present work, and periods of p = 21.10 ± 0.14, 10.00 ± 0.14, 7.30 ± 0.09, 13.20 ± 0.09, 2.10 ± 0.06, and 0.68 ± 0.05 yr are obtained for 3C 273 based on the data in the present work combined with historical works.

  3. OPTICAL MONITORING OF TWO BRIGHTEST NEARBY QUASARS, PHL 1811 AND 3C 273

    International Nuclear Information System (INIS)

    Variability is one of the most observable characteristics of active galactic nuclei, and it is important when considering the emission mechanism. In this paper, we report optical photometry monitoring of two nearby brightest quasars, PHL 1811 and 3C 273, using the ST-6 camera attached to the Newtonian focus and the Ap6E CCD camera attached to the primary focus of the 70 cm meniscus telescope at the Abastumani Observatory, Georgia. PHL 1811 was monitored during the period from 2002 September to 2012 December, while 3C 273 was monitored during the period from 1998 February to 2008 May. During our monitoring period, the two sources did not show any significant intra-day variability. The largest detected variations are ΔR = 0.112 ± 0.010 mag. for PHL 1811, ΔB = 0.595 ± 0.099 mag, ΔV = 0.369 ± 0.028 mag, ΔR = 0.495 ± 0.076 mag, and ΔI = 0.355 ± 0.009 mag for 3C 273. When the periodicity analysis methods are adopted for the observations of the sources, a period of p = 5.80 ± 1.12 yr is obtained for PHL 1811 in the R light curve in the present work, and periods of p = 21.10 ± 0.14, 10.00 ± 0.14, 7.30 ± 0.09, 13.20 ± 0.09, 2.10 ± 0.06, and 0.68 ± 0.05 yr are obtained for 3C 273 based on the data in the present work combined with historical works

  4. Beaming and precession in the inner jet of 3C273

    OpenAIRE

    Zulema Abraham; Romero, Gustavo E.

    2001-01-01

    We have used all the available VLBI data to determine the kinematical evolution of the inner jet of 3C273. The position angles, velocities and formation epochs of different superluminal components are compatible with a precessing inner jet. The time dependence of the Doppler factor for this jet is computed and the implications for the gamma-ray emission are discussed. Additionally, the model, when considered along with simultaneous radio and X-ra y variability observations provides an upper b...

  5. Relationship between X-ray and ultraviolet emission in 3C 273

    OpenAIRE

    Paltani, S.; Courvoisier, T. J. -L.; Turler, M.; R. Walter(ISDC)

    1997-01-01

    In 3C 273, ultraviolet flux and X-ray flux measured by BATSE are not well correlated, contrarily to predictions of several models, unless the X-ray flux lags the UV emission by 1.75 yr. The absence of observed correlation at small lag cannot be due to spectral variability. A Comptonizing corona model is however compatible with all UV and X-ray observations covering the BATSE period.

  6. A high-resolution multi-wavelength study of the jet in 3C 273

    OpenAIRE

    Jester, S.; Roeser, H. -J.; Meisenheimer, K.; Perley, R.; Garrington, S.

    2000-01-01

    We present HST images at 622 nm and 300 nm of the optical jet in 3C273 and determine the run of the optical spectral index at 0.2" along the jet. We find no evidence for localized acceleration or loss sites, and support for a little-changing spectral shape throughout the jet. We consider this further evidence in favour of a distributed acceleration process.

  7. Simulations of the relativistic parsec-scale jet in 3C273

    OpenAIRE

    Perucho, M; Lobanov, A. P.; Marti, J. M.

    2004-01-01

    We present a hydrodynamical 3D simulation of the relativistic jet in 3C273, in comparison to previous linear perturbation analysis of Kelvin-Helmholtz instability developing in the jet. Our aim is to assess advantages and limitations of both analytical and numerical approaches and to identify spatial and temporal scales on which the linear regime of Kelvin-Helmholtz instability can be applied in studies of morphology and kinematics of parsec-scale jets.

  8. An HST Proper-motion Study of the Large-scale Jet of 3C273

    Science.gov (United States)

    Meyer, Eileen T.; Sparks, William B.; Georganopoulos, Markos; Anderson, Jay; van der Marel, Roeland; Biretta, John; Sohn, Sangmo Tony; Chiaberge, Marco; Perlman, Eric; Norman, Colin

    2016-02-01

    The radio galaxy 3C 273 hosts one of the nearest and best-studied powerful quasar jets. Having been imaged repeatedly by the Hubble Space Telescope (HST) over the past twenty years, it was chosen for an HST program to measure proper motions in the kiloparsec-scale resolved jets of nearby radio-loud active galaxies. The jet in 3C 273 is highly relativistic on sub-parsec scales, with apparent proper motions up to 15c observed by very long baseline interferometry. In contrast, we find that the kiloparsec-scale knots are compatible with being stationary, with a mean speed of -0.2 ± 0.5c over the whole jet. Assuming the knots are packets of moving plasma, an upper limit of 1c implies a bulk Lorentz factor Γ < 2.9. This suggests that the jet has either decelerated significantly by the time it reaches the kiloparsec scale, or that the knots in the jet are standing shock features. The second scenario is incompatible with the inverse Compton off the Cosmic Microwave Background (IC/CMB) model for the X-ray emission of these knots, which requires the knots to be in motion, but IC/CMB is also disfavored in the first scenario due to energetic considerations, in agreement with the recent finding of Meyer & Georganopoulos which ruled out the IC/CMB model for the X-ray emission of 3C 273 via gamma-ray upper limits.

  9. Simultaneous X-ray and infrared variability in the quasar 3C273

    CERN Document Server

    McHardy, I; Newsam, A; Marscher, A P; Robson, I; Stevens, J; Hardy, Ian Mc; Lawson, Anthony; Newsam, Andrew; Marscher, Alan; Robson, Ian; Stevens, Jason

    1999-01-01

    From a combination of high quality X-ray observations from the NASA Rossi X-ray Timing Explorer (RXTE), and infrared observations from the UK Infrared Telescope (UKIRT) we show that the medium energy X-ray (3-20 keV) and near infrared fluxes in the quasar 3C273 are highly correlated. It is widely believed that the X-ray emission in quasars like 3C273 arises from Compton scattering of low energy seed photons and our observations provide the first reliable detection of correlated variations in 3C273 between the X-ray band and any lower energy band. For a realistic electron distribution we demonstrate that it is probable that each decade of the seed photon distribution from the mm to IR waveband contributes roughly equally to the medium energy X-ray flux. However the expected mm variations are too small to be detected above the noise, probably explaining the lack of success of previous searches for a correlation between X-ray and mm variations. In addition we show that the infrared leads the X-rays by 0.75+/-0.2...

  10. 86 GHz Very Long Baseline Polarimetry of 3C273 and 3C279 with the Coordinated Millimeter VLBI Array

    CERN Document Server

    Attridge, J M

    2001-01-01

    (86) GHz Very Long Baseline Polarimetry probes magnetic field structures within the cores of Active Galactic Nuclei at higher angular resolutions and a spectral octave higher than previously achievable. Observations of 3C273 and 3C279 taken in April 2000 with the Coordinated Millimeter VLBI Array have resulted in the first total intensity (Stokes I) and linear polarization VLBI images reported of any source at 86 GHz. These results reveal the 86 GHz electric vector position angles within the jets of 3C273 and 3C279 to be orthogonal to each other, and the core of 3C273 to be unpolarized. If this lack of polarization is due to Faraday depolarization alone, the dispersion in rotation measure is >=90000 rad/m^2 for the core of 3C273.

  11. Scintillation observations of the 3C48, 3C273 and 3C295 at 25 MHz

    International Nuclear Information System (INIS)

    Interplanetary scintillations of 3C 48, 3C 273, and 3C 295 have been observed at 25 MHz. 3C 48 is found to possess a halo. 3C 295 at the decametric waves becomes an one -component source. 3C 273 has the same angular structure as in the meter - wavelength range. The models of the sources corresponding to the present observations are proposed

  12. 30 years of multi-wavelength observations of 3C 273

    OpenAIRE

    Turler, M.; Paltani, S.; Courvoisier, T. J. -L.; Aller, M. F.; H. D. Aller(Astronomy Department, University of Michigan, Ann Arbor); Blecha, A.; Bouchet, P.; Lainela, M.; McHardy, I.M.; Robson, E. I.; J. A. Stevens; Terasranta, H.; Tornikoski, M.; Ulrich, M.-H.; Waltman, E. B.

    1998-01-01

    We present a wide multi-wavelength database of most observations of the quasar 3C 273 obtained during the last 30 years. This database is the most complete set of observations available for an active galactic nucleus (AGN). It contains nearly 20'000 observations grouped together into 70 light curves covering 16 orders of magnitude in frequency from the radio to the gamma-ray domain. The database is constituted of many previously unpublished observations and of most publicly available data gat...

  13. HST and MERLIN Observations of the Jet in 3C273

    OpenAIRE

    Bahcall, J. N.; Kirhakos, S; D. P. Schneider; Davis, R. J.; Muxlow, T.W.B.; Garrington, S.T.; Conway, R. G.; Unwin, S. C.

    1995-01-01

    We present red and blue images of the jet of the quasar 3C273 obtained with the WFPC2 on the Hubble Space Telescope as well as a new radio map made with the MERLIN array. The images are of significantly better quality than that of previous data. The two maps are aligned to an accuracy of 0.020$''$; this accuracy is achieved because both the quasar and the jet are contained in both the radio and optical images. The start of the optical jet is marked by an elongated knot which appears identical...

  14. Distribution of X-ray Emission from Jet Knots of 3C273

    OpenAIRE

    Bannikova, E. Yu.; Mykhailova, M. S.

    2007-01-01

    The jet of the quasar 3C273 is observed at different spectral bands. This jet has a knot structure. Jet radiation in radio and optical bands are connected with synchrotron mechanism, while the emission mechanism producing the X-rays is controversial. We suppose that the X-rays observed for two knots nearest to the quasar can originate from the inverse Compton scattering of external source radiation on relativistic electrons. But in the jet region with constant low X-ray intensity the inverse ...

  15. Particle acceleration in the hotspot of the jet of quasar 3C273

    International Nuclear Information System (INIS)

    Recent radio, optical and near-infrared observations of the dominant hotspot at the outer end of the quasar jet 3C273A have revealed a complex spectrum, which provides a unique probe of the acceleration process supplying the synchrotron-emitting electrons. The authors present theoretical calculations of the electron spectrum produced by non-relativistic shock acceleration which, include both synchrotron losses and a finite emission region. The resultant synchrotron spectrum fits the observations, providing a natural explanation for the steep spectrum at radio to infrared frequencies, the observed flattening at ν 14 Hz. The model yields a new magnetic field estimate of 70 nT. (author)

  16. Multi-band variability in the blazar 3C 273 with XMM-Newton

    OpenAIRE

    Kalita, Nibedita; Gupta, Alok C.; Wiita, Paul J.; Bhagwan, Jai; Duorah, Kalpana

    2015-01-01

    We have undertaken a nearly simultaneous optical/UV and X-ray variability study of the flat spectrum radio quasar, 3C 273 using data available from the XMM$-$Newton satellite mission from June 2000 to July 2012. Here we focus on the multi-wavelength flux variability on both intra-day and long time scales of this very well known radio-loud source. We found high flux variability over long time scales in all bands for which observations were made. The optical/UV variability amplitude was more th...

  17. Faraday Rotation Measure Gradients from a Helical Magnetic Field in 3C 273

    OpenAIRE

    Zavala, R. T.; Taylor, G. B.

    2005-01-01

    Using high frequency (12-22 GHz) VLBA observations we confirm the existence of a Faraday rotation measure gradient of ~ 500 rad/m^2/mas transverse to the jet axis in the quasar 3C 273. The gradient is seen in two epochs spaced roughly six months apart. This stable transverse rotation measure gradient is expected if a helical magnetic field wraps around the jet. The overall order to the magnetic field in the inner projected 40 parsecs is consistent with a helical field. However, we find an une...

  18. Time Variation of Rotation Measure Gradient in 3C 273 Jet

    OpenAIRE

    Asada, Keiichi; Inoue, Makoto; Kameno, Seiji; Nagai, Hiroshi

    2008-01-01

    The existence of a gradient in the Faraday rotation measure (RM) of the quasar 3C 273 jet is confirmed by follow-up observations. A gradient transverse to the jet axis is seen for more than 20 mas in projected distance. Taking account of the viewing angle, we estimate it to be more than 100 pc. Comparing to the distribution of the RM in 1995, we detect a time variation of it at the same distance from the core over 7 yr. We discuss the origin of the Faraday rotation based on this rapid time va...

  19. Wavelet Analysis of AGN X-Ray Time Series: A QPO in 3C 273?

    OpenAIRE

    Espaillat, C.; Bregman, J.; Hughes, P; Lloyd-Davies, E.

    2008-01-01

    Quasi-periodic signals have yielded important constraints on the masses of black holes in galactic X-ray binaries, and here we extend this to active galactic nuclei (AGNs). We employ a wavelet technique to analyze 19 observations of 10 AGNs obtained with the XMM-Newton EPIC pn camera. We report the detection of a candidate 3.3 ks quasi period in 3C 273. If this period represents an orbital timescale originating near a last stable orbit of 3Rs, it implies a central black hole mass of 7.3x10^6 ...

  20. Multi-wavelength Observations of 3C 273 in 1993-1995

    OpenAIRE

    von Montigny, C.

    1997-01-01

    We present the results of the multi-wavelength campaigns on 3C 273 in 1993-1995. During the observations in late 1993 this quasar showed an increase of its flux for energies greater equal 100 MeV from about 2.1 x 10^-7 photons/cm^2/s to approximately 5.6 x 10^-7 photons/cm^2/s during a radio outburst at 14.5, 22 and 37 GHz. However, no one-to-one correlation of the gamma-ray radiation with any frequency could be found. The photon spectral index of the high energy spectrum changed from (3.20 +...

  1. Shedding New Light on the 3C 273 Jet with the Spitzer Space Telescope

    OpenAIRE

    Uchiyama, Y.; Urry, C. M.; Cheung, C. C.; Jester, S.; van Duyne, J.; Coppi, P.; Sambruna, R. M.; Takahashi, T.; Tavecchio, F.; Maraschi, L.

    2006-01-01

    We have performed infrared imaging of the jet of the quasar 3C 273 at wavelengths 3.6 and 5.8 microns with the Infrared Array Camera (IRAC) on the Spitzer Space Telescope. When combined with the radio, optical and X-ray measurements, the IRAC photometry clearly shows that the optical emission is dominated by the high-energy component of the jet, not by the radio synchrotron component, as had been assumed to date. The high-energy component may be due to a second synchrotron component or to IC ...

  2. Constraining the location of rapid gamma-ray flares in the FSRQ 3C 273

    OpenAIRE

    Rani, B.; Lott, B.; Krichbaum, T. P.; Fuhrmann, L.; Zensus, J. A.

    2013-01-01

    We present a \\gamma-ray photon flux and spectral variability study of the flat-spectrum radio quasar 3C 273 over a rapid flaring activity period between September 2009 to April 2010. Five major flares are observed in the source during this period. The most rapid flare observed in the source has a flux doubling time of 1.1 hr. The rapid \\gamma-ray flares allow us to constrain the location and size of the \\gamma-ray emission region in the source. The \\gamma \\gamma-opacity constrains the Doppler...

  3. Modelling 20 years of synchrotron flaring in the jet of 3C 273

    OpenAIRE

    Turler, M.; Courvoisier, T. J. -L.; Paltani, S.

    2000-01-01

    We present a phenomenological jet model which is able to reproduce well the observed variations of the submillimetre-to-radio emission of the bright quasar 3C 273 during the last 20 years. It is a generalization of the original shock model of Marscher & Gear (1985), which is now able to describe an accelerating or decelerating shock wave, in a curved, non-conical and non-adiabatic jet. The model defines the properties of a synchrotron outburst which is expected to be emitted by the jet materi...

  4. Beaming and precession in the inner jet of 3C273

    Directory of Open Access Journals (Sweden)

    Zulema Abraham

    2001-01-01

    Full Text Available We have used all the available VLBI data to determine the kinematical evolution of the inner jet of 3C273. The position angles, velocities and formation epochs of different superluminal components are compatible with a precessing inner jet. The time dependence of the Doppler factor for this jet is computed and the implications for the gamma-ray emission are discussed. Additionally, the model, when considered along with simultaneous radio and X-ra y variability observations provides an upper bound to the Hubble constant (H0<~ 80 km/s/Mpc.

  5. The variability of the quasar 3C 273: a radio to gamma-ray view

    CERN Document Server

    Soldi, S; Türler, M

    2009-01-01

    We have analysed the first 15 months of Fermi/LAT data of the radio loud quasar 3C 273. Intense gamma-ray activity has been detected, showing an average flux of F(> 100 MeV) = 1.4e-6 ph/cm^2/s, with a peak at F(> 100 MeV) = 5.6e-6 ph/cm^2/s detected during a flare in September 2009. Together with the brightening of the source, a possible hardening of the gamma-ray spectrum is observed, pointing to a shift of the inverse Compton peak toward higher energies than the 1-10 MeV range in which 3C 273 inverse Compton emission is typically observed to peak. During the 15 months of observations the photon index is measured to vary between 2.4 and 3.3, with an average value of 2.78 +/- 0.03. When compared to the observations at other wavelengths, the gamma-rays show the largest flux variations and we discuss the possibility that two different components are responsible for the inverse Compton hump emission below and above the MeV peak.

  6. 2003--2005 INTEGRAL and XMM-Newton observations of 3C 273

    CERN Document Server

    Chernyakova, M; Courvoisier, T J L; Türler, M; Soldi, S; Beckmann, V; Lubinski, P; Walter, R; Page, K L; Stuhlinger, M; Staubert, R; McHardy, I M

    2007-01-01

    The aim of this paper is to study the evolution of the broadband spectrum of one of the brightest and nearest quasars 3C 273. We analyze the data obtained during quasi-simultaneous INTEGRAL and XMM monitoring of the blazar 3C 273 in 2003--2005 in the UV, X-ray and soft gamma-ray bands and study the results in the context of the long-term evolution of the source. The 0.2-100 keV spectrum of the source is well fitted by a combination of a soft cut-off power law and a hard power law. No improvement of the fit is achieved if one replaces the soft cut-off power law by either a blackbody, or a disk reflection model. During the observation period the source has reached the historically softest state in the hard X-ray domain with a photon index $\\Gamma=1.82\\pm 0.01$. Comparing our data with available archived X-ray data from previous years, we find a secular evolution of the source toward softer X-ray emission (the photon index has increased by $\\Delta\\Gamma\\simeq 0.3-0.4$ over the last thirty years). We argue that e...

  7. Multi-band variability in the blazar 3C 273 with XMM-Newton

    CERN Document Server

    Kalita, Nibedita; Wiita, Paul J; Bhagwan, Jai; Duorah, Kalpana

    2015-01-01

    We have undertaken a nearly simultaneous optical/UV and X-ray variability study of the flat spectrum radio quasar, 3C 273 using data available from the XMM$-$Newton satellite mission from June 2000 to July 2012. Here we focus on the multi-wavelength flux variability on both intra-day and long time scales of this very well known radio-loud source. We found high flux variability over long time scales in all bands for which observations were made. The optical/UV variability amplitude was more than twice than that in the X-ray bands. There is some frequency dependence of the variability in optical/UV bands in the sense that the variability amplitude increases with increasing frequency; however, the X-ray emissions disagree with this trend as the variability amplitude decreases from soft to hard X-ray bands. On intra-day time scales 3C 273 showed small amplitude variability in X-ray bands. A hardness ratio analysis in the X-ray regime indicates that the particle acceleration mechanism dominates the cooling mechani...

  8. Novel Analysis of the Multiwavelength Structure of Relativistic Jet in Quasar 3C 273

    CERN Document Server

    Marchenko, Volodymyr; Ostrowski, Michal; Stawarz, Lukasz; Bohdan, Artem; Jamrozy, Marek; Hnatyk, Bohdan

    2016-01-01

    We present a detailed analysis of the best-quality multi-wavelength data gathered for the large-scale jet in the core-dominated quasar 3C 273. We analyze all the archival observations of the target with the Chandra X-ray Observatory, the far-ultraviolet observations with the Hubble Space Telescope, and a 8.4 GHz maps obtained with the Very Large Array. In our study we focus on investigating the morphology of the outflow at different frequencies, and therefore we apply various techniques for the image deconvolution, paying particular attention to a precise modeling of the Chandra and Hubble point spread functions. We find that the prominent brightness enhancements in the X-ray and far-ultraviolet jet of 3C 273 - the "knots" - are not point-like, and can be resolved transversely as extended features with sizes of about $\\simeq 0.5$ kpc. Also, the radio outflow is wider than the deconvolved X-ray/ultraviolet jet. Finally, the intensity peaks of the X-ray knots are located systematically upstream of the correspon...

  9. High-Fidelity VLA Imaging of the Radio Structure of 3C273

    CERN Document Server

    Perley, R A

    2016-01-01

    3C273, the nearest bright quasar, comprises a strong nuclear core and a bright, one-sided jet extending ~ 23 arcseconds to the SW. The source has been the subject of imaging campaigns in all wavebands. Extensive observations of this source have been made with the Very Large Array and other telescopes as part of a campaign to understand the jet emission mechanisms. Partial results from the VLA radio campaign have been published, but to date, the complete set of VLA imaging results has not been made available. We have utilized the VLA to determine the radio structure of 3C273 in Stokes I, Q, and U, over the widest possible frequency and resolution range. The VLA observed the source in all four of its configurations, and with all eight of its frequency bands, spanning 73.8 MHz to 43 GHz. The data were taken in a pseudo-spectral line mode to minimize the VLA's correlator errors, and were fully calibrated with subsequent self-calibration techniques to maximise image fidelity. Images in Stokes parameters I, Q, and ...

  10. The Low-Redshift Lyman Alpha Forest toward 3C 273

    CERN Document Server

    Williger, G M; Weymann, R J; Jenkins, E B; Sembach, K R; Tripp, T M; Davé, R; Haberzettl, L; Heap, S R

    2010-01-01

    We present an analysis of the Ly-a forest toward 3C 273 from the Space Telescope Imaging Spectrograph at ~7 km/s resolution, along with re-processed data from the Far Ultraviolet Spectroscopic Explorer. The high UV flux of 3C 273 allows us to probe the weak, low z absorbers. The main sample consists of 21 HI absorbers that we could discriminate to a sensitivity of log NHI~ 12.5. The redshift density for absorbers with 13.1= 12.5, it is consistent with numerical model predictions. The Doppler parameter distribution is consistent with other low z samples. We find no evidence for a break in the column density power-law distribution to log NHI=12.3. A broad Ly-a absorber (BLA) is within Delta v == 12.6, consistent with the level predicted from hydrodynamical simulations, and indication for a Ly-a forest void at 0.09

  11. Faraday Rotation Measure Gradients from a Helical Magnetic Field in 3C273

    Energy Technology Data Exchange (ETDEWEB)

    Zavala, Robert T.; /Naval Observ., Flagstaff; Taylor, G.B.; /NRAO, Socorro /KIPAC, Menlo Park

    2005-06-06

    Using high frequency (12-22 GHz) VLBA observations we confirm the existence of a Faraday rotation measure gradient of {approx}500 rad m{sup -2} mas{sup -1} transverse to the jet axis in the quasar 3C273. The gradient is seen in two epochs spaced roughly six months apart. This stable transverse rotation measure gradient is expected if a helical magnetic field wraps around the jet. The overall order to the magnetic field in the inner projected 40 parsecs is consistent with a helical field. However, we find an unexpected increase in fractional polarization along the edges of the source, contrary to expectations. This high fractional polarization rules out internal Faraday rotation, but is not readily explained by a helical field. After correcting for the rotation measure, the intrinsic magnetic field direction in the jet of 3C273 changes from parallel to nearly perpendicular to the projected jet motion at two locations. If a helical magnetic field causes the observed rotation measure gradient then the synchrotron emitting electrons must be separate from the helical field region. The presence or absence of transverse rotation measure gradients in other sources is also discussed.

  12. Thirty years of multi-wavelength observations of 3C273

    CERN Document Server

    Türler, M; Courvoisier, Thierry J L; Aller, M F; Aller, H D; Blecha, A; Bouchet, P; Lainela, M; McHardy, I M; Robson, E I; Stevens, J A; Terasranta, H; Tornikoski, M; Ulrich, M H; Waltman, E B; Wamsteker, W; Wright, M C H

    1999-01-01

    We present a wide multi-wavelength database of most observations of the quasar 3C 273 obtained during the last 30 years. This database is the most complete set of observations available for an active galactic nucleus (AGN). It contains nearly 20'000 observations grouped together into 70 light curves covering 16 orders of magnitude in frequency from the radio to the gamma-ray domain. The database is constituted of many previously unpublished observations and of most publicly available data gathered in the literature and on the World Wide Web (WWW). It is complete to the best of our knowledge, except in the optical (UBV) domain where we chose not to add all observations from the literature. In addition to the photometric data, we present the spectra of 3C 273 obtained by the International Ultraviolet Explorer (IUE) satellite. In the X-ray domain, we used the spectral fit parameters from the literature to construct the light curves. Apart from describing the data, we show the most representative light curves and...

  13. Faraday Rotation Measure Gradients from a Helical Magnetic Field in 3C273

    International Nuclear Information System (INIS)

    Using high frequency (12-22 GHz) VLBA observations we confirm the existence of a Faraday rotation measure gradient of ∼500 rad m-2 mas-1 transverse to the jet axis in the quasar 3C273. The gradient is seen in two epochs spaced roughly six months apart. This stable transverse rotation measure gradient is expected if a helical magnetic field wraps around the jet. The overall order to the magnetic field in the inner projected 40 parsecs is consistent with a helical field. However, we find an unexpected increase in fractional polarization along the edges of the source, contrary to expectations. This high fractional polarization rules out internal Faraday rotation, but is not readily explained by a helical field. After correcting for the rotation measure, the intrinsic magnetic field direction in the jet of 3C273 changes from parallel to nearly perpendicular to the projected jet motion at two locations. If a helical magnetic field causes the observed rotation measure gradient then the synchrotron emitting electrons must be separate from the helical field region. The presence or absence of transverse rotation measure gradients in other sources is also discussed

  14. The parsec-scale jets in 3C 273 and 3C 345

    Science.gov (United States)

    Unwin, Stephen C.; Wehrle, Ann E.; Davis, Richard J.; Muxlow, Thomas W. B.

    1992-01-01

    We present recent centimeter-wavelength 'global-array' VLBI images of the quasars 3C 273 and 3C 345 with dynamic ranges in excess of 3000:1. They trace the jet emission on scales from r about 5 parsecs out to about 200 parsecs. The maps of 3C273 at 18 cm wavelength show a well-collimated one-sided jet with a wavy ridge line; these wiggles exist on size scales ranging from about 1 pc to over 10 kpc. We show that the well-known superluminal flow extends to r about 120 pc. Images of 3C 345 at 6 cm wavelength from data taken in 1989 and 1990 show surprising features not seen in lower dynamic-range maps of this otherwise well-studied quasar: the inner part of the jet shows edge-brightening, which is important for modeling of jet confinement. The jet fades out very abruptly at r about 40 pc, then reappears at about 70 pc; beyond 70 pc, the resumed jet flares and is more diffuse than an extrapolation of the inner jet would predict. This morphology is reminiscent of M 87, and is suggestive of a shock wave.

  15. Investigations of radio jets in M87, 3C273, and 3C345

    Energy Technology Data Exchange (ETDEWEB)

    Biretta, J.A.

    1986-01-01

    Observational studies of extra-galactic radio jets in M87, 3C273, and 3C345 are presented. Observations of the M87 jet were made at 15 GHz with 0.12'' resolution. All of the knots are clearly resolved both along and across the jet. Most of the knots are found to be smooth in appearance with no evidence of shocklike discontinuities. The brightest knot and the innermost knot are exceptions to this. The brightest knot (knot A) seems consistent with a shock caused by unsteady flow in the jet. Models for this feature are discussed. Combining these data with x-ray data suggests that the jet is neither freely expanding, thermally confined, nor ram-pressure confined. The jet may, however, be magnetically confined. The author presents 10.7 GHz VLBI observations of 3C273 with high north-south resolution. A strong, nonmonotonic curvature is found in the jet at projected radii less than or equal to 5 pc. It is unlikely that this curvature can be caused by precession. Measurements of the core size show that bulk relativistic motion in the core is not required for consistency with the observed x-ray flux.

  16. Investigations of radio jets in M87, 3C273, and 3C345

    International Nuclear Information System (INIS)

    Observational studies of extra-galactic radio jets in M87, 3C273, and 3C345 are presented. Observations of the M87 jet were made at 15 GHz with 0.12'' resolution. All of the knots are clearly resolved both along and across the jet. Most of the knots are found to be smooth in appearance with no evidence of shocklike discontinuities. The brightest knot and the innermost knot are exceptions to this. The brightest knot (knot A) seems consistent with a shock caused by unsteady flow in the jet. Models for this feature are discussed. Combining these data with x-ray data suggests that the jet is neither freely expanding, thermally confined, nor ram-pressure confined. The jet may, however, be magnetically confined. The author presents 10.7 GHz VLBI observations of 3C273 with high north-south resolution. A strong, nonmonotonic curvature is found in the jet at projected radii less than or equal to 5 pc. It is unlikely that this curvature can be caused by precession. Measurements of the core size show that bulk relativistic motion in the core is not required for consistency with the observed x-ray flux

  17. Constraining the location of rapid gamma-ray flares in the FSRQ 3C 273

    CERN Document Server

    Rani, B; Krichbaum, T P; Fuhrmann, L; Zensus, J A

    2013-01-01

    We present a \\gamma-ray photon flux and spectral variability study of the flat-spectrum radio quasar 3C 273 over a rapid flaring activity period between September 2009 to April 2010. Five major flares are observed in the source during this period. The most rapid flare observed in the source has a flux doubling time of 1.1 hr. The rapid \\gamma-ray flares allow us to constrain the location and size of the \\gamma-ray emission region in the source. The \\gamma \\gamma-opacity constrains the Doppler factor, $\\delta_{\\gamma} \\geq$ 10 for the highest energy (15 GeV) photon observed by the {\\it Fermi}-Large Area Telescope (LAT). Causality arguments constrain the size of the emission region to 1.6$\\times 10^{15}$ cm. The \\gamma-ray spectra measured over this period show clear deviations from a simple power law with a break in 1-2 GeV energy range. We discuss possible explanations for the origin of the \\gamma-ray spectral breaks. Our study suggests that the \\gamma-ray emission region in 3C 273 is located within the broad...

  18. An HST Proper-Motion Study of the Large-scale Jet of 3C273

    CERN Document Server

    Meyer, Eileen T; Anderson, Jay; Sohn, Sangmo Tony; Chiaberge, Marco; Perlman, Eric; Norman, Colin

    2016-01-01

    The radio galaxy 3C 273 hosts one of the nearest and best-studied powerful quasar jets. Having been imaged repeatedly by the Hubble Space Telescope (HST) over the past twenty years, it was chosen for an HST program to measure proper motions in the kiloparsec-scale resolved jets of nearby radio-loud active galaxies. The jet in 3C 273 is highly relativistic on sub-parsec scales, with apparent proper motions up to 15$c$ observed by VLBI (Lister et al., 2013). In contrast, we find that the kpc-scale knots are compatible with being stationary, with a mean speed of $-$0.2$\\pm$0.5$c$ over the whole jet. Assuming the knots are packets of moving plasma, an upper limit of 1c implies a bulk Lorentz factor $\\Gamma<$2.9. This suggests that the jet has either decelerated significantly by the time it reaches the kpc scale, or that the knots in the jet are standing shock features. The second scenario is incompatible with the inverse Compton off the Cosmic Microwave Background (IC/CMB) model for the X-ray emission of these...

  19. VizieR Online Data Catalog: Optical light curves of PHL1811 and 3C273 (Fan+, 2014)

    Science.gov (United States)

    Fan, J. H.; Kurtanidze, O.; Liu, Y.; Richter, G. M.; Chanishvili, R.; Yuan, Y. H.

    2014-09-01

    PHL 1811 and 3C 273 are targets in the monitoring programs carried out at the Abastumani Observatory, Mt. Kanobili, Georgia. PHL 1811 has been monitored since 2002, while 3C 273 has been observed since 1998 February. All of our observations were made using the filters combined from the glasses. Those filters are matched with the standard B, V (Johnson), RC, and IC (Cousins) passbands. The seeing during our observations varied in the range of 0.8-3.0 arcsec. For PHL 1811, optical R data observed from 2002 September to 2012 December. For 3C 273, the optical BVRI observations were carried out from 1998 February to 2008. (2 data files).

  20. An IC/CMB interpretation for the large-scale jet X-ray emission of 3C 273

    OpenAIRE

    Liu, Wen-Po

    2015-01-01

    We present that the model of inverse Compton scattering of cosmic microwave background photons (IC/CMB) could well explain the large-scale jet X-ray radiation of 3C 273, and does not violate new Fermi observations. For the individual knots, the synchrotron spectrum of the low-energy electrons responsible for the IC/CMB X-ray emission may be different from the extrapolation of the 10GHz radio spectrum of knots. Based on the IC/CMB model for the 3C 273 large-scale jet, the Fermi observations ma...

  1. Optical and infrared observations of the luminous quasar PDS 456: a radio-quiet analogue of 3C 273?

    OpenAIRE

    Simpson, Chris; Ward, Martin; O' Brien, Paul; Reeves, James,

    1998-01-01

    We present infrared photometry and optical and infrared spectroscopy of the recently-discovered, extremely luminous nearby quasar PDS 456. A number of broad emission features are seen in the near-infrared which we are unable to identify. We measure a more accurate redshift from a narrow forbidden emission line and compare the optical-infrared spectrum to that of 3C 273. The close similarity suggests that PDS 456 is a radio-quiet analogue of 3C 273, although radio observations do not support t...

  2. Re-Analysis of QPO in 3C 273 Light Curve

    Indian Academy of Sciences (India)

    P. Mohan; A. Mangalam; Hum Chand; Alok C. Gupta

    2011-03-01

    We have developed analysis tools to search for quasi periodic oscillations in light curves from active galactic nuclei, using the following time series techniques: Wavelets, periodogram, Lomb–Scargle periodogram, structure function and multi-harmonic analysis of variance. The analysis tools incorporate different noise models with significant levels for all the techniques that is an improvement over the previous work. By looking for consistently high significance, we make the detection of periodicities more robust. We apply this tool to a previously reported QPO (Espaillat et al. 2008) in the X-ray light curve of 3C 273 with a periodicity of ∼ 3300 s and find that the significance is only 74% in the wavelet and fails to show up above 95% significance in the periodogram and multi-harmonic analysis of variance.

  3. Ten Years of Monitoring 3C 273 with XMM–Newton

    Indian Academy of Sciences (India)

    Liu Liu; Youhong Zhang

    2011-03-01

    We present ten years optical/UV/X-ray observations of 3C 273 performed using XMM–Newton between 2000 and 2009. The short-time scale variability behaviour of the soft and hard X-ray light curves may suggest different origins of the soft/hard X-ray emissions. We fit well the 0.2–10 keV X-ray spectrum with a hard power-law component plus a soft Comptonization component. The lack of – correlation of the hard power-law component and the weakness of iron lines may support dominance of the jet component. The soft X-ray excess correlates much better with ultraviolet than with the hard power-law component, strongly suggesting that soft excess emission originates from inverse Comptonization of UV photons.

  4. Leucine replaced by methionine at 273 position in chronic myeloid leukemia: Knowns and unknowns…

    Directory of Open Access Journals (Sweden)

    Aditi Harsh Thanky

    2016-01-01

    Full Text Available Chronic myeloid leukemia is a clonal bone marrow stem cell disorder characterized by the presence of Philadelphia chromosome t(9;22(q34;q11 leading to fusion oncogene BCR-ABL. Tyrosine kinase inhibitors (TKIs act by competitively inhibiting BCR-ABL oncoprotein with significant response rates. However, up to 30% of patients fail to achieve complete cytogenetic remission on 1st line TKI imatinib, one of the reasons being mutations in BCR-ABL kinase domain leading to imatinib resistance. Over 80 such mutations have been documented in the literature; however, some of the rare mutations still remain to be studied for their impact in development of resistance and their responsiveness to currently available therapeutic options. Here, we report one such case of a rare mutation leucine replaced by methionine at 273 position and its clinical implications.

  5. The angular distribution of neutron scattering from hydrogen at 27.3 MeV

    International Nuclear Information System (INIS)

    The angular distribution for np scattering at 27.3 MeV has been measured at 7 angles between 170 and 57.90 in the lab system. The neutrons scattered by a small plastic scintillator were detected in another plastic scintillator whose absolute efficiency had been measured between 5 and 25 MeV by use of the associated particle method. It was found to be necessary to investigate the effect on the angular distribution of the 12C(n,n'y) reaction occurring in the target scintillator. The data overlap, and are combined with, existing distribution data at the same energy obtained by detecting recoil protons. The asymmetry about 1/2π of the resulting angular distribution is in better agreement with predictions from phase-shift analyses than with those from meson-theoretical models. (Auth.)

  6. Rapid infrared and optical variability in the bright quasar 3C273

    International Nuclear Information System (INIS)

    We have observed variations by a factor of two in the infrared flux from the bright quasar 3C273 on a timescale as short as one day. In February 1988, the behaviour of the source changed from having a stable infrared flux and slow optical variations to a state characterized by recurrent infrared and optical flaring. The optical variations were of several per cent per day, changing from increase to decrease approximately every week. The amplitude of the repeated optical flares was 30-40%. The data are consistent with re-injection/acceleration of electrons followed by rapid cooling. The inferred magnetic field is 0.7 gauss and the data are marginally consistent with no relativistic beaming. (author)

  7. The High Resolution Chandra X-Ray Spectrum of 3C273

    Science.gov (United States)

    Fruscione, Antonella; Lavoie, Anthony (Technical Monitor)

    2000-01-01

    The bright quasar 3C273 was observed by Chandra in January 2000 for 120 ksec as a calibration target. It was observed with all detector- plus-grating combinations (ACIS+HETG, ACIS+LETG, and HRC+LETG) yielding an X-ray spectrum across the entire 0.1-10 keV band with unprecedented spectral resolution. At about 10 arcsec from the nucleus, an X-ray jet is also clearly visible and resolved in the Oth order images. While the jet is much fainter than the nuclear source, the Chandra spatial resolution allows, for the first time, spectral analysis of both components separately. We will present detailed spectral analysis with particular emphasis on possible absorption features and comparison with simultaneous BeppoSAX data.

  8. HST optical spectral index map of the jet of 3C 273

    CERN Document Server

    Jester, S; Meisenheimer, K; Perley, R A; Conway, R

    2001-01-01

    We present HST images at 622 nm and 300 nm of the jet in 3C273 and determine the run of the optical spectral index at 0.2" along the jet. The smoothness of spectral index changes shows that the physical conditions are varying smoothly across the jet. There is no correlation between the optical flux and spectral index, as would be expected for relativistic electrons suffering strong cooling due to synchrotron emission. We find no evidence for localized acceleration or loss sites. This suggests that the spectral shape is not changing much throughout the jet. We show that relativistic beaming and/or sub-equipartition magnetic fields cannot remove the discrepancy between light-travel time along the jet and the lifetime of electrons emitting optical synchrotron radiation. We consider this further evidence in favour of a distributed electron acceleration process.

  9. The variability of the quasar 3C 273: a radio to gamma-ray view

    OpenAIRE

    Soldi, S.; Beckmann, V.; M. Türler

    2009-01-01

    We have analysed the first 15 months of Fermi/LAT data of the radio loud quasar 3C 273. Intense gamma-ray activity has been detected, showing an average flux of F(> 100 MeV) = 1.4e-6 ph/cm^2/s, with a peak at F(> 100 MeV) = 5.6e-6 ph/cm^2/s detected during a flare in September 2009. Together with the brightening of the source, a possible hardening of the gamma-ray spectrum is observed, pointing to a shift of the inverse Compton peak toward higher energies than the 1-10 MeV range in which 3C 2...

  10. Particle acceleration in the hotspot of the jet of quasar 3C273

    Energy Technology Data Exchange (ETDEWEB)

    Meisenhaimer, K.; Heavens, A.F.

    1986-10-02

    Recent radio, optical and near-infrared observations of the dominant hotspot at the outer end of the quasar jet 3C273A have revealed a complex spectrum, which provides a unique probe of the acceleration process supplying the synchrotron-emitting electrons. The authors present theoretical calculations of the electron spectrum produced by non-relativistic shock acceleration which, include both synchrotron losses and a finite emission region. The resultant synchrotron spectrum fits the observations, providing a natural explanation for the steep spectrum at radio to infrared frequencies, the observed flattening at ..nu.. < ..nu..sub(b) = 1.5 GHz, and the cutoff above ..nu..sub(c) = 2 x 10/sup 14/ Hz. The model yields a new magnetic field estimate of 70 nT.

  11. HST and MERLIN observations of the jet in 3C273

    CERN Document Server

    Bahcall, J N; Schneider, D P; Davis, R J; Muxlow, T W B; Garrington, S T; Conway, R G; Unwin, S C

    1995-01-01

    We present red and blue images of the jet of the quasar 3C273 obtained with the WFPC2 on the Hubble Space Telescope as well as a new radio map made with the MERLIN array. The images are of significantly better quality than that of previous data. The two maps are aligned to an accuracy of 0.020''; this accuracy is achieved because both the quasar and the jet are contained in both the radio and optical images. The start of the optical jet is marked by an elongated knot which appears identical at radio and optical wavelengths. Other knots in the optical jet correspond to narrow oblique features within the radio outline. The total width of the smooth emission in the optical jet is~0.7''; the FWHM of the optical knots is~0.3''. The knots may trace the current location of a narrow, perhaps helical jet lying within the outlines of the older radio cocoon.

  12. Rapid infrared and optical variability in the bright quasar 3C273

    Energy Technology Data Exchange (ETDEWEB)

    Courvoisier, T.J.-L.; Robson, E.I.; Hughes, D.H.; Blecha, A.; Bouchet, P.; Schwarz, H.E.; Krisciunas, K.

    1988-09-22

    We have observed variations by a factor of two in the infrared flux from the bright quasar 3C273 on a timescale as short as one day. In February 1988, the behaviour of the source changed from having a stable infrared flux and slow optical variations to a state characterized by recurrent infrared and optical flaring. The optical variations were of several per cent per day, changing from increase to decrease approximately every week. The amplitude of the repeated optical flares was 30-40%. The data are consistent with re-injection/acceleration of electrons followed by rapid cooling. The inferred magnetic field is 0.7 gauss and the data are marginally consistent with no relativistic beaming.

  13. Concurrent 43 and 86 GHz Very Long Baseline Polarimetry of 3C273

    CERN Document Server

    Attridge, J M; Homan, D C; Attridge, Joanne M.; Wardle, John F. C.; Homan, Daniel C.

    2005-01-01

    We present sub-milliarcsecond resolution total intensity and linear polarization VLBI images of 3C273, using concurrent 43 and 86 GHz data taken with the Very Long Baseline Array in May 2002. The structure seen in the innermost jet suggest that we have fortuitously caught the jet in the act of changing direction. The polarization images confirm that the core is unpolarized (fractional polarization m 5.2 x 10^{4} rad m^{-2} must be present in or in front of that region. These are among the highest rotation measures reported so far in the nucleus of any active galaxy or quasar, and must occur outside (but probably close to) the radio emitting region. The transverse rotation measure gradient is in the same sense as that observed by Asada et al and by Zavala and Taylor at greater core distances. The magnitude of the transverse gradient decreases rapidly with distance down the jet, and appears to be variable.

  14. The radio-ultraviolet spectral energy distribution of the jet in 3C273

    CERN Document Server

    Jester, S; Meisenheimer, K; Perley, R

    2004-01-01

    We present deep VLA and HST observations of the large-scale jet in 3C 273 matched to 0.3" resolution. The observed spectra show a significant flattening in the infrared-ultraviolet wavelength range. The jet's emission cannot therefore be assumed to arise from a single electron population and requires the presence of an additional emission component. The observed smooth variations of the spectral indices along the jet imply that the physical conditions vary correspondingly smoothly. We determine the maximum particle energy for the optical jet using synchrotron spectral fits. The slow decline of the maximum energy along the jet implies particle reacceleration acting along the entire jet. In addition to the already established global anti-correlation between maximum particle energy and surface brightness, we find a weak positive correlation between small-scale variations in maximum particle energy and surface brightness. The origin of these conflicting global and local correlations is unclear, but they provide t...

  15. A flare in the infra-red to radio continuum spectrum of 3C273

    International Nuclear Information System (INIS)

    The authors have observed a well defined outburst in the continuum spectrum of the quasar 3C273. The flare propagated from the submillimetre region to the radio while at the same time decaying in the near and far-infrared. Subsequent monitoring has shown that within the space of a year the source has attained its quiescent continuum level at all wavelengths shorter than 20 μm. The near and far infrared spectral shape of the flare was similar to the quiescent spectrum but a pronounced peak was observed in the short millimetre region. This peak, compatible with synchrotron self-absorption, was seen to propagate to longer wavelengths over a time of two months. The timescale and energetics of the flare suggest a major outburst of energy from a region within a parsec of the nucleus. Precise details depend critically on whether isotropic or relativistic beaming are assumed. The data are consistent with a relativistic beaming model

  16. The Metallicity of the Local IGM from the HST/STIS Spectrum of 3C273

    CERN Document Server

    Davé, R; Williger, G M; Weymann, R J; Tripp, T M; Jenkins, E B; Dav\\'e, Romeel

    2001-01-01

    We present a preliminary study of the metallicity of low-redshift Lyman alpha absorbers from the HST/STIS spectrum of 3C273. Using a pixel-based shift-and-coadd technique, we compare observations to carefully-constructed mock quasar spectra from a cosmological hydrodynamic simulation. We place an upper limit of [C/H] 90% confidence using two Ly-alpha absorbers with NHI>10^{14}cm^-2, from the fact that we see no absorption near the expected CIV positions, whereas the artificial spectra predict significant absorption. We test whether this result is sensitive to the assumed shape of the photoionizing background, but find little difference in our results for a Haardt & Madau (quasar-based) flux spectrum or a softer one. With only two absorbers, the sample is still small, but upcoming observations should increase our sample size and provide greater sensitivity.

  17. Nonthermal X-ray emission from 3C 273 - The core of a knotty problem?

    International Nuclear Information System (INIS)

    The quasar 3C 273 was observed in the hard X-ray region of the spectrum (15-300 keV) during a stratospheric balloon flight on July 15, 1987. The emitted photon spectrum is well described by a single power law of photon index -1.61 which corresponds to a hard (20-200 keV) X-ray luminosity of 0.8 x 10 to the 47th ergs/s. This flux is consistent with the 1978/1979 HEAO 1 and AIT/MPI measurements and about a factor of three below the high state measured in 1981 (AIT/MPI). The implications of these results with respect to the location of the production site and mechanism are discussed. 26 refs

  18. A cosmic double helix in the archetypical quasar 3C273.

    Science.gov (United States)

    Lobanov, A P; Zensus, J A

    2001-10-01

    Finding direct evidence for plasma instability in extragalactic jets is crucial for understanding the nature of relativistic outflows from active galactic nuclei. Our radio interferometric observations of the quasar 3C273 made with the orbiting radio telescope, HALCA, and an array of ground telescopes have yielded an image in which the emission across the jet is resolved, revealing two threadlike patterns that form a double helix inside the jet. This double helical structure is consistent with a Kelvin-Helmholtz instability, and at least five different instability modes can be identified and modeled by a light jet with a Lorentz factor of 2 and Mach number of 3.5. The model reproduces in detail the internal structure of the jet on scales of up to 30 milli-arc seconds ( approximately 300 parsecs) and is consistent with the general morphology of the jet on scales of up to 1 kiloparsec. PMID:11588254

  19. 3C 273 with NuSTAR: Unveiling the Active Galactic Nucleus

    Science.gov (United States)

    Madsen, Kristin K.; Fürst, Felix; Walton, Dominic J.; Harrison, Fiona A.; Nalewajko, Krzysztof; Ballantyne, David R.; Boggs, Steve E.; Brenneman, Laura W.; Christensen, Finn E.; Craig, William W.; Fabian, Andrew C.; Forster, Karl; Grefenstette, Brian W.; Guainazzi, Matteo; Hailey, Charles J.; Madejski, Greg M.; Matt, Giorgio; Stern, Daniel; Walter, Roland; Zhang, William W.

    2015-10-01

    We present results from a 244 ks NuSTAR observation of 3C 273 obtained during a cross-calibration campaign with the Chandra, INTEGRAL, Suzaku, Swift, and XMM-Newton observatories. We show that the spectrum, when fit with a power-law model using data from all observatories except INTEGRAL over the 1-78 keV band, leaves significant residuals in the NuSTAR data between 30 and 78 keV. The NuSTAR 3-78 keV spectrum is well described by an exponentially cutoff power law ({{Γ }}=1.646+/- 0.006, {E}{cutoff}={202}-34+51 keV) with a weak reflection component from cold, dense material. There is also evidence for a weak ({EW}=23+/- 11 eV) neutral iron line. We interpret these features as arising from coronal emission plus reflection off an accretion disk or distant material. Beyond 80 keV INTEGRAL data show clear excess flux relative to an extrapolation of the active galactic nucleus model fit to NuSTAR. This high-energy power law is consistent with the presence of a beamed jet, which begins to dominate over emission from the inner accretion flow at 30-40 keV. Modeling the jet locally (in the NuSTAR + INTEGRAL band) as a power law, we find that the coronal component is fit by {{{Γ }}}{AGN}=1.638+/- 0.045, {E}{cutoff}=47+/- 15 {keV}, and jet photon index by {{{Γ }}}{jet}=1.05+/- 0.4. We also consider Fermi/LAT observations of 3C 273, and here the broadband spectrum of the jet can be described by a log-parabolic model, peaking at ˜2 MeV. Finally, we investigate the spectral variability in the NuSTAR band and find an inverse correlation between flux and Γ.

  20. 类星体3C 273 X射线波段周期特性分析%Analysis of the Variability Periodicities of Quasar 3C 273 in the X-ray Band

    Institute of Scientific and Technical Information of China (English)

    邱光良; 马洪军; 张雄; 郑永刚

    2012-01-01

    In this paper, we have colleted a total of 1059 observational datapoints of quasar 3C 273 from Ariel V ssI, GINGA, EXOSAT and RXTEX in the X-ray band (2-10keV), and constructed its historical light curve from 1976 to 2008, and also used the Jurkevich method and the DCF method to calculate and analyze its variability periodicities, the resuls indicate that its long-term of variation is 14. 45℃. 15 years in the X-ray band. In addition, we used this period of 3C 273 to estimate and discuss its central black hole mass in terms of the theory of binary black hole model.%收集了Ariel V ssI、GINGA、EXOSAT及RXTEX卫星在X射线波段(2-10keY)的观测数据点1059个,获得了类星体3C 273从1976年至2008年的历史光变曲线.利用Jurkevich方法及DCF方法计算并分析了类星体3C 273的光变周期,结果表明,3C 273在X射线波段的光变周期为14.45±0.15年.此外,针对这一光变周期结果,用双黑洞模型对其中心黑洞质量进行了估算和讨论.

  1. Cross-calibration of NuSTAR: A Multi-observatory Snapshot of Blazar 3C273

    Science.gov (United States)

    Balokovic, Mislav; Ballantyne, D. R.; Blandford, R. D.; Boggs, S. E.; Boydstun, K.; Brenneman, L.; Cappi, M.; Christensen, F.; Craig, W.; Elvis, M.; Fabian, A.; Fuerst, F.; Guainazzi, M.; Hailey, C. J.; Harrison, F.; Madejski, G. M.; Marinucci, A.; Matt, G.; Nandra, K.; Reynolds, C. S.; Stern, D.; Walton, D.; Zhang, W.; NuSTAR Team

    2013-01-01

    The Nuclear Spectroscopic Telescope Array (NuSTAR) is the first space-based observatory capable of focusing X-rays in the hard X-ray band between 3 and 79 keV. Following a successful launch in June 2012, NuSTAR performed a series of calibration observations, including an observation of the blazar 3C273. In this poster we present results of simultaneous observations of 3C273 by NuSTAR, XMM-Newton, Chandra, Suzaku, Swift and INTEGRAL taken primarily for cross-calibration and demonstrate the unique capability of NuSTAR to extend high sensitivity observations above 10 keV. We further complement this rich X-ray data set with nearly simultaneous multi-wavelength data spanning the radio, infrared, optical and gamma-ray bands in order to constrain the low-state spectral energy distribution of 3C273. We discuss both early science from 3C273 as well as the NuSTAR cross-calibration targets and plans.

  2. Far Ultraviolet Spectroscopy of the Intergalactic and Interstellar Absorption Toward 3C 273

    Science.gov (United States)

    Sembach, Kenneth R.; Howk, J. Christopher; Savage, Blair D.; Shull, J. Michael; Oegerle, William R.; Fisher, Richard R. (Technical Monitor)

    2001-01-01

    We present Far Ultraviolet Spectroscopic Explorer observations of the molecular, neutral atomic, weakly ionized, and highly ionized components of the interstellar and intergalactic material toward the quasar 3C273. We identify Ly-beta absorption in eight of the known intergalactic Ly-alpha absorbers along the sight line with the rest-frame equivalent widths W(sub r)(Ly-alpha) > 50 micro-angstroms. Refined estimates of the H(I) column densities and Doppler parameters (b) of the clouds are presented. We find a range of b = 16-46 km/s. We detect multiple H(I) lines (Ly-beta - Ly-theta) in the 1590 km/s Virgo absorber and estimate logN(H(I)) = 15.85 +/- 0.10, ten times more H(I) than all of the other absorbers along the sight line combined. The Doppler width of this absorber, b = 16 km/s, implies T 4000/Z, where Z is the metallicity. Strong Galactic interstellar O(VI) is present between -100 and +100 km/s with an additional high-velocity wing containing about 13% of the total O(VI) between +100 and +240 km/s. The Galactic O(VI), N(V), and C(IV) lines have similar shapes, with roughly constant ratios across the -100 to +100 km/s velocity range. The high velocity O(VI) wing is not detected in other species. Much of the interstellar high ion absorption probably occurs within a highly fragmented medium within the Loop IV remnant or in the outer cavity walls of the remnant. Multiple hot gas production mechanisms are required. The broad O(VI) absorption wing likely traces the expulsion of hot gas out of the Galactic disk into the halo. A flux limit of 5.4 x 10(epx -16) erg/sq cm/s on the amount of diffuse O(VI) emission present = 3.5' off the 3C273 sight line combined with the observed O(VI) column density toward 3C273, logN O(VI) = 14.73 +/- 0.04, implies n(sub e) < 0.02/cubic cm and P/k < 11,500/cubic cm for an assumed temperature of 3 x 10(exp 5) K. The elemental abundances in the neutral and weakly-ionized interstellar clouds are similar to those found for other halo

  3. Exploring the nature of the broadband variability in the flat spectrum radio quasar 3C 273

    Science.gov (United States)

    Chidiac, C.; Rani, B.; Krichbaum, T. P.; Angelakis, E.; Fuhrmann, L.; Nestoras, I.; Zensus, J. A.; Sievers, A.; Ungerechts, H.; Itoh, R.; Fukazawa, Y.; Uemura, M.; Sasada, M.; Gurwell, M.; Fedorova, E.

    2016-05-01

    The detailed investigation of the broadband flux variability in the blazar 3C 273 allowed us to probe the location and size of emission regions and their physical conditions. We conducted correlation studies of the flaring activity in 3C 273, which was observed for the period between 2008 and 2012. The observed broadband variations were investigated using the structure function and the discrete correlation function methods. Starting from the commonly used power spectral density (PSD) analysis at X-ray frequencies, we extended our investigation to characterise the nature of variability at radio, optical, and γ-ray frequencies. The PSD analysis showed that the optical and infrared light-curve slopes are consistent with the slope of white-noise processes, while the PSD slopes at radio, X-ray, and γ-ray energies are consistent with red-noise processes. We found that the estimated fractional variability amplitudes strongly depend on the observed frequency. The flux variations at γ-ray and mm-radio bands are found to be significantly correlated. Using the estimated time lag of (110 ± 27) days between γ-ray and radio light-curves, where γ-ray variations lead the radio bands, we constrained the location of the γ-ray emission region at a de-projected distance of 1.2 ± 0.9 pc from the jet apex. Flux variations at X-ray bands were found to have a significant correlation with variations at both radio and γ-ray energies. The correlation between X-ray and γ-ray light curves indicates two possible time lags, which suggests that two components are responsible for the X-ray emission. A negative time lag of -(50 ± 20) days, where the X-rays are leading the emission, suggests that X-rays are emitted closer to the jet apex from a compact region (0.02-0.05 pc in size), most likely from the corona at a distance of (0.5 ± 0.4) pc from the jet apex. A positive time lag of (110 ± 20) days (γ-rays are leading the emission) suggests a jet-base origin of the other X

  4. Observations with a VLB array. III. The sources 3C 120, 3C 273B, 2134+004, and 3C 84

    International Nuclear Information System (INIS)

    The sources 3C 120, 3C 273B, 2134+004, and 3C 84 have been observed at several epochs at 2.8 cm using a multielement very-long-baseline interferometer (VLBI). The resulting visibility data show that the brightness distributions of each source are variable. There are large changes in the visibilities of 3C 120 and 3C 273B on a time scale of months. For 3C 120, and perhaps 3C 273B, the changes can be explained by source distributions in which the components are separating at high (probably relativistic) speeds

  5. Prospective clinical evaluation of 273 modified acid-etched dental implants: 1- to 5- year results

    Directory of Open Access Journals (Sweden)

    Michele De Franco

    2012-03-01

    Full Text Available Aim: The aim of this study was to evaluate the implant survival and the implant-crown success of implants with surface treated with organic acids. Materials and methods: A total of 273 implants (Implus®, Leader-Novaxa, Milan, Italy were inserted in 63 patients, from June 2006 to June 2010, in a single clinical centre. In each annual follow up session, clinical, radiographic and prosthetic parameters were evaluated. The implant-crown success criteria included the absence of pain, suppuration and clinical mobility, a distance between the implant shoulder and the first visible bone contact (DIB <2.0 mm from the surgery and the absence of prosthetic complications at the implantabutment interface. Prosthetic restorations were 32 fixed partial prostheses, 48 single crowns and 16 fixed full arches. Results: The cumulative survival rate was 95.70% (93.81 maxilla, 98.24% mandible. Among the surviving implants, the implant-crown success was 96.07%. At the 5-year control, the mean DIB was 1.2 mm (± 0.5. Conclusion: Implants with surface treated with organic acids seem to represent a good solution for the prosthetic rehabilitation of partially and completely edentulous patients.

  6. 3C 273 with NuSTAR: Unveiling the Active Galactic Nucleus

    DEFF Research Database (Denmark)

    Madsen, Kristin K.; Fürst, Felix; Walton, Dominic J.;

    2015-01-01

    We present results from a 244 ks NuSTAR observation of 3C 273 obtained during a cross-calibration campaign with the Chandra, INTEGRAL, Suzaku, Swift, and XMM-Newton observatories. We show that the spectrum, when fit with a power-law model using data from all observatories except INTEGRAL over the 1......-78 keV band, leaves significant residuals in the NuSTAR data between 30 and 78 keV. The NuSTAR 3-78 keV spectrum is well. described by an exponentially cutoff power law (Γ = 1.646± 0.006, Ecutoff = 202-34 +51 keV) with a weak reflection component from cold, dense material. There is also evidence for a...... weak (EW = 23 ± 11 eV) neutral iron line. We interpret these features as arising from coronal emission plus reflection off an accretion disk or distant material. Beyond 80 keV INTEGRAL data show clear excess flux relative to an extrapolation of the active galactic nucleus model fit to NuSTAR. This high...

  7. Exploring the nature of broadband variability in the FSRQ 3C 273

    CERN Document Server

    Chidiac, C; Krichbaum, T P; Angelakis, E; Fuhrmann, L; Nestoras, I; Zensus, J A; Sievers, A; Ungerechts, H; Itoh, R; Fukazawa, Y; Uemura, M; Sasada, M; Gurwell, M; Fedorova, E

    2016-01-01

    Detailed investigation of broadband flux variability in the blazar 3C 273 allows us to probe the location and size of emission regions and their physical conditions. We report the results on correlation studies of the flaring activity observed between 2008 and 2012. The observed broadband variations were investigated using the structure function and the discrete correlation function, and power spectral density analysis (PSD) methods. The PSD analysis showed that the optical/IR light curve slopes are consistent with the slope of white noise processes, while, the PSD slopes at radio, X-ray and gamma-ray energies are consistent with red-noise processes. The flux variations at gamma-ray and mm-radio bands are found to be significantly correlated. Using the estimated time lag of (110\\pm27) days between gamma-ray and radio light curves, we constrained the location of the gamma-ray emission region at a de-projected distance of 1.2\\pm0.9 pc from the jet apex. Flux variations at X-ray bands were found to have a signif...

  8. No evidence for large-scale outflows in the extended ionised halo of ULIRG Mrk273

    CERN Document Server

    Spence, R A W; Tadhunter, C N; Rose, M; Cabrera-Lavers, A; Spoon, H; Munoz-Tunon, C

    2016-01-01

    We present deep new GTC/OSIRIS narrow-band images and optical WHT/ISIS long-slit spectroscopy of the merging system Mrk273 that show a spectacular extended halo of warm ionised gas out to a radius of $\\sim45$ kpc from the system nucleus. Outside of the immediate nuclear regions (r > 6 kpc), there is no evidence for kinematic disturbance in the ionised gas: in the extended regions covered by our spectroscopic slits the emission lines are relatively narrow (FWHM $\\lesssim$ 350 km$\\rm s^{-1}$) and velocity shifts small (|$\\Delta$V| $\\lesssim{} $250 km$\\rm s^{-1}$). This is despite the presence of powerful near-nuclear outflows (FWHM > 1000 km$\\rm s^{-1}$; |$\\Delta$V| > 400 km$\\rm s^{-1}$; r < 6 kpc). Diagnostic ratio plots are fully consistent with Seyfert 2 photo-ionisation to the NE of the nuclear region, however to the SW the plots are more consistent with low-velocity radiative shock models. The kinematics of the ionised gas, combined with the fact that the main structures are aligned with low-surface-bri...

  9. INTEGRAL/IBIS deep extragalactic survey: M81, LMC and 3C 273/Coma fields

    CERN Document Server

    Mereminskiy, Ilya A; Lutovinov, Alexander A; Sazonov, Sergey Yu; Revnivtsev, Mikhail G; Sunyaev, Rashid A

    2016-01-01

    We present results of deep surveys of three extragalactic fields, M81 (exposure of 9.7 Ms), LMC (6.8 Ms) and 3C 273/Coma (9.3 Ms), in the hard X-ray (17-60 keV) energy band with the IBIS telescope onboard the INTEGRAL observatory, based on 12 years of observations (2003-2015). The combined survey reaches a $4\\sigma$ peak sensitivity of 0.18 mCrab (2.6$\\times$10$^{-12}$ erg s$^{-1}$ cm$^{-2}$) and sensitivity better than 0.25 and 0.87 mCrab over 10% and 90% of its full area of 4900 deg$^{2}$, respectively. We have detected in total 147 sources at $S/N>4\\sigma$, including 37 sources observed in hard X-rays for the first time. The survey is dominated by extragalactic sources, mostly by active galactic nuclei (AGN). The sample of identified sources contains 98 AGN (including 64 Seyfert galaxies, 7 LINERs, 3 XBONGs, 16 blazars and 8 AGN of unclear optical class), two galaxy clusters (Coma and Abell 3266), 17 objects located in the Large and Small Magellanic Clouds (13 high- and 2 low-mass X-ray binaries and 2 X-ra...

  10. A large high-energy $\\gamma$-ray flare from the blazar 3C 273

    CERN Document Server

    Collmar, W; Bennett, K; Blömen, H; Hermsen, W; Lichti, G G; Ryan, J; Schönfelder, V; Steinle, H; Williams, O R; Böttcher, M

    2000-01-01

    The Compton Gamma-Ray Observatory (CGRO) experiments EGRET and COMPTEL observed the Virgo sky region continuously for 7 weeks between December 10, 1996 and January 28, 1997. The prominent quasar 3C~273 was found to be the brightest source in gamma-rays and was significantly detected by EGRET and COMPTEL. The EGRET experiment observed a time-variable flux at energies above 100 MeV, which reached in a 2-week flaring period (December 30, 1996 to January 14, 1997) its highest flux level observed during the CGRO-era. COMPTEL, however, does not observe obvious time variability at energies below ~30 MeV contemporaneous to EGRET. In particular, no flare was observed, indicating that this outburst is solely a high-energy (>100 MeV) phenomenon. The energy spectrum between 3 MeV and 10 GeV is well represented by a simple power-law model. Below 3 MeV a spectral turnover is indicated. Performing spectral analysis for different time periods, we found evidence for a spectral hardening during the flaring period, which is con...

  11. Heterogeneous ice nucleation and water uptake by field-collected atmospheric particles below 273 K

    Science.gov (United States)

    Wang, Bingbing; Laskin, Alexander; Roedel, Tobias; Gilles, Mary K.; Moffet, Ryan C.; Tivanski, Alexei V.; Knopf, Daniel A.

    2012-09-01

    Ice formation induced by atmospheric particles through heterogeneous nucleation is not well understood. Onset conditions for heterogeneous ice nucleation and water uptake by particles collected in Los Angeles and Mexico City were determined as a function of temperature (200-273 K) and relative humidity with respect to ice (RHice). Four dominant particle types were identified including soot associated with organics, soot with organic and inorganics, inorganic particles of marine origin coated with organic material, and Pb/Zn-containing particles apportioned to emissions relevant to waste incineration. Single particle characterization was provided by micro-spectroscopic analyses using computer controlled scanning electron microscopy with energy dispersive analysis of X-rays (CCSEM/EDX) and scanning transmission X-ray microscopy with near edge X-ray absorption fine structure spectroscopy (STXM/NEXAFS). Above 230 K, significant differences in onsets of water uptake and immersion freezing of different particle types were observed. Below 230 K, particles exhibited high deposition ice nucleation efficiencies and formed ice atRHicewell below homogeneous ice nucleation limits. The data suggest that water uptake and immersion freezing are more sensitive to changes in particle chemical composition compared to deposition ice nucleation. The data demonstrate that anthropogenic and marine influenced particles, exhibiting various chemical and physical properties, possess distinctly different ice nucleation efficiencies and can serve as efficient IN at atmospheric conditions typical for cirrus and mixed-phase clouds.

  12. The Environment of Lyman a Absorbers in the Sightline toward 3C273

    CERN Document Server

    Morris, S L; Dressler, A; McCarthy, P J; Smith, B A; Terrile, R J; Gionvanelli, R; Irwin, M; Dressler, Alan

    1993-01-01

    We present new ground-based data following up on the HST discovery of low-redshift Lya absorption in the sight-line to the quasar 3C273. Narrow-band filter observations show that there are no H II regions within a 12 kpc radius of the line-of-sight to the quasar, at the velocities of three of the absorbers. Broad-band imaging shows that there are no dwarf galaxies at Virgo distances with absolute magnitude above MB~-13.5 and within a radius of 40 kpc. We present fiber spectroscopy of galaxies within a radius of 1 deg, down to an apparent magnitude of B~19. We show that the absorbers are definitely not distributed at random with respect to the galaxies, but also that the absorber-galaxy correlation function is not as strong as the galaxy-galaxy correlation function on large scales. Our data are consistent with the hypothesis that all galaxies more luminous than 1/10 L* have effective cross-sections (for association with absorbers with Log(NH)>13.0), of between 0.5 and 1 Mpc. We also show a clear case of a Lya ...

  13. Magnetic Field Structure in the Parsec Scale Jet of 3C273 from Multifrequency VLBA Observations

    CERN Document Server

    Savolainen, T; Valtaoja, E; Tornikoski, M

    2007-01-01

    We present first results from a multifrequency VLBA observations of 3C273 in 2003. The source was observed simultaneously at 5.0, 8.4, 15.3, 22.2, 43.2 and 86.2 GHz, and from this multifrequency data set, spectra of 16 emission features in the parsec scale jet were carefully constructed by using a new model-fitting based method. The measured spectra and sizes of the emission features were used to calculate the magnetic field density and the energy density of the relativistic electrons in the different parts of the parsec scale jet, independent of any equipartition assumption. We measure magnetic field density of an order of 1 Gauss in the core. The magnetic energy density in the core dominates over that of the relativistic electrons, while in the downstream region our data are roughly consistent with an equipartition. A strong gradient in the magnetic field density across the jet width, coincident with a transverse velocity structure at about 1.5 mas from the core, was found: the slower superluminal component...

  14. Extreme Brightness Temperatures and Refractive Substructure in 3C273 with RadioAstron

    Science.gov (United States)

    Johnson, Michael D.; Kovalev, Yuri Y.; Gwinn, Carl R.; Gurvits, Leonid I.; Narayan, Ramesh; Macquart, Jean-Pierre; Jauncey, David L.; Voitsik, Peter A.; Anderson, James M.; Sokolovsky, Kirill V.; Lisakov, Mikhail M.

    2016-03-01

    Earth-space interferometry with RadioAstron provides the highest direct angular resolution ever achieved in astronomy at any wavelength. RadioAstron detections of the classic quasar 3C 273 on interferometric baselines up to 171,000 km suggest brightness temperatures exceeding expected limits from the “inverse-Compton catastrophe” by two orders of magnitude. We show that at 18 cm, these estimates most likely arise from refractive substructure introduced by scattering in the interstellar medium. We use the scattering properties to estimate an intrinsic brightness temperature of 7× {10}12 {{K}}, which is consistent with expected theoretical limits, but which is ˜15 times lower than estimates that neglect substructure. At 6.2 cm, the substructure influences the measured values appreciably but gives an estimated brightness temperature that is comparable to models that do not account for the substructure. At 1.35 {{cm}}, the substructure does not affect the extremely high inferred brightness temperatures, in excess of {10}13 {{K}}. We also demonstrate that for a source having a Gaussian surface brightness profile, a single long-baseline estimate of refractive substructure determines an absolute minimum brightness temperature, if the scattering properties along a given line of sight are known, and that this minimum accurately approximates the apparent brightness temperature over a wide range of total flux densities.

  15. 3C273 variability at 7 mm: Evidences of shocks and precession in the jet

    CERN Document Server

    Beaklini, Pedro Paulo B

    2013-01-01

    We report 4 years of observations of 3C273 at 7 mm obtained with the Itapetinga Radiotelescope, in Brazil, between 2009 and 2013. We detected a flare in 2010 March, when the flux density increased by 50% and reached 35 Jy. After the flare, the flux density started to decrease and reached values lower than 10 Jy. We suggest that the 7 mm flare is the radio counterpart of the $\\gamma$-ray flare observed by Fermi/LAT in 2009 September, in which the flux density at high energies reached a factor of fifty of its average value. A delay of 170 days between the radio and $\\gamma$-ray flares was revealed using the Discrete Correlation Function (DCF) that can be interpreted in the context of a shock model, in which each flare corresponds to the formation of a compact superluminal component that expands and becomes optically thin at radio frequencies at latter epochs. The difference in flare intensity between frequencies and at a different times, is explained as a consequence of an increase in the Doppler factor $\\delta...

  16. Chandra Observations of the X-Ray Jet of 3C273

    CERN Document Server

    Sambruna, R M; Tavecchio, F; Maraschi, L; Scarpa, R; Chartas, G; Muxlow, T W B; Sambruna, Rita M.

    2001-01-01

    We report results from Chandra observations of the X-ray jet of 3C~273 during the calibration phase in 2000 January. The zeroeth-order images and spectra from two 40-ks exposures with the HETG and LETG+ACIS-S show a complex X-ray structure. The brightest optical knots are detected and resolved in the 0.2-8 keV energy band. The X-ray morphology tracks well the optical. However, while the X-ray brightness decreases along the jet, the outer parts of the jet tend to be increasingly bright with increasing wavelength. The spectral energy distributions of four selected regions can best be explained by inverse Compton scattering of (beamed) cosmic microwave background photons. The model parameters are compatible with equipartition and a moderate Doppler factor, which is consistent with the one-sidedness of the jet. Alternative models either imply implausible physical conditions and energetics (the synchrotron self-Compton model) or are sufficiently ad hoc to be unconstrained by the present data (synchrotron radiation...

  17. Dynamics of the Lyman alpha and C IV emitting gas in 3C 273

    CERN Document Server

    Paltani, S; Paltani, Stephane; Turler, Marc

    2003-01-01

    In this paper we study the variability properties of the Lyman alpha and C IV emission lines in 3C273 using archival IUE observations. Our data show for the first time the existence of variability on time scales of several years. We study the spatial distribution and the velocity field of the emitting gas by performing detailed analyses on the line variability using correlations, 1D and 2D response functions, and principal component analysis. In both lines we find evidence for two components, one which has the dynamic properties of gas in Keplerian motion around a black hole with a mass of the order of 10^9 Mo, and one which is characterized by high, blue-shifted velocities at large lag. There is no indication of the presence of optically thick emission medium neither in the Lya, nor in the Civ response functions. The component characterized by blue-shifted velocities, which is comparatively much stronger in Civ than in Lya, is more or less compatible with being the result of gas falling towards the central b...

  18. HEAO 1 observations of high-energy X-rays from 3C273. [quasar emissions

    Science.gov (United States)

    Primini, F. A.; Cooke, B. A.; Dobson, C. A.; Howe, S. K.; Scheepmaker, A.; Wheaton, W. A.; Lewin, W. H. G.; Baity, W. A.; Gruber, D. E.; Matteson, J. L.

    1979-01-01

    The first detection of high energy (13 to 120 keV) X rays from the quasar 3C273, made by the HEAO 1 satellite, is reported. Observations were made with the 13 to 180 keV slat collimated detectors of the high energy X-ray and low energy gamma-ray (A4) experiment during December 1977-January 1978 and June-July 1978. Results are consistent with the previously observed X-ray flux variability on a scale of months. Photon count rates are presented for each of five energy bands and count rate and photon spectra for the June through July 1978 observations are derived. A comparison of the data obtained with that at lower X-ray energies and higher gamma-ray energies indicates that there is an overall spectral steepening from low to high energies and a possible break near 20 keV, which may be due to the gamma rays originating from a different region than that of the X rays.

  19. Extreme Brightness Temperatures and Refractive Substructure in 3C273 with RadioAstron

    CERN Document Server

    Johnson, Michael D; Gwinn, Carl R; Gurvits, Leonid I; Narayan, Ramesh; Macquart, Jean-Pierre; Jauncey, David L; Voitsik, Peter A; Anderson, James M; Sokolovsky, Kirill V; Lisakov, Mikhail M

    2016-01-01

    Earth-space interferometry with RadioAstron provides the highest direct angular resolution ever achieved in astronomy at any wavelength. RadioAstron detections of the classic quasar 3C273 on interferometric baselines up to 171,000 km suggest brightness temperatures exceeding expected limits from the "inverse-Compton catastrophe" by two orders of magnitude. We show that at 18 cm, these estimates most probably arise from refractive substructure introduced by scattering in the interstellar medium. We use the scattering properties to estimate an intrinsic brightness temperature of 7*10^12 K, which is consistent with expected theoretical limits, but which is ~15 times lower than estimates that neglect substructure. At 6 cm, the substructure influences the measured values appreciably but gives an estimated brightness temperature that is comparable to models that do not account for the substructure. At 1.3 cm, the substructure does not affect the extremely high inferred brightness temperatures, in excess of 10^13 K....

  20. A BeppoSAX observation of 3C273 broadband spectrum and detection of a low-energy absorption feature

    CERN Document Server

    Grandi, P; Mineo, T; Parmar, A N; Fiore, F; Matteuzzi, A; Nicastro, F; Perola, G C; Piro, L; Cappi, M; Cusumano, G; Frontera, F; Giarrusso, S; Palazzi, E; Piraino, S

    1997-01-01

    We report the results of a 3C273 observation performed during the Science Verification Phase (SVP) of the BeppoSax satellite. The broad-band spectrum is well represented by a power-law between 1 keV and 200 keV. The spectral slope is flat (\\Gamma ~1.6) with a weak emission line at ~ 6.4 keV (rest frame) of EW ~ 30 eV. Below 1 keV, a deviation from a power-law due to an absorption feature plus a soft component is present. This is the first time that a feature in absorption at ~ 0.5 keV (observer frame) is unambiguously detected in 3C273.

  1. Dust content of a hydrogen rich, low surface brightness galaxy and the luminosity history of 3C273

    Science.gov (United States)

    Hamilton, Thomas T.

    1993-01-01

    This project consists of a 30,000 second PSPC observation of the Giovanelli-Haynes Cloud in an attempt to detect light emitted by 3C273 which has been reflected by the cloud, and incidentally search the cloud for other sources of X-ray emission. The observation was carried out by ROSAT on Dec. 25, 1992 and the data was received by the P.I. in late March of 1993. We have examined the data and determined that the observation's background level, astrometry, etc. are acceptable. We have also detected diffuse emission from the direction of the Giovanelli-Haynes Cloud. Determination of the origin of this emission, by examining its morphology in relation to that of the radio map and the object's geometric relation with 3C273, requires software implementation of specialized algorithms. However, the most dramatic observation in the field is a potentially new population of discrete soft X-ray sources associated with dwarf galaxies.

  2. Identification and quantification of metabolites of a novel nonbenzodiazepine anxiolytic compound (CL 273,547) by thermospray LC/MS in tandem with 14C detection and an off-line stable isotope recognition computer program

    International Nuclear Information System (INIS)

    Anxiolytic, CL 273,547, a nonsedative, nonbenzodiazepine, is being developed as an anxiolytic agent. This work was performed to elucidate the structures of CL 273,547 metabolites, and to compare human and dog in vivo metabolism. CL 273,547 metabolites were isolated from the urine of dogs dosed orally 50 mg/kg (specific activity 0.31 μCi/mg). These metabolites were compared to urine metabolites from humans dosed orally 90 mg (45 mg tetradeuterated CL 273,547 and 45 mg CL 273,547, specific activity of 0.182 μCi/mg)

  3. Multifrequency Observations of the Virgo Blazars 3C 273 and 3C 279 in CGRO Cycle 8

    CERN Document Server

    Collmar, W; Grove, J E; Hartman, R C; Heindl, W A; Kraus, A L; Teraesranta, H; Villata, M; Bennett, K; Blömen, H; Johnson, W N; Krichbaum, T P; Raiteri, C M; Ryan, J; Sobrito, G; Schönfelder, V; Williams, O R; Wilms, J

    2000-01-01

    We report first observational results of multifrequency campaigns on the prominent Virgo blazars 3C 273 and 3C 279 which were carried out in January and February 1999. Both blazars are detected from radio to gamma-ray energies. We present the measured X- to gamma-ray spectra of both sources, and for 3C 279 we compare the 1999 broad-band (radio to gamma-ray) spectrum to measured previous ones.

  4. 86 GHz Very Long Baseline Polarimetry of 3C273 and 3C279 with the Coordinated Millimeter VLBI Array

    OpenAIRE

    Attridge, Joanne M.

    2001-01-01

    86 GHz Very Long Baseline Polarimetry probes magnetic field structures within the cores of Active Galactic Nuclei at higher angular resolutions and a spectral octave higher than previously achievable. Observations of 3C273 and 3C279 taken in April 2000 with the Coordinated Millimeter VLBI Array have resulted in the first total intensity (Stokes I) and linear polarization VLBI images reported of any source at 86 GHz. These results reveal the 86 GHz electric vector position angles within the je...

  5. Proton acceleration beyond 100 EeV by an oblique shock wave in the jet of 3C 273

    OpenAIRE

    Honda, Yasuko S.; Honda, Mitsuru

    2004-01-01

    We estimate the highest energy of proton diffusively accelerated by shock in knot A1 of the jet in luminous nearby quasar 3C 273. Referring to the recent polarization measurements using very long baseline interferometry (VLBI), we consider the shock propagation across magnetic field lines, namely, configuration of the oblique shock. For larger inclination of the field lines, the effects of particle reflection at the shock front are more pronounced, to significantly increase acceleration effic...

  6. Characterizing the Jet Precession of Quasar 3C273 at 1.3mm with the Event Horizon Telescope

    Science.gov (United States)

    Calzadilla, Michael; Fish, Vincent L.; Lu, Rusen; Akiyama, Kazunori; Doeleman, Sheperd

    2015-01-01

    The Event Horizon Telescope (EHT) is an array of millimeter-wavelength telescopes that observe the nearest supermassive black holes using the technique of very long baseline interferometry (VLBI). The EHT is uniquely capable of resolving structures on angular scales of tens of microarcseconds, corresponding to a few Schwarzschild radii around nearby black holes such as the one in our galactic center, Sgr A*. One of the goals of the EHT is to better understand relativistic outflow processes around black holes, which can be achieved due to its extremely high spatial resolution. To that end, here we present the first high-resolution VLBI observations of 3C273 at 1.3mm. We successfully detected non-zero closure phases, which indicate asymmetric structure that we then fit using simple geometric models. The orientation between model components varied over the range of years that 3C273 was observed, in agreement with multi-epoch data at lower frequencies. Our results suggest that precession can be observed even at sub-parsec scales in 3C273. Furthermore, we demonstrate that polarimetric ratios can be used for relative astrometry between flaring components and discuss the implications of that for future research.

  7. VLTI/AMBER differential interferometry of the broad-line region of the quasar 3C273

    Science.gov (United States)

    Petrov, Romain G.; Millour, Florentin; Lagarde, Stéphane; Vannier, Martin; Rakshit, Suvendu; Marconi, Alessandro; weigelt, Gerd

    2012-07-01

    Unveiling the structure of the Broad Line Region (BLR) of AGNs is critical to understand the quasar phenomenon. Resolving a few BLRs by optical interferometry will bring decisive information to confront, complement and calibrate the reverberation mapping technique, seed of the mass-luminosity relation in quasars. BLRs are much smaller than the angular resolution of the VLT and Keck interferometers and they can be resolved only by differential interferometry very accurate measurements of differential visibility and phase. The latest yields the photocenter variation with λ, and constrains the size, position and velocity law of various regions of the BLR. AGNs are below the magnitude limit for spectrally resolved interferometry set by currently available fringe trackers. A new “blind” observation method and a data processing based on the accumulation of 2D Fourier power and cross spectra permitted us the first spectrally resolved interferometric observation of a BLR, on the K=10 quasar 3C273. A careful bias analysis is still in progress, but we report strong evidence that, as the baseline increases, the differential visibility decreases in the Paα line. Combined with a differential phase certainly smaller than 3°, this yields an angular radius of the BLR larger than 0.4 milliarcseconds, or 1000 light days at the distance of 3C273, much larger than the reverberation mapping radius of 300 light days. Explaining the coexistence of these two different scales, and possibly structures and mechanisms, implies very new insights about the BLR of 3C273.

  8. INTEGRAL/IBIS deep extragalactic survey: M81, LMC and 3C 273/Coma fields

    Science.gov (United States)

    Mereminskiy, Ilya A.; Krivonos, Roman A.; Lutovinov, Alexander A.; Sazonov, Sergey Yu.; Revnivtsev, Mikhail G.; Sunyaev, Rashid A.

    2016-06-01

    We present results of a deep survey of three extragalactic fields, M81 (exposure of 9.7 Ms), Large Magellanic Cloud (6.8 Ms) and 3C 273/Coma (9.3 Ms), in the hard X-ray (17-60 keV) energy band with the IBIS telescope onboard the INTEGRAL observatory, based on 12 years of observations (2003-2015). The combined survey reaches a 4σ peak sensitivity of 0.18 mCrab (2.6 × 10-12 erg s-1 cm-2) and sensitivity better than 0.25 and 0.87 mCrab over 10 per cent and 90 per cent of its full area of 4900 deg2, respectively. We have detected in total 147 sources at S/N > 4σ, including 37 sources observed in hard X-rays for the first time. The survey is dominated by extragalactic sources, mostly active galactic nuclei (AGN). The sample of identified sources contains 98 AGN (including 64 Seyfert galaxies, seven low-ionization nuclear emission-line region galaxies, three X-ray bright optically normal galaxies, 16 blazars and eight AGN of unclear optical class), two galaxy clusters (Coma and Abell 3266), 17 objects located in the Large and Small Magellanic Clouds (13 high- and two low-mass X-ray binaries and two X-ray pulsars), three Galactic cataclysmic variables, one ultraluminous X-ray source (M82 X-1) and one blended source (SWIFT J1105.7+5854). The nature of 25 sources remains unknown, so that the survey's identification is currently complete at 83 per cent. We have constructed AGN number-flux relations (log N-log S) and calculated AGN number densities in the local Universe for the entire survey and for each of the three extragalactic fields.

  9. Revisiting correlations between broad-line and jet emission variations for AGNs: 3C 120 and 3C 273

    Science.gov (United States)

    Liu, H. T.; Bai, J. M.; Feng, H. C.; Li, S. K.

    2015-06-01

    We restudy the issue of cross-correlations between broad-line and jet emission variations, and aim to locate the position of a radio (and gamma-ray) emitting region in a jet of active galactic nuclei. Considering the radial profiles of the radius and number density of clouds in a spherical broad-line region (BLR), we derive new formulae connecting the jet-emitting position Rjet to the time lag τob between broad-line and jet emission variations, and the BLR radius. Also, formulae are derived for a disc-like BLR and a spherical shell BLR. The model-independent flux randomization/random subset selection method is used to estimate τob. For 3C 120, positive lags of about 0.3 yr are found between the 15 GHz emission and the Hβ, Hγ and He II λ4686 lines, including broad-line data in a newly published paper, indicating that the line variations lead the 15 GHz ones. Each of the broad-line light curves corresponds to a radio outburst. Rjet = 1.1-1.5 parsec (pc) is obtained for 3C 120. For 3C 273, a common feature of negative time lags is found in the cross-correlation functions between light curves of radio emission and the Balmer lines, as well as Lyα λ1216 and C IV λ1549 lines. Rjet = 1.0-2.6 pc is obtained for 3C 273. The estimated Rjet is comparable for 3C 120 and 3C 273, and the gamma-ray-emitting positions will be within ˜1-3 pc from the central engines. Comparisons show that the cloud number density and radius radial distributions and the BLR structures have only negligible effects on Rjet.

  10. 27.3-day and 13.6-day Atmospheric Tide and Lunar Forcing on Atmospheric Circulation

    Institute of Scientific and Technical Information of China (English)

    LI Guoqing

    2005-01-01

    An analysis of time variations of the earth's length of day (LOD) versus atmospheric geopotential height fields and lunar phase is presented. A strong correlation is found between LOD and geopotential height from which a close relationship is inferred and found between atmospheric circulation and the lunar cycle around the earth. It is found that there is a 27.3-day and 13.6-day east-west oscillation in the atmospheric circulation following the lunar phase change. The lunar revolution around the earth strongly influences the atmospheric circulation. During each lunar cycle around the earth there is, on average, an alternating change of 6.8-day-decrease, 6.8-day-increase, 6.8-day-decrease and 6.8-day-increase in atmospheric zonal wind, atmospheric angular momentum and LOD. The dominant factor producing such an oscillation in atmospheric circulation is the periodic change of lunar declination during the lunar revolution around the earth. The 27.3- day and 13.6-day atmospheric oscillatory phenomenon is akin to a strong atmospheric tide, which is different from the weak atmospheric tides, diurnal and semidiurnal, previously documented in the literature. Also it is different from the tides in the ocean in accordance with their frequency and date of occurrence. Estimation shows that the 27.3-day lunar forcing produces a 1-2 m s-1 change in atmospheric zonal wind. Therefore, it should be considered in models of atmospheric circulation and short and middle term weather forecasting. The physical mechanism and dynamic processes in lunar forcing on atmospheric circulation are discussed.

  11. Temperature dependence of gamma ray induced luminescence of ethanolamine based liquid scintillator between 212 and 273 K

    International Nuclear Information System (INIS)

    The luminescence response of ethanolamine based liquid scintillator (Ethanolamine + 1g/l Butyle PBD + 0.1g/l BBOT) has been investigated as a function of temperature in the range 212-273 K. It has been observed that under gamma excitation the scintillation efficiency increases by a factor of 1.37 with decrease in temperature. The data obtained conforms to Arrhenius relation in which activation energy of rate process (.20 ev) is typical for thermal activated diffusion controlled process. (author)

  12. X-rays from the jet in 3C 273: clues from the radio-optical spectra

    OpenAIRE

    Jester, S.; Roeser, H. -J.; Meisenheimer, K.; Perley, R.

    2002-01-01

    Using new deep VLA and HST observations of the large-scale jet in 3C273 matched to 0.3" resolution, we have detected excess near-ultraviolet emission (300 nm) above a synchrotron cutoff spectrum accounting for the emission from radio through optical (3.6 cm - 620 nm). This necessitates a two-component model for the emission. The radio-optical-X-ray spectral energy distributions suggest a common origin for the UV excess and the X-rays from the jet.

  13. ORFEUS-II Far-Ultraviolet Observations of 3C273: 1. Interstellar and Intergalactic Absorption Lines

    OpenAIRE

    Hurwitz, Mark; Appenzeller, Immo; Barnstedt, Juergen; Bowyer, Stuart; Dixon, W. Van Dyke; Grewing, Michael; Kappelmann, Norbert; Kraemer, Gerhard; Krautter, Joachim; Mandel, Holger

    1998-01-01

    We present the first intermediate-resolution (lambda / 3000) spectrum of the bright quasi-stellar object 3C273 at wavelengths between 900 and 1200 A. Observations were performed with the Berkeley spectrograph aboard the ORFEUS-SPAS II mission. We detect Lyman beta counterparts to previously-identified intergalactic Lyman-alpha features at cz = 19900, 1600, and 1000 km/s; counterparts to other putative Lyman-alpha clouds along the sight line are below our detection limit. The strengths of the ...

  14. High Resolution X-ray Spectroscopy of the Local Hot Gas along the 3C 273 Sightline

    OpenAIRE

    Fang, Taotao; Jiang, Xiaochuan

    2014-01-01

    X-ray observations of highly ionized metal absorption lines at z=0 provide critical information of the hot gas distribution in and around the Milky Way. We present a study of more than ten-year Chandra and XMM-Newton observations of 3C 273, one of the brightest extragalactic X-ray sources. Compared with previous work, We obtain much tighter constraints of the physical properties of the X-ray absorber. We also find a large, non-thermal velocity at ~ 100 - 150 km/s is the main reason for the hi...

  15. X-rays from the jet in 3C 273 clues from the radio-optical spectra

    CERN Document Server

    Jester, S; Meisenheimer, K; Perley, R

    2002-01-01

    Using new deep VLA and HST observations of the large-scale jet in 3C273 matched to 0.3" resolution, we have detected excess near-ultraviolet emission (300 nm) above a synchrotron cutoff spectrum accounting for the emission from radio through optical (3.6 cm - 620 nm). This necessitates a two-component model for the emission. The radio-optical-X-ray spectral energy distributions suggest a common origin for the UV excess and the X-rays from the jet.

  16. Fermi-LAT observations of the exceptional gamma-ray outbursts of 3C 273 in September 2009

    OpenAIRE

    2010-01-01

    We present the light curves and spectral data of two exceptionally luminous gamma-ray outburts observed by the Large Area Telescope (LAT) experiment on board Fermi Gamma-ray Space Telescope from 3C 273 in September 2009. During these flares, having a duration of a few days, the source reached its highest gamma-ray flux ever measured. This allowed us to study in some details their spectral and temporal structures. The rise and decay are asymmetric on timescales of 6 hours, and the spectral ind...

  17. On-ground characterization of the Euclid low noise CCD273 sensor for precise galaxy shape measurements

    International Nuclear Information System (INIS)

    The VISible imaging instrument VIS is one of two instruments on board the Euclid telescope. The focal plane consists of 36 CCD273-84 sensors manufactured by the e2v technologies. The sensors are designed to provide a maximum charge transfer efficiency (CTE) to minimize distortions to source shapes. Each sensor undergoes a rigorous on-ground electro-optical testing at several stages of the mission to ensure that strict requirements are met before the launch of the spacecraft. This paper summarizes the commissioning of the Euclid CCD273 testing facility at the Mullard Space Science Laboratory (MSSL), the lead institute for VIS . The testing bench supports the measurements of the point spread function (PSF), system noise and the flat field evaluation. Accurate spot measurements are extremely important for the precise modelling and general understanding of an instrument's PSF . We show the preliminary results of the optical characterization of the pre-development devices with a special interest in the measurements of the PSF at different illumination levels and in the VIS spectral range of 550–900 nm. Additionally, the influence of the on-ground testing environment and a dedicated readout electronics on the obtained images is taken into consideration

  18. Parsec structure and properties of the jet of 3C273. Results of Space VLBI data processing

    CERN Document Server

    Chuprikov, Andrey

    2011-01-01

    We present result of processing of data of ground-space VLBI experiment titled W068. Particularly, one part of data of that observational session is successfully processed. These data were obtained on 2000 March 17 between 9:00 UT and 10:30 UT. 10 antennas of American interferometer VLBA (Very Long Baseline Array) and Japan satellite VSOP (VLBI Space Observatory Programme) were involved into this experiment. Moreover, 27 antennae of VLA (Very Large Array)} were used as an additional ground antenna. Data were transferred from archive of the NRAO (National Radio Astronomy Observatory, USA)and processed with the software titled 'Astro Space Locator' (ASL for Windows). The main result of this processing is the image of the quasar titled 3C273 with high resolution and high accuracy. Using this image, we make some conclusions about the radio structure of jet of this object. Our result is not in conflict with other results of processing of the Space VLBI data for 3C273 published earlier with many authors. We could a...

  19. High Resolution X-ray Spectroscopy of the Local Hot Gas along the 3C 273 Sightline

    CERN Document Server

    Fang, Taotao

    2014-01-01

    X-ray observations of highly ionized metal absorption lines at z=0 provide critical information of the hot gas distribution in and around the Milky Way. We present a study of more than ten-year Chandra and XMM-Newton observations of 3C 273, one of the brightest extragalactic X-ray sources. Compared with previous work, We obtain much tighter constraints of the physical properties of the X-ray absorber. We also find a large, non-thermal velocity at ~ 100 - 150 km/s is the main reason for the higher line equivalent width when compared with other sightlines. Using joint analysis with X-ray emission and ultraviolet observations, we derive a size of 5 - 15 kpc and a temperature of (1.5-1.8) 10^6 K for the X-ray absorber. The 3C 273 sightline passes through a number of Galactic structures, including the radio Loop I, IV, the North Polar Spur, and the neighborhood of the newly discovered "Fermi bubbles". We argue that the X-ray absorber is unlikely associated with the nearby radio Loop I and IV; however, the non-ther...

  20. Some observations on the use of the triple points of deuterium and xenon in interpolation schemes for platinum resistance thermometers below 273 K

    International Nuclear Information System (INIS)

    The use of the triple points of deuterium and xenon is investigated in some interpolation schemes for platinum resistance thermometers between 13.8 K and 273 K. The use of these triple points together is shown to lead to a large sensitivity to errors in the realization of the boiling point of water or the triple point of gallium and of the triple point of xenon for interpolated temperatures below 25 K. The behaviour of these interpolation schemes is presented as evidence that the large non-uniqueness observed in temperature scales between 84 K and 273 K is due in part to measurement errors at the boiling point of water. The use of the triple point of xenon and in interpolation scheme between 25 K and 273 K is shown to lead to a large sensitivity to calibration errors in the triple points of xenon and gallium between 25 K and 54 K. (orig.)

  1. Simultaneous X-ray and infrared variability in the quasar 3C273 – II. Confirmation of the correlation and X-ray lag

    OpenAIRE

    McHardy, Ian; Lawson, Anthony; Newsam, Andrew; Marscher, Alan; Sokolov, Andrei; Urry, Megan; Wehrle, Ann

    2007-01-01

    The X-ray emission from quasars, such as 3C273, is generally agreed to arise from Compton scattering of low-energy seed photons by relativistic electrons in a relativistic jet oriented close to the line of sight. However, there are a number of possible models for the origin of the seed photons. In Paper I (McHardy et al.), we showed that the X-ray and infrared (IR) variability from 3C273 was highly correlated in 1997, with the IR flux leading the X-rays by ∼0.75 ± 0.25 d. The strong correlat...

  2. VLBI observations of 3C273 at 22GHz and 43 GHz. I: Search for short time-scale structural variation

    OpenAIRE

    Mantovani, F.; Junor, W.; Valerio, C; McHardy, I.

    1999-01-01

    The results of VLBI observations of the quasar 3C273, obtained during a multi-frequency campaign in late 1992 in the radio, millimeter and X-ray bands are presented and discussed. The VLBI observations were made at 22 GHz with a Global Array and at 43 GHz with the Very Long Baseline Array. Hybrid maps and modelfits were made in order to look for any short time scale structural variations of the inner part of the radio jet. In 42 days 3C273 was observed 5 times at roughly 10 day intervals. The...

  3. The Wavelet Analysis of the Activity Processes of Quasar 3C 273 in the Radio-X Wavebands

    Science.gov (United States)

    Ryabov, M. I.; Sukharev, A. L.

    Dynamics of development of activity process of a quasar 3C 273 according to published data of radio (Green Bank, Algonquin, UMRAO, Haystack, Metsahovi, Itapetinga, Crimea), ultra-violet (IUE, XMM-Newton) and x-ray (RXTE, CGRO, GINGA, ASCA, EXOSAT, HEAO2, GRANAT, ROSAT) supervision are investigated. Periodogram and wavelet analysis methods are applied for definition of the basic periods of variability in each range and dynamics of their changes for 30-40 years of observation. Properties of the separate periods of acti-vity during 6-8 years are considered. On spectral indexes, time shifts, spectra of maximum activity and data VLBI of observation properties of extreme displays of activity in system "core-accretion disk-jet" are defined.

  4. A BeppoSAX observation of 3C273: broadband spectrum and detection of a low-energy absorption feature

    OpenAIRE

    Grandi, P; Guainazzi, M.; Mineo, T.; Parmar, A. N.; Fiore, F.; Matteuzzi, A.; F. Nicastro; Perola, G. C.; Piro, L.; Cappi, M.; Cusumano, G.; Frontera, F.; Giarrusso, S.; Palazzi, E.; Piraino, S.

    1997-01-01

    We report the results of a 3C273 observation performed during the Science Verification Phase (SVP) of the BeppoSax satellite. The broad-band spectrum is well represented by a power-law between 1 keV and 200 keV. The spectral slope is flat (\\Gamma ~1.6) with a weak emission line at ~ 6.4 keV (rest frame) of EW ~ 30 eV. Below 1 keV, a deviation from a power-law due to an absorption feature plus a soft component is present. This is the first time that a feature in absorption at ~ 0.5 keV (observ...

  5. RadioAstron Observations of the Quasar 3C273: A Challenge to the Brightness Temperature Limit

    Science.gov (United States)

    Kovalev, Y. Y.; Kardashev, N. S.; Kellermann, K. I.; Lobanov, A. P.; Johnson, M. D.; Gurvits, L. I.; Voitsik, P. A.; Zensus, J. A.; Anderson, J. M.; Bach, U.; Jauncey, D. L.; Ghigo, F.; Ghosh, T.; Kraus, A.; Kovalev, Yu. A.; Lisakov, M. M.; Petrov, L. Yu.; Romney, J. D.; Salter, C. J.; Sokolovsky, K. V.

    2016-03-01

    Inverse Compton cooling limits the brightness temperature of the radiating plasma to a maximum of 1011.5 K. Relativistic boosting can increase its observed value, but apparent brightness temperatures much in excess of 1013 K are inaccessible using ground-based very long baseline interferometry (VLBI) at any wavelength. We present observations of the quasar 3C 273, made with the space VLBI mission RadioAstron on baselines up to 171,000 km, which directly reveal the presence of angular structure as small as 26 μas (2.7 light months) and brightness temperature in excess of 1013 K. These measurements challenge our understanding of the non-thermal continuum emission in the vicinity of supermassive black holes and require a much higher Doppler factor than what is determined from jet apparent kinematics.

  6. VLBI observations of 3C273 at 22 GHz and 43 GHz ; 2, test of Synchrotron Self-Compton process

    CERN Document Server

    Mantovani, F; McHardy, I M; Valerio, C

    1999-01-01

    The VLBI observations at 22 GHz and 43 GHz of the quasar 3C273 obtained during a multi-frequency campaign in late 1992 in the radio, millimetre and X-ray bands allow us to derive the components' angular sizes, their peak fluxes and turnover frequencies. Lower limits to the Doppler factors have been derived by comparing the observed X-ray fluxes with those predicted by the Synchrotron Self-Compton model. Independent estimates of the Doppler factors were obtained through the assumption of the energy equipartition between the particles and the magnetic field. Of the five components used to model the first two milli-arcseconds of the jet, apart from the core, two components are in equipartition and the remaining two, at larger distances from the core, have large Doppler factors and are mainly responsible for the X-ray emission due to the Synchrotron Self-Compton process.

  7. RadioAstron Observations of the Quasar 3C273: a Challenge to the Brightness Temperature Limit

    CERN Document Server

    Kovalev, Y Y; Kellermann, K I; Lobanov, A P; Johnson, M D; Gurvits, L I; Voitsik, P A; Zensus, J A; Anderson, J M; Bach, U; Jauncey, D L; Ghigo, F; Ghosh, T; Kraus, A; Kovalev, Yu A; Lisakov, M M; Petrov, L Yu; Romney, J D; Salter, C J; Sokolovsky, K V

    2016-01-01

    Inverse Compton cooling limits the brightness temperature of the radiating plasma to a maximum of $10^{11.5}$ K. Relativistic boosting can increase its observed value, but apparent brightness temperatures much in excess of $10^{13}$ K are inaccessible using ground-based very long baseline interferometry (VLBI) at any wavelength. We present observations of the quasar 3C273, made with the space VLBI mission RadioAstron on baselines up to 171,000 km, which directly reveal the presence of angular structure as small as 26 $\\mu$as (2.7 light months) and brightness temperature in excess of $10^{13}$ K. These measurements challenge our understanding of the non-thermal continuum emission in the vicinity of supermassive black holes and require much higher jet speeds than are observed.

  8. FERMI-LARGE AREA TELESCOPE OBSERVATIONS OF THE EXCEPTIONAL GAMMA-RAY OUTBURSTS OF 3C 273 IN 2009 SEPTEMBER

    International Nuclear Information System (INIS)

    We present the light curves and spectral data of two exceptionally luminous gamma-ray outbursts observed by the Large Area Telescope experiment on board the Fermi Gamma-ray Space Telescope from 3C 273 in 2009 September. During these flares, having a duration of a few days, the source reached its highest γ-ray flux ever measured. This allowed us to study, in some details, their spectral and temporal structures. The rise and the decay are asymmetric on timescales of 6 hr, and the spectral index was significantly harder during the flares than during the preceding 11 months. We also found that short, very intense flares put out the same time-integrated energy as long, less intense flares like that observed in 2009 August.

  9. HIGH RESOLUTION X-RAY SPECTROSCOPY OF THE LOCAL HOT GAS ALONG THE 3C 273 SIGHTLINE

    Energy Technology Data Exchange (ETDEWEB)

    Fang, Taotao; Jiang, Xiaochuan, E-mail: fangt@xmu.edu.cn [Department of Astronomy and Institute for Theoretical Physics and Astrophysics, Xiamen University, 422 Siming South Road, Siming, Xiamen, Fujian (China)

    2014-04-20

    X-ray observations of highly ionized metal absorption lines at z = 0 provide critical information on the hot gas distribution in and around the Milky Way. We present a study of more than 10 yr of Chandra and XMM-Newton observations of 3C 273, one of the brightest extragalactic X-ray sources. Compared with previous works, we obtain much tighter constraints on the physical properties of the X-ray absorber. We also find a large, non-thermal velocity at ∼100-150 km s{sup –1}, the main reason for the higher line equivalent width when compared with other sightlines. Using joint analysis with X-ray emission and ultraviolet observations, we derive a size of 5-15 kpc and a temperature of (1.5-1.8) × 10{sup 6} K for the X-ray absorber. The 3C 273 sightline passes through a number of Galactic structures, including radio loops I and IV, the North Polar Spur, and the neighborhood of the newly discovered ''Fermi bubbles''. We argue that the X-ray absorber is unlikely to be associated with the nearby radio loops I and IV; however, the non-thermal velocity can be naturally explained as the result of the expansion of the ''Fermi bubbles''. Our data imply a shock-expansion velocity of 200-300 km s{sup –1}. Our study indicates a likely complex environment for the production of the Galactic X-ray absorbers along different sightlines, and highlights the significance of probing galactic feedback with high resolution X-ray spectroscopy.

  10. Multifrequency VLBI follow up study of strong γ-ray flares in the blazars 3C273 and 3C279

    Science.gov (United States)

    Lisakov, Mikhail M.; Kovalev, Yuri Y.

    2015-03-01

    We present multifrequency VLBI observations of the blazars 3C273 and 3C279 after detecting strong γ-ray flares in both of them. 3C273 exhibited a prominent flare in γ-rays in September 2009 which was followed by a strong flare in the 7 mm VLBI core and emergence of a new feature in the parsec scale jet. We have used time delay between flares in different wavebands together with kinematic analysis to determine that the γ-ray emission zone in 3C273 is located 3.6-5.3 pc upstream from the apparent 7 mm core. We have also analyzed frequency dependent core position to measure a deprojected distance between 7 mm core and the true base of the jet: 1-6 pc for 3C273 and 1-3 pc for 3C279, depending on observing epoch. For 3C279 light curve analysis did not give a robust γ-radio delay because there were too many overlapping flares in this source during considered period.

  11. DASCH detection of a ~17y QPO in the 100y light curve of 3C273

    Science.gov (United States)

    Grindlay, Jonathan E.; Miller, George Franklin; Siemiginowska, Aneta; Los, Edward; Kelly, Brandon C.; Tang, Sumin

    2014-06-01

    The Digital Access to a Sky Century @ Harvard (DASCH) project is digitizing the ~500,000 plates in the Harvard plate collection which are (primarily) direct images ranging from 4 x 5deg through 30 x 40deg and covering full sky from 1885 - 1992 (see dasch.rc.fas.harvard.edu). This results in ~1000 - 3000 images of any object. Astrometric positions for each resolved object are measured on each plate to 0.3 -3arcsec (depending on plate scale) and B band photometry is derived to +/-0.1mag using the APASS survey for spatially dependent photometric calibration and color corrections. Limiting magnitudes are typically B = 13 - 17. We report the 100y lightcurve 1100 points) of the bright quasar 3C273 and the analysis of its ~1mag variability on timescales ranging from days to decades. We have used generalized Lomb-Scargle techniques, which handle the inherently unevenly spaced data sampling and seasonal gaps, to investigate the preferred variability timescales and possible quasi-periodic oscillations (QPOs) present in this unique dataset. An advantage of the DASCH data and processing is the ready availability of a large comparison sample of nearby non-variable objects (foreground stars) of comparable magnitude which then directly measure the noise due to both photometric errors and (particularly) the uneven sampling. The generalized L-S periodogram shows significant excess (vs. field stars) power on several well defined timescales, the most prominent being at ~17.2y. The full power spectrum is derived using the CARMA model fitting technique described by Kelly et al, arXiv:1402.5978 and will be compared with a variety of models for the origin of the ~17y QPO as well as the significance of the several shorter timescale features. Models for the physical origin of the QPO features are discussed, including optical emission from precession of the jet in 3C273. Prospects for detection of similar longterm variability in other bright AGN with DASCH, when the full production scanning

  12. A simple formulation for thermodynamic properties of steam from 273 to 523 K, explicit in temperature and pressure

    Energy Technology Data Exchange (ETDEWEB)

    Patek, J.; Klomfar, J. [Institute of Thermomechanics, Academy of Sciences of the Czech Republic, Dolejskova 5, CZ 182 00 Prague 8 (Czech Republic)

    2009-08-15

    The present formulation completes the description of the thermodynamic properties of LiBr-H{sub 2}O system, the solution properties of which are provided by the previous study of the authors. The intent of the paper is to provide potential users with a simple and easily implementable tool for calculating thermodynamic properties of steam. A Gibss energy equation is presented which was developed as an approximation of the values of the pure water vapor properties computed from the internationally accepted IAPWS formulation 1995. Explicit equations for molar volume, isobaric heat capacity, enthalpy, and entropy are given. The maximum deviations from IAPWS-95 are {+-}0.03% for molar volume, {+-}0.8% for isobaric heat capacity, {+-}0.7 kJ kg{sup -1} (i.e. {+-}0.026%) for the enthalpy and less than {+-}0.015 kJ kg{sup -1} K{sup -1} (i.e. {+-}0.022%) for the entropy. The deviations lie within the declared maximum deviation bands at temperatures from 273 to 523 K and up to the pressure of saturation at each given temperature. (author)

  13. Non-LTE, Relativistic Accretion Disk Fits to 3C~273 and the Origin of the Lyman Limit Spectral Break

    CERN Document Server

    Blaes, Omer M; Agol, E; Krolik, J H; Blaes, Omer; Hubeny, Ivan; Agol, Eric; Krolik, Julian H.

    2001-01-01

    We fit general relativistic, geometrically thin accretion disk models with non-LTE atmospheres to near simultaneous multiwavelength data of 3C~273, extending from the optical to the far ultraviolet. Our model fits show no flux discontinuity associated with a hydrogen Lyman edge, but they do exhibit a spectral break which qualitatively resembles that seen in the data. This break arises from relativistic smearing of Lyman emission edges which are produced locally at tens of gravitational radii in the disk. We discuss the possible effects of metal line blanketing on the model spectra, as well as the substantial Comptonization required to explain the observed soft X-ray excess. Our best fit accretion disk model underpredicts the near ultraviolet emission in this source, and also has an optical spectrum which is too red. We discuss some of the remaining physical uncertainties, and suggest in particular that an extension of our models to the slim disk regime and/or including nonzero magnetic torques across the inne...

  14. Synchrotron radiation from the jet of 3C 273. 3: The speed and direction of the jet

    Science.gov (United States)

    Conway, R. G.; Davis, R. J.

    1994-04-01

    The jet of 3C 273 is interpreted as synchrotron plasma moving at a mildly relativistic speed up to a terminal shock, identified with the brightest radio component, H2, in the head. The Mach number of the flow can be deduced from the brightness contrast of the shocked gas compared with the upstream portions of the flow, after making due allowance for the effects of the Doppler beaming. This shows that the jet speed is approximately equals 0.8 c, while the speed of the shocked gas is approximately equals 0.4 c. By comparing the linear polarization of the jet (18%, with B parallel to the jet axis), and that of the shocked gas (23% with B transverse), it is shown that the direction of the jet must be 30 deg - 35 deg to the line of sight. The Doppler shift of the shocked gas in the head is less than or equal to 1.5, and is insufficient to hide a hypothetical counter-jet by a factor of about 2000. The direction of the jet differs by 20 deg - 30 deg from that deduced from the superluminal proper motion detected in the core, most probably because of a bend situated at a distance between 8 and 20 mas from the core. We suggest that the virtual absence of optical emission from H2 can be explained if there has been a recent disconnection event, as suggested by the 'Dentist's Drill' model of Cox, Gull & Scheuer.

  15. Structural Investigation of the Oligosaccharide Portion Isolated from the Lipooligosaccharide of the Permafrost Psychrophile Psychrobacter arcticus 273-4

    Directory of Open Access Journals (Sweden)

    Angela Casillo

    2015-07-01

    Full Text Available Psychrophilic microorganisms have successfully colonized all permanently cold environments from the deep sea to mountain and polar regions. The ability of an organism to survive and grow in cryoenviroments depends on a number of adaptive strategies aimed at maintaining vital cellular functions at subzero temperatures, which include the structural modifications of the membrane. To understand the role of the membrane in the adaptation, it is necessary to characterize the cell-wall components, such as the lipopolysaccharides, that represent the major constituent of the outer membrane. The aim of this study was to investigate the structure of the carbohydrate backbone of the lipooligosaccharide (LOS isolated from the cold-adapted Psychrobacter arcticus 273-4. The strain, isolated from a 20,000-to-30,000-year-old continuously frozen permafrost in Siberia, was cultivated at 4 °C. The LOS was isolated from dry cells and analyzed by means of chemical methods. In particular, it was degraded either by mild acid hydrolysis or by hydrazinolysis and investigated in detail by 1H and 13C NMR spectroscopy and by ESI FT-ICR mass spectrometry. The oligosaccharide was characterized by the substitution of the heptose residue, usually linked to Kdo in the inner core, with a glucose, and for the unusual presence of N-acetylmuramic acid.

  16. Structural Investigation of the Oligosaccharide Portion Isolated from the Lipooligosaccharide of the Permafrost Psychrophile Psychrobacter arcticus 273-4.

    Science.gov (United States)

    Casillo, Angela; Parrilli, Ermenegilda; Filomena, Sannino; Lindner, Buko; Lanzetta, Rosa; Parrilli, Michelangelo; Tutino, Maria Luisa; Corsaro, Maria Michela

    2015-07-01

    Psychrophilic microorganisms have successfully colonized all permanently cold environments from the deep sea to mountain and polar regions. The ability of an organism to survive and grow in cryoenviroments depends on a number of adaptive strategies aimed at maintaining vital cellular functions at subzero temperatures, which include the structural modifications of the membrane. To understand the role of the membrane in the adaptation, it is necessary to characterize the cell-wall components, such as the lipopolysaccharides, that represent the major constituent of the outer membrane. The aim of this study was to investigate the structure of the carbohydrate backbone of the lipooligosaccharide (LOS) isolated from the cold-adapted Psychrobacter arcticus 273-4. The strain, isolated from a 20,000-to-30,000-year-old continuously frozen permafrost in Siberia, was cultivated at 4 °C. The LOS was isolated from dry cells and analyzed by means of chemical methods. In particular, it was degraded either by mild acid hydrolysis or by hydrazinolysis and investigated in detail by (1)H and (13)C NMR spectroscopy and by ESI FT-ICR mass spectrometry. The oligosaccharide was characterized by the substitution of the heptose residue, usually linked to Kdo in the inner core, with a glucose, and for the unusual presence of N-acetylmuramic acid. PMID:26204948

  17. ORFEUS-II Far-Ultraviolet Observations of 3C273; 1, Interstellar and Intergalactic Absorption Lines

    CERN Document Server

    Hurwitz, M; Barnstedt, J; Bowyer, S; Van Dixon, W D; Grewing, M; Kappelmann, N; Krämer, G; Krautter, J; Mandel, H; Hurwitz, Mark; Appenzeller, Immo; Barnstedt, Juergen; Bowyer, Stuart; Grewing, Michael; Kappelmann, Norbert; Kraemer, Gerhard; Krautter, Joachim; Mandel, Holger

    1998-01-01

    We present the first intermediate-resolution (lambda / 3000) spectrum of the bright quasi-stellar object 3C273 at wavelengths between 900 and 1200 A. Observations were performed with the Berkeley spectrograph aboard the ORFEUS-SPAS II mission. We detect Lyman beta counterparts to previously-identified intergalactic Lyman-alpha features at cz = 19900, 1600, and 1000 km/s; counterparts to other putative Lyman-alpha clouds along the sight line are below our detection limit. The strengths of the two very low redshift Lyman-beta features, which are believed to arise in Virgo intracluster gas, exceed preflight expectations, suggesting that the previous determination of the cloud parameters may underestimate the true column densities. A curve-of-growth analysis sets a minimum H I column density of 4 E14/cm^2 for the 1600 km/s cloud. We find marginally significant evidence for Galactic H_2 along the sight line, with a total column density of about 1 E15/cm^2. We detect the stronger interstellar O VI doublet member un...

  18. The role of Kelvin-Helmholtz instability in the internal structure of relativistic outflows : the case of the jet in 3C 273

    OpenAIRE

    Perucho Pla, Manuel; Lobanov, A. P.; Marti Puig, Jose Maria; Hardee, P. E.

    2006-01-01

    Context. Relativistic outflows represent one of the best-suited tools to probe the physics of AGN. Numerical modelling of internal structure of the relativistic outflows on parsec scales provides important clues about the conditions and dynamics of the material in the immediate vicinity of the central black holes in AGN. Aims. We investigate possible causes of the structural patterns and regularities observed in the parsec-scale jet of the well-known quasar 3C 273. Methods. We present here th...

  19. SPECIAL LOCAL TAXES. THEORETICAL AND PRACTICAL ISSUES REGARDING LATE LODGING OF PRELIMINARY COMPLAINTS IN ADMINISTRATIVE COURTS UNDER ARTICLE 30 OF LAW 273/2006 ON LOCAL PUBLIC FINANCES

    Directory of Open Access Journals (Sweden)

    Andrei Costin GRIMBERG

    2015-06-01

    Full Text Available The procedure to challenge decisions imposing the local taxes is a special procedure.Article 30 of Law no.273/2006 has provided a special procedure for the challenging of special taxes, by derogation from the Law no. 554/2004. Thus, interested persons may challenge the special taxes within 15 days of the posting or publication thereof; in this case, however, the claimant has failed by far to meet this deadline, virtually skipping the appeal stage and going straight and only through the procedure stipulated by Law no.554/2004.Any contrary approach would amount to a case of disregarding of the legal reasoning introduced by the special law no. 273/2006 under which appeals against special charges should be lodged with the decision-making bodies within 15 days after their passing.In the case that the applicant skips this stage, his action in court will be deemed, for the purpose of the provisions of article 30 of Law no.273/2006, as a belated application. It was thus found that Article 30 paragraph 6 of the Law no. 273/2006 and article 194 of the Rules for implementation of the Law no. 571/2003 contain rules that are exemptions from the provisions of Law no. 554/200, in terms of the deadline for challenging decisions passed by local governments, establishing special charges.It is therefore normal in fiscal matters that a special and derogatory term for appeal be established, which is shorter and accrues as of the moment in time when the term has been objectively determined, and which applies equally to all applicants, with the need for establishing such a term being called for by the need to avoid levying special taxes for a long period of time and from a significant number of target taxpayers, as well as the subsequent cancellation at some point in time of the administrative act by which such taxes were imposed.

  20. A Pumilio-induced RNA structure switch in p27-3' UTR controls miR-221 and miR-222 accessibility.

    Science.gov (United States)

    Kedde, Martijn; van Kouwenhove, Marieke; Zwart, Wilbert; Oude Vrielink, Joachim A F; Elkon, Ran; Agami, Reuven

    2010-10-01

    Key regulators of 3' untranslated regions (3' UTRs) are microRNAs and RNA-binding proteins (RBPs). The p27 tumour suppressor is highly expressed in quiescent cells, and its downregulation is required for cell cycle entry after growth factor stimulation. Intriguingly, p27 accumulates in quiescent cells despite high levels of its inhibitors miR-221 and miR-222 (Refs 5, 6). Here we show that miR-221 and miR-222 are underactive towards p27-3' UTR in quiescent cells, as a result of target site hindrance. Pumilio-1 (PUM1) is a ubiquitously expressed RBP that was shown to interact with p27-3' UTR. In response to growth factor stimulation, PUM1 is upregulated and phosphorylated for optimal induction of its RNA-binding activity towards the p27-3' UTR. PUM1 binding induces a local change in RNA structure that favours association with miR-221 and miR-222, efficient suppression of p27 expression, and rapid entry to the cell cycle. We have therefore uncovered a novel RBP-induced structural switch modulating microRNA-mediated gene expression regulation. PMID:20818387

  1. Simultaneous X-ray and infrared variability in the quasar 3C273 II: Confirmation of the correlation and X-ray lag

    CERN Document Server

    McHardy, I; Newsam, A; Marscher, A; Sokolov, A; Urry, M; Wehrle, A; Hardy, Ian Mc; Lawson, Anthony; Newsam, Andrew; Marscher, Alan; Sokolov, Andrei; Urry, Megan; Wehrle, Ann

    2006-01-01

    The X-ray emission from quasars such as 3C273 is generally agreed to arise from Compton scattering of low energy seed photons by relativistic electrons in a relativistic jet oriented close to the line of sight. However there are a number of possible models for the origin of the seed photons. In Paper I (McHardy et al 1999) we showed that the X-ray and IR variability from 3C273 was highly correlated in 1997, with the IR flux leading the X-rays by ~0.75 +/- 0.25 days. The strong correlation, and lag, supports the Synchrotron Self-Compton (SSC) model, where the seed photons are synchroton photons from the jet itself. The previous correlation was based on one moderately well sampled flare and another poorly sampled flare, so the possibility of chance correlated variability exists. Here we report on further X-ray and IR observations of 3C273 which confirm the behaviour seen in Paper I. During a 2 week period of observations we see a flare of amplitude ~25%, lasting for ~5 days, showing a high correlation between I...

  2. Solubilities of Nizatidine in Methanol + Water, Ethanol + Water and i-Propanol + Water from 273.15 to 303.15 K%Solubilities of Nizatidine in Methanol + Water, Ethanol + Water and i-Propanol + Water from 273.15 to 303.15 K

    Institute of Scientific and Technical Information of China (English)

    李音; 吕秀阳

    2012-01-01

    The solubilities of nizatidine in methanol + water, ethanol + water and i-propanol + water mixtures were determined in the temperature range from 273.15 K to 303.15 K at atmospheric pressure by a static analytical method. The general single model was used to correlate the experimental data, which fits the data very well.

  3. Recurrent Microdeletions at Xq27.3-Xq28 and Male Infertility: A Study in the Czech Population.

    Directory of Open Access Journals (Sweden)

    Blanka Chylíková

    Full Text Available Genetic causes of male infertility are hypothesized to involve multiple types of mutations, from single gene defects to complex chromosome rearrangements. Recently, several recurrent X-chromosome microdeletions (located in subtelomeric region of the long arm were reported to be associated with male infertility in Spanish and Italian males. The aim of our study was to test their prevalence and infertility association in population of men from the Czech Republic.107 males with pathological sperm evaluation resulting in nonobstructive infertility were compared to 131 males with normal fecundity. X-chromosome microdeletions were assessed by +/- PCR with three primer pairs for each region Xcnv64 (Xq27.3, Xcnv67 (Xq28 and Xcnv69 (Xq28. The latter microdeletion was further characterized by amplification across the deleted region, dividing the deletion into three types; A, B and C.We detected presence of isolated Xcnv64 deletion in 3 patients and 14 controls, and Xcnv69 in 3 patients and 6 controls (1 and 1 patient vs.4 and 1 control for types A and B respectively. There was one control with combined Xcnv64 and Xcnv69 type B deletions, and one patient with combination of Xcnv64 and Xcnv69 type C deletions. The frequency of the deletions was thus not higher in patient compared to control group, Xcnv64 was marginally associated with controls (adjusted Fisher´s exact test P = 0.043, Xcnv69 was not associated (P = 0.452. We excluded presence of more extensive rearrangements in two subjects with combined Xcnv64 and Xcnv69 deletions. There was no Xcnv67 deletion in our cohort.In conclusion, the two previously reported X-linked microdeletions (Xcnv64 and Xcnv69 do not seem to confer a significant risk to impaired spermatogenesis in the Czech population. The potential clinical role of the previously reported patient-specific Xcnv67 remains to be determined in a larger study population.

  4. Modification of the gamma-ray spectra by internal absorption in OVV blazars: The example cases of 3C 273 and 3C 279

    OpenAIRE

    Sitarek, J.; Bednarek, W.

    2008-01-01

    Recent observations with the low threshold Cherenkov telescopes proved that sub-TeV gamma-rays are able to arrive from active galaxies at relatively large distances in spite of expected severe absorption in the extragalactic background light (EBL). We calculate the gamma-ray spectra at TeV energies from two example OVV quasars, 3C 273 and 3C 279, assuming that gamma-rays are injected in the inner parts of the jets launched by the accretion disks. It is assumed that gamma-rays in the broad ene...

  5. Fungibility (inter-changeability between urgency protective measures: provisional and anticipated (reflection on paragraph 7th of article number 273 of the code of civil procedures Fungibilidade entre as tutelas de urgência: cautelar e antecipada (reflexão sobre o parágrafo 7º, do artigo 273, do código de processo civil

    Directory of Open Access Journals (Sweden)

    Raquel Carolina Palegari Saraiva

    2008-01-01

    Full Text Available This article studies the urgency protective measures, provisional protective measure in article 798 and following articles; and the anticipated protective measure in article 273, I, all from the Code of Civil Procedures; both protective measures have the preventive purpose of removing the risk of damage. Such preventive measures have their own characteristics. The detailed study of such protective measures enables a better characterization of their identity, as well as the identification of their differences. It was observed that there is certain confusion in their application in specific cases. So Fungibility was created in article number 273, paragraph number 7, in order to assist legal staff concerning urgency protective measures, for an appropriate application in the civil procedural system.O artigo estuda as tutelas de urgência, tutela cautelar dos arts. 798 e seguintes e a tutela antecipada do art. 273, I, todos do Código de Processo Civil, ambas com finalidade preventiva para afastar a iminência de risco de dano. As tutelas em apreço têm características próprias. O estudo das mesmas permite fixar melhor a identidade dos institutos, bem como as características que as distanciam. Verifica-se certo embaraço quanto à sua aplicação diante do caso concreto. Assim, surge a fungibilidade no art. 273, §7º para o auxílio dos operadores do Direito quanto às tutelas urgentes, para sua aplicação no sistema processual civil.

  6. The role of Kelvin-Helmholtz instability in the internal structure of relativistic outflows. The case of the jet in 3C 273

    CERN Document Server

    Perucho, M; Martí, J M; Hardee, P E

    2006-01-01

    Relativistic outflows represent one of the best-suited tools to probe the physics of AGN. Numerical modelling of internal structure of the relativistic outflows on parsec scales provides important clues about the conditions and dynamics of the material in the immediate vicinity of the central black holes in AGN. We investigate possible causes of the structural patterns and regularities observed in the parsec-scale jet of the well-known quasar 3C 273. We present here the results from a 3D relativistic hydrodynamics numerical simulation based on the parameters given for the jet by Lobanov & Zensus (2001), and one in which the effects of jet precession and the injection of discrete components have been taken into account. We compare the model with the structures observed in 3C 273 using very long baseline interferometry and constrain the basic properties of the flow. We find growing perturbation modes in the simulation with similar wavelengths to those observed, but with a different set of wave speeds and mo...

  7. VLBI observations of 3C273 at 22 GHz and 43 GHz; 1, Search for short time-scale structural variation

    CERN Document Server

    Mantovani, F; Valerio, C; McHardy, I

    1999-01-01

    The results of VLBI observations of the quasar 3C273, obtained during a multi-frequency campaign in late 1992 in the radio, millimeter and X-ray bands are presented and discussed. The VLBI observations were made at 22 GHz with a Global Array and at 43 GHz with the Very Long Baseline Array. Hybrid maps and modelfits were made in order to look for any short time scale structural variations of the inner part of the radio jet. In 42 days 3C273 was observed 5 times at roughly 10 day intervals. The jet structure did not show dramatic changes in that period. However, we were able to follow the changes in the positions of the components along the first 2 mas of the jet with respect to the core. The resolution achieved by these observations allows the decomposition of the apparent velocity vector of each component into two orthogonal directions. We find evidence of reverse motion for a component along the jet. The jet starts wiggling well inside the first parsec from the core. The spatial period of the quasi-sinusoida...

  8. Experimental and Theoretical Study of the Effect of Moisture on Methane Adsorption and Desorption by Activated Carbon at 273.5 K

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Adsorption and desorption of methane by activated carbon (AC) at constant temperature and at various pressures were investigated. The effect of moisture was also studied. A volumetric method was used, up to 40 bar, at a temperature of 273.5 K. Results of a dry AC sample were compared with those obtained from a moist sample and two different ACs with different physical and surface properties were used. As expected, the results showed that the existence of moisture, trapped in the AC pores, could lead to a decrease in the amount of methane adsorbed and a decrease in the amount of methane delivered during desorption. To model the experimental results, a large variety of adsorption isotherms were used. The regressed parameters for the adsorption isotherms were obtained using the experimental data generated in the present study. The accuracy of the results obtained from the different adsorption isotherms was favorably compared.

  9. Lithostratigraphy of Shell 272-1 and 273-1 Wells: implications as to depositional history of the Baltimore Canyon Trough, Mid- Atlantic OCS.

    Science.gov (United States)

    Libby-French, J.

    1981-01-01

    The Shell 272-1 and 273-1 wells, located c106km SE of Atlantic City, in the NW part of the Baltimore Canyon Trough penetrate strata from Cenozoic down to Upper Jurassic, and the lithology of each is described. 7 major lithologic units were established and correlated to the COST B-2 and B-3 wells. The depositional environments of the Upper Jurassic rocks range from an upper delta plain facies to a back-reef facies. The Lower Cretaceous strata, in a vertical sequence, consist of upper delta plain, lower delta plain, marginal marine, and distributary-mouth-bar deposits. A Cenomanian sandstone is the youngest indicator of deltaic deposition; marine strata dominate the remainder of the Upper Cretaceous and Cenozoic.-from Authors

  10. Derivation of upward muon energy spectra in the TeV range produced by neutrinos from 3C273 AGN and diffuse atmospheric sources

    International Nuclear Information System (INIS)

    The neutrino-induced upward muon energy spectrum on Earth at the TeV energy range emitted by the point source 3C273 AGN has been calculated using the AGN-emitted neutrino spectrum of Szabo and Protheroe and the result has been compared with that expected from background neutrinos. The QCD-based model of Berezinsky et al. has been fairly employed to estimate the muon contribution due to the charge current interactions in rock. The diffuse neutrino-induced upward muon energy spectrum from AGN sources has also been estimated and compared with the expected results from the spectra of prompt neutrinos and atmospheric backgrounds. It is found that the upward muon fluxes generated by AGN neutrinos are dominating the Universe beyond 10 TeV muon energy

  11. Derivation of upward muon energy spectra in the TeV range produced by neutrinos from 3C273 AGN and diffuse atmospheric sources

    Energy Technology Data Exchange (ETDEWEB)

    Bhattacharyya, D.P. [Indian Association for the Cultivation of Science, Calcutta (India). Dept. of Theoretical Physics

    1998-01-01

    The neutrino-induced upward muon energy spectrum on Earth at the TeV energy range emitted by the point source 3C273 AGN has been calculated using the AGN-emitted neutrino spectrum of Szabo and Protheroe and the result has been compared with that expected from background neutrinos. The QCD-based model of Berezinsky et al. has been fairly employed to estimate the muon contribution due to the charge current interactions in rock. The diffuse neutrino-induced upward muon energy spectrum from AGN sources has also been estimated and compared with the expected results from the spectra of prompt neutrinos and atmospheric backgrounds. It is found that the upward muon fluxes generated by AGN neutrinos are dominating the Universe beyond 10 TeV muon energy.

  12. The role of Kelvin-Helmholtz instability in the internal structure of relativistic outflows. The case of the jet in 3C 273

    Science.gov (United States)

    Perucho, M.; Lobanov, A. P.; Martí, J.-M.; Hardee, P. E.

    2006-09-01

    Context: .Relativistic outflows represent one of the best-suited tools to probe the physics of AGN. Numerical modelling of internal structure of the relativistic outflows on parsec scales provides important clues about the conditions and dynamics of the material in the immediate vicinity of the central black holes in AGN. Aims: .We investigate possible causes of the structural patterns and regularities observed in the parsec-scale jet of the well-known quasar 3C 273. Methods: .We present here the results from a 3D relativistic hydrodynamics numerical simulation based on the parameters given for the jet by Lobanov & Zensus (2001, Science, 294, 128), and one in which the effects of jet precession and the injection of discrete components have been taken into account. We compare the model with the structures observed in 3C 273 using very long baseline interferometry and constrain the basic properties of the flow. Results: .We find growing perturbation modes in the simulation with similar wavelengths to those observed, but with a different set of wave speeds and mode identification. If the observed longest helical structure is produced by the precession of the flow, longer precession periods should be expected. Conclusions: .Our results show that some of the observed structures could be explained by growing Kelvin-Helmholtz instabilities in a slow moving region of the jet. However, we point towards possible errors in the mode identification that show the need of more complete linear analysis in order to interpret the observations. We conclude that, with the given viewing angle, superluminal components and jet precession cannot explain the observed structures.

  13. Mitochondrial protection by the mixed muscarinic/σ1 ligand ANAVEX2-73, a tetrahydrofuran derivative, in Aβ25-35 peptide-injected mice, a nontransgenic Alzheimer's disease model.

    Science.gov (United States)

    Lahmy, Valentine; Long, Romain; Morin, Didier; Villard, Vanessa; Maurice, Tangui

    2014-01-01

    Alzheimer's disease (AD), the most prevalent dementia in the elderly, is characterized by progressive synaptic and neuronal loss. Mitochondrial dysfunctions have been consistently reported as an early event in AD and appear before Aβ deposition and memory decline. In order to define a new neuroprotectant strategy in AD targeting mitochondrial alterations, we develop tetrahydro-N,N-dimethyl-2,2-diphenyl-3-furanmethanamine (ANAVEX2-73, AE37), a mixed muscarinic receptor ligand and a sigma-1 receptor (σ1R) agonist. We previously reported that ANAVEX2-73 shows anti-amnesic and neuroprotective activities in mice injected intracerebroventricular (ICV) with oligomeric amyloid-β25-35 peptide (Aβ25-35). The σ1R is present at mitochondria-associated endoplasmic reticulum (ER) membranes, where it acts as a sensor/modulator of ER stress responses and local Ca(2+) exchanges with the mitochondria. We therefore evaluated the effect of ANAVEX2-73 and PRE-084, a reference σ1R agonist, on preservation of mitochondrial integrity in Aβ25-35-injected mice. In isolated mitochondria from hippocampus preparations of Aβ25-35 injected animals, we measured respiration rates, complex activities, lipid peroxidation, Bax/Bcl-2 ratios and cytochrome c release into the cytosol. Five days after Aβ25-35 injection, mitochondrial respiration in mouse hippocampus was altered. ANAVEX2-73 (0.01-1 mg/kg IP) restored normal respiration and PRE-084 (0.5-1 mg/kg IP) increased respiration rates. Both compounds prevented Aβ25-35-induced increases in lipid peroxidation levels, Bax/Bcl-2 ratio and cytochrome c release into the cytosol, all indicators of increased toxicity. ANAVEX2-73 and PRE-084 efficiently prevented the mitochondrial respiratory dysfunction and resulting oxidative stress and apoptosis. The σ1R, targeted selectively or non-selectively, therefore appears as a valuable target for protection against mitochondrial damages in AD. PMID:25653589

  14. Analysis of Article 27(3 (b of TRIPs-the Content and Implications of the IP Protection on Plant Varieties

    Directory of Open Access Journals (Sweden)

    Pratyush Jhunjhunwala

    2009-01-01

    Full Text Available Problem statement: Introduction of Intellectual Property Protection (IPP to plant varieties has gone through some rough weather with objections being made not only with respect to their introduction but also with the type of protection to be accorded to the new varieties. Article 27(3(b of the TRIPs Agreement contains a lot of flexibilities as it allows WTO member states to choose the form of intellectual property protection and also the strength of IP protection. However, one of the primary effects of the provision is that it has forced a good number of the nations across the world to accord IPP to plant varieties where there existed none. The primary rationale given for the introduction of IPP in biotechnology is that it shall incentivise research in biotechnology which in turn shall help nations in building its food security. Conclusion: The study seeks to show that though the rationale has stood true to a good extent (as a lot of new plant varieties have been created by plant breeders in the past few decades that carry special traits resulting in an increase in the agricultural output and the quality of the produce. However, the research in plant varieties is often restricted to only a few crops that are commercially the most viable, hence, showing no change in the pattern of investment in the plant varieties even after the introduction of IPP. Moreover, after the introduction of Article 27(3 (b (according of IPP to plant varieties and limiting the scope of imitation there has seen large scale concentration and restructuring of the seeds industry all across the world. Further, the gradual substitution of traditional varieties by the modified plant varieties has also surfaced a whole host of other economic and environmental problems. These problems and holes in the incentive rationale thus justifies the counter measures taken by many nations such as farmer’s rights, origin disclosure requirements, incentivizing the use of traditional

  15. Production of the High Energy-Momentum Spectra of Quasars 3C 279 and 3C 273 Using the Penrose Mechanism

    Science.gov (United States)

    Williams, R. K.

    2000-05-01

    Monte Carlo computer model simulations show that Penrose Compton scattering (PCS) near the event horizon and Penrose pair production (PPP) at or near the photon orbit, in the ergosphere of a supermassive (M=108 Msun) rotating black hole, can generate the necessary energy-momentum spectra to explain the origin of the mysterious fluxes of ultrarelativistic electrons, inferred from observations to emerge from the cores of Quasars 3C 279 and 3C 273, and other active galactic nuclei (AGNs). Particles from an accretion disk surrounding the black hole fall into the ergosphere and scatter off particles that are in trapped or bound unstable orbits. The Penrose mechanism allows rotational energy of a Kerr black hole, and energy-momentum produced by its strong gravitational field, to be extracted by scattered particles escaping from the ergosphere to infinity (i.e., large distances from the black hole). The results of these model calculations show that the Penrose mechanism is capable of producing the observed high energy particles ( ~ GeV) emitted by quasars and other AGNs. This mechanism can extract hard X-ray/⪆ -ray photons from PCS of initially infalling low energy UV/soft X-ray photons by target orbiting electrons in the ergosphere. The PPP (⪆ ⪆ --> e-e^+) allows the escape of relativistic e- e+ pairs---produced by infalling low energy photons interacting with highly blueshifted target photons at the photon orbit. These e- e+ pairs emerge with maximum Lorentz factor ~ 104, which are consistent with relativistic beaming models used to explain the high energy spectra of so-called blazars, such as 3C 279 and 3C 273. Moreover, and importantly, the emission of scattered particles by this mechanism naturally produces relativistic jets collimated about the polar axis, and in most cases one-sided or asymmetrical, agreeing with observations of AGNs. In these fully relativistic calculations, the energy-momentum four vectors (or four-momenta) of the scattered particles are

  16. Very high-resolution observations of the radio sources NRAO 150, OJ 287, 3C 273, M87, 1633+38, BL Lacertae, and 3C 454. 3

    Energy Technology Data Exchange (ETDEWEB)

    Kellermann, K.I. (National Radio Astronomy Observatory, Green Bank, WV); Shaffer, D.B.; Purcell, G.H.

    1977-02-01

    Very long baseline interferometer observations made at a wavelength of 2 and 2.8 cm with baselines ranging from 54 to 291 million wavelengths show a number of radio sources with only slightly resolved components, even on the longest baselines; the quasars 1633 + 38 and 3C 454.3, the objects OJ 287 and BL Lac, and the nucleus of M87 (Virgo A, 3C 274) all contain components < or approximately 0.4 milli-arcsec. The smallest component observed is in the core of 3C 454.3, which contains about 50% of the total flux density and is < or approximately 0.2 milli-arcsec in diameter. The compact component in the nucleus of M87 is < or approximately 1.5 light-months across, and contains about one-third of the total flux density of the nucleus at 2.8 cm. NRAO 150 and BL Lac are double: the components of NRAO 150 are separated by 0.6 milli-arcsec, while BL Lac has an elongated structure consisting of a large (1.4 milli-arcsec) component separated by 1.25 milli-arcsec from a smaller (0.5 milli-arcsec) variable one. The present data on 3C 273 are consistent with triple models similar to those discussed previously, but with a somewhat greater apparent separation of components.

  17. Solubility measurement and modelling of 1,8-dinitronaphthalene in nine organic solvents from T = (273.15 to 308.15) K and mixing properties of solutions

    International Nuclear Information System (INIS)

    Highlights: • Solubility of 1,8-dinitronaphthalene in nine organic solvents were determined. • The solubility were correlated with Apelblat equation, Wilson and NRTL model. • The mixing properties of solution were calculated based on the Wilson model. - Abstract: The solubility of 1,8-dinitronaphthalene in acetonitrile, methanol, ethanol, trichloromethane, isopropanol, acetone, toluene, ethyl acetate and butyl alcohol were obtained experimentally at temperatures ranging from (273.15 to 308.15) K under 0.1 MPa by using a gravimetric method. The solubility of 1,8-dinitronaphthalene in those solvents increases with an increase in temperature. The solubility values decrease according to the following order: acetone > (acetonitrile, ethyl acetate) > trichloromethane > toluene > methanol > ethanol > isopropanol > butyl alcohol. Three models, the modified Apelblat equation, Wilson and NRTL were used to correlate the solubility of 1,8-dinitronaphthalene in the solvents studied. The calculated solubility by the modified Apelblat equation provides better agreement than those evaluated by the other two models. The regressed results via the three models are all acceptable for the solubility of 1,8-dinitronaphthalene in the selected solvents. Furthermore, the mixing Gibbs energy, mixing enthalpy, and mixing entropy for per 1 mol of mixture of 1,8-dinitronaphthalene and solvents were calculated based on the Wilson model. The dissolution process of 1,8-dinitronaphthalene in the selected solvents is spontaneous and exothermic

  18. New Chandra observations of the jet in 3C273. 1. Softer X-ray than radio spectra and the X-ray emission mechanism

    International Nuclear Information System (INIS)

    The jet in 3C273 is a high-power quasar jet with radio, optical and X-ray emission whose size and brightness allow a detailed study of the emission processes acting in it. We present deep Chandra observations of this jet and analyze the spectral properties of the jet emission from radio through X-rays. We find that the X-ray spectra are significantly softer than the radio spectra in all regions of the bright part of the jet except for the first bright ''knot A'', ruling out a model in which the X-ray emission from the entire jet arises from beamed inverse-Compton scattering of cosmic microwave background photons in a single-zone jet flow. Within two-zone jet models, we find that a synchrotron origin for the jet's X-rays requires fewer additional assumptions than an inverse-Compton model, especially if velocity shear leads to efficient particle acceleration in jet flows

  19. Hubble Space Telescope far-ultraviolet imaging of the jet in 3C273: a common emission component from optical to X-rays

    CERN Document Server

    Jester, Sebastian; Martel, Andre'; Perlman, Eric; Sparks, Bill

    2007-01-01

    We present far-ultraviolet (UV) observations at 150 nm of the jet of the quasar 3C 273 obtained with the Advanced Camera for Survey's Solar Blind Channel (ACS/SBC) on board the Hubble Space Telescope. While the jet morphology is very similar to that in the optical and near-ultraviolet, the spectral energy distributions (SEDs) of the jet's sub-regions show an upturn in nu f_nu at 150 nm compared to 300 nm everywhere in the jet. Moreover, the 150 nm flux is compatible with extrapolating the X-ray power-law down to the ultra-violet region. This constitutes strong support for a common origin of the jet's far-UV and X-ray emission. It implies that even a substantial fraction of the *visible light* in the X-ray brightest parts of the jet arises from the same spectral component as the X-rays, as had been suggested earlier based on Spitzer Space Telescope observations. We argue that the identification of this UV/X-ray component opens up the possibility to establish the synchrotron origin of the X-ray emission by opti...

  20. New Chandra observations of the jet in 3C273. 1. Softer X-ray than radio spectra and the X-ray emission mechanism

    Energy Technology Data Exchange (ETDEWEB)

    Jester, Sebastian; /Fermilab; Harris, D.E.; /Smithsonian Astrophys. Observ.; Marshall, H.L.; /MIT, MKI; Meisenheimer, K.; /Heidelberg, Max Planck Inst. Astron.

    2006-05-01

    The jet in 3C273 is a high-power quasar jet with radio, optical and X-ray emission whose size and brightness allow a detailed study of the emission processes acting in it. We present deep Chandra observations of this jet and analyze the spectral properties of the jet emission from radio through X-rays. We find that the X-ray spectra are significantly softer than the radio spectra in all regions of the bright part of the jet except for the first bright ''knot A'', ruling out a model in which the X-ray emission from the entire jet arises from beamed inverse-Compton scattering of cosmic microwave background photons in a single-zone jet flow. Within two-zone jet models, we find that a synchrotron origin for the jet's X-rays requires fewer additional assumptions than an inverse-Compton model, especially if velocity shear leads to efficient particle acceleration in jet flows.

  1. Variability of fluxes extragalactic radio sources 3С120, 3С273, BL Lac, OJ 287 , its "spectrums periods" and VLBI data on the centimeters waves

    Science.gov (United States)

    Donskykh, Ann; Ryabov, Mikhail; Sukharev, Artem

    We analyzed long and short term monitoring of data fluxes of extragalactic sources 3C120, 3C273, BL Lac, OJ 287 obtained at frequencies of 14.5 GHz (1974-2011), 8 GHz (1971-2011), 4.8GHz and (1979-2010), on the RT-26, University of Michigan, USA. Variability of the flux of the radio source was investigated by applying wavelet analysis. There were identified long-period and short components at all studied frequencies and it was determined the time of their existence. The "spectra periods" for each year of observation were built to assess the contribution of individual periods in the formation of the most powerful phase of activity of the radio sources. The dynamics of the manifestations of active periods at different frequencies was observed. The obtained data was compared with the results of MOJAVE VLBI monitoring for the period of 1995-2012 years at a frequency of 15.4 GHz. It allowed to investigate the structure of emissions during periods of manifestation activity maxima.

  2. New Chandra observations of the jet in 3C273. I. Softer X-ray than radio spectra and the X-ray emission mechanism

    CERN Document Server

    Jester, S; Marshall, H L; Meisenheimer, K

    2006-01-01

    The jet in 3C273 is a high-power quasar jet with radio, optical and X-ray emission whose size and brightness allow a detailed study of the emission processes acting in it. We present deep Chandra observations of this jet and analyse the spectral properties of the jet emission from radio through X-rays. We find that the X-ray spectra are significantly softer than the radio spectra in all regions of the bright part of the jet except for the first bright "knot A", ruling out a model in which the X-ray emission from the entire jet arises from beamed inverse-Compton scattering of cosmic microwave background photons in a single-zone jet flow. Within two-zone jet models, we find that a synchrotron origin for the jet's X-rays requires fewer additional assumptions than an inverse-Compton model, especially if velocity shear leads to efficient particle acceleration in jet flows.

  3. Thermodynamic properties and equation of state of liquid di-isodecyl phthalate at temperature between (273 and 423) K and at pressures up to 140 MPa

    International Nuclear Information System (INIS)

    We report measurements of the thermodynamic properties of liquid di-isodecyl phthalate (DIDP) and an equation of state determined therefrom. The speed of sound in DIDP was measured at temperatures between (293.15 and 413.15) K and a pressures between (0.1 and 140) MPa with a relative uncertainty of 0.1%. In addition, the isobaric specific heat capacity was measured at temperatures between (293.15 and 423.15) K at a pressure of 0.1 MPa with a relative uncertainty of 1%, and the density was measured at temperatures between (273.15 and 413.15) K at a pressure of 0.1 MPa with a relative uncertainty of 0.015%. The thermodynamic properties of DIDP were obtained from the measured speeds of sound by thermodynamic integration starting from the initial values of density and isobaric specific heat capacity obtained experimentally. The results have been represented by a new equation of state containing nine parameters with an uncertainty in density not worse than 0.025%. Comparisons with literature data are made.

  4. Thermodynamic properties and equation of state of liquid di-isodecyl phthalate at temperature between (273 and 423) K and at pressures up to 140 MPa

    Energy Technology Data Exchange (ETDEWEB)

    Peleties, F. [Department of Chemical Engineering, Imperial College London, South Kensington Campus, London SW7 2AZ (United Kingdom); Segovia, J.J. [Grupo de Termodinamica y Calibracion (TERMOCAL), Dpto. Ingenieria Energetica y Fluidomecanica, E.T.S. de Ingenieros Industriales, Universidad de Valladolid, E-47011 Valladolid (Spain); Trusler, J.P.M., E-mail: m.trusler@imperial.ac.u [Department of Chemical Engineering, Imperial College London, South Kensington Campus, London SW7 2AZ (United Kingdom); Vega-Maza, D. [Grupo de Termodinamica y Calibracion (TERMOCAL), Dpto. Ingenieria Energetica y Fluidomecanica, E.T.S. de Ingenieros Industriales, Universidad de Valladolid, E-47011 Valladolid (Spain)

    2010-05-15

    We report measurements of the thermodynamic properties of liquid di-isodecyl phthalate (DIDP) and an equation of state determined therefrom. The speed of sound in DIDP was measured at temperatures between (293.15 and 413.15) K and a pressures between (0.1 and 140) MPa with a relative uncertainty of 0.1%. In addition, the isobaric specific heat capacity was measured at temperatures between (293.15 and 423.15) K at a pressure of 0.1 MPa with a relative uncertainty of 1%, and the density was measured at temperatures between (273.15 and 413.15) K at a pressure of 0.1 MPa with a relative uncertainty of 0.015%. The thermodynamic properties of DIDP were obtained from the measured speeds of sound by thermodynamic integration starting from the initial values of density and isobaric specific heat capacity obtained experimentally. The results have been represented by a new equation of state containing nine parameters with an uncertainty in density not worse than 0.025%. Comparisons with literature data are made.

  5. The Camelina aquaporin CsPIP2;1 is regulated by phosphorylation at Ser273, but not at Ser277, of the C-terminus and is involved in salt- and drought-stress responses.

    Science.gov (United States)

    Jang, Ha-Young; Rhee, Jiye; Carlson, John E; Ahn, Sung-Ju

    2014-09-15

    Aquaporin (AQP) proteins are involved in water homeostasis in cells at all taxonomic levels of life. Phosphorylation of some AQPs has been proposed to regulate water permeability via gating of the channel itself. We analyzed plasma membrane intrinsic proteins (PIP) from Camelina and characterized their biological functions under both stressful and favorable conditions. A three-dimensional theoretical model of the Camelina AQP proteins was built by homology modeling which could prove useful in further functional characterization of AQPs. CsPIP2;1 was strongly and constitutively expressed in roots and leaves of Camelina, suggesting that this gene is related to maintenance of homeostasis during salt and drought stresses. CsPIP2s exhibited water channel activity in Xenopus oocytes. We then examined the roles of CsPIP2;1 phosphorylation at Ser273 and Ser277 in the regulation of water permeability using phosphorylation mutants. A single deletion strain of CsPIP2;1 was generated to serve as the primary host for testing AQP expression constructs. A Ser277 to alanine mutation (to prevent phosphorylation) did not change CsPIP2;1 water permeability while a Ser273 mutation to alanine did affect water permeability. Furthermore, a CsPIP2;1 point mutation when ectopically expressed in yeast resulted in lower growth in salt and drought conditions compared with controls, and confirmation of Ser273 as the phosphorylation site. Our results support the idea that post-translational modifications in the Ser273 regulatory domains of the C-terminus fine tune water flux through CsPIP2;1. PMID:25046761

  6. The X-ray emission mechanism of large scale powerful quasar jets: Fermi rules out IC/CMB for 3C 273.

    Directory of Open Access Journals (Sweden)

    Georganopoulos Markos

    2013-12-01

    Full Text Available The process responsible for the Chandra-detected X-ray emission from the large-scale jets of powerful quasars is not clear yet. The two main models are inverse Compton scattering off the cosmic microwave background photons (IC/CMB and synchrotron emission from a population of electrons separate from those producing the radio-IR emission. These two models imply radically different conditions in the large scale jet in terms of jet speed, kinetic power, and maximum energy of the particle acceleration mechanism, with important implications for the impact of the jet on the larger-scale environment. Georganopoulos et al. (2006 proposed a diagnostic based on a fundamental difference between these two models: the production of synchrotron X-rays requires multi-TeV electrons, while the EC/CMB model requires a cutoff in the electron energy distribution below TeV energies. This has significant implications for the γ-ray emission predicted by these two models. Here we present new Fermi observations that put an upper limit on the gamma-ray flux from the large-scale jet of 3C 273 that clearly violates the flux expected from the IC/CMB X-ray interpretation found by extrapolation of the UV to X-ray spectrum of knot A, thus ruling out the IC/CMB interpretation entirely for this source. Further, the upper limit from Fermi puts a limit on the Doppler beaming factor of at least δ <9, assuming equipartition fields, and possibly as low as δ <5 assuming no major deceleration of the jet from knots A through D1.

  7. Spectral Variability in Hard X-rays and the Evidence for a 13.5 Years Period in the Bright Quasar 3C273

    Indian Academy of Sciences (India)

    R. K. Manchanda

    2002-09-01

    We report the observation of nearest quasar 3C273 made with LASE instrument on November 20th, 1998 as a part of our continuing programme of balloon borne hard X-ray observations in the 20–200 keV band using high sensitivity Large Area Scintillation counter Experiment. Our data clearly show a steep spectrum in the 20–200 keV with power law spectral index = 226 ± 0.07. This is in complete contrast to the reported data from OSSE and BeppoSAX which suggest the value of 1.3 to 1.6 for the power law index in the X-ray energy band, but is quite consistent with the value derived for the high energy gamma ray data. A single power law fit in the X-ray and gamma ray energy bands points to a common origin of these photons and the absence of spectral break around 1 MeV as suggested in literature. We have reanalyzed the available data to study the temporal variability of the spectrum in the hard X-ray band. Our analysis reveals that 50 keV flux from the source, shows a strong modulation with a period of about 13.5 years. The analysis of the optical light curve of the source also supports the 5000 day period.We discuss the emission mechanism and the possible sites for X-ray photons along with the implications of the long term periodicity with respect to source geometry.

  8. Speeds of sound in (0.95 N2 + 0.05 CO and 0.9 N2 + 0.1 CO) gas mixtures at T = (273 and 325) K and pressure up to 10 MPa

    International Nuclear Information System (INIS)

    Highlights: • Experimental speeds of sound for two mixtures are reported. • A spherical resonator is used for the measurements. • Heat capacities are calculated from the speeds of sound. - Abstract: The measurements of speed of sound for two mixtures of (N2 + CO) are reported. The data have been obtained using a spherical resonator for two isotherms T = (273.15 and 325.15) K and pressures up to 10 MPa. The uncertainty study is detailed and the total uncertainty of the speed of sound is not worse than 0.016%. The results have been compared with the GERG-2008 equation of state

  9. Solid-Liquid Equilibria of D-Glucose, D-Fructose and Sucrose in the Mixture of Ethanol and Water from 273.2 K to 293.2 K%273.2K至293.2K之间D-葡萄糖、D-果糖和蔗糖在乙醇和水的混合溶剂中的固液平衡

    Institute of Scientific and Technical Information of China (English)

    龚行楚; 王珊珊; 瞿海斌

    2011-01-01

    Experimental data on the solubility of D-glucose, D-fructose and sucrose in the mixed solvents composed of water and ethanol from 273.2 to 293.2 K were determined. The solubility of D-glucose, D-fructose and sucrose decreased as the ethanol content increased in the mixed solvent. The solubility of D-glucose, D-fructose and sucrose decreased with decreasing equilibrium temperature. The modified UNIQUAC model, S-UNIFAC model and mS-UNIFAC model were applied to predict the solid-liquid equilibria. The prediction results were compared and discussed. Better prediction accuracy was generated using the modified UNIQUAC model.

  10. Very high-resolution observations of the radio sources NRAO 150, OJ 287, 3C 273, M87, 1633+38, BL Lacertae, and 3C 454.3

    International Nuclear Information System (INIS)

    Very long baseline interferometer observations made at a wavelength of 2 and 2.8 cm with baselines ranging from 54 to 291 million wavelengths show a number of radio sources with only slightly resolved components, even on the longest baselines; the quasars 1633 + 38 and 3C 454.3, the objects OJ 287 and BL Lac, and the nucleus of M87 (Virgo A, 3C 274) all contain components < or approximately 0.4 milli-arcsec. The smallest component observed is in the core of 3C 454.3, which contains about 50% of the total flux density and is < or approximately 0.2 milli-arcsec in diameter. The compact component in the nucleus of M87 is < or approximately 1.5 light-months across, and contains about one-third of the total flux density of the nucleus at 2.8 cm. NRAO 150 and BL Lac are double: the components of NRAO 150 are separated by 0.6 milli-arcsec, while BL Lac has an elongated structure consisting of a large (1.4 milli-arcsec) component separated by 1.25 milli-arcsec from a smaller (0.5 milli-arcsec) variable one. The present data on 3C 273 are consistent with triple models similar to those discussed previously, but with a somewhat greater apparent separation of components

  11. Xylose reductase from the thermophilic fungus Talaromyces emersonii: cloning and heterologous expression of the native gene (Texr) and a double mutant (TexrK271R+N273D) with altered coenzyme specificity

    Indian Academy of Sciences (India)

    Sara Fernandes; Maria G Tuohy; Patrick G Murray

    2009-12-01

    Xylose reductase is involved in the first step of the fungal pentose catabolic pathway. The gene encoding xylose reductase (Texr) was isolated from the thermophilic fungus Talaromyces emersonii, expressed in Escherichia coli and purified to homogeneity. Texr encodes a 320 amino acid protein with a molecular weight of 36 kDa, which exhibited high sequence identity with other xylose reductase sequences and was shown to be a member of the aldoketoreductase (AKR) superfamily with a preference for reduced nicotinamide adenine dinucleotide phosphate (NADPH) as coenzyme. Given the potential application of xylose reductase enzymes that preferentially utilize the reduced form of nicotinamide adenine dinucleotide (NADH) rather than NADPH in the fermentation of five carbon sugars by genetically engineered microorganisms, the coenzyme selectivity of TeXR was altered by site-directed mutagenesis. The TeXRK271R+N273D double mutant displayed an altered coenzyme preference with a 16-fold improvement in NADH utilization relative to the wild type and therefore has the potential to reduce redox imbalance of xylose fermentation in recombinant S. cerevisiae strains. Expression of Texr was shown to be inducible by the same carbon sources responsible for the induction of genes encoding enzymes relevant to lignocellulose hydrolysis, suggesting a coordinated expression of intracellular and extracellular enzymes relevant to hydrolysis and metabolism of pentose sugars in T. emersonii in adaptation to its natural habitat. This indicates a potential advantage in survival and response to a nutrient-poor environment.

  12. Observation and search for γ rays 1-20 MeV from the Crab, NGC4151, Cyg X-1, Cyg X-3, CG135 +1 and 3C273

    International Nuclear Information System (INIS)

    Observations of γ-rays of 1-20 MeV with the UCR Compton double scatter γ-ray telescope are reported for a balloon flight launched from Palestine, Texas, 4.5 GV, at 01.00UT 29 September 1978. The energy distribution of the total γ-rays from the Crab from 1.2 to 20 MeV was measured. Two σ upper limits of 3, 2, 0.6 and 0.4 x 10-4 photons cm-2 s-1 MeV-1 at energies 1.2-3, 3-5, 5-10 and 10-20 MeV, respectively, were found for the Seyfert galaxy NGC4151, the black hole candidate Cyg X-1 and for Cyg X-3. In the same energy intervals, the 2σ upper limits for the nearest and second nearest QSOs CG135+1 and 3C273 are 5, 3, 1 and 0.4 x 10-4 photons cm-2s-1MeV-1. These upper limits restrict confirmed γ-ray sources at 1-20 MeV to the Crab and NP0532. The upper limits found for NGC4151 do not support Seyfert galaxies as the source of cosmic diffuse radiation. (author)

  13. 7 CFR 273.15 - Fair hearings.

    Science.gov (United States)

    2010-01-01

    ... clear expression, oral or written, by the household or its representative to the effect that it wishes... accept an oral expression from the household or its representative to withdraw a fair hearing may discuss... makes an oral request for a hearing, the State agency shall complete the procedures necessary to...

  14. 7 CFR 273.5 - Students.

    Science.gov (United States)

    2010-01-01

    ... education. Such enrollment shall be deemed to continue through normal periods of class attendance, vacation... adequate child care is not available to enable the student to attend class and comply with the...

  15. 40 CFR 273.20 - Exports.

    Science.gov (United States)

    2010-07-01

    ... to those OECD countries specified in 40 CFR 262.58(a)(1) (in which case the handler is subject to the requirements of 40 CFR part 262, subpart H) must: (a) Comply with the requirements applicable to a primary exporter in 40 CFR 262.53, 262.56(a) (1) through (4), (6), and (b) and 262.57; (b) Export such...

  16. 40 CFR 273.40 - Exports.

    Science.gov (United States)

    2010-07-01

    ... to those OECD countries specified in 40 CFR 262.58(a)(1) (in which case the handler is subject to the requirements of 40 CFR part 262, subpart H) must: (a) Comply with the requirements applicable to a primary exporter in 40 CFR 262.53, 262.56(a)(1) through (4), (6), and (b) and 262.57; (b) Export such...

  17. 40 CFR 60.273 - Emission monitoring.

    Science.gov (United States)

    2010-07-01

    ... manufacturer to be capable of detecting particulate matter emissions at concentrations of 1 milligram per... sensor must provide output of relative particulate matter loadings and the owner or operator shall... bag leak detection system; or (6) Shutting down the process producing the particulate emissions....

  18. 25 CFR 273.12 - Eligible students.

    Science.gov (United States)

    2010-04-01

    .... Indian students, from age 3 years through grade(s) 12, except those who are enrolled in Bureau or... they are 1/4 or more degree Indian blood and recognized by the Secretary as being eligible for...

  19. 33 CFR 273.13 - Program policy.

    Science.gov (United States)

    2010-07-01

    ... infestation should constitute a known problem of economic importance in the area involved. Initial planning... Program is designed to deal primarily with weed infestations of major economic significance including... vegetation do not generally meet those criteria for special problems merely because they may qualify...

  20. 12 CFR 27.3 - Recordkeeping requirements.

    Science.gov (United States)

    2010-01-01

    ... base salary, wages, overtime pay, bonuses, commissions, dividends, interest, rental income, retirement... interest. The bank may also include insurance, real estate taxes and any monthly assessments for home owner...' total monthly payments on all outstanding liabilities. Include installment debts, real estate loans...

  1. 40 CFR 273.52 - Waste management.

    Science.gov (United States)

    2010-07-01

    ... Transportation regulations in 49 CFR part 171 through 180 for transport of any universal waste that meets the definition of hazardous material in 49 CFR 171.8. For purposes of the Department of Transportation... Requirements of the U.S. Environmental Protection Agency specified in 40 CFR part 262. Because universal...

  2. 48 CFR 719.273-2 - Definitions.

    Science.gov (United States)

    2010-10-01

    ..., small disadvantaged business, women-owned small business, veteran-owned and service-disabled veteran-owned small business and small business located in HUBZones, as those terms are defined in 13 CFR part..., women-owned small business, HUBZone small business, veteran-owned small business or...

  3. 33 CFR 273.12 - References.

    Science.gov (United States)

    2010-07-01

    ... 1972, (86 Stat. 973), 21 October 1972. (c) 40 CFR 180, Tolerances and exemptions from tolerances for... Health Act of 1970, (84 Stat. 1609, 29 U.S.C. 668), 29 December 1970. (e) 29 CFR 1960, Safety and Health... Management System.” (h) ER 1105-2-507, “Preparation and Coordination of Environmental Statements.” (33...

  4. 40 CFR 273.33 - Waste management.

    Science.gov (United States)

    2010-07-01

    ... mercury-containing equipment in a way that prevents releases of any universal waste or component of a... foreseeable conditions, and must be reasonably designed to prevent the escape of mercury into the environment...) Immediately seals the original housing holding the mercury with an air-tight seal to prevent the release...

  5. 40 CFR 273.13 - Waste management.

    Science.gov (United States)

    2010-07-01

    ... to prevent the escape of mercury into the environment by volatilization or any other means. (2) A... that meets the requirements of 40 CFR 262.34; (iv) Immediately transfers any mercury resulting from...-tight seal to prevent the release of any mercury to the environment; and (ii) Follows all...

  6. Sections 273, 320, 433, 823, 1004 and 242 of the 17th Civil Code; Articles 4(I), 5(I), 20(IV) of the Basic Law; Sect. 256 of the Code of Civil Procedure (Refusal to pay electricity rates, with electricity being generated by means of atomic energy)

    Energy Technology Data Exchange (ETDEWEB)

    Krueger, W.

    1981-01-01

    Anyone who buys electricity from an energy supply utility which also supplies electricity generated by means of nuclear energy, has neither the right to withhold payment according to sect. 273 of the Code of Civil Procedure nor according to sect. 242 of the Civil Code in conjunction with paragraph I of Art. 4, pararagraph I of Art. 5, paragraph IV of Article 20 of the Basic Law. Decision of the Regional Court of Dortmund, as of Oct. 10, 1980 - 3 O 673/79 (non-appealable).

  7. Search for TeV gamma-ray emission from AGN's using the Whipple imaging telescope. [QSO 0836+710; PKS 0528+134; 4C 38. 1; 3C 273; 3C 279; Mrk 421; Mrk 501; I Zw 187; VRO 42. 22. 01

    Energy Technology Data Exchange (ETDEWEB)

    Fennell, S. (Physics Dept., University College Dublin, Belfield, Dublin 4 (Ireland) Whipple Observatory, Harvard-Smithsonian CfA, Box 97, Amado, Arizona 85645 (United States)); Akerlof, C.W. (Physics Dept., University of Michigan, Ann Arbor, Michigan 48109 (United States)); Cawley, M.F. (Physics Dept., St. Patrick' s College, Maynooth, County Kildare (Ireland)); Chantell, M. (Whipple Observatory, Harvard-Smithsonian CfA, Box 97, Amado, Arizona 85645 (United States)); Fegan, D.J. (Physics Dept., University College Dublin, Belfield, Dublin 4 (Ireland)); Gaidos, J.A. (Physics Dept., Purdue Univ., West Lafayette, Indiana 47907 (United States)); Hagan, J. (Physics Dept., University College Dublin, Belfield, Dublin 4 (Ireland)); Hillas, A.M. (Physics Dept., University of Leeds, Leeds, LS2 9JT (United Kingdom)); Kerrick, A.D.; Lamb, R.C. (Physics and Astronomy Dept., Iowa State University, Ames, Iowa 50011 (United States)); Lawrence, M.A. (Whipple Observatory, Harvard-Smithsonian CfA,

    1993-07-05

    MeV--GeV emission has been reported by the EGRET team for a number of AGN's. We report the results of observations taken with the Whipple Gamma Ray imaging telescope during the spring of 1992, on QSO0836+710, PKS0528+134, 4C38.1, 3C273, 3C279, Mrk421, Mrk501, IZW187, and VRO42.22.01. The EGRET team also sees a short time-scale variation in luminosity for some of these objects. The results of a search for variability at TeV energies in these objects is reported.

  8. The Discoveries of Bohrium, Hassium, Meitnerium, and the new Region of Deformed Shell Nuclei

    CERN Document Server

    Münzenberg, G

    2003-01-01

    The investigation of the light trans-actinide elements was not only exciting as it included the discovery of a number of new chemical elements. It led also to the discovery of a new region of shell nuclei existing beyond the macroscopic stability limit. Theory explained this in terms of a new shell region of deformed nuclei which bridge the trans-uranium nuclei and the predicted superheavy elements. This contribution will give a brief historic overview over these discoveries, experimental developments, and the impact on ongoing and future superheavy-element research.

  9. The Discoveries of Bohrium, Hassium, Meitnerium, and the new Region of Deformed Shell Nuclei

    International Nuclear Information System (INIS)

    The investigation of the light trans-actinide elements was not only exciting as it included the discovery of a number of new chemical elements. It led also to the discovery of a new region of shell nuclei existing beyond the macroscopic stability limit. Theory explained this in terms of a new shell region of deformed nuclei which bridge the trans-uranium nuclei and the predicted superheavy elements. This contribution will give a brief historic overview over these discoveries, experimental developments, and the impact on ongoing and future superheavy-element research. (author)

  10. The Discoveries of Bohrium, Hassium, Meitnerium, and the New Region of Deformed Shell Nuclei

    Science.gov (United States)

    Muenzenberg, Gottfried

    2003-03-01

    The investigation of the light trans-actinide elements was not only exciting as it included the discovery of a number of new chemical elements. It led also to the discovery of a new region of shell nuclei existing beyond the macroscopic stability limit. Theory explained this in terms of a new shell region of deformed nuclei which bridge the trans-uranium nuclei and the predicted superheavy elements. This contribution will give a brief historic overview over these discoveries, experimental developments, and the impact on ongoing and future superheavy-element research.

  11. Cruise Report, Townsend Cromwell, Cruise 01-10 (TC-273)

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Personnel from the Coral Reef Ecosystem Investigation, Honolulu Laboratory, National Marine Fisheries Service, NOAA, conducted reef assessments/ monitoring in...

  12. 25 CFR 273.18 - Additional requirements for education plan.

    Science.gov (United States)

    2010-04-01

    ... total enrollment of school or district, by age and grade level. (l) State the eligible Indian enrollment... support. The public school district must establish in its justification that it meets the requirements... employees. (4) Costs which parents normally are expected to pay for each school. (5) Supplemental...

  13. 25 CFR 273.13 - Proposals eligible for contracts.

    Science.gov (United States)

    2010-04-01

    ... contract for operational support, a public school district shall be required to establish as part of the... residing in Federal boarding facilities for the purpose of attending public schools within the school... equal to the State average. (iv) There is at least 70 percent eligible Indian enrollment within...

  14. 7 CFR 273.18 - Claims against households.

    Science.gov (United States)

    2010-01-01

    ..., and credit or debit cards You do not have to accept credit or debit cards if you do not have the... overpaid or (ii) Benefits that are trafficked. Trafficking is defined in 7 CFR 271.2. (2) This claim is a... by a household transacting an untampered expired Authorization to Participate (ATP) card....

  15. 40 CFR 60.273a - Emission monitoring.

    Science.gov (United States)

    2010-07-01

    ... manufacturer to be capable of detecting particulate matter emissions at concentrations of 1 milligram per... sensor must provide output of relative particulate matter loadings and the owner or operator shall... alarm system that will sound when an increase in relative particulate loading is detected over the...

  16. 77 FR 273 - Combined Notice of Filings #1

    Science.gov (United States)

    2012-01-04

    ... qualifying facility filings: Docket Numbers: QF12-120-000. Applicants: The Coca-Cola Company. Description: Form 556--Notice of self-certification of qualifying cogeneration facility status of The Coca-Cola..., LLC, Choctaw Gas Generation, LLC, FirstLight Power Resources Management, L, ANP Funding I,...

  17. 7 CFR 273.9 - Income and deductions.

    Science.gov (United States)

    2010-01-01

    ... tax credits received as part of the paycheck or as a reduction in taxes that otherwise would have been..., but not limited to, income tax refunds, rebates, or credits; retroactive lump-sum social security, SSI... Band of Ottawa Indians (Pub. L. 94-540). (vii) Earned income tax credits received as a result of Pub....

  18. 7 CFR 273.16 - Disqualification for intentional Program violation.

    Science.gov (United States)

    2010-01-01

    ... responsibility. (1) The State agency shall be responsible for investigating any case of alleged intentional... intentional Program violation in a format designed by FNS. This format shall include the individual's social... adopted the two-tiered approach for administrative disqualification hearings may also provide for...

  19. 48 CFR 719.273-8 - Developmental assistance.

    Science.gov (United States)

    2010-10-01

    ... DEVELOPMENT SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS The U.S. Agency for International Development... relating to— (1) Financial management; (2) Organizational management; (3) Overall business management/planning; (4) Business development; and (5) Technical assistance. (b) Loans; (c) Rent-free use...

  20. Dicty_cDB: SSE273 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KING DRAFT SEQUENCE, 11 unordered pieces. 44 2.6 1 AF325944 |AF325944.1 HIV-1 isolate Don21.34 from United K...ingdom envelope glycoprotein (env) gene, partial cds. 44 2.6 1 AF325943 |AF325943.1 HIV-1 isolate Don18.51 from United...42 |AF325942.1 HIV-1 isolate Don18.33 from United Kingdom envelope glycoprotein (env) gene, partial cds. 44 ...2.6 1 AF325941 |AF325941.1 HIV-1 isolate Don18.26 from United Kingdom envelope glycoprotein (env) gene, part...ial cds. 44 2.6 1 AF325940 |AF325940.1 HIV-1 isolate Don14.43 from United Kingdom

  1. Dicty_cDB: CHE273 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sgvnssi*vesfcl kikhsnfseillillsxqrnccwftkt*willsfx*xnfx*t Frame C: hlmhrlhqhhqrxfe*khivklf*mhellhhlsfysli...dariasppfillin*sikvpfcgissssspwccccc c*teidg*vdcggfceieiedfevgvigetpdfgailieepeadgtd...ffxixqfplnx Frame B: afnasiaptppapf*vktycealldariasppfillin*sikvpfcgissssspwccccc c*teidg*vdcggfceieiedfevgvigetpdfgaili...f ehflfpfeliqlyv*ihf*ilkhvgrilqvmkf*hlhhrivrln*--- ---xrkxhhvvxhh**nypmixqsxefdgmnyyfwfplnllimr*ylvlil... Frames) Frame A: si*cidctnttsaxlsenil*sssrctncfttfhfth*lihkstilwyiiivvamvllll llnrn*wls*lwwfl

  2. 31 CFR 27.3 - Assessment of civil penalties.

    Science.gov (United States)

    2010-07-01

    ... with, or as a part of, any advertisement, solicitation, business activity, or product, whether alone or... States Secret Service,” “United States Customs Service,” “Internal Revenue Service,” “Bureau of Alcohol..., Bureau of Alcohol, Tobacco and Firearms,” “Commissioner of the Public Debt,” “Director of the Bureau...

  3. 7 CFR 273.17 - Restoration of lost benefits.

    Science.gov (United States)

    2010-01-01

    ... the proposed lost benefit restoration. (c) Disputed benefits. (1) If the State agency determines that... agency, after reviewing the case file, does not agree, the household has 90 days from the date of...

  4. Dicty_cDB: VFF273 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Solanum tuberosum cDNA clone cPRO2F7 5' end, mRNA sequence. 46 0.001 2 BQ512190 |BQ512190.1 EST619605 Generation... Solanum tuberosum cDNA clone STMHW74 5' end, mRNA sequence. 46 0.001 2 BQ512191 |BQ512191.1 EST619606 Generation

  5. 14 CFR 171.273 - Maintenance and operations requirements.

    Science.gov (United States)

    2010-01-01

    ... beacon power, and modulation. (18) The following information concerning the ISMLS facility: (i) Facility... emission and frequencies of the ISMLS localizer, glide path, beacon markers, and associated compass... marker beacon radiation characteristics must be conducted in accordance with the maintenance...

  6. Flow-induced vibration -- 1994. PVP-Volume 273

    International Nuclear Information System (INIS)

    Flow-induced vibration is a subject of practical interest to many engineering disciplines, including the power generation, process, and petrochemical industries. In the nuclear industry, flow-induced vibration reaches a higher level of concern because of safety issues and the huge cost associated with down time and site repair. Not surprisingly, during the last 25 years a tremendous amount of effort has been spent in the study of flow-induced vibration phenomena related to nuclear plant components, notably nuclear steam generator tube banks and nuclear fuel bundles. Yet, in spite of this concentrated effort, the industry is still not free from flow-induced vibration-related problems. This explains why in this volume almost half of the papers address the issue of cross-flow induced vibration in tube bundles, with applications to the nuclear steam generator and nuclear fuel bundles in mind. Unlike 10 or 15 years ago, when flow-induced vibration studies almost always involved experimentation and empirical studies, the advent of high-speed computers has enabled numerical calculation and simulation of this complex phenomenon to take place. Separate abstracts were prepared for 27 papers in this volume

  7. Dicty_cDB: SSB273 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available HSP's gapped (non-prelim): 0 length of query: 261 length of database: 80,480,566 effective HSP length: 17 effective... length of query: 244 effective length of database: 78,821,179 effective ...search space: 19232367676 effective search space used: 19232367676 T: 0 A: 0 X1: 6 (11.9 bits) X2: 15 (29.7 ...cessful extensions: 0 Number of sequences better than 10.0: 0 length of query: 261 length of database: P,440,743,729 effective... HSP length: 22 effective length of query: 239 effective length of database: O,889,706,121 effective

  8. 7 CFR 273.12 - Requirements for change reporting households.

    Science.gov (United States)

    2010-01-01

    ... List of CFR Sections Affected, which appears in the Finding Aids section of the printed volume and on... the reports in accordance with procedures for the systems used in budgeting the household's income and... following: (i) A space for the household to report whether the change shall continue beyond the report...

  9. Study of the solubility, viscosity and density in Na+, Zn2+/Cl− − H2O, Na+ − Zn2+ − (H2PO2)− − H2O, Na+, Cl−/(H2PO2)− − H2O, and Zn2+, Cl−/(H2PO2)− − H2O ternary systems, and in Na+, Zn2+/Cl−, (H2PO2)−//H2O reciprocal quaternary system at 273.15 K

    International Nuclear Information System (INIS)

    Highlights: • The physicochemical properties of ternary and one quaternary have been studied. • Reciprocal quaternary systems’ solubility and phase equilibrium have been studied. • In all systems the solid phases have been found. • It was found that Zn(H2PO2)2 salt contains 70% of the general crystallization field. - Abstract: The solubility and the physicochemical properties (density, viscosity) in the Na-Zn- Cl-H2O), (Na + Zn + H2PO2 + H2O), (Na + Cl + H2PO2 + H2O), and (Zn + Cl + H2PO2 + H2O) ternaries, and in Na+, Zn2+/Cl−, (H2PO2)−//H2O reciprocal quaternary systems at T = 273.15 K were investigated by using the isothermal method. The diagrams of ternary salts systems, (NaCl + ZnCl2 + H2O), (NaCl + NaH2PO2 + H2O), (NaH2PO2 + Zn(H2PO2)2 + H2O), (ZnCl2 + Zn(H2PO2)2 + H2O), are plotted in figures 1–4. However, whole ions of reciprocal quaternary salt systems are plotted in figure 5. Additionally, the density and viscosity values of ternary systems vs. their corresponding composition values in weight per cent are plotted in figures 6–10. At the (i) (ZnCl2 + Zn(H2PO2)2 + H2O), (ii) (NaCl + ZnCl2 + H2O), (iii) (NaCl + NaH2PO2 + H2O), (iv) (NaH2PO2 + Zn(H2PO2)2 + H2O) ternary systems the solid phase compositions have been determined as: (i) Zn(H2PO2)2 ⋅ H2O, Zn(H2PO2)2, ZnCl2 ⋅ 2H2O, (ii) NaCl, 2NaCl ⋅ ZnCl2 ⋅ 2H2O, and ZnCl2 ⋅ 2H2O, (iii) NaCl and NaH2PO2 ⋅ H2O, (iv) Zn(H2PO2)2 ⋅ H2O and NaH2PO2 ⋅ H2O, respectively. On the other hand reciprocal quaternary system was observed as: ZnCl2 ⋅ 2H2O, 2NaCl ⋅ ZnCl2 ⋅ 2H2O, Zn(H2PO2)2 ⋅ H2O, NaH2PO2 ⋅ H2O, NaCl. According to results, the least soluble salt was Zn(H2PO2)2. The crystallization field of this salt, being the largest in comparison with those of other salts, occupied 70% of the general crystallization field

  10. Investigation of elements 107, bohrium (Bh) and 108, hassium (Hs) in sulfuric acid solutions according to the test experiments with their homologs

    International Nuclear Information System (INIS)

    Ion-exchange behavior of Re and Os as homologs of Bh and Hs, respectively, has been studied in the sulfuric acid media. The distribution coefficients of 183Re and 185Os as well as of other radionuclides between Dowex-50 and H2SO4 solutions were determined as a function of the acid concentration. It was shown, that cation-exchange column may be used for the separation of Os, Re and W from elements of III group, whereas anion-exchange column for their concentration from diluted sulfuric acid solutions. The 0.05M H2SO4 was used for continuous on-line separation of short-lived Os isotopes produced in the nuclear reactions: nat.Dy(20Ne, xn)Os. Radionuclides of Os, Re and W were strongly sorbed on anion-exchange column only. (author)

  11. Ionization potentials and radii of neutral and ionized species of elements 107 (bohrium) and 108 (hassium) from extended multiconfiguration Dirac-Fock calculations

    Science.gov (United States)

    Johnson, E.; Fricke, B.; Jacob, T.; Dong, C. Z.; Fritzsche, S.; Pershina, V.

    2002-02-01

    Large multiconfiguration Dirac-Fock calculations were performed for all neutral and up to 7 and 8 times ionized species of elements 107 and 108, respectively, as well as all the homologous elements Mn, Tc, Re, Fe, Ru, and Os for a number of different total angular momenta. Comparison of the resulting ionization potentials to the known values of the homologues allow an extrapolation and thus a prediction of the chemically important seven or eight ionization potentials of elements 107 or 108 as well as a prediction of some ionic radii.

  12. Yeast Interacting Proteins Database: YDL239C, YDR273W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YDL239C ADY3 Protein required for spore wall formation, thought to mediate assembly...ption Protein required for spore wall formation, thought to mediate assembly of a Don1p-containing structure

  13. SU-E-J-273: Simulation of the Radiation Response of Hypoxic Tumors

    Energy Technology Data Exchange (ETDEWEB)

    Espinoza, I [Pontificia Universidad Catolica de Chile, Santiago (Chile); Peschke, P; Karger, C [German Cancer Research Center (DKFZ), Heidelberg (Germany)

    2014-06-01

    Purpose: In radiotherapy, it is important to predict the response of tumour to irradiation prior to the treatment. Mathematical modelling of tumour control probability (TCP) based on the dose distribution, medical imaging and other biological information may help to improve this prediction and to optimize the treatment plan. The aim of this work is to develop an image based 3D multiscale radiobiological model, which describes the growth and the response to radiotherapy of hypoxic tumors. Methods: The computer model is based on voxels, containing tumour, normal (including capillary) and dead cells. Killing of tumour cells due to irradiation is calculated by the Linear Quadratic Model (extended for hypoxia), and the proliferation and resorption of cells are modelled by exponential laws. The initial shape of the tumours is taken from CT images and the initial vascular and cell density information from PET and/or MR images. Including the fractionation regime and the physical dose distribution of the radiation treatment, the model simulates the spatial-temporal evolution of the tumor. Additionally, the dose distribution may be biologically optimized. Results: The model describes the appearance of hypoxia during tumour growth and the reoxygenation processes during radiotherapy. Among other parameters, the TCP is calculated for different dose distributions. The results are in accordance with published results. Conclusion: The simulation model may contribute to the understanding of the influence of biological parameters on tumor response during treatment, and specifically on TCP. It may be used to implement dose-painting approaches. Experimental and clinical validation is needed. This study is supported by a grant from the Ministry of Education of Chile, Programa Mece Educacion Superior (2)

  14. Getting Unemployed Adults into Jobs. Does Jobsearch Training Add Value to "Training for Work"? Report 273.

    Science.gov (United States)

    Atkinson, John

    The effectiveness of Training for Work, which is the United Kingdom's main public program for helping long-term unemployed adults find jobs, was examined through interviews with training managers in 8 training and enterprise councils (TECs), 53 training providers, and 374 individuals who had joined Training for Work in spring/summer 1993 and left…

  15. CKD273, a New Proteomics Classifier Assessing CKD and Its Prognosis

    OpenAIRE

    Argilés, Àngel; Siwy, Justyna; Duranton, Flore; Gayrard, Nathalie; Dakna, Mohammed; Lundin, Ulrika; Osaba, Lourdes; Delles, Christian; Mourad, Georges; Weinberger, Klaus M.; Mischak, Harald

    2013-01-01

    National Kidney Foundation CKD staging has allowed uniformity in studies on CKD. However, early diagnosis and predicting progression to end stage renal disease are yet to be improved. Seventy six patients with different levels of CKD, including outpatients and dialysed patients were studied for transcriptome, metabolome and proteome description. High resolution urinary proteome analysis was blindly performed in the 53 non-anuric out of the 76 CKD patients. In addition to routine clinical para...

  16. The angular distribution of neutron-proton scattering at 27.3 MeV

    International Nuclear Information System (INIS)

    The results of experimental investigations are presented to study a forward-backward asymmetry in the n-p scattering angular distribution for angles from 34 deg to 116 deg. To improve the precision of the measurements the neutron detector efficiency factor was analyzed in the 5-25 MeV energy range. Features of the time-of-flight spectrum are discussed. The data obtained confirm the asymmetry predicted by the phase shift evaluations

  17. Angular distribution of neutron--proton scattering at 27.3 MeV

    International Nuclear Information System (INIS)

    Neutron time-of-flight spectra were measured with an NE-102A plastic scintillator. Measured cross sections are compared with phase-shift analyses. The absolute efficiency of the detector as a function of neutron energy is also shown. 4 figures

  18. 43 CFR 2.73 - Petitions for amendments: Time limits for processing.

    Science.gov (United States)

    2010-10-01

    ... manager responsible for the system containing the challenged record, unless a decision on the petition has... decision on a petition may be extended if the official responsible for making a decision on the petition... collected from facilities other than the facility at which the official responsible for making the...

  19. 7 CFR 2.73 - Director, Office of Energy Policy and New Uses.

    Science.gov (United States)

    2010-01-01

    ... and New Uses: (1) Providing Department leadership in: (i) Analyzing and evaluating existing and... related activities. (6) These delegations exclude the energy management actions related to the...

  20. 48 CFR 719.273-5 - Selection of Protégé firms.

    Science.gov (United States)

    2010-10-01

    ... responsible for selecting Protégé firms. Mentors are encouraged to select from a broad base of small business including small disadvantaged business, women-owned small business, veteran-owned small business, service... DEVELOPMENT SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS The U.S. Agency for International...

  1. Making, reviewing and receiving orders under the Nuclear Safety and Control Act. Regulatory guide G-273

    International Nuclear Information System (INIS)

    This document provides guidance for making, reviewing and receiving orders pursuant to the Nuclear Safety and Control Act ('NSC Act' or 'the Act') and its regulations. This guide applies to the inspectors and designated officers (DOs) empowered to make and review orders under the Act and to any person receiving an order under the Act. With respect to the making and reviewing of orders by an inspector or DO, this guide describes the roles and responsibilities of the Commission, inspectors and DOs, and the required steps to carry out these activities. (The form for making orders and an inspector's checklist can be found in Appendices A and C respectively.) With respect to receiving orders made by an inspector or DO, this guide describes: the rights and responsibilities of persons receiving an order, and the actions required for compliance with such orders. Also addressed in the guide are the roles, responsibilities and the actions required by any person making an appeal or an application for redetermination of an order made by an inspector or DO, and orders that the Commission itself may make in exceptional circumstances, such as an emergency. Failure to comply with the requirements of an order is addressed by the CNSC compliance program and is beyond the scope of this document. (author)

  2. Further COS-B evidence for gamma-ray emission from 3C273

    International Nuclear Information System (INIS)

    In this report the results of the third observation of Virgo region are reported: the source was seen again and the combined data have been analysed to improve on the position and the time-averaged energy spectrum of the gamma-ray source

  3. Constraints of Flat Spectrum Radio Quasars in the hadronic model: the case of 3C 273

    OpenAIRE

    Petropoulou, Maria; Dimitrakoudis, Stavros

    2015-01-01

    We present a method of constraining the properties of the $\\gamma$-ray emitting region in flat spectrum radio quasars (FSRQs) in the one-zone proton synchrotron model, where the $\\gamma$-rays are produced by synchrotron radiation of relativistic protons. We show that for low enough values of the Doppler factor $\\delta$, the emission from the electromagnetic (EM) cascade which is initiated by the internal absorption of high-energy photons from photohadronic interactions may exceed the observed...

  4. From Centimeter to Millimeter Wavelengths: A High Angular Resolution Study of 3C273

    OpenAIRE

    Krichbaum, T. P.; Witzel, A.; Zensus, J. A.

    2001-01-01

    Comment: 6 pages, 8 figures, appeared in: Proceedings of the 5th European VLBI Network Symposium held at Onsala Space Observatory, June 29-July 1, 2000, eds. J.E. Conway, A.G. Polatidis, R.S. Booth, and Y.M. Pihlstrom, p. 25-30. (ISBN 91-631-0548-9)

  5. 7 CFR 273.24 - Time limit for able-bodied adults.

    Science.gov (United States)

    2010-01-01

    ... be measured and tracked consistently so that individuals who are similarly situated are treated the... lack of jobs in declining occupations or industries; is described in an academic study or other... processed in accord with 7 CFR part 15. (h) Adjustments. FNS will make adjustments as follows: (1)...

  6. Analyses of quasar 3C 273 using XMM-Newton and RXTE

    OpenAIRE

    Stuhlinger, Martin

    2004-01-01

    Due to their tremendous luminosity over up to thirteen orders of magnitudes in frequency, active galactic nuclei (AGN) belong to the most distant discrete objects that can be observed in the universe. Except the differentiation into radio quiet AGNs and radio loud AGNs, dependent on the presence or absence of a jet, the unification model explains the different phenomenonal appearances of AGNs by a different viewing angle on the same physical kind of objects. As the brightest and nearest ...

  7. Antarctica: The Continuing Experiment. Foreign Policy Association Headline Series, No. 273.

    Science.gov (United States)

    Quigg, Philip W.

    One of a series of booklets on world issues examines the sharpened differences between those nations that have declared sovereignty over parts of Antarctica and those that have not; between those nations that have arbitrarily assumed responsibility for the administration of Antarctica and the smaller, more numerous nations that believe their…

  8. 7 CFR 273.21 - Monthly Reporting and Retrospective Budgeting (MRRB).

    Science.gov (United States)

    2010-01-01

    ... households that change their reporting and budgeting status. The State agency shall use one of the following procedures for households subject to change in reporting/budgeting status. (1) Households which become subject to MRRB. The State agency may change the reporting/budgeting status of households which...

  9. 75 FR 54880 - Eddie Floyd, Licensee of FM Translator Station K273AF, Carson City, NV, Facility ID No. 13529...

    Science.gov (United States)

    2010-09-09

    ... case, Floyd's felony conviction relating to money laundering of proceeds from illegal drug trafficking... based on his felony conviction relating to money laundering and his apparent failure to inform the... count of violating 18 U.S.C. 1956(a)(1)(B)(I), involving money laundering, and one count of violating...

  10. Structural Investigation of the Oligosaccharide Portion Isolated from the Lipooligosaccharide of the Permafrost Psychrophile Psychrobacter arcticus 273-4

    OpenAIRE

    Angela Casillo; Ermenegilda Parrilli; Sannino Filomena; Buko Lindner; Rosa Lanzetta; Michelangelo Parrilli; Maria Luisa Tutino; Maria Michela Corsaro

    2015-01-01

    Psychrophilic microorganisms have successfully colonized all permanently cold environments from the deep sea to mountain and polar regions. The ability of an organism to survive and grow in cryoenviroments depends on a number of adaptive strategies aimed at maintaining vital cellular functions at subzero temperatures, which include the structural modifications of the membrane. To understand the role of the membrane in the adaptation, it is necessary to characterize the cell-wall components, ...

  11. Revisiting Correlations Between Broad-Line and Jet Emission Variations for AGNs: 3C 120 and 3C 273

    OpenAIRE

    Liu, H. T.; Bai, J. M.; Feng, H. C.; Li, S. K.

    2014-01-01

    We restudy the issue of cross-correlations between broad-line and jet emission variations, and aim to locate the position of radio (and gamma-ray) emitting region in jet of active galactic nuclei (AGNs). Considering the radial profiles of the radius and number density of clouds in a spherical broad-line region (BLR), we derive new formulae connecting jet emitting position $R_{\\rm{jet}}$ to time lag $\\tau_{\\rm{ob}}$ between broad-line and jet emission variations, and BLR radius. Also, formulae...

  12. X-ray imaging observations of the radio galaxies Cen A, Vir A, and 3C273

    International Nuclear Information System (INIS)

    This dissertation reports results from detailed two-dimensional X-ray images of three radio galaxies obtained with the High Resolution Imager and Imaging Proportional Counter on board the Einstein X-ray Observatory (HEAO-B satellite). The images reveal several distinct sources of X-ray emission in these galaxies including the active nucleus, hot interstellar medium, stars, radio lobes, and jets. The most important result is the discovery of X-ray jets in all three of these galaxies, demonstrating that highly energetic processes occur in the transport of energy and matter from radio galaxy nuclei to lobes. In addition, the strongest evidence to date for inverse Compton X-ray emission from extended radio lobes is provided and for hydrostatic (in contrast to ram) pressure confinement of radio lobes by a hot external medium. In Centaurus A = NGC 5128, the most dramatic X-ray structure is a linear jet of emission extending 8'' to 4' (0.2 to 6 kpc) from the nucleus towards the NE radio lobes. It consists of several resolved knots about 150 pc in radius, each emitting 1038 to 1039 erg/s in soft x-rays. Various thermal nd non-thermal models for the emission are considered in detail; none can be rigorously excluded with the available evidence. Also present in the images of Cen A are: X-ray emission associated with the outer optical jet and radio lobe; a ridge of emission below and parallel to the dust lane, probably produced by Population I sources; diffuse emission absorbed along the dust lane, probably due to a hot interstellar medium of about 108 M; the strong, variable nuclear source; and five X-ray sources unrelated to the galaxy, including a probable distant RS CVn binary system

  13. X-ray imaging observations of the radio galaxies Cen A, Vir A, and 3C273

    Energy Technology Data Exchange (ETDEWEB)

    Feigelson, E.D.

    1980-01-01

    This dissertation reports results from detailed two-dimensional X-ray images of three radio galaxies obtained with the High Resolution Imager and Imaging Proportional Counter on board the Einstein X-ray Observatory (HEAO-B satellite). The images reveal several distinct sources of X-ray emission in these galaxies including the active nucleus, hot interstellar medium, stars, radio lobes, and jets. The most important result is the discovery of X-ray jets in all three of these galaxies, demonstrating that highly energetic processes occur in the transport of energy and matter from radio galaxy nuclei to lobes. In addition, the strongest evidence to date for inverse Compton X-ray emission from extended radio lobes is provided and for hydrostatic (in contrast to ram) pressure confinement of radio lobes by a hot external medium. In Centaurus A = NGC 5128, the most dramatic X-ray structure is a linear jet of emission extending 8'' to 4' (0.2 to 6 kpc) from the nucleus towards the NE radio lobes. It consists of several resolved knots about 150 pc in radius, each emitting 10/sup 38/ to 10/sup 39/ erg/s in soft x-rays. Various thermal nd non-thermal models for the emission are considered in detail; none can be rigorously excluded with the available evidence. Also present in the images of Cen A are: X-ray emission associated with the outer optical jet and radio lobe; a ridge of emission below and parallel to the dust lane, probably produced by Population I sources; diffuse emission absorbed along the dust lane, probably due to a hot interstellar medium of about 10/sup 8/ M; the strong, variable nuclear source; and five X-ray sources unrelated to the galaxy, including a probable distant RS CVn binary system.

  14. Parsec structure and properties of the jet of 3C273. Results of Space VLBI data processing

    OpenAIRE

    Chuprikov, Andrey; Guirin, Igor

    2011-01-01

    We present result of processing of data of ground-space VLBI experiment titled W068. Particularly, one part of data of that observational session is successfully processed. These data were obtained on 2000 March 17 between 9:00 UT and 10:30 UT. 10 antennas of American interferometer VLBA (Very Long Baseline Array) and Japan satellite VSOP (VLBI Space Observatory Programme) were involved into this experiment. Moreover, 27 antennae of VLA (Very Large Array)} were used as an additional ground an...

  15. VLTI/AMBER differential interferometry of the broad-line region of the quasar 3C273

    CERN Document Server

    Petrov, Romain G; Lagarde, Stéphane; Vannier, Martin; Rakshit, Suvendu; Marconi, Alessandro; Weigelt, Gerd

    2014-01-01

    Unveiling the structure of the Broad Line Region (BLR) of AGNs is critical to understand the quasar phenomenon. Resolving a few BLRs by optical interferometry will bring decisive information to confront, complement and calibrate the reverberation mapping technique, basis of the mass-luminosity relation in quasars. BLRs are much smaller than the angular resolution of the VLT and Keck interferometers and they can be resolved only by differential interferometry very accurate measurements of differential visibility and phase as a function of wavelength. The latter yields the photocenter variation with wavelength, and constrains the size, position and velocity law of various regions of the BLR. AGNs are below the magnitude limit for spectrally resolved interferometry set by currently available fringe trackers. A new "blind" observation method and a data processing based on the accumulation of 2D Fourier power and cross spectra permitted us to obtain the first spectrally resolved interferometric observation of a BL...

  16. VLTI/AMBER differential interferometry of the broad-line region of the quasar 3C273

    OpenAIRE

    Petrov, Romain G.; Millour, Florentin; Lagarde, Stéphane; Vannier, Martin; Rakshit, Suvendu; Marconi, Alessandro; Weigelt, Gerd

    2014-01-01

    Unveiling the structure of the Broad Line Region (BLR) of AGNs is critical to understand the quasar phenomenon. Resolving a few BLRs by optical interferometry will bring decisive information to confront, complement and calibrate the reverberation mapping technique, basis of the mass-luminosity relation in quasars. BLRs are much smaller than the angular resolution of the VLT and Keck interferometers and they can be resolved only by differential interferometry very accurate measurements of diff...

  17. SU-E-J-273: Skin Temperature Recovery Rate as a Potential Predictor for Radiation-Induced Skin Reactions

    Energy Technology Data Exchange (ETDEWEB)

    Biswal, N C; Wu, Z; Chu, J [Rush University Medical Center, Chicago, IL (United States); Sun, J [Argonne National Laboratory, Lemont, IL (United States)

    2015-06-15

    Purpose: To assess the potential of dynamic infrared imaging to evaluate early skin reactions during radiation therapy in cancer patients. Methods: Thermal images were captured by our home-built system consisting of two flash lamps and an infrared (IR) camera. The surface temperature of the skin was first raised by ∼ 6 °C from ∼1 ms short flashes; the camera then captured a series of IR images for 10 seconds. For each image series, a basal temperature was recorded for 0.5 seconds before flash was triggered. The temperature gradients (ε) were calculated between a reference point (immediately after the flash) and at a time point of 2sec, 4sec and 9sec after that. A 1.0 cm region of interest (ROI) on the skin was drawn; the mean and standard deviations of the ROIs were calculated. The standard ε values for normal human skins were evaluated by imaging 3 healthy subjects with different skin colors. All of them were imaged on 3 separate days for consistency checks. Results: The temperature gradient, which is the temperature recovery rate, depends on the thermal properties of underlying tissue, i.e. thermal conductivity. The average ε for three volunteers averaged over 3 measurements were 0.64±0.1, 0.72±0.2 and 0.80±0.3 at 2sec, 4sec and 9sec respectively. The standard deviations were within 1.5%–3.2%. One of the volunteers had a prior small skin burn on the left wrist and the ε values for the burned site were around 9% (at 4sec) and 13% (at 9sec) lower than that from the nearby normal skin. Conclusion: The temperature gradients from the healthy subjects were reproducible within 1.5%–3.2 % and that from a burned skin showed a significant difference (9%–13%) from the normal skin. We have an IRB approved protocol to image head and neck patients scheduled for radiation therapy.

  18. Mark Carey, In the Shadow of Melting Glaciers. Climate Change and Andean Society, Oxford, Oxford University Press, 2010, 273 p.

    OpenAIRE

    Capdevila, Luc

    2012-01-01

    Jusqu’à ces dix dernières années, les recherches sur le changement environnemental dans les milieux montagnards ont principalement été du ressort des sciences de la terre et de la vie. Les sciences de l’homme et de la société ont été peu mobilisées sur ces terrains. Cette situation est encore plus critique lorsqu’il s’agit des massifs montagneux situés hors d’Europe et d’Amérique du nord. Or il est essentiel d’étudier la transformation des écosystèmes montagnards – stress hydrique, désertific...

  19. A simple formulation for thermodynamic properties of steam from 273 to 523 K, explicit in temperature and pressure

    Czech Academy of Sciences Publication Activity Database

    Pátek, Jaroslav; Klomfar, Jaroslav

    2009-01-01

    Roč. 32, č. 5 (2009), s. 1123-1125. ISSN 0140-7007 Institutional research plan: CEZ:AV0Z20760514 Keywords : absorption system * vapour * water * water-lithium bromide Subject RIV: BJ - Thermodynamics Impact factor: 1.537, year: 2009 http:// apps .isiknowledge.com/summary.do?qid=1&product=UA&SID=T2f%407aA433c5aJl9C9C&search_mode=GeneralSearch

  20. AB273. Challenge of AMS700CXR inflatable penile prosthesis for treating patients with severe ED in China

    Science.gov (United States)

    Xin, Zhongcheng

    2016-01-01

    More than 50% of patients with erectile dysfunction (ED) showed erectile tissues pathological changes include corpus cavernous fibrosis, endothelial dysfunction, arterial and/or vein disorder, neuropathy and hormon disorder et al. Currently used on demanded treating ED therapies, include oral medication using PDE5i, intra-cavernosal injection (ICI) therapy, vacuum device et al., the clinical efficacies of reached to 70% with some kinks of adverse events, however, these therapies showed no effects on sever ED with sever pathological changes in erectile tissue. Penile prosthesis implantation (PPI) is the solution of choice in patients who have failed or present contraindication to the use of all conservative treatment for ED. We retrospectively evaluated the clinical outcome of PPI in Chinese patients with severe erectile dysfunction (SED) from July 2000 to December 2011, 224 patients, overall satisfaction with the PPI surgery was reported by 89.0% of men and 82.5% of partners, mechanical malfunction occurred in 4 cases (2.0%) and 3 cases were re-implanted new device, and 2 cases (1.0%) developed a mild curvature of the penis. Scrotal erosion with infection occurred in 1 case with diabetes mellitus (0.5%) and required complete removal of the implanted AMS 700 CXM. After 3 years no PPI device available in China, AMS 700CXR finally approved by China SDA recently, and the quality this device is improved very much compared to AMS700CXM, and the long-term mechanical reliability studies on AMS 700CXR noted that the clinical efficacy and device service of AMS 700CXR showed significantly better than that of AMS 700 CXM, which yields excellent results in terms of cosmetic and functional outcome and therefore has a significant impact on patients' satisfaction, sex life and overall quality of life. Overall, long term reliability has been significantly improved and complication rates are low in the hands of experienced surgeons.

  1. NUCLEAR CHEMISTRY: Element 107 Leaves the Table Unturned.

    Science.gov (United States)

    Service, R F

    2000-08-25

    This week, an international team of chemists reported on the first successful analysis of the chemical properties of bohrium, element 107. The results matched predictions, postponing scientists' hopes of seeing interesting deviations from theory among ultraheavy elements. PMID:17772986

  2. Mendeleev's principle against Einstein's relativity: news from the chemistry of superheavy elements

    Energy Technology Data Exchange (ETDEWEB)

    Gaeggeler, Heinz W [Department of Chemistry and Biochemistry, University of Bern, Bern (Switzerland)

    2009-12-31

    The review briefly considers the problems of synthesis and chemical identification of superheavy elements. The specific features of their properties are determined by the relativistic effects. The synthesis and chemical investigations into bohrium and element 112 are discussed as examples.

  3. Mendeleev's principle against Einstein's relativity: news from the chemistry of superheavy elements

    International Nuclear Information System (INIS)

    The review briefly considers the problems of synthesis and chemical identification of superheavy elements. The specific features of their properties are determined by the relativistic effects. The synthesis and chemical investigations into bohrium and element 112 are discussed as examples.

  4. Mendeleev's principle against Einstein's relativity: news from the chemistry of superheavy elements

    Science.gov (United States)

    Gäggeler, Heinz W.

    2009-12-01

    The review briefly considers the problems of synthesis and chemical identification of superheavy elements. The specific features of their properties are determined by the relativistic effects. The synthesis and chemical investigations into bohrium and element 112 are discussed as examples.

  5. Fema (273, 356, 368, 369, 440), Eurocode 8 ve DBYBHY (2007) Yönetmeliklerinde Yapı-Zemin Etkileşimi Problemi

    OpenAIRE

    ÇELİK, İlyas Devran; Mehmet FENKLİ; Mustafa SİVRİ; KIMILLI, Nurettin Alpay; Bayraktar, Deniz

    2015-01-01

    Under dynamic loads such as earthquakes, soil-structure interaction is independent of the behavior of the structure is not in question. At the impact of the structure on the ground, so the ground floor of the structure will change from both kinematic and dynamic maintenance, building the behavior of the structure will affect the behavior of the ground. However, in practice often it is neglected in this case. Today, only the soil-structure interaction is taken into account in modern earthquake...

  6. Effects of using the simplified airway risk index vs usual airway assessment on unanticipated difficult tracheal intubation - a cluster randomized trial with 64,273 participants

    DEFF Research Database (Denmark)

    Kehlet Nørskov, Anders; Wetterslev, J; Rosenstock, C V;

    2016-01-01

    BACKGROUND: Unanticipated difficult intubation remains a challenge in anaesthesia. The Simplified Airway Risk Index (SARI) is a multivariable risk model consisting of seven independent risk factors for difficult intubation. Our aim was to compare preoperative airway assessment based on the SARI w...

  7. A computationally effective formulation of the thermodynamic properties of LiBr-H2O solutions from 273 to 500 K over full composition range

    Czech Academy of Sciences Publication Activity Database

    Pátek, Jaroslav; Klomfar, Jaroslav

    2006-01-01

    Roč. 29, č. 4 (2006), s. 566-578. ISSN 0140-7007 Institutional research plan: CEZ:AV0Z20760514 Keywords : water -lithium bromide * aqueous solution * thermodynamic properties Subject RIV: BJ - Thermodynamics Impact factor: 0.936, year: 2006

  8. Emissions Inventory Report Summary: Reporting Requirements for the New Mexico Administrative Code, Title 20, Chapter 2, Part 73 (20 NMAC 2.73) for Calendar Year 2001

    Energy Technology Data Exchange (ETDEWEB)

    Margorie Stockton

    2003-04-01

    Los Alamos National Laboratory is subject to annual emissions-reporting requirements for regulated air contaminants under Title 20 of the New Mexico Administrative Code, Chapter 2, Part 73 (20.2.73 NMAC), Notice of Intent and Emissions Inventory Requirements. The applicability of the requirements is based on the Laboratory's potential to emit 100 tons per year of suspended particulate matter, nitrogen oxides, carbon monoxide, sulfur oxides, or volatile organic compounds. For calendar year 2001, the Technical Area 3 steam plant was the primary source of criteria air pollutants from the Laboratory, while research and development activities were the primary source of volatile organic compounds. Emissions of beryllium and aluminum were reported for activities permitted under 20.2.72 NMAC. Hazardous air pollutant emissions from chemical use for research and development activities were also reported.

  9. Modulation of gene expression in U251 glioblastoma cells by binding of mutant p53 R273H to intronic and intergenic sequences

    Czech Academy of Sciences Publication Activity Database

    Brázdová, Marie; Quante, T.; Tögel, L.; Walter, K.; Loscher, Ch.; Tichý, Vlastimil; Činčárová, Lenka; Deppert, W.; Tolstonog, G.V.

    2009-01-01

    Roč. 37, č. 5 (2009), s. 1486-1500. ISSN 0305-1048 R&D Projects: GA ČR(CZ) GP204/06/P369; GA ČR(CZ) GA204/08/1560; GA MŠk(CZ) 1K04119 Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : mutant p53 * cancer * gene expression Subject RIV: BO - Biophysics Impact factor: 7.479, year: 2009

  10. SU-E-T-273: Radiation Shielding for a Fixed Horizontal-Beam Linac in a Shipping Container and a Conventional Treatment Vault

    International Nuclear Information System (INIS)

    Purpose: A fixed horizontal-beam linac, where the patient is treated in a seated position, could lower the overall costs of the treatment unit and room shielding substantially. This design also allows the treatment room and control area to be contained within a reduced space, such as a shipping container. The main application is the introduction of low-cost, high-quality radiation therapy to low- and middle-income regions. Here we consider shielding for upright treatments with a fixed-6MV-beam linac in a shipping container and a conventional treatment vault. Methods: Shielding calculations were done for two treatment room layouts using calculation methods in NCRP Report 151: (1) a shipping container (6m × 2.4m with the remaining space occupied by the console area), and (2) the treatment vault in NCRP 151 (7.8m by 5.4m by 3.4m). The shipping container has a fixed gantry that points in one direction at all times. For the treatment vault, various beam directions were evaluated. Results: The shipping container requires a primary barrier of 168cm concrete (4.5 TVL), surrounded by a secondary barrier of 3.6 TVL. The other walls require between 2.8–3.3 TVL. Multiple shielding calculations were done along the side wall. The results show that patient scatter increases in the forward direction and decreases dramatically in the backward direction. Leakage scatter also varies along the wall, depending largely on the distance between the gantry and the wall. For the treatment room, fixed-beam requires a slightly thicker primary barrier than the conventional linac (0.6 TVL), although this barrier is only needed in the center of one wall. The secondary barrier is different only by 0–0.2 TVL. Conclusion: This work shows that (1) the shipping container option is achievable, using indigenous materials for shielding and (2) upright treatments can be performed in a conventional treatment room with minimal additional shielding. Varian Medical Systems

  11. The Nuclear Structures of Cen A, M87 and 3C273 at Very High Resolution with RadioAstron and the LBA

    Science.gov (United States)

    Reynolds, Cormac; Lobanov, Andrei; Giovannini, Gabriele; Orienti, Monica; Tingay, Steven; Kovalev, Yuri; Krichbaum, Thomas P.; Savolainen, Tuomas; Anderson, James M.

    2013-10-01

    We request 30 hours of LBA time to perform perigee imaging observations with the RadioAstron orbiting VLBI antenna. RadioAstron provides a unique opportunity to image nearby AGN at unprecedented resolution and will allow us to address fundamental questions related to the jet formation process in AGN. The proposed observations can reveal the nuclear structures in these objects down to scales of just a few Schwarzschild radii, a resolution that will allow us to compare observational data on the region where the jets are launched and collimated to the predictions of analytical models and simulations.

  12. Fermi Rules Out the IC/CMB Model for the Large Scale Jet X-ray Emission of 3C 273

    OpenAIRE

    Meyer, Eileen T.; Georganopoulos, Markos

    2013-01-01

    The X-ray emission mechanism in large-scale jets of powerful radio quasars has been a source of debate in recent years, with two competing interpretations: either the X-rays are of synchrotron origin, arising from a different electron energy distribution than that producing the radio to optical synchrotron component, or they are due to inverse Compton scattering of cosmic microwave background photons (IC/CMB) by relativistic electrons in a powerful relativistic jet with bulk Lorentz factor Ga...

  13. Henry's Law Constants of Methane, Nitrogen, Oxygen and Carbon Dioxide in Ethanol from 273 to 498 K: Prediction from Molecular Simulation

    OpenAIRE

    Schnabel, T.; Vrabec, J.; Hasse, H.

    2009-01-01

    noindent Henry's law constants of the solutes methane, nitrogen, oxygen and carbon dioxide in the solvent ethanol are predicted by molecular simulation. The molecular models for the solutes are taken from previous work. For the solvent ethanol, a new rigid anisotropic united atom molecular model based on Lennard-Jones and Coulombic interactions is developed. It is adjusted to experimental pure component saturated liquid density and vapor pressure data. Henry's law constants are calculated by ...

  14. Emissions Inventory Report Summary: Reporting Requirements for the New Mexico Administrative Code, Title 20, Chapter 2, Part 73 (20 NMAC 2.73) for Calendar Year 2001

    International Nuclear Information System (INIS)

    Los Alamos National Laboratory is subject to annual emissions-reporting requirements for regulated air contaminants under Title 20 of the New Mexico Administrative Code, Chapter 2, Part 73 (20.2.73 NMAC), Notice of Intent and Emissions Inventory Requirements. The applicability of the requirements is based on the Laboratory's potential to emit 100 tons per year of suspended particulate matter, nitrogen oxides, carbon monoxide, sulfur oxides, or volatile organic compounds. For calendar year 2001, the Technical Area 3 steam plant was the primary source of criteria air pollutants from the Laboratory, while research and development activities were the primary source of volatile organic compounds. Emissions of beryllium and aluminum were reported for activities permitted under 20.2.72 NMAC. Hazardous air pollutant emissions from chemical use for research and development activities were also reported

  15. Thermodynamic properties of the LiCl-H2O system at vapor-liquid equilibrium from 273 K to 400 K

    Czech Academy of Sciences Publication Activity Database

    Pátek, Jaroslav; Klomfar, Jaroslav

    2008-01-01

    Roč. 31, č. 2 (2008), s. 287-303. ISSN 0140-7007 Institutional research plan: CEZ:AV0Z20760514 Keywords : water * lithium chloride * equation of state Subject RIV: BJ - Thermodynamics Impact factor: 1.458, year: 2008

  16. Corrigendum to “Sorption/desorption of non-hydrophobic and ionisable pharmaceutical and personal care products from reclaimed water onto/from a natural sediment” Sci Total Environ 472 (2014) 273–281

    International Nuclear Information System (INIS)

    In the present work, the sorption of pharmaceutical and personal care products (PPCPs) (acetaminophen, atenolol, carbamazepine, caffeine, naproxen and sulphamethoxazole) onto the natural organic matter (NOM) and the inorganic surfaces of a natural sandy loam sediment was quantified separately. The quantification was based on the PPCP charge, their degree of ionisation, their octanol-water partitioning coefficient (KOW) and the sediment organic carbon fraction (ƒOC). PPCP desorption from the sediment was examined under conditions of infiltrating water containing a high concentration of inorganic ions (mimicking infiltrating reclaimed water), and a low concentration (and smaller diversity) of inorganic ions (mimicking rainwater infiltration). Batch tests were performed using a sediment/water ratio of 1:4 and a PPCP initial concentration ranging from 1 to 100 μg L−1. The results showed the type and degree of PPCP ionisation to strongly influence the sorption of these compounds onto the sediment. The sorption of cationic species onto the sediment was higher than that of anionic species and mostly reversible; the sorption of neutral species was negligible with the exception of caffeine. The anionic species sorbed less onto the sediment, but also desorbed less easily. Most of the compounds showed a sorption that was highly influenced by interaction with mineral surfaces. The presence of inorganic ions had no impact on the desorption of the PPCPs from the sediment. According to the calculated percentages of removal, the mobility followed the order: carbamazepine > acetaminophen > naproxen > atenolol > sulphamethoxazole > caffeine

  17. Corrigendum to “Sorption/desorption of non-hydrophobic and ionisable pharmaceutical and personal care products from reclaimed water onto/from a natural sediment” Sci Total Environ 472 (2014) 273–281

    Energy Technology Data Exchange (ETDEWEB)

    Martínez-Hernández, Virtudes, E-mail: virtudes.martinez@imdea.org [IMDEA Agua, Madrid Institute for Advanced Studies in Water, Parque Científico Tecnológico de la Universidad de Alcalá, 28805 Alcalá de Henares, Madrid (Spain); Meffe, Raffaella; Herrera, Sonia [IMDEA Agua, Madrid Institute for Advanced Studies in Water, Parque Científico Tecnológico de la Universidad de Alcalá, 28805 Alcalá de Henares, Madrid (Spain); Arranz, Elena [University of Alcalá, Geography and Geology Department, 28871 Alcalá de Henares, Madrid (Spain); Bustamante, Irene de [IMDEA Agua, Madrid Institute for Advanced Studies in Water, Parque Científico Tecnológico de la Universidad de Alcalá, 28805 Alcalá de Henares, Madrid (Spain); University of Alcalá, Geography and Geology Department, 28871 Alcalá de Henares, Madrid (Spain)

    2015-02-01

    In the present work, the sorption of pharmaceutical and personal care products (PPCPs) (acetaminophen, atenolol, carbamazepine, caffeine, naproxen and sulphamethoxazole) onto the natural organic matter (NOM) and the inorganic surfaces of a natural sandy loam sediment was quantified separately. The quantification was based on the PPCP charge, their degree of ionisation, their octanol-water partitioning coefficient (K{sub OW}) and the sediment organic carbon fraction (ƒ{sub OC}). PPCP desorption from the sediment was examined under conditions of infiltrating water containing a high concentration of inorganic ions (mimicking infiltrating reclaimed water), and a low concentration (and smaller diversity) of inorganic ions (mimicking rainwater infiltration). Batch tests were performed using a sediment/water ratio of 1:4 and a PPCP initial concentration ranging from 1 to 100 μg L{sup −1}. The results showed the type and degree of PPCP ionisation to strongly influence the sorption of these compounds onto the sediment. The sorption of cationic species onto the sediment was higher than that of anionic species and mostly reversible; the sorption of neutral species was negligible with the exception of caffeine. The anionic species sorbed less onto the sediment, but also desorbed less easily. Most of the compounds showed a sorption that was highly influenced by interaction with mineral surfaces. The presence of inorganic ions had no impact on the desorption of the PPCPs from the sediment. According to the calculated percentages of removal, the mobility followed the order: carbamazepine > acetaminophen > naproxen > atenolol > sulphamethoxazole > caffeine.

  18. Crystal structure of ATVORF273, a new fold for a thermo- and acido-stable protein from the Acidianus two-tailed virus

    DEFF Research Database (Denmark)

    Felisberto-Rodrigues, Catarina; Blangy, Stéphanie; Goulet, Adeline; Vestergaard, Gisle Alberg; Cambillau, Christian; Garrett, Roger Antony; Ortiz-Lombardía, Miguel

    2012-01-01

    Acidianus two-tailed virus (ATV) infects crenarchaea of the genus Acidianus living in terrestrial thermal springs at extremely high temperatures and low pH. ATV is a member of the Bicaudaviridae virus family and undergoes extra-cellular development of two tails, a process that is unique in the...... tetramer, computed from small-angle X-ray scattering (SAXS) data. The crystal structure has properties typical of hyperthermostable proteins, including a relatively high number of salt bridges. However, the protein also exhibits flexible loops and surface pockets. Remarkably, ATV[Formula: see text...

  19. Research Progress of 2.7-3 μm Rare Earth Laser Crystals%2.7~3 μm稀土激光晶体研究进展

    Institute of Scientific and Technical Information of China (English)

    陈家康; 孙敦陆; 张会丽; 窦仁勤; 罗建乔; 刘文鹏; 张庆礼; 殷绍唐

    2013-01-01

    本文介绍了以稀土Er3+和Ho3+为激活离子,YAG,YAP,YLF,YSGG,GSGG为基质的2~7~3μm激光晶体的特点和应用背景,展示了其中一些晶体的吸收和荧光光谱,讨论了这些晶体的能级结构、光谱和激光特性及器件研究进展,并认为提高效率和激光输出功率以及获得新的特征波长是今后2~7~3 μm激光晶体的主要发展方向.

  20. Ecaterina Oana Brândaş, Motivul mântuirii în capodopere ale literaturii universal, Editura Cărţii de Ştiinţă, Cluj-Napoca, 2012, 273 pagini.

    Directory of Open Access Journals (Sweden)

    Alexandra Denisa IGNA

    2013-01-01

    Full Text Available Cartea doamnei Ecaterina Oana Brîndaş, lector universitar de limba engleză la Universitatea Emanuel din Oradea, prezintă o examinare comparativă a motivului biblic al mântuirii în capodopere ale literaturii universale. Autoarea porneşte de la premisa că orice operă de valoare este implicit religioasă şi explică acest lucru prin natura inspiraţiei ca prezenţă divină şi impuls creator. Despre relaţia Bibliei cu literatura s-a scris foarte mult. Bibliografia de la sfârşitul cărţii confirmă şi îndrumă în această privinţă

  1. AcEST: DK946829 [AcEST

    Lifescience Database Archive (English)

    Full Text Available HYW 60 Query: 190 QYTNCYNWHDLTMVCENHRMKNVIKENK 273 Q D+TM+ + R K ++++ + Sbjct: 61 Q--------DMTMMLDQKRWKKILEK...LASNIKSLPHYW 60 Query: 190 QYTNCYNWHDLTMVCENHRMKNVIKENK 273 Q D+TM+ + R K ++++ + Sbjct: 61 Q--------DMTMM

  2. Protein (Viridiplantae): 297825487 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 273 81972:1273 hypothetical protein ARALYDRAFT_901062 Arabidopsis lyrata subsp. lyrata MAKPAKGKNKSLLDCSPLLEELPQSPDC...RNRGNPEANPRKCNMAKPAKDKNKSLLDCSPLLEELPQSPDCRNRGNPEANPRKCNMAKPAKDKNKSLLDCSPLLEELPQSPDC

  3. 40 CFR 261.9 - Requirements for Universal Waste.

    Science.gov (United States)

    2010-07-01

    ... hazardous waste. The wastes listed in this section are subject to regulation under 40 CFR part 273: (a) Batteries as described in 40 CFR 273.2; (b) Pesticides as described in § 273.3 of this chapter; (c) Mercury... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Requirements for Universal Waste....

  4. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC273 (Link to dictyBase) - - - Contig-U16382-1 VFC273P (Link... to Original site) VFC273F 538 VFC273Z 633 VFC273P 1171 - - Show VFC273 Library VF (Link to library) Clone ID VFC273 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Original site URL http://dict...lue N AC116957 |AC116957.2 Dictyostelium discoideum chromosome 2 map 1685067-2090751 strain AX4, complete se...quence. 1146 0.0 5 X03281 |X03281.1 Dictyostelium discoideum gene for actin A8. 1

  5. Chemical properties of transactinides

    Science.gov (United States)

    Gäggeler, H. W.

    2005-09-01

    First investigations of chemical properties of bohrium (Z = 107) and hassium (Z = 108) showed an expected behaviour as ordinary members of groups 7 and 8 of the periodic table. Two attempts to study element 112 yielded some indication for a behaviour like a very volatile noble metal. However, a very recent experiment to confirm this preliminary observation failed. Two examples are described how chemical studies may help to support element discovery claims from purely physics experiments. The two examples are the discovery claims of the elements 112 and 115, respectively, where the progenies hassium and dubnium were chemically identified.

  6. Chemical properties of transactinides

    International Nuclear Information System (INIS)

    First investigations of chemical properties of bohrium (Z = 107) and hassium (Z = 108) showed an expected behaviour as ordinary members of groups 7 and 8 of the periodic table. Two attempts to study element 112 yielded some indication for a behaviour like a very volatile noble metal. However, a very recent experiment to confirm this preliminary observation failed. Two examples are described how chemical studies may help to support element discovery claims from purely physics experiments. The two examples are the discovery claims of the elements 112 and 115, respectively, where the progenies hassium and dubnium were chemically identified. (orig.)

  7. Chemical properties of transactinides

    Energy Technology Data Exchange (ETDEWEB)

    Gaeggeler, H.W. [Paul Scherrer Institut, Villigen (Switzerland); University of Bern, Bern (Switzerland)

    2005-09-01

    First investigations of chemical properties of bohrium (Z = 107) and hassium (Z = 108) showed an expected behaviour as ordinary members of groups 7 and 8 of the periodic table. Two attempts to study element 112 yielded some indication for a behaviour like a very volatile noble metal. However, a very recent experiment to confirm this preliminary observation failed. Two examples are described how chemical studies may help to support element discovery claims from purely physics experiments. The two examples are the discovery claims of the elements 112 and 115, respectively, where the progenies hassium and dubnium were chemically identified. (orig.)

  8. Chemistry of Transactinides

    Science.gov (United States)

    Kratz, J. V.

    In this chapter, the chemical properties of the man-made transactinide elements rutherfordium, Rf (element 104), dubnium, Db (element 105), seaborgium, Sg (element 106), bohrium, Bh (element 107), hassium, Hs (element 108), and copernicium, Cn (element 112) are reviewed, and prospects for chemical characterizations of even heavier elements are discussed. The experimental methods to perform rapid chemical separations on the time scale of seconds are presented and comments are given on the special situation with the transactinides where chemistry has to be studied with single atoms. It follows a description of theoretical predictions and selected experimental results on the chemistry of elements 104 through 108, and element 112.

  9. Systematic study of Bh isotopes in a relativistic mean field formalism

    Science.gov (United States)

    Mehta, M. S.; Raj, B. K.; Patra, S. K.; Gupta, Raj K.

    2002-10-01

    The binding energy, charge radius, and quadrupole deformation parameter for the isotopic chain of the superheavy element bohrium (107Bh), from proton to neutron drip line, are calculated by using an axially deformed relativistic mean field model. The potential energy surfaces for some of the selected nuclei are plotted and the various possible shapes are investigated. The rms radii, density distributions, and two-neutron separation energies are also evaluated and the single-particle energies for some illustrative cases are analyzed to see the magic structures. Furthermore, the α-decay rates are calculated and compared with the available experimental data for the recently observed new isotopes 266,267Bh.

  10. Systematic study of Bh isotopes in a relativistic mean field formalism

    International Nuclear Information System (INIS)

    The binding energy, charge radius, and quadrupole deformation parameter for the isotopic chain of the superheavy element bohrium (107Bh), from proton to neutron drip line, are calculated by using an axially deformed relativistic mean field model. The potential energy surfaces for some of the selected nuclei are plotted and the various possible shapes are investigated. The rms radii, density distributions, and two-neutron separation energies are also evaluated and the single-particle energies for some illustrative cases are analyzed to see the magic structures. Furthermore, the α-decay rates are calculated and compared with the available experimental data for the recently observed new isotopes 266,267Bh

  11. Quaderni di filologia e lingue romanze 7 (1992, Supplemento Terza serie, Attidel Convegno "Relazione di viaggi fra Italia e Spagna" Macerata, Università degli Studi, 15-17 dicembre 1992, 259 pp.; 8(1993, 273 pp.; 9(1994, 285 pp.; 10(1995, 346 pp.

    Directory of Open Access Journals (Sweden)

    Pavao Tekavčić

    2015-09-01

    Full Text Available Il periodico maceratese, nato nel 1979, continua ad apparire a ritmo annuale re­ golare. Avendo recensito i voll. 1985-1992 nel numero 34 di «Linguistica», presen­ tiamo qui le annate citate nel titolo, concentrandoci sempre sui contributi di interesse linguistico (o almeno filologico, che continuano ad essere in minoranza di fronte a quelli di argomento letterario.

  12. Ket qua hop tác nghiên cuu ve quan ly tài nguyên &273;at giua vien nghiên cuu phát trien pháp và vien tho nh&432;ong nông hóa

    OpenAIRE

    Rochelle Newall, Emma; Do Duy Phai; Janeau, Jean-Louis; Jouquet, Pascal; Henry des Tureaux, Thierry; Maeght, Jean-Luc; Nguyen Duy Phuong; Nguyen Van Thiet; Orange, Didier; Pham Dinh Rinh; Podwojewski, Pascal; Ribolzi, Olivier; De Rouw, Anneke; Silvera, Norbert; Doan Thi Thuy

    2015-01-01

    For almost two decades, the French Institut de Recherche pour le Développement (IRD) has been working in partnership with the Soils and Fertilizer Research Institute (SFRI) to study soil erosion and land use change in the small catchment of Dong Cao, Tien Xuan, North Vietnam. This partnership forms one of the main pillars of the regional Multi - Scale Environmental Changes observatory (MSEC, http://msec.obs - mip.fr/) that was launched in 1998. This network studies three headwater...

  13. Birds of a Feather Flock Together: The Congruence of Personality Types within Librarians’ Subject Specialties. A Review of: Williamson, J.M., A.E. Pemberton, and J.W. Lounsbury. “Personality Traits of Individuals in Different Specialties of Librarianship.” Journal of Documentation 64.2 (2008: 273-86.

    Directory of Open Access Journals (Sweden)

    John Loy

    2008-12-01

    Full Text Available Objectives – To investigate the personality traits of a range of librarians and information professionals using the Personal Style Inventory (PSI, and to investigate whether the personality traits of those in person-orientated library specialties differ from those in technique-orientated specialties.Design – Self-selecting survey.Setting – Solicitations to complete the survey were sent out via 10 e-mail discussion lists, and paper copies were made available at the annual American Library Association conference in 2002.Subjects – 2,075 librarians and information science professionals.Methods – Participants completed the survey either in print format, as an e-mail attachment or a Web form. The survey format was an adaptation of the PSI scale using 13 of the accepted 16 scales, namely: adaptabilityassertivenessautonomyconscientiousnesscustomer service orientation emotional resilienceextraversionopennessoptimismteamworktough-mindednessvisionary-operational work stylework driveResponses were analysed using a two-step cluster analysis technique, and participants were grouped into seven clusters.Main Results – The largest group of respondents was cataloguers at 23.7%, followed by other (health or law 19.1%,academic reference librarians 13.2%, special librarians 12.3% with all other groups in single figures. Respondents were divided up into the following seven clusters. • Cluster 1, the “unadaptive” group -- so labelled because several unadaptive traits such as low emotional resilience, low optimism, low teamwork, and low work drive are included.• Cluster 2, “adaptive academic reference librarians” -- high on customer service orientation, extraversion and teamwork, and low on tough-mindedness.• Cluster 3, “adaptive cataloguers” -- low on customer service orientation and possessing a more operational work style.• Cluster 4, “adaptive special librarians” -- high on autonomy, customer service orientation and extraversion.• Cluster 5, “adaptive distance education librarians, public librarians, records managers, and school librarians” -- possessing a visionary work style and scoring high on adaptability, assertiveness,customer service orientation, emotional resilience, high extraversion, openness, optimism, and teamwork; scoring low on tough-mindedness.• Cluster 6, “adaptive other information professionals” -- also possessing a visionary work style and with high scores on adaptability, assertiveness, autonomy, customer service orientation, emotional resilience, extraversion, openness, optimism, teamwork, and work drive.• Cluster 7, “adaptive archivists and systems librarians” scoring high on assertiveness, openness, and toughmindedness.Most clusters were comprised of a single occupational group, with only Clusters 1 and 5 made up of individuals from more than one group.Conclusion – The results indicate that different librarianship subspecialties can be differentiated by personality traits, and that individuals are likely to be drawn to either person-orientated or technique-orientated library specialties depending on their personality traits.

  14. Antibiofilm and anti-infection of a marine bacterial exopolysaccharide against Pseudomonas aeruginosa.

    Directory of Open Access Journals (Sweden)

    Shimei eWu

    2016-02-01

    Full Text Available Pseudomonas aeruginosa is a well-known pathogenic bacterium that forms biofilms and produces virulence factors, thus leading to major problems in many fields, such as clinical infection, food contamination and marine biofouling. In this study, we report the purification and characterization of an exopolysaccharide EPS273 from the culture supernatant of marine bacterium Pseudomonas stutzeri 273. The exopolysaccharide EPS273 not only effectively inhibits biofilm formation but also disperses preformed biofilm of Pseudomonas aeruginosa PAO1. High performance liquid chromatography traces of the hydrolyzed polysaccharides shows that EPS273 primarily consists of glucosamine, rhamnose, glucose and mannose. Further investigation demonstrates that EPS273 reduces the production of the virulence factors pyocyanin, exoprotease and rhamnolipid, and the virulence of P. aeruginosa PAO1 to human lung cells A549 and zebrafish embryos is also obviously attenuated by EPS273. In addition, EPS273 also greatly reduces the production of hydrogen peroxide (H2O2 and extracellular DNA (eDNA, which are important factors for biofilm formation. Furthermore, EPS273 exhibits strong antioxidant potential by quenching hydroxyl and superoxide anion radicals. Notably, the antibiofouling activity of EPS273 is observed in the marine environment up to two weeks according to the amounts of bacteria and diatoms in the glass slides submerged in the ocean. Taken together, the properties of EPS273 indicate that it has a promising prospect in combating bacterial biofilm-associated infection, food-processing contamination and marine biofouling.

  15. AcEST: DK962936 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0015_D02 566 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0015_D02. 5' end seq ... 19/157 (75%) Frame = +1 Query: 94 MLVYQXXXXXXXXXXXXFPY KEIQNGILWEVEGKWVVKGAVDVDIGANPSAXXXXXXXXX 273 MLVYQ ... LWEV+GKWVV+GA+DVDIGANPSA Sbjct: 1 MLVYQDLLTGDELLSDSFPY REIENGILWEVDGKWVVQGAIDVDIGANPSAEGGGDDEGV 60 Query: ... 18/157 (75%) Frame = +1 Query: 94 MLVYQXXXXXXXXXXXXFPY KEIQNGILWEVEGKWVVKGAVDVDIGANPSAXXXXXXXXX 273 MLVYQ ... 19/157 (75%) Frame = +1 Query: 94 MLVYQXXXXXXXXXXXXFPY KEIQNGILWEVEGKWVVKGAVDVDIGANPSAXXXXXXXXX 273 MLVYQ ...

  16. AcEST: DK955116 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0022_D21 577 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_D21. 5' end seq ... 14/152 (75%) Frame = +1 Query: 94 MLVYQXXXXXXXXXXXXFPY KEIQNGILWEVEGKWVVKGAVDVDIGANPSAXXXXXXXXX 273 MLVYQ ... LWEV+GKWVV+GA+DVDIGANPSA Sbjct: 1 MLVYQDLLTGDELLSDSFPY REIENGILWEVDGKWVVQGAIDVDIGANPSAEGGGDDEGV 60 Query: ... 15/156 (73%) Frame = +1 Query: 94 MLVYQXXXXXXXXXXXXFPY KEIQNGILWEVEGKWVVKGAVDVDIGANPSAXXXXXXXXX 273 MLVYQ ... 13/151 (74%) Frame = +1 Query: 94 MLVYQXXXXXXXXXXXXFPY KEIQNGILWEVEGKWVVKGAVDVDIGANPSAXXXXXXXXX 273 MLVYQ ...

  17. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    International Nuclear Information System (INIS)

    Although originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element 107 Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided

  18. Protein (Cyanobacteria): 292904 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available YP_001656852.1 1117:5118 1118:3354 1125:314 1126:273 449447:1039 phosphate-binding peripl...YIEYGFAKNNKLPMATLQNQAGQFVIPNETNAAATLATVELPENLRAFIVDPPGENSYPIVTYSWMLVYKKYNDPQKALAMEAMIEFGLNQGQEQSAALGYIPLPKNVRERVAAAADVIYPDYTINVD ...

  19. Flight activity and habitat preference of bats in a karstic area, as revealed by bat detectors

    Czech Academy of Sciences Publication Activity Database

    Zukal, Jan; Řehák, Z.

    2006-01-01

    Roč. 55, č. 3 (2006), s. 273-281. ISSN 0139-7893 Institutional research plan: CEZ:AV0Z60930519 Keywords : Moravian Karst * echolocation calls * bat community * detectoring Subject RIV: EG - Zoology Impact factor: 0.529, year: 2006 http://www.ivb.cz/folia/55/3/273-281.pdf

  20. Drug: D01832 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D01832 Drug Modafinil (JAN/USAN/INN); Provigil (TN) C15H15NO2S 273.0823 273.3501 D01832.gif Anal ... OANALEPTICS N06B PSYCHOSTIMULANTS, AGENTS USED FOR ADHD ... AND NOOTROPICS N06BA Centrally acting sympathomime ...

  1. Too large or too small? Returns to scale in a retail network

    Czech Academy of Sciences Publication Activity Database

    Brázdik, František; Druska, V.

    -, č. 273 (2005), s. 1-45. ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : data envelopment analysis application * linear programming * retail units Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp273.pdf

  2. Drug: D03215 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D03215 Drug Armodafinil (USAN/INN); Nuvigil (TN) C15H15NO2S 273.0823 273.3501 D0321...leep Disorder Agents Sleep Disorders, Other Armodafinil D03215 Armodafinil (USAN/INN) CAS: 112111-43-0 PubCh

  3. Drug: D07340 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D07340 Drug Oxaflozane (INN) C14H18F3NO 273.134 273.294 D07340.gif ATC code: N06AX10 Anatomical ... r08303] N NERVOUS SYSTEM N06 PSYCHOANALEPTICS N06A ANTIDEPRESSANTS ... N06AX Other antidepressants ... N06AX10 Oxaflozane D07 ...

  4. Methodological developments and applications of neutron activation analysis

    Czech Academy of Sciences Publication Activity Database

    Kučera, Jan

    2007-01-01

    Roč. 273, č. 2 (2007), s. 273-280. ISSN 0236-5731 Institutional research plan: CEZ:AV0Z10480505 Keywords : neutron activation analysis * radiochemical separation Subject RIV: BE - Theoretical Physics Impact factor: 0.499, year: 2007

  5. 76 FR 59927 - Treatment of Aliens Whose Employment Creation Immigrant (EB-5) Petitions Were Approved After...

    Science.gov (United States)

    2011-09-28

    ... SECURITY 8 CFR Parts 216 and 245 RIN 1615-AA90 Treatment of Aliens Whose Employment Creation Immigrant (EB... applications and petitions of qualifying aliens whose employment-creation immigrant petitions were approved by...-273 Provisions C. Summary of the Adjudications Required by Public Law 107-273 III. Aliens Eligible...

  6. The importance and measurement of new production

    Digital Repository Service at National Institute of Oceanography (India)

    Platt, T.; Jauhari, P.; Sathyendranath, S.

    stream_size 12 stream_content_type text/plain stream_name Primary_Prod_Biogeochem_Cycle_Sea_1992_273.pdf.txt stream_source_info Primary_Prod_Biogeochem_Cycle_Sea_1992_273.pdf.txt Content-Encoding ISO-8859-1 Content-Type text.../plain; charset=ISO-8859-1 ...

  7. Dicty_cDB: AFK185 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 497988 |pid:none) Polypterus senegalus enolase B mRN... 273 2e-72 DQ497989_1( DQ4...97989 |pid:none) Typhlonectes natans enolase B mRNA... 273 3e-72 DQ497985_1( DQ497985 |pid:none) Polypterus senegal

  8. Drug: D00786 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D00786 Drug Tolcapone (JAN/USAN/INN); Tasmar (TN) C14H11NO5 273.0637 273.2408 D00786.gif Antiparkinson...12) Dopaminergic synapse map07057 Antiparkinsonian agents map07216 Catecholamine ...capone (JAN/USAN/INN) USP drug classification [BR:br08302] Antiparkinson Agents Antiparkinson

  9. AcEST: DK957002 [AcEST

    Lifescience Database Archive (English)

    Full Text Available = 82/86 (95%) Frame = +1 Query: 94 MVLSNDIDLLHPPAEVEKKKHKLKRLVQSPNSYFMDVKCQGCFSITTVFSHSQTVVLCGN 273 MVL NDI...DLL+PPAE+EK+KHKLKRLVQSPNS+FMDVKCQGCF+ITTVFSHSQTVV+CGN Sbjct: 1 MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNI..., Positives = 78/84 (92%) Frame = +1 Query: 94 MVLSNDIDLLHPPAEVEKKKHKLKRLVQSPNSYFMDVKCQGCFSITTVFSHSQTVVLCGN ...273 MVL NDIDLLHPP E+EK+KHKLKRLVQSPNS+FMDVKCQGCF+ITTVFSHSQTVV+CGN Sbjct: 1 MVLQNDI...DLLHPPPELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGN 60 Query: 274 CSAVLCQPTGGRARLTEGSSFRKK 345 C VLCQPTGG+

  10. Gas phase chemistry of the transactinides

    Science.gov (United States)

    Türler, A.

    1999-01-01

    In the past few years the gas phase chemistry of the first three transactinide elements rutherfordium (element 104), dubnium (element 105) and seaborgium (element 106) has been studied experimentally using OLGA, the On-line Gas chemistry Apparatus, developed at Paul Scherrer Institute. In each experiment, the investigated transactinide element was identified by measuring the characteristic decay properties of its isotopes. In the chemistry of rutherfordium and dubnium evidence for relativistic effects were found, as predicted previously in theoretical calculations. For the first time, the volatility of Sg oxychlorides in comparison to its lighter homologues W and Mo was measured. Also, the half-lives and SF-branches of the nuclides 265Sg and 266Sg were determined. Finally, prospects for a chemical separation of bohrium (element 107) and hassium (element 108) using gas phase chemistry will be discussed.

  11. Gas phase chemistry of the transactinides

    International Nuclear Information System (INIS)

    In the past few years the gas phase chemistry of the first three transactinide elements Rutherfordium (element 104), Dubnium (element 105) and Seaborgium (element 106) has been studied experimentally using OLGA, the On-line Gas chemistry Apparatus, developed at Paul Scherrer Institute. In each experiment, the investigated transactinide element was identified by measuring the characteristic decay properties of its isotopes. In the chemistry of Rutherfordium and Dubnium evidence for relativistic effects were found, as predicted previously in theoretical calculations. For the first time, the volatility of Sg oxychlorides in comparison to its lighter homologues W and Mo was measured. Also, the half-lives and SF-branches of the nuclides 265Sg and 266Sg were determined. Finally, prospects for a chemical separation of Bohrium (element 107) and Hassium (108) using gas phase chemistry will be discussed. (author)

  12. Heavy-element chemistry - Status and perspectives

    International Nuclear Information System (INIS)

    In the past ten years, nuclear chemists have made considerable progress in developing fast on-line separation techniques, which allowed to chemically characterize the first four transactinide elements Rf (rutherfordium, Z=104), Db (dubnium, Z=105), Sg (seaborgium, Z=106), and recently also Bh (bohrium, Z=107). In all cases the isolated nuclides were unambiguously identified by observing genetically linked decay chains. Nuclides with production cross-sections of less than 100 pb and half-lives as short as a few seconds have been chemically isolated. Thus, chemists have discovered or significantly contributed to the characterization of the nuclear-decay properties of a number of transactinide nuclei. New techniques with greatly improved overall efficiencies should allow chemists to extend their studies to even heavier elements such as Hs (hassium, Z=108) and to the recently discovered superheavy elements with Z=112 and 114, which can be produced only with picobarn cross-sections. (orig.)

  13. Heavy-element chemistry --Status and perspectives

    Science.gov (United States)

    Türler, A.

    In the past ten years, nuclear chemists have made considerable progress in developing fast on-line separation techniques, which allowed to chemically characterize the first four transactinide elements Rf (rutherfordium, Z = 104), Db (dubnium, Z = 105), Sg (seaborgium, Z = 106), and recently also Bh (bohrium, Z = 107). In all cases the isolated nuclides were unambiguously identified by observing genetically linked decay chains. Nuclides with production cross-sections of less than 100 pb and half-lives as short as a few seconds have been chemically isolated. Thus, chemists have discovered or significantly contributed to the characterization of the nuclear-decay properties of a number of transactinide nuclei. New techniques with greatly improved overall efficiencies should allow chemists to extend their studies to even heavier elements such as Hs (hassium, Z = 108) and to the recently discovered superheavy elements with Z = 112 and 114, which can be produced only with picobarn cross-sections.

  14. Gas phase chemistry of the transactinides

    International Nuclear Information System (INIS)

    In the past few years the gas phase chemistry of the first three transactinide elements rutherfordium (element 104), dubnium (element 105) and seaborgium (element 106) has been studied experimentally using OLGA, the On-line Gas chemistry Apparatus, developed at Paul Scherrer Institute. In each experiment, the investigated transactinide element was identified by measuring the characteristic decay properties of its isotopes. In the chemistry of rutherfordium and dubnium evidence for relativistic effects were found, as predicted previously in theoretical calculations. For the first time, the volatility of Sg oxychlorides in comparison to its lighter homologues W and Mo was measured. Also, the half-lives and SF-branches of the nuclides 265Sg and 266Sg were determined. Finally, prospects for a chemical separation of bohrium (element 107) and hassium (element 108) using gas phase chemistry will be discussed. (author)

  15. Heavy-element chemistry - Status and perspectives

    Energy Technology Data Exchange (ETDEWEB)

    Tuerler, A. [Paul Scherrer Institut, Villigen (Switzerland); Bern univ. (Switzerland)

    2002-10-01

    In the past ten years, nuclear chemists have made considerable progress in developing fast on-line separation techniques, which allowed to chemically characterize the first four transactinide elements Rf (rutherfordium, Z=104), Db (dubnium, Z=105), Sg (seaborgium, Z=106), and recently also Bh (bohrium, Z=107). In all cases the isolated nuclides were unambiguously identified by observing genetically linked decay chains. Nuclides with production cross-sections of less than 100 pb and half-lives as short as a few seconds have been chemically isolated. Thus, chemists have discovered or significantly contributed to the characterization of the nuclear-decay properties of a number of transactinide nuclei. New techniques with greatly improved overall efficiencies should allow chemists to extend their studies to even heavier elements such as Hs (hassium, Z=108) and to the recently discovered superheavy elements with Z=112 and 114, which can be produced only with picobarn cross-sections. (orig.)

  16. Production and chemistry of transactinide elements

    International Nuclear Information System (INIS)

    Recent progress in production and chemistry of the transactinide elements, element 107 bohrium (Bh) and element 104 rutherfordium (Rf), is reviewed. First information on chemical properties of Bh was obtained in gas chromatographic experiments on an atom-at-a-time basis. Chemical separation and characterization of 6 atoms of 267Bh produced in the bombardment of a 249Bk target with 22Ne beams are outlined. Aqueous chemistry of Rf being performed at JAERI (Japan Atomic Energy Research Institute) is briefly summarized. On-line anion-exchange experiments in acidic solutions on 261Rf produced in the 248Cm(18O,5n) reaction were conducted with a rapid ion-exchange separation apparatus. Characteristic anion-exchange behavior of Rf is discussed. (author)

  17. Transition metals and their carbides and nitrides: Trends in electronic and structural properties

    International Nuclear Information System (INIS)

    A study of the structural and electronic properties of selected transition metals and their carbides and nitrides is presented. We focus on assessing trends of possible importance for understanding their hardness. Lattice constants, bulk moduli (Bo), and charge densities are calculated using the local density approximation with a pseudopotential plane wave approach. An fcc lattice is employed for the transition metal elements in order to make comparisons and study trends relateable to their carbides and nitrides. Our results show that both increasing the number of valence d electrons and the presence of f electrons in the core lead to larger (Bo). Charge density plots and histograms enable us to explain the nature of the charge distribution in the interstitial region for the different compounds considered. In addition, we include the heavier elements seaborgium, bohrium, and hasnium in order to test further trends. Surprisingly, the calculated Bo for Hs is comparable to that of diamond. copyright 1999 The American Physical Society

  18. Transition metals and their carbides and nitrides: Trends in electronic and structural properties

    Science.gov (United States)

    Grossman, Jeffrey C.; Mizel, Ari; Côté, Michel; Cohen, Marvin L.; Louie, Steven G.

    1999-09-01

    A study of the structural and electronic properties of selected transition metals and their carbides and nitrides is presented. We focus on assessing trends of possible importance for understanding their hardness. Lattice constants, bulk moduli (Bo), and charge densities are calculated using the local density approximation with a pseudopotential plane wave approach. An fcc lattice is employed for the transition metal elements in order to make comparisons and study trends relateable to their carbides and nitrides. Our results show that both increasing the number of valence d electrons and the presence of f electrons in the core lead to larger (Bo). Charge density plots and histograms enable us to explain the nature of the charge distribution in the interstitial region for the different compounds considered. In addition, we include the heavier elements seaborgium, bohrium, and hasnium in order to test further trends. Surprisingly, the calculated Bo for Hs is comparable to that of diamond.

  19. Gas phase chemistry of technetium and rhenium oxychlorides

    Energy Technology Data Exchange (ETDEWEB)

    Eichler, R. [Bern Univ. (Switzerland). Abt. fuer Chemie und Biochemie; Eichler, B.; Jost, D.T.; Piguet, D.; Tuerler, A. [Paul Scherrer Inst. (PSI), Villigen (Switzerland); Gaeggeler, H.W. [Bern Univ. (Switzerland). Abt. fuer Chemie und Biochemie; Paul Scherrer Inst. (PSI), Villigen (Switzerland)

    2000-07-01

    The chloride and oxychloride chemistry of the group 7 elements TC and Re was investigated in order to develop an experimental approach to a gas chemical characterisation of bohrium (Bh, element 107). In thermochromatography experiments with trace amounts of {sup 101,104}Tc and {sup 183,184}Re the formation of one volatile compound was observed in O{sub 2}/HCl containing carrier gas, which was attributed to MO{sub 3}Cl (M=Tc, Re). From the measured deposition temperatures the adsorption enthalpies on quartz surfaces {delta}H{sub ads}(TcO{sub 3}Cl)=-51{+-}3 kJ/mol and {delta}H{sub ads}(ReO{sub 3}Cl)=-62{+-}3 kJ/mol were evaluated. The sublimation enthalpies were derived using an empirical correlation between {delta}H{sub ads} and {delta}H{sub subl}: {delta}H{sub subl}(TcO{sub 3}Cl)=49{+-}10 kJ/mol and {delta}H{sub subl}(ReO{sub 3}Cl)=67{+-}10 kJ/mol. A fast gas chemical separation technique for highly volatile compounds of short-lived isotopes based on isothermal gas solid adsorption chromatography (OLGA-principle) was developed. With a modified OLGA device, model studies with the short-lived nuclides {sup 106,107,108}Tc and {sup 169,170,174,176}Re were carried out in preparation of an experimental gas chemical investigation of bohrium (Bh, element 107). Separation times of less than 3 s were achieved. A good separation of the oxychlorides of group 7 elements from chloride and oxychloride compounds of {sup 152-155}Er, {sup 151-154}Ho (as models for actinide elements), {sup 98-101}Nb, {sup 99-102}Zr (as models for light transactinide elements), {sup 218}Po, and {sup 214}Bi was accomplished in this chemical system. (orig.)

  20. Gas phase chemistry of technetium and rhenium oxychlorides

    International Nuclear Information System (INIS)

    The chloride and oxychloride chemistry of the group 7 elements TC and Re was investigated in order to develop an experimental approach to a gas chemical characterisation of bohrium (Bh, element 107). In thermochromatography experiments with trace amounts of 101,104Tc and 183,184Re the formation of one volatile compound was observed in O2/HCl containing carrier gas, which was attributed to MO3Cl (M=Tc, Re). From the measured deposition temperatures the adsorption enthalpies on quartz surfaces ΔHads(TcO3Cl)=-51±3 kJ/mol and ΔHads(ReO3Cl)=-62±3 kJ/mol were evaluated. The sublimation enthalpies were derived using an empirical correlation between ΔHads and ΔHsubl: ΔHsubl(TcO3Cl)=49±10 kJ/mol and ΔHsubl(ReO3Cl)=67±10 kJ/mol. A fast gas chemical separation technique for highly volatile compounds of short-lived isotopes based on isothermal gas solid adsorption chromatography (OLGA-principle) was developed. With a modified OLGA device, model studies with the short-lived nuclides 106,107,108Tc and 169,170,174,176Re were carried out in preparation of an experimental gas chemical investigation of bohrium (Bh, element 107). Separation times of less than 3 s were achieved. A good separation of the oxychlorides of group 7 elements from chloride and oxychloride compounds of 152-155Er, 151-154Ho (as models for actinide elements), 98-101Nb, 99-102Zr (as models for light transactinide elements), 218Po, and 214Bi was accomplished in this chemical system. (orig.)