EVIDENCE FOR SECONDARY EMISSION AS THE ORIGIN OF HARD SPECTRA IN TeV BLAZARS
International Nuclear Information System (INIS)
Zheng, Y. G.; Kang, T.
2013-01-01
We develop a model for the possible origin of hard, very high energy (VHE) spectra from a distant blazar. In the model, both the primary photons produced in the source and secondary photons produced outside it contribute to the observed high-energy γ-ray emission. That is, the primary photons are produced through the synchrotron self-Compton process, and the secondary photons are produced through high-energy proton interactions with background photons along the line of sight. We apply the model to a characteristic case of VHE γ-ray emission in the distant blazar 1ES 1101-232. Assuming suitable electron and proton spectra, we obtain excellent fits to the observed spectra of this blazar. This indicated that the surprisingly low attenuation of the high-energy γ-rays, especially the shape of the VHE γ-ray tail of the observed spectra, can be explained by secondary γ-rays produced in interactions of cosmic-ray protons with background photons in intergalactic space.
γ-Ray Emission from the Extreme Blazar 1ES 0229+200 J. Li, T ...
Indian Academy of Sciences (India)
Abstract. Based on the traditional Synchrotron Self-Compton (SSC) model, we consider a secondary γ-ray emission component to an extreme blazar 1ES 0229 + 200 for the multiwavelength radiation. By assuming a suitable electron spectra and Inter-Galactic Magnetic Field (IGMF), we obtained excellent fits to observed ...
Sosa, M. S.; von Essen, C.; Andruchow, I.; Cellone, S. A.
2017-11-01
Blazars, a type of Active Galactic Nuclei, present a particular orientation of their jets close to the line of sight. Their radiation is thus relativistically beamed, giving rise to extreme behaviors, specially strong variability on very short timescales (I.e., microvariability). Here we present simultaneous photometric and polarimetric observations of two relatively nearby blazars, 1ES 1959+650 and HB89 2201+044, that were obtained using the Calar Alto Faint Object Spectrograph mounted at the 2.2 m telescope in Calar Alto, Spain. An outstanding characteristic of these two blazars is the presence of well resolved host galaxies. This particular feature allows us to produce a study of their intrinsic polarization, a measurement of the polarization state of the galactic nucleus unaffected by the host galaxy. To carry out this work, we computed photometric fluxes from which we calculated the degree and orientation of the blazars polarization. Then, we analyzed the depolarizing effect introduced by the host galaxy with the main goal to recover the intrinsic polarization of the galactic nucleus, carefully taking into consideration the spurious polarimetric variability introduced by changes in seeing along the observing nights. We find that the two blazars do not present intra-night photo-polarimetric variability, although we do detect a significant inter-night variability. Comparing polarimetric values before and after accounting for the host galaxies, we observe a significant difference in the polarization degree of about 1% in the case of 1ES 1959+650, and 0.3% in the case of HB89 2201+044, thus evidencing the non-negligible impact introduced by the host galaxies. We note that this host galaxy effect depends on the waveband, and varies with changing seeing conditions, so it should be particularly considered when studying frequency-dependent polarization in blazars. Based on observations collected at the Centro Astronómico Hispano Alemán (CAHA) at Calar Alto, operated
A Search for Quasi-periodic Oscillations in the Blazar 1ES 1959+650
Energy Technology Data Exchange (ETDEWEB)
Li, Xiao-Pan; Luo, Yu-Hui; Yang, Hai-Yan; Cai, Yan; Yang, Hai-Tao [Department of Physics, Zhaotong University, Zhaotong, 657000 (China); Yang, Cheng, E-mail: lxpzrc@163.com [College of Photoelectron and Communication Engineering, Yunnan Open University, Kunming, 650223 (China)
2017-09-20
We have searched quasi-periodic oscillations (QPOs) in the 15 GHz light curve of the BL Lac object 1ES 1959+650 monitored by the Owens Valley Radio Observatory 40 m telescope during the period from 2008 January to 2016 February, using the Lomb–Scargle Periodogram, power spectral density (PSD), discrete autocorrelation function, and phase dispersion minimization (PDM) techniques. The red noise background has been established via the PSD method, and no QPO can be derived at the 3 σ confidence level accounting for the impact of the red noise variability. We conclude that the light curve of 1ES 1959+650 can be explained by a stochastic red noise process that contributes greatly to the total observed variability amplitude, dominates the power spectrum, causes spurious bumps and wiggles in the autocorrelation function and can result in the variance of the folded light curve decreasing toward lower temporal frequencies when few-cycle, sinusoid-like patterns are present. Moreover, many early supposed periodicity claims for blazar light curves need to be reevaluated assuming red noise.
HIGH-ENERGY NEUTRINOS FROM RECENT BLAZAR FLARES
Energy Technology Data Exchange (ETDEWEB)
Halzen, Francis; Kheirandish, Ali [Wisconsin IceCube Particle Astrophysics Center and Department of Physics, University of Wisconsin, Madison, WI 53706 (United States)
2016-11-01
The energy density of cosmic neutrinos measured by IceCube matches the one observed by Fermi in extragalactic photons that predominantly originate in blazars. This has inspired attempts to match Fermi sources with IceCube neutrinos. A spatial association combined with a coincidence in time with a flaring source may represent a smoking gun for the origin of the IceCube flux. In 2015 June, the Fermi Large Area Telescope observed an intense flare from blazar 3C 279 that exceeded the steady flux of the source by a factor of 40 for the duration of a day. We show that IceCube is likely to observe neutrinos, if indeed hadronic in origin, in data that are still blinded at this time. We also discuss other opportunities for coincident observations that include a recent flare from blazar 1ES 1959+650 that previously produced an intriguing coincidence with AMANDA observations.
Long term monitoring of Gamma-Ray emission from the BL Lacertae object (1ES 2200+420)
Gunawardhana, Isuru; VERITAS Collaboration
2016-03-01
Blazars are a class of Active Galactic Nuclei (AGN) that have relativistic jets pointing along the observer line of sight. Blazars exhibit variable emission extending from radio to TeV energies. The variability timescale of the TeV flux is a key component of understanding the location of the very high energy emission zones. Deep observations of the quiescent state measurements are also required to disentangle the flaring state emission from quiescent state emission, a prerequisite for understanding the origin of blazar spectral variability. BL Lacertae (also known as 1ES 2200+420), as the namesake for all BL Lac objects, is a prime example of one such blazar. The VERITAS Observatory, an Imaging Atmospheric Cherenkov Telescope (IACT) array sensitive to gamma rays in the range from 85 GeV to 30 TeV, dedicates approximately 110 hours per year on deep observations of known gamma-ray blazars. In this talk, I will describe the TeV photon flux variability of BL Lacertae measured by VERITAS from 2013 to 2015.
A Very High Energy Gamma-Ray Spectrum of 1ES 2344+514
Schroedter, M.; Badran, H. M.; Buckley, J. H.; Gordo, J. Bussons; Carter-Lewis, D. A.; Duke, C.; Fegan, D. J.; Fegan, S. F.; Finley, J. P.; Gillanders, G. H.; Grube, J.; Horan, D.; Kenny, G. E.; Kertzman, M.; Kosack, K.
2005-01-01
The BL Lacertae (BL Lac) object 1ES 2344+514 (1ES 2344), at a redshift of 0.044, was discovered as a source of very high energy (VHE) gamma rays by the Whipple Collaboration in 1995 \\citep{2344Catanese98}. This detection was recently confirmed by the HEGRA Collaboration \\citep{2344Hegra03}. As is typical for high-frequency peaked blazars, the VHE gamma-ray emission is highly variable. On the night of 20 December, 1995, a gamma-ray flare of 5.3-sigma significance was detected, the brightest ou...
The classification of flaring states of blazars
Resconi, E.; Franco, D.; Gross, A.; Costamante, L.; Flaccomio, E.
2009-08-01
Aims: The time evolution of the electromagnetic emission from blazars, in particular high-frequency peaked sources (HBLs), displays irregular activity that has not yet been understood. In this work we report a methodology capable of characterizing the time behavior of these variable objects. Methods: The maximum likelihood blocks (MLBs) is a model-independent estimator that subdivides the light curve into time blocks, whose length and amplitude are compatible with states of constant emission rate of the observed source. The MLBs yield the statistical significance in the rate variations and strongly suppresses the noise fluctuations in the light curves. We applied the MLBs for the first time on the long term X-ray light curves (RXTE/ASM) of Mkn 421, Mkn 501, 1ES 1959+650, and 1ES 2155-304, more than 10 years of observational data (1996-2007). Using the MLBs interpretation of RXTE/ASM data, the integrated time flux distribution is determined for each single source considered. We identify in these distributions the characteristic level, as well as the flaring states of the blazars. Results: All the distributions show a significant component at negative flux values, most probably caused by an uncertainty in the background subtraction and by intrinsic fluctuations of RXTE/ASM. This effect concerns in particular short time observations. To quantify the probability that the intrinsic fluctuations give rise to a false identification of a flare, we study a population of very faint sources and their integrated time-flux distribution. We determine duty cycle or fraction of time a source spent in the flaring state of the source Mkn 421, Mkn 501, 1ES 1959+650 and 1ES 2155-304. Moreover, we study the random coincidences between flares and generic sporadic events such as high-energy neutrinos or flares in other wavelengths.
2010-01-01
... of the Nuclear Waste Policy Act of 1982 (96 Stat. 2230), to be used at the request of any party in... 10 Energy 1 2010-01-01 2010-01-01 false Purpose. 2.1101 Section 2.1101 Energy NUCLEAR REGULATORY... Procedures for Expansion of Spent Nuclear Fuel Storage Capacity at Civilian Nuclear Power Reactors § 2.1101...
Radio core dominance of Fermi blazars
Pei, Zhi-Yuan; Fan, Jun-Hui; Liu, Yi; Yuan, Yi-Hai; Cai, Wei; Xiao, Hu-Bing; Lin, Chao; Yang, Jiang-He
2016-07-01
During the first 4 years of mission, Fermi/LAT detected 1444 blazars (3FGL) (Ackermann et al. in Astrophys. J. 810:14, 2015). Fermi/LAT observations of blazars indicate that Fermi blazars are luminous and strongly variable with variability time scales, for some cases, as short as hours. Those observations suggest a strong beaming effect in Fermi/LAT blazars. In the present work, we will investigate the beaming effect in Fermi/LAT blazars using a core-dominance parameter, R = S_{core}/ S_{ext.}, where S_{core} is the core emission, while S_{ext.} is the extended emission. We compiled 1335 blazars with available core-dominance parameter, out of which 169 blazars have γ-ray emission (from 3FGL). We compared the core-dominance parameters, log R, between the 169 Fermi-detected blazars (FDBs) and the rest non-Fermi-detected blazars (non-FDBs), and we found that the averaged values are R+(2.25±0.10), suggesting that a source with larger log R has larger V.I. value. Thirdly, we compared the mean values of radio spectral index for FDBs and non-FDBs, and we obtained < α_{radio}rangle =0.06±0.35 for FDBs and < α_{radio}rangle =0.57±0.46 for non-FDBs. If γ-rays are composed of two components like radio emission (core and extended components), then we can expect a correlation between log R and the γ-ray spectral index. When we used the radio core-dominance parameter, log R, to investigate the relationship, we found that the spectral index for the core component is α_{γ}|_{core} = 1.11 (a photon spectral index of α_{γ}^{ph}|_{core} = 2.11) and that for the extended component is α_{γ}|_{ext.} = 0.70 (a photon spectral index of α_{γ}^{ph}|_{ext.} = 1.70). Some discussions are also presented.
X-Ray Intraday Variability of Five TeV Blazars with NuSTAR
Energy Technology Data Exchange (ETDEWEB)
Pandey, Ashwani; Gupta, Alok C. [Aryabhatta Research Institute of Observational Sciences (ARIES), Manora Peak, Nainital 263002 (India); Wiita, Paul J., E-mail: ashwanitapan@gmail.com, E-mail: acgupta30@gmail.com, E-mail: wiitap@tcnj.edu [Department of Physics, The College of New Jersey, 2000 Pennington Road, Ewing, NJ 08628-0718 (United States)
2017-06-01
We have examined 40 Nuclear Spectroscopic Telescope Array ( NuSTAR ) light curves (LCs) of five TeV emitting high synchrotron peaked blazars: 1ES 0229+200, Mrk 421, Mrk 501, 1ES 1959+650, and PKS 2155−304. Four of the blazars showed intraday variability in the NuSTAR energy range of 3–79 keV. Using an autocorrelation function analysis we searched for intraday variability timescales in these LCs and found indications of several between 2.5 and 32.8 ks in eight LCs of Mrk 421, a timescale around 8.0 ks for one LC of Mrk 501, and timescales of 29.6 and 57.4 ks in two LCs of PKS 2155-304. The other two blazars’ LCs do not show any evidence for intraday variability timescales shorter than the lengths of those observations; however, the data were both sparser and noisier for them. We found positive correlations with zero lag between soft (3–10 keV) and hard (10–79 keV) bands for most of the LCs, indicating that their emissions originate from the same electron population. We examined spectral variability using a hardness ratio analysis and noticed a general “harder-when-brighter” behavior. The 22 LCs of Mrk 421 observed between 2012 July and 2013 April show that this source was in a quiescent state for an extended period of time and then underwent an unprecedented double-peaked outburst while monitored on a daily basis during 2013 April 10–16. We briefly discuss models capable of explaining these blazar emissions.
Bouton, Joseph H; Wood, Donald T
2012-11-27
A switchgrass cultivar designated EG1101 is disclosed. Also disclosed are seeds of switchgrass cultivar EG1101, plants of switchgrass EG1101, plant parts of switchgrass cultivar EG1101 and methods for producing a switchgrass plant produced by crossing switchgrass cultivar EG1101 with itself or with another switchgrass variety. Methods are also described for producing a switchgrass plant containing in its genetic material one or more transgenes and to the transgenic switchgrass plants and plant parts produced by those methods. Switchgrass cultivars or breeding cultivars and plant parts derived from switchgrass variety EG1101, methods for producing other switchgrass cultivars, lines or plant parts derived from switchgrass cultivar EG1101 and the switchgrass plants, varieties, and their parts derived from use of those methods are described herein. Hybrid switchgrass seeds, plants and plant parts produced by crossing the cultivar EG1101 with another switchgrass cultivar are also described.
CONTEMPORANEOUS VLBA 5 GHz OBSERVATIONS OF LARGE AREA TELESCOPE DETECTED BLAZARS
Energy Technology Data Exchange (ETDEWEB)
Linford, J. D.; Taylor, G. B. [Department of Physics and Astronomy, University of New Mexico, MSC07 4220, Albuquerque, NM 87131-0001 (United States); Romani, R. W. [Department of Physics, Stanford University, Stanford, CA 94305 (United States); Helmboldt, J. F. [Naval Research Laboratory, Code 7213, 4555 Overlook Avenue SW, Washington, DC 20375 (United States); Readhead, A. C. S.; Reeves, R.; Richards, J. L. [Astronomy Department, California Institute of Technology, Mail Code 247-17, 1200 East California Boulevard, Pasadena, CA 91125 (United States)
2012-01-10
The radio properties of blazars detected by the Large Area Telescope (LAT) on board the Fermi Gamma-ray Space Telescope have been observed contemporaneously by the Very Long Baseline Array (VLBA). In total, 232 sources were observed with the VLBA. Ninety sources that were previously observed as part of the VLBA Imaging and Polarimetry Survey (VIPS) have been included in the sample, as well as 142 sources not found in VIPS. This very large, 5 GHz flux-limited sample of active galactic nuclei (AGNs) provides insights into the mechanism that produces strong {gamma}-ray emission. In particular, we see that {gamma}-ray emission is related to strong, uniform magnetic fields in the cores of the host AGN. Included in this sample are non-blazar AGNs such as 3C84, M82, and NGC 6251. For the blazars, the total VLBA radio flux density at 5 GHz correlates strongly with {gamma}-ray flux. The LAT BL Lac objects tend to be similar to the non-LAT BL Lac objects, but the LAT flat-spectrum radio quasars (FSRQs) are significantly different from the non-LAT FSRQs. Strong core polarization is significantly more common among the LAT sources, and core fractional polarization appears to increase during LAT detection.
CONTEMPORANEOUS VLBA 5 GHz OBSERVATIONS OF LARGE AREA TELESCOPE DETECTED BLAZARS
International Nuclear Information System (INIS)
Linford, J. D.; Taylor, G. B.; Romani, R. W.; Helmboldt, J. F.; Readhead, A. C. S.; Reeves, R.; Richards, J. L.
2012-01-01
The radio properties of blazars detected by the Large Area Telescope (LAT) on board the Fermi Gamma-ray Space Telescope have been observed contemporaneously by the Very Long Baseline Array (VLBA). In total, 232 sources were observed with the VLBA. Ninety sources that were previously observed as part of the VLBA Imaging and Polarimetry Survey (VIPS) have been included in the sample, as well as 142 sources not found in VIPS. This very large, 5 GHz flux-limited sample of active galactic nuclei (AGNs) provides insights into the mechanism that produces strong γ-ray emission. In particular, we see that γ-ray emission is related to strong, uniform magnetic fields in the cores of the host AGN. Included in this sample are non-blazar AGNs such as 3C84, M82, and NGC 6251. For the blazars, the total VLBA radio flux density at 5 GHz correlates strongly with γ-ray flux. The LAT BL Lac objects tend to be similar to the non-LAT BL Lac objects, but the LAT flat-spectrum radio quasars (FSRQs) are significantly different from the non-LAT FSRQs. Strong core polarization is significantly more common among the LAT sources, and core fractional polarization appears to increase during LAT detection.
Contemporaneous VLBA 5 GHz Observations of Large Area Telescope Detected Blazars
Linford, J. D.; Taylor, G. B.; Romani, R. W.; Helmboldt, J. F.; Readhead, A. C. S.; Reeves, R.; Richards, J. L.
2012-01-01
The radio properties of blazars detected by the Large Area Telescope (LAT) on board the Fermi Gamma-ray Space Telescope have been observed contemporaneously by the Very Long Baseline Array (VLBA). In total, 232 sources were observed with the VLBA. Ninety sources that were previously observed as part of the VLBA Imaging and Polarimetry Survey (VIPS) have been included in the sample, as well as 142 sources not found in VIPS. This very large, 5 GHz flux-limited sample of active galactic nuclei (AGNs) provides insights into the mechanism that produces strong γ-ray emission. In particular, we see that γ-ray emission is related to strong, uniform magnetic fields in the cores of the host AGN. Included in this sample are non-blazar AGNs such as 3C84, M82, and NGC 6251. For the blazars, the total VLBA radio flux density at 5 GHz correlates strongly with γ-ray flux. The LAT BL Lac objects tend to be similar to the non-LAT BL Lac objects, but the LAT flat-spectrum radio quasars (FSRQs) are significantly different from the non-LAT FSRQs. Strong core polarization is significantly more common among the LAT sources, and core fractional polarization appears to increase during LAT detection.
48 CFR 22.1101 - Applicability.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Applicability. 22.1101 Section 22.1101 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION SOCIOECONOMIC... their blue-collar service workers and some white-collar service workers fairly, but it does not cover...
INVESTIGATING BROADBAND VARIABILITY OF THE TeV BLAZAR 1ES 1959+650
International Nuclear Information System (INIS)
Aliu, E.; Archambault, S.; Arlen, T.; Aune, T.; Barnacka, A.; Beilicke, M.; Buckley, J. H.; Bugaev, V.; Benbow, W.; Cerruti, M.; Berger, K.; Bird, R.; Collins-Hughes, E.; Bouvier, A.; Chen, X.; Ciupik, L.; Connolly, M. P.; Cui, W.; Dumm, J.; Eisch, J. D.
2014-01-01
We summarize broadband observations of the TeV-emitting blazar 1ES 1959+650, including optical R-band observations by the robotic telescopes Super-LOTIS and iTelescope, UV observations by Swift Ultraviolet and Optical Telescope, X-ray observations by the Swift X-ray Telescope, high-energy gamma-ray observations with the Fermi Large Area Telescope, and very-high-energy (VHE) gamma-ray observations by VERITAS above 315 GeV, all taken between 2012 April 17 and 2012 June 1 (MJD 56034 and 56079). The contemporaneous variability of the broadband spectral energy distribution is explored in the context of a simple synchrotron self Compton (SSC) model. In the SSC emission scenario, we find that the parameters required to represent the high state are significantly different than those in the low state. Motivated by possible evidence of gas in the vicinity of the blazar, we also investigate a reflected emission model to describe the observed variability pattern. This model assumes that the non-thermal emission from the jet is reflected by a nearby cloud of gas, allowing the reflected emission to re-enter the blob and produce an elevated gamma-ray state with no simultaneous elevated synchrotron flux. The model applied here, although not required to explain the observed variability pattern, represents one possible scenario which can describe the observations. As applied to an elevated VHE state of 66% of the Crab Nebula flux, observed on a single night during the observation period, the reflected emission scenario does not support a purely leptonic non-thermal emission mechanism. The reflected emission model does, however, predict a reflected photon field with sufficient energy to enable elevated gamma-ray emission via pion production with protons of energies between 10 and 100 TeV
Energy Technology Data Exchange (ETDEWEB)
Massaro, F.; Masetti, N.; D' Abrusco, R.; Paggi, A.; Funk, S.
2014-09-09
We present an analysis of the optical spectra available in the Sloan Digital Sky Survey data release nine (SDSS DR9) for the blazars listed in the ROMA-BZCAT and for the γ-ray blazar candidates selected according to their IR colors. First, we adopt a statistical approach based on Monte Carlo simulations to find the optical counterparts of the blazars listed in the ROMA-BZCAT catalog. Then, we crossmatched the SDSS spectroscopic catalog with our selected samples of blazars and γ-ray blazar candidates, searching for those with optical spectra available to classify our blazar-like sources and, whenever possible, to confirm their redshifts. Our main objectives are to determine the classification of uncertain blazars listed in the ROMA-BZCAT and to discover new gamma-ray blazars. For the ROMA-BZCAT sources, we investigated a sample of 84 blazars, confirming the classification for 20 of them and obtaining 18 new redshift estimates. For the γ-ray blazars, indicated as potential counterparts of unassociated Fermi sources or with uncertain nature, we established the blazar-like nature of 8 out of the 27 sources analyzed and confirmed 14 classifications.
Directory of Open Access Journals (Sweden)
Hassan Musa
2011-03-01
Full Text Available Abstract Suffolk sheep carrying the DRB1*1101 (previously referred to as-DRB1*0203 or G2 allele have been reported to show increased resistance to natural Teladorsagia circumcincta infection compared to non-carriers. The objective of this study was to compare the biochemical and physiological responses of DRB1*1101 carrier and non-carrier twin lambs to an experimental infection with 3 × 104 L3 Teladorsagia circumcincta. The variables studied included worm burden, faecal egg count, abomasal mast cells, IgA, IgE, IgG1 plus IgG2 and haematological parameters at 0, 3, 7, 21 and 35 days post infection (dpi, and duodenal smooth muscle contractility at 0 and 35 dpi. DRB1*1101 carrier lambs had significantly lower worm burden, higher mast cell and plasma platelet counts than the DRB1*1101 non-carriers (P DRB1*1101 non-carrier lambs had a significantly higher plasma lymphocyte count, and produced greater duodenal contractile force relative to the carrier lambs (P DRB1*1101 is acquired rather than innate, depends on worm expulsion rather than fecundity and is dependent on mucosal mast cell proliferation, platelet activation, and IgA and IgE antibody responses.
BLAZAR SPECTRAL PROPERTIES AT 74 MHz
Energy Technology Data Exchange (ETDEWEB)
Massaro, F.; Funk, S. [SLAC National Laboratory and Kavli Institute for Particle Astrophysics and Cosmology, 2575 Sand Hill Road, Menlo Park, CA 94025 (United States); Giroletti, M. [INAF Istituto di Radioastronomia, via Gobetti 101, I-40129 Bologna (Italy); Paggi, A.; D' Abrusco, R. [Harvard-Smithsonian Astrophysical Observatory, 60 Garden Street, Cambridge, MA 02138 (United States); Tosti, G. [Dipartimento di Fisica, Università degli Studi di Perugia, I-06123 Perugia (Italy)
2013-10-01
Blazars are the most extreme class of active galactic nuclei. Despite a previous investigation at 102 MHz for a small sample of BL Lac objects and our recent analysis of blazars detected in the Westerbork Northern Sky Survey, a systematic study of the blazar spectral properties at frequencies below 100 MHz has been never carried out. In this paper, we present the first analysis of the radio spectral behavior of blazars based on the recent Very Large Array Low-frequency Sky Survey (VLSS) at 74 MHz. We search for blazar counterparts in the VLSS catalog, confirming that they are detected at 74 MHz. We then show that blazars present radio-flat spectra (i.e., radio spectral indices of ∼0.5) when evaluated, which also about an order of magnitude in frequency lower than previous analyses. Finally, we discuss the implications of our findings in the context of the blazars-radio galaxies connection since the low-frequency radio data provide a new diagnostic tool to verify the expectations of the unification scenario for radio-loud active galaxies.
2010-10-01
... 49 Transportation 8 2010-10-01 2010-10-01 false Construction. 1101.3 Section 1101.3 Transportation Other Regulations Relating to Transportation (Continued) SURFACE TRANSPORTATION BOARD, DEPARTMENT OF TRANSPORTATION RULES OF PRACTICE DEFINITIONS AND CONSTRUCTION § 1101.3 Construction. The rules of construction...
46 CFR 11.1101 - Purpose of rules.
2010-10-01
... passenger ships as defined in § 10.1103. ... 46 Shipping 1 2010-10-01 2010-10-01 false Purpose of rules. 11.1101 Section 11.1101 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY MERCHANT MARINE OFFICERS AND SEAMEN REQUIREMENTS FOR OFFICER...
THE WISE BLAZAR-LIKE RADIO-LOUD SOURCES: AN ALL-SKY CATALOG OF CANDIDATE γ-RAY BLAZARS
Energy Technology Data Exchange (ETDEWEB)
D' Abrusco, R.; Paggi, A.; Smith, H. A. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Massaro, F. [Dipartimento di Fisica, Università degli Studi di Torino, via Pietro Giuria 1, I-10125 Torino (Italy); Masetti, N. [INAF/IASF di Bologna, via Gobetti 101, I-40129 Bologna (Italy); Landoni, M. [INAF/Osservatorio Astronomico di Brera, Via E. Bianchi 46, I-23807 Merate (Italy); Tosti, G. [Dipartimento di Fisica, Università degli Studi di Perugia, I-06123 Perugia (Italy)
2014-11-01
We present a catalog of radio-loud candidate γ-ray emitting blazars with WISE mid-infrared colors similar to the colors of confirmed γ-ray blazars. The catalog is assembled from WISE sources detected in all four WISE filters, with colors compatible with the three-dimensional locus of the WISE γ-ray emitting blazars, and which can be spatially cross-matched with radio sources from one of the three radio surveys: NVSS, FIRST, and/or SUMSS. Our initial WISE selection uses a slightly modified version of previously successful algorithms. We then select only the radio-loud sources using a measure of the radio-to-IR flux, the q {sub 22} parameter, which is analogous to the q {sub 24} parameter known in the literature but which instead uses the WISE band-four flux at 22 μm. Our final catalog contains 7855 sources classified as BL Lacs, FSRQs, or mixed candidate blazars; 1295 of these sources can be spatially re-associated as confirmed blazars. We describe the properties of the final catalog of WISE blazar-like radio-loud sources and consider possible contaminants. Finally, we discuss why this large catalog of candidate γ-ray emitting blazars represents a new and useful resource to address the problem of finding low-energy counterparts to currently unidentified high-energy sources.
30 CFR 75.1101-9 - Back-up water system.
2010-07-01
... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Back-up water system. 75.1101-9 Section 75.1101-9 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR COAL MINE SAFETY AND HEALTH MANDATORY SAFETY STANDARDS-UNDERGROUND COAL MINES Fire Protection § 75.1101-9 Back-up water system...
Gamma-Ray and Multiwavelength Emission from Blazars Meg Urry
Indian Academy of Sciences (India)
Abstract. Blazars are now well understood as approaching relativistic jets aligned with the line of sight. The long-time uncertainty about the demographics of blazars is starting to become clearer: since the Fermi blazar sample includes a larger fraction of high-frequency peaked blazars. (like the typical X-ray-selected blazars ...
Xin, Yaping; Zhang, Dongming; Fu, Yanqin; Wang, Chongxian; Li, Qingju; Tian, Chenguang; Zhang, Suhe; Lyu, Xiaodong
2017-08-30
C1qTNF-related protein 1 (CTRP1) is independently associated with type 2 diabetes. However, the relationship between CTRP1 and insulin resistance is still not established. This study aimed to explore the role of CTRP1 under the situation of insulin resistance in adipose tissue. Plasma CTRP1 level was investigated in type 2 diabetic subjects (n = 35) and non-diabetic subjects (n = 35). The relationship between CTRP1 and phosphorylation of multi insulin receptor substrate 1 (IRS-1) serine (Ser) sites was further explored. Our data showed that Plasma CTRP1 was higher and negative correlation with insulin resistance in diabetic subjects (r = -0.283, p = 0.018). Glucose utilisation test revealed that the glucose utilisation rate of mature adipocytes was improved by CTRP1 in the presence of insulin. CTRP1 was not only related to IRS-1 protein, but also negatively correlated with IRS-1 Ser1101 phosphorylation (r = -0.398, p = 0.031). Furthermore, Phosphorylation levels of IRS-1 Ser1101 were significantly lower after incubation with 40 ng/mL CTRP1 in mature adipocytes than those with no intervention (p insulin resistance by reducing the phosphorylation of IRS-1 Ser1101, induced in the situation of insulin resistance as a feedback adipokine.
FACT. More than four years of blazar monitoring
Energy Technology Data Exchange (ETDEWEB)
Dorner, Daniela [Universitaet Wuerzburg (Germany); Collaboration: FACT-Collaboration
2016-07-01
Since October 2011, the First G-APD Cherenkov Telescope (FACT) has been collecting more than 5500 hours of physics data. Thanks to the silicon based photosensors (SiPMs, aka G-APDs), observations during bright ambient light like full moon can be carried out without degradation of the sensors. Keeping the gain of the SiPMs stable using an online feedback system, a stable and homogeneous detector performance is achieved. Based on this and an automatic data taking procedure, an unbiased longterm data sample is collected. An automatic quick look analysis provides results shortly after the data are taken allowing to send flare alerts within the same night. The main targets for FACT are the bright TeV blazars Mrk 421 and Mrk 501 which are monitored since January 2012. In addition, several other sources like for example the Crab Nebula, 1ES 1959+650, 1ES 2344+54.1 are observed. In this presentation, the results from more than four years of monitoring are summarized. Several flares from Mrk 501 and Mrk 421 are discussed in the multi-wavelength (MWL) context. Mrk 501 underwent major outbursts in June 2012 and June 2014 during the yearly MWL campaigns. Mrk 421 showed a bright flare in April 2013 where also MWL observations are available. 1ES 1959+650 showed enhanced flux in autumn 2015. Results from these observations are discussed.
40 CFR 26.1101 - To what does this subpart apply?
2010-07-01
... 40 Protection of Environment 1 2010-07-01 2010-07-01 false To what does this subpart apply? 26.1101 Section 26.1101 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL PROTECTION OF... Intentional Exposure of Non-pregnant, Non-nursing Adults § 26.1101 To what does this subpart apply? (a) Except...
42 CFR 493.1101 - Standard: Facilities.
2010-10-01
... 42 Public Health 5 2010-10-01 2010-10-01 false Standard: Facilities. 493.1101 Section 493.1101... (CONTINUED) STANDARDS AND CERTIFICATION LABORATORY REQUIREMENTS Facility Administration for Nonwaived Testing § 493.1101 Standard: Facilities. (a) The laboratory must be constructed, arranged, and maintained to...
Blazar Sequence in Fermi Era Liang Chen
Indian Academy of Sciences (India)
Abstract. In this paper, we review the latest research results on the topic of blazar sequence. It seems that the blazar sequence is phenomenally ruled out, while the theoretical blazar sequence still holds. We point out that black hole mass is a dominated parameter accounting for high-power- high-synchrotron-peaked and ...
43 CFR 4.1101 - Jurisdiction of the Board.
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Jurisdiction of the Board. 4.1101 Section... APPEALS PROCEDURES Special Rules Applicable to Surface Coal Mining Hearings and Appeals General Provisions § 4.1101 Jurisdiction of the Board. (a) The jurisdiction of the Board, as set forth in § 4.1(b)(3...
Steady-state emission of blazars at very high energies
Energy Technology Data Exchange (ETDEWEB)
Hoehne-Moench, Daniel
2010-07-01
One key scientific program of the MAGIC telescope project is the discovery and detection of blazars. They constitute the most prominent extragalactic source class in the very high energy (VHE) {gamma}-ray regime with 29 out of 34 known objects. Therefore a major part of the available observation time was spent in the last years on high-frequency peaked blazars. The selection criteria were chosen to increase the detection probability. As the X-ray flux is believed to be correlated to the VHE {gamma}-ray flux, only X-ray selected sources with a flux F{sub X}>2 {mu}Jy at 1 keV were considered. To avoid strong attenuation of the -rays in the extragalactic infrared background, the redshift was restricted to values between z<0.15 and z<0.4, depending on the declination of the objects. The latter determines the zenith distance during culmination which should not exceed 30 (for z<0.4) and 45 (for z<0.15), respectively. Between August 2005 and April 2009, a sample of 24 X-ray selected high-frequency peaked blazars has been observed with the MAGIC telescope. Three of them were detected including 1ES 1218+304 being the first high-frequency peaked BL Lacertae object (HBL) to be discovered with MAGIC in VHE {gamma}-rays. One previously detected object was not confirmed as VHE emitter in this campaign by MAGIC. A set of 20 blazars previously not detected is treated more closely in this work. In this campaign, during almost four years {proportional_to}450 hrs or {proportional_to}22% of the available observation time for extragalactic objects were dedicated to investigate the baseline emission of blazars and their broadband spectral properties in this emission state. For the sample of 20 objects in a redshift range of 0.018
Astronomical Plate Archives and Binary Blazars Studies
Czech Academy of Sciences Publication Activity Database
Hudec, René
2011-01-01
Roč. 32, 1-2 (2011), s. 91-95 ISSN 0250-6335. [Conference on Multiwavelength Variability of Blazars. Guangzhou, 22,09,2010-24,09,2010] R&D Projects: GA ČR GA205/08/1207 Grant - others:GA ČR(CZ) GA102/09/0997; MŠMT(CZ) ME09027 Institutional research plan: CEZ:AV0Z10030501 Keywords : astronomical plates * plate archives archives * binary blazars Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 0.400, year: 2011
Ringo2 Optical Polarimetry of Blazars
Directory of Open Access Journals (Sweden)
Helen Jermak
2016-10-01
Full Text Available We present polarimetric and photometric observations from a sample of 15 γ-ray bright blazars with data from the Tuorla blazar monitoring program (KVA DIPOL and Liverpool Telescope (LT Ringo2 polarimeters (supplemented with γ-ray data from Fermi-LAT. We find that (1 The optical magnitude and γ-ray flux are positively correlated; (2 electric vector position angle rotations can occur in any blazar subclass; (3 there is no difference in the γ-ray flaring rates in the sample between subclasses; flares can occur during and outside of rotations with no preference for this behaviour; (4 the average degree of polarisation (P, optical magnitude and γ-ray flux are lower during a rotation compared with during non-rotation; (5 the number of observed flaring events and optical polarisation rotations are correlated and (6 the maximum observed P increases from ∼10% to ∼30% to ∼40% for subclasses with synchrotron peaks at high, intermediate and low frequencies respectively.
CLUSTERING OF γ-RAY-SELECTED 2LAC FERMI BLAZARS
Energy Technology Data Exchange (ETDEWEB)
Allevato, V.; Finoguenov, A. [Department of Physics, University of Helsinki, Gustaf Hällströmin katu 2a, FI-00014 Helsinki (Finland); Cappelluti, N. [University of Maryland, Baltimore County, 1000 Hilltop Circle, Baltimore, MD 21250 (United States)
2014-12-20
We present the first measurement of the projected correlation function of 485 γ-ray-selected blazars, divided into 175 BL Lacertae (BL Lacs) and 310 flat-spectrum radio quasars (FSRQs) detected in the 2 year all-sky survey by the Fermi-Large Area Telescope. We find that Fermi BL Lacs and FSRQs reside in massive dark matter halos (DMHs) with log M{sub h} = 13.35{sub −0.14}{sup +0.20} and log M{sub h} = 13.40{sub −0.19}{sup +0.15} h {sup –1} M {sub ☉}, respectively, at low (z ∼ 0.4) and high (z ∼ 1.2) redshift. In terms of clustering properties, these results suggest that BL Lacs and FSRQs are similar objects residing in the same dense environment typical of galaxy groups, despite their different spectral energy distributions, power, and accretion rates. We find no difference in the typical bias and hosting halo mass between Fermi blazars and radio-loud active galactic nuclei (AGNs), supporting the unification scheme simply equating radio-loud objects with misaligned blazar counterparts. This similarity in terms of the typical environment they preferentially live in, suggests that blazars tend to occupy the center of DMHs, as already pointed out for radio-loud AGNs. This implies, in light of several projects looking for the γ-ray emission from DM annihilation in galaxy clusters, a strong contamination from blazars to the expected signal from DM annihilation.
7 CFR 760.1101 - Administration.
2010-01-01
... 7 Agriculture 7 2010-01-01 2010-01-01 false Administration. 760.1101 Section 760.1101 Agriculture Regulations of the Department of Agriculture (Continued) FARM SERVICE AGENCY, DEPARTMENT OF AGRICULTURE... Administration. (a) This program is administered under the general supervision of the Administrator, Farm Service...
2010-01-01
... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Generally. 1101.41 Section 1101.41 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION CONSUMER PRODUCT SAFETY ACT REGULATIONS INFORMATION... court; (2) Information about a product which the Commission has reasonable cause to believe is in...
22 CFR 1101.10 - Accounting for disclosures.
2010-04-01
... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Accounting for disclosures. 1101.10 Section 1101... STATES SECTION PRIVACY ACT OF 1974 § 1101.10 Accounting for disclosures. (a) Each system manager shall establish a system of accounting for all disclosures of records, either orally or in writing made outside...
Ghisellini, Gabriele
2009-05-01
Although blazars are thought to emit most of their luminosity in the γ-ray band, there are subclasses of them very prominent in hard X-rays. These are the best candidates to be studied by Simbol-X. They are at the extremes of the blazar sequence, having very small or very high jet powers. The former are the class of TeV emitting BL Lacs, whose synchrotron emission often peaks at tens of keV or more. The latter are the blazars with the most powerful jets, have high black hole masses accreting at high (i.e. close to Eddington) rates. These sources are predicted to have their high energy peak even below the MeV band, and therefore are very promising candidates to be studied with Simbol-X.
34 CFR 110.1 - What is the purpose of ED's age discrimination regulations?
2010-07-01
... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE General § 110.1 What is the purpose of ED's age discrimination regulations? The purpose of these regulations is to set out ED's rules for implementing the Age... 34 Education 1 2010-07-01 2010-07-01 false What is the purpose of ED's age discrimination...
International Nuclear Information System (INIS)
Linderoth, T R; Horch, S; Petersen, L; Laegsgaard, E; Stensgaard, I; Besenbacher, F
2005-01-01
The technique of scanning tunnelling microscopy (STM) uniquely allows dynamic processes on surfaces to be followed directly in real space and at atomic resolution. Results for the 551225 surface diffusion of Pt adatoms and clusters on the anisotropic, missing row reconstructed Pt(110)-(1 x 2) surface are briefly reviewed. Mass transport in this system is entirely one-dimensional (1D) since, at low adatom coverage, atoms and clusters are confined to the missing row troughs. In this paper, we therefore address the question if Pt/Pt(110)-(1 x 2) is a 1D model system to study late stage growth phenomena such as island ripening? From STM measurements, we quantify the morphology changes resulting from annealing a surface configuration with small 1D Pt islands in the missing row troughs to temperatures in the interval 369-395 K. Interestingly, the resulting increase in island sizes (ripening) cannot be accounted for by the known island and adatom mobilities within a 1D model. An explanation is provided from dynamic, time-resolved 'STM-movies' that directly reveal two novel island-mediated mechanisms for inter-trough mass transport which cause the Pt/Pt(110)-(1 x 2) system not to be purely 1D at the higher surface coverage used in the annealing experiments
Extended radio emission and the nature of blazars
International Nuclear Information System (INIS)
Antonucci, R.R.J.; Ulvestad, J.S.
1985-01-01
The VLA has been used at 20 cm to map all 23 of the 54 confirmed blazars listed in the Angel and Stockman review paper that had not been mapped before at high resolution. (Blazars include BL Lac objects and optically violently variable quasars.) In addition, data on most of the previously mapped blazars have been reprocessed in order to achieve higher dynamic range. Extended emission has been detected associated with 49 of the 54 objects. The extended radio emission has been used to test the hypothesis that blazars are normal radio galaxies and radio quasars viewed along the jet axes. We find that blazars have substantial extended power, consistent with this hypothesis. Many have extended powers as high as the luminous Fanaroff-Riley class 2 radio doubles. The projected linear sizes are small, as expected from foreshortening of the extended sources, and many blazars have the expected core-halo morphology. There are also several small doubles, a head-tail source, and some one-sided sources, and these could be in cases where the line of sight is slightly off the jet axis, or projections of asymmetrical radio galaxies and quasars. The ratio of core to extended radio emission has been studied as a possible indicator of viewing aspect or beaming intensity. It is found to correlate with optical polarization, optical and radio core variability, and one-sided radio morphology. We can go beyond these consistency checks and work toward a proof of the hypothesis under discussion. The flux from the extended emission alone is sufficient in some blazars to qualify them for inclusion in the 3C and 4C catalogs. Suppose that the radio core emission is anisotropic, but the extended emission is predominantly isotropic. The isotropy of the extended emission implies that these blazars would be in the catalogs even if viewed from the side
Indian Academy of Sciences (India)
Administrator
Electronic Supplementary Material. Graphical abstract. Preparation and characterization of monosubstituted porphyrins immobilized on nanosilica by Ebrahim Ahmadi et al (pp 1101–1112). N-(3-triethoxysilylpropyl)-4-formyl benzamide (Aldehyde (1)), that bears a Si(OEt)3 group, was anchored to silica support by controlled ...
30 CFR 75.1101-21 - Back-up water system.
2010-07-01
... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Back-up water system. 75.1101-21 Section 75.1101-21 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR COAL MINE SAFETY... water system. One fire hose outlet together with a length of hose capable of extending to the belt drive...
Energy Technology Data Exchange (ETDEWEB)
Paliya, Vaidehi S.; Ajello, M.; Kaur, A. [Department of Physics and Astronomy, Clemson University, Kinard Lab of Physics, Clemson, SC 29634-0978 (United States); Stalin, C. S., E-mail: vpaliya@g.clemson.edu [Indian Institute of Astrophysics, Block II, Koramangala, Bangalore-560034 (India)
2017-07-20
We report the first results obtained from our campaign to characterize the intra-night-optical variability (INOV) properties of Fermi detected blazars, using the observations from the recently commissioned 1.3 m J. C. Bhattacharya telescope (JCBT). During the first run, we were able to observe 17 blazars in the Bessel R filter for ∼137 hr. Using C- and scaled F -statistics, we quantify the extent of INOV and derive the duty cycle (DC), which is the fraction of time during which a source exhibits a substantial flux variability. We find a high DC of 40% for BL Lac objects and the flat spectrum radio quasars are relatively less variable (DC ∼ 15%). However, when estimated for blazars sub-classes, a high DC of ∼59% is found in low synchrotron peaked (LSP) blazars, whereas, intermediate and high synchrotron peaked objects have a low DC of ∼11% and 13%, respectively. We find evidence of the association of the high amplitude INOV with the γ -ray flaring state. We also notice a high polarization during the elevated INOV states (for the sources that have polarimetric data available), thus supporting the jet based origin of the observed variability. We plan to enlarge the sample and utilize the time availability from the small telescopes, such as 1.3 m JCBT, to strengthen/verify the results obtained in this work and those existing in the literature.
Spin-resolved photoemission of surface states of W(110)-(1x1)H
International Nuclear Information System (INIS)
Hochstrasser, M.; Tobin, J.G.; Rotenberg, Eli; Kevan, S.D.
2002-01-01
The surface electronic states of W(110)-(1x1)H have been measured using spin- and angle-resolved photoemission. We directly demonstrate that the surface bands are both split and spin-polarized by the spin-orbit interaction in association with the loss of inversion symmetry near a surface. We observe 100 percent spin polarization of the surface states, with the spins aligned in the plane of the surface and oriented in a circular fashion relative to the S-bar symmetry point. In contrast, no measurable polarization of nearby bulk states is observed
Automated Blazar Light Curves Using Machine Learning
Energy Technology Data Exchange (ETDEWEB)
Johnson, Spencer James [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)
2017-07-27
This presentation describes a problem and methodology pertaining to automated blazar light curves. Namely, optical variability patterns for blazars require the construction of light curves and in order to generate the light curves, data must be filtered before processing to ensure quality.
Oxygen adsorption on Pt(110)-(1x2): new high-coverage structures
DEFF Research Database (Denmark)
Helveg, Stig; Lorensen, Henrik Qvist; Horch, Sebastian
1999-01-01
From an interplay between scanning tunneling microscopy (STM) experiments and density functional theory (DFT) calculations, a comprehensive picture is obtained for oxygen adsorption on the Pt(110)-(1 x 2) surface, from single isolated oxygen atoms chemisorbed in FCC sites along the platinum ridges...... adsorption and platinum lattice distortions. (C) 1999 Elsevier Science B.V. All rights reserved....
The Study on the Physical Properties of Blazar Jets
Kang, S. J.
2017-09-01
of LSP blazars is the same as that of FR IIs, we find that it is an electron-positron pair dominated leptonic jet in these blazars, and the number density of electron-positron pairs is several times higher than that of electron-proton pairs, but the jet power is still dominated by protons. For the high-synchrotron-peaked (HSP) BL Lac PKS 1424+240, the SED fitting with the synchrotron self-Compton (SSC) model gave unreasonable fitting parameters (e.g., a very large Doppler factor δ). In this work, we take into account the possible external soft photon field, and then fit the multi-waveband SEDs of blazar PKS 1424+240 with one-zone leptonic jet models in both states. We find the SSC+external-Compton (EC) model can give a better fitting result if the EC process is included. However, the needed energy density of external soft photon field (U_{ext}) is much lower than the typical value. This result is consistent with the results of some other BL Lacs, where the BLR or torus is very weak or disappearing. It means that there is evolution of the energy density of external soft photon field with decreasing of the luminosity of blazars (the flat spectrum radio quasars (FSRQs)-BL Lac: low energy peaked BL Lac (LBL)-intermediate energy peaked BL Lac (IBL)-high energy peaked BL Lac (HBL)). And on this basis, in the chapter 5, we further explore the possible evolution of the external soft photon field of blazars based on the EC process. We employ the one-zone homogeneous leptonic jet model and χ2 procedure to fit simultaneously or quasi-simultaneously multi-waveband SEDs for a sample of blazars with a wide distribution of luminosities. In our model, we set Uext as a free parameter. Studying the energy density of the external photon field in different subclasses of blazars, we find: (1) the Uext of the high luminosity blazar (FSRQs and LBLs) keeps roughly as a constant, which is, however, smaller than that constrained from BLR observations. Assuming IR as the source of soft
Data reduction and analysis of the multiband optical images of the blazar Mrk180
Directory of Open Access Journals (Sweden)
M Sabzi Sarvestani
2012-09-01
Full Text Available Nearly simultaneous multiband monitoring of blazars is very limited and most studies reported in literature are conflicting, too. Although optical variability on intra-night timescales is now a well established phenomenon for blazars, its relationship to long-term variability remains unclear. Possible clues could come from monitoring the optical spectrum for correlation with brightness. The presence or absence of bluer color in blazar color index, when its luminosity is increased on intra-night and inter-night timescales, can provide interesting clues to the origin of blazar variability from hourly to much longer timescales. Luminosity of blazars varies at all wavelengths over a variety of timescales. Various models have been proposed to explain blazar variability. However, the mechanism responsible for variability is not conclusively understood. One factor which can discriminate the various variability models is that of color (spectral index variations of blazars. This factor may help to better understand the mechanism of blazar variability. Therefore, it was initially proposed, by the second author of this paper to the OHP observatory, to carry out quasi-simultaneous multiband monitoring of one of the brightest blazer, Mrk180. Fortunately, it was accepted by the scientific team of the observatory and the 1.20m telescope time was allocated to the project from 23 to 28 April 2009. Because of the weather conditions, we could only monitor this blazar for three nights. Raw data processing and data reduction were performed using the standard system of Europe Southerner Observatory, ESO-MIDAS. We considered two reference stars and measured the magnitudes of the reference stars and the blazar Mrk 180 and then plotted the light curves and the color index diagrams. The light curves showed the optical variations of the blazar. The maximum amplitude value of its variations was 0.185 mag for the V filter. Investigating the blazar color index shows its
Search for Magnetically Broadened Cascade Emission from Blazars with VERITAS
Energy Technology Data Exchange (ETDEWEB)
Archambault, S.; Griffin, S. [Physics Department, McGill University, Montreal, QC H3A 2T8 (Canada); Archer, A.; Bugaev, V. [Department of Physics, Washington University, St. Louis, MO 63130 (United States); Benbow, W.; Cerruti, M. [Fred Lawrence Whipple Observatory, Harvard-Smithsonian Center for Astrophysics, Amado, AZ 85645 (United States); Buchovecky, M. [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States); Connolly, M. P. [School of Physics, National University of Ireland Galway, University Road, Galway (Ireland); Cui, W.; Finley, J. P. [Department of Physics and Astronomy, Purdue University, West Lafayette, IN 47907 (United States); Falcone, A. [Department of Astronomy and Astrophysics, 525 Davey Lab, Pennsylvania State University, University Park, PA 16802 (United States); Alonso, M. Fernández [Instituto de Astronomía y Física del Espacio (IAFE, CONICET-UBA), CC 67—Suc. 28, (C1428ZAA) Ciudad Autónoma de Buenos Aires (Argentina); Fleischhack, H.; Hütten, M. [DESY, Platanenallee 6, D-15738 Zeuthen (Germany); Fortson, L. [School of Physics and Astronomy, University of Minnesota, Minneapolis, MN 55455 (United States); Furniss, A. [Department of Physics, California State University—East Bay, Hayward, CA 94542 (United States); Hervet, O.; Johnson, C. A. [Santa Cruz Institute for Particle Physics and Department of Physics, University of California, Santa Cruz, CA 95064 (United States); Holder, J. [Department of Physics and Astronomy and the Bartol Research Institute, University of Delaware, Newark, DE 19716 (United States); Humensky, T. B., E-mail: elisa.pueschel@ucd.ie, E-mail: weisgarber@physics.wisc.edu [Physics Department, Columbia University, New York, NY 10027 (United States); and others
2017-02-01
We present a search for magnetically broadened gamma-ray emission around active galactic nuclei (AGNs), using VERITAS observations of seven hard-spectrum blazars. A cascade process occurs when multi-TeV gamma-rays from an AGN interact with extragalactic background light (EBL) photons to produce electron–positron pairs, which then interact with cosmic microwave background photons via inverse-Compton scattering to produce gamma-rays. Due to the deflection of the electron–positron pairs, a non-zero intergalactic magnetic field (IGMF) would potentially produce detectable effects on the angular distribution of the cascade emission. In particular, an angular broadening compared to the unscattered emission could occur. Through non-detection of angularly broadened emission from 1ES 1218+304, the source with the largest predicted cascade fraction, we exclude a range of IGMF strengths around 10{sup −14} G at the 95% confidence level. The extent of the exclusion range varies with the assumptions made about the intrinsic spectrum of 1ES 1218+304 and the EBL model used in the simulation of the cascade process. All of the sources are used to set limits on the flux due to extended emission.
An Investigation of Blazars without Redshifts: Not a Missing Population at High Redshift
Energy Technology Data Exchange (ETDEWEB)
Mao, Peiyuan; Urry, C. Megan [Yale Center for Astronomy and Astrophysics, Physics Department, New Haven, CT 06520 (United States)
2017-06-01
We investigate a sample of 622 blazars with measured fluxes at 12 wavebands across the radio-to-gamma-ray spectrum but without spectroscopic or photometric redshifts. This sample includes hundreds of sources with newly analyzed X-ray spectra reported here. From the synchrotron peak frequencies, estimated by fitting the broadband spectral energy distributions (SEDs), we find that the fraction of high-synchrotron-peaked blazars in these 622 sources is roughly the same as in larger samples of blazars that do have redshifts. We characterize the no-redshift blazars using their infrared colors, which lie in the distinct locus called the WISE blazar strip, then estimate their redshifts using a KNN regression based on the redshifts of the closest blazars in the WISE color–color plot. Finally, using randomly drawn values from plausible redshift distributions, we simulate the SEDs of these blazars and compare them to known blazar SEDs. Based on all these considerations, we conclude that blazars without redshift estimates are unlikely to be high-luminosity, high-synchrotron-peaked objects, which had been suggested in order to explain the “blazar sequence”—an observed trend of SED shape with luminosity—as a selection effect. Instead, the observed properties of no-redshift blazars are compatible with a causal connection between jet power and electron cooling, i.e., a true blazar sequence.
22 CFR 1101.16 - Criminal penalties.
2010-04-01
... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Criminal penalties. 1101.16 Section 1101.16 Foreign Relations INTERNATIONAL BOUNDARY AND WATER COMMISSION, UNITED STATES AND MEXICO, UNITED STATES... public notice of a system of records as required by 5 U.S.C. 552a(e)(4). ...
What We Talk about When We Talk about Blazars?
Energy Technology Data Exchange (ETDEWEB)
Foschini, Luigi, E-mail: luigi.foschini@brera.inaf.it [INAF – Osservatorio Astronomico di Brera, Lecco (Italy)
2017-07-11
After the discovery of powerful relativistic jets from Narrow-Line Seyfert 1 Galaxies, and the understanding of their similarity with those of blazars, a problem of terminology was born. The word blazar is today associated to BL Lac Objects and Flat-Spectrum Radio Quasars, which are somehow different from Narrow-Line Seyfert 1 Galaxies. Using the same word for all the three classes of AGN could drive either toward some misunderstanding, or to the oversight of some important characteristics. I review the main characteristics of these sources, and finally I propose a new scheme of classification.
Stochastic modeling of the Fermi/LAT γ-ray blazar variability
Energy Technology Data Exchange (ETDEWEB)
Sobolewska, M. A.; Siemiginowska, A. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Kelly, B. C. [Department of Physics, Broida Hall, University of California, Santa Barbara, CA 93107 (United States); Nalewajko, K., E-mail: malgosia@camk.edu.pl [JILA, University of Colorado and National Institute of Standards and Technology, 440 UCB, Boulder, CO 80309 (United States)
2014-05-10
We study the γ-ray variability of 13 blazars observed with the Fermi/Large Area Telescope (LAT). These blazars have the most complete light curves collected during the first four years of the Fermi sky survey. We model them with the Ornstein-Uhlenbeck (OU) process or a mixture of the OU processes. The OU process has power spectral density (PSD) proportional to 1/f {sup α} with α changing at a characteristic timescale, τ{sub 0}, from 0 (τ >> τ{sub 0}) to 2 (τ << τ{sub 0}). The PSD of the mixed OU process has two characteristic timescales and an additional intermediate region with 0 < α < 2. We show that the OU model provides a good description of the Fermi/LAT light curves of three blazars in our sample. For the first time, we constrain a characteristic γ-ray timescale of variability in two BL Lac sources, 3C 66A and PKS 2155-304 (τ{sub 0} ≅ 25 days and τ{sub 0} ≅ 43 days, respectively, in the observer's frame), which are longer than the soft X-ray timescales detected in blazars and Seyfert galaxies. We find that the mixed OU process approximates the light curves of the remaining 10 blazars better than the OU process. We derive limits on their long and short characteristic timescales, and infer that their Fermi/LAT PSD resemble power-law functions. We constrain the PSD slopes for all but one source in the sample. We find hints for sub-hour Fermi/LAT variability in four flat spectrum radio quasars. We discuss the implications of our results for theoretical models of blazar variability.
Energy Technology Data Exchange (ETDEWEB)
Álvarez Crespo, N.; Massaro, F. [Dipartimento di Fisica, Università degli Studi di Torino, via Pietro Giuria 1, I-10125 Torino (Italy); Masetti, N. [INAF—Istituto di Astrofisica Spaziale e Fisica Cosmica di Bologna, via Gobetti 101, I-40129, Bologna (Italy); Ricci, F.; La Franca, F. [Dipartimento di Matematica e Fisica, Università Roma Tre, via della Vasca Navale 84, I-00146, Roma (Italy); Landoni, M. [INAF-Osservatorio Astronomico di Brera, Via Emilio Bianchi 46, I-23807 Merate (Italy); Patiño-Álvarez, V.; Chavushyan, V.; Torrealba, J. [Instituto Nacional de Astrofisica, Óptica y Electrónica, Apartado Postal 51-216, 72000 Puebla, México (Mexico); D’Abrusco, R.; Paggi, A.; Smith, Howard A. [Harvard—Smithsonian Astrophysical Observatory, 60 Garden Street, Cambridge, MA 02138 (United States); Jiménez-Bailón, E. [Instituto de Astronomía, Universidad Nacional Autónoma de México, Apdo. Postal 877, Ensenada, 22800 Baja California, México (Mexico); Latronico, L. [Istituto Nazionale di Fisica Nucleare, Sezione di Torino, I-10125 Torino (Italy); Tosti, G. [Dipartimento di Fisica, Università degli Studi di Perugia, I-06123 Perugia (Italy)
2016-02-15
The extragalactic γ-ray sky is dominated by emission from blazars, a peculiar class of active galactic nuclei. Many of the γ-ray sources included in the Fermi-Large Area Telescope Third Source catalog (3FGL) are classified as blazar candidates of uncertain type (BCUs) because there are no optical spectra available in the literature to confirm their nature. In 2013, we started a spectroscopic campaign to look for the optical counterparts of the BCUs and of the unidentified γ-ray sources to confirm their blazar nature. Whenever possible we also determine their redshifts. Here, we present the results of the observations carried out in the northern hemisphere in 2013 and 2014 at the Telescopio Nazionale Galileo, Kitt Peak National Observatory, and Observatorio Astronómico Nacional in San Pedro Mártir. In this paper, we describe the optical spectra of 25 sources. We confirmed that all of the 15 BCUs observed in our campaign and included in our sample are blazars and we estimated the redshifts for three of them. In addition, we present the spectra for three sources classified as BL Lacs in the literature but with no optical spectra available to date. We found that one of them is a quasar (QSO) at a redshift of z = 0.208 and the other two are BL Lacs. Moreover, we also present seven new spectra for known blazars listed in the Roma-BZCAT that have an uncertain redshift or are classified as BL Lac candidates. We found that one of them, 5BZB J0724+2621, is a “changing look” blazar. According to the spectrum available in the literature, it was classified as a BL Lac, but in our observation we clearly detected a broad emission line that led us to classify this source as a QSO at z = 1.17.
Polarization Properties of 24 Fermi-Detected Blazars
Linford, Justin; Taylor, G. B.; Schinzel, F. K.; Zavala, R. T.
2013-01-01
Gamma-ray emitting blazars have been shown to frequently have significant polarization at radio wavelengths. In early 2012, we obtained Very Long Baseline Array (VLBA) observations of 24 blazars detected by the Large Area Telescope (LAT) on board the Fermi Gamma-ray Space Telescope. These observations utilized the new 2 gigabit-per-second mode of the VLBA. We observed each source with full polarization at 8.4 GHz, 15 GHz, and 22 GHz with 256 MHz of total bandwidth per polarization. Our sample contains 14 flat-spectrum radio quasars (FSRQs) and 10 BL Lacertae objects (BL Lacs). We analyze the spectral index, rotation measure, and magnetic field structures of these 24 gamma-ray loud blazars.
IDENTIFICATION OF NEW GAMMA-RAY BLAZAR CANDIDATES WITH MULTIFREQUENCY ARCHIVAL OBSERVATIONS
Energy Technology Data Exchange (ETDEWEB)
Cowperthwaite, Philip S. [Department of Astronomy, University of Maryland, College Park, MD 20742-2421 (United States); Massaro, F. [SLAC National Laboratory and Kavli Institute for Particle Astrophysics and Cosmology, 2575 Sand Hill Road, Menlo Park, CA 94025 (United States); D' Abrusco, R.; Paggi, A.; Smith, Howard A. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Tosti, G., E-mail: pcowpert@umd.edu [Dipartimento di Fisica, Università Degli Studi di Perugia, I-06123 Perugia (Italy)
2013-11-01
Blazars are a highly variable, radio-loud subclass of active galactic nuclei. In order to better understand such objects we must be able to easily identify candidate blazars from the growing population of unidentified sources. Working toward this goal, we attempt to identify new gamma-ray blazar candidates from a sample of 102 previously unidentified sources. These sources are selected from The Astronomer's Telegram and the literature on the basis of non-periodic variability and multi-wavelength behavior. We then attempt to associate these objects to an IR counterpart in the Wide-field Infrared Survey Explorer all-sky survey. We are able to identify 16 candidate sources whose IR colors are consistent with those of the blazar population. Of those, 13 sources have IR colors indicative of being gamma-ray emitting blazar candidates. These sources all possess archival multi-wavelength observations that support their blazar-like nature.
Steady-state emission of blazars at very high energies
International Nuclear Information System (INIS)
Hoehne-Moench, Daniel
2010-01-01
One key scientific program of the MAGIC telescope project is the discovery and detection of blazars. They constitute the most prominent extragalactic source class in the very high energy (VHE) γ-ray regime with 29 out of 34 known objects. Therefore a major part of the available observation time was spent in the last years on high-frequency peaked blazars. The selection criteria were chosen to increase the detection probability. As the X-ray flux is believed to be correlated to the VHE γ-ray flux, only X-ray selected sources with a flux F X >2 μJy at 1 keV were considered. To avoid strong attenuation of the -rays in the extragalactic infrared background, the redshift was restricted to values between z X-γ between the X-ray range at 1 keV and the VHE γ-ray regime at 200 GeV were calculated. The majority of objects show a spectral behaviour as expected from the source class of HBLs: The energy output in the VHE regime is in general lower than in X-rays. For the stacked blazar sample the broad-band spectral index was calculated to α X-γ =1.09, confirming the result found for the individual objects. Another evidence for the revelation of the baseline emission is the broad-band spectral energy distribution (SED) comprising archival as well as contemporaneous multi-wavelength data from the radio to the VHE band. The SEDs of known VHE γ-ray sources in low flux states matches well the SED of the stacked blazar sample. (orig.)
VizieR Online Data Catalog: Sample of Fermi Blazars (Chen+, 2016)
Chen, Y.-Y.; Zhang, X.; Xiong, D.-R.; Wang, S.-J.; Yu, X.-L.
2016-04-01
We tried to select a large number of blazars with reliable redshift, radio core and extended radio luminosity at 1.4GHz. Firstly, we considered the following samples of blazars to get the radio core luminosity and extended luminosity at 1.4GHz: Kharb et al. (2010, J/ApJ/710/764), Antonucci & Ulvestad (1985ApJ...294..158A), Cassaro et al. (1999A&AS..139..601C), Murphy et al. (1993MNRAS.264..298M), Landt & Bignall (2008MNRAS.391..967L), Caccianiga & Marcha (2004, Cat. J/MNRAS/348/973), Giroletti et al. (2004). We cross-correlated these samples with the Fermi LAT Third Source Catalog (3FGL), and we acquired the 3FGL spectral index and energy flux at 0.1-100GeV from clean sources in 3FGL (Fermi-LAT Collaboration 2015, J/ApJS/218/23) Using these catalogs, we compiled 201 Fermi blazars. (1 data file).
30 CFR 75.1101-15 - Construction of dry powder chemical systems.
2010-07-01
... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Construction of dry powder chemical systems. 75.1101-15 Section 75.1101-15 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR...-15 Construction of dry powder chemical systems. (a) Each self-contained dry powder system shall be...
Energetics and dynamics of Pt dimers on Pt(110)-(1x2)
International Nuclear Information System (INIS)
Linderoth, T.R.; Horch, S.; Petersen, L.; Helveg, S.; Schoenning, M.; Laegsgaard, E.; Stensgaard, I.; Besenbacher, F.
2000-01-01
The stability and dynamics of Pt dimers on Pt(110)-(1x2) are studied using fast-scanning, variable-temperature STM. The kinetics of both dissociation and association of dimers have been quantified from a direct analysis of time-lapse STM movies. The extracted barriers are at variance with results from ab initio calculations, and we speculate that the discrepancies are due to trace amounts of gas impurities such as CO
Blazar origin of some IceCube events
Energy Technology Data Exchange (ETDEWEB)
Miranda, Luis Salvador; Leon, Alberto Rosales de; Sahu, Sarira [Universidad Nacional Autonoma de Mexico, Circuito Exterior, C.U., Instituto de Ciencias Nucleares, Mexico, DF (Mexico)
2016-07-15
Recently the ANTARES collaboration presented a time dependent analysis of a selected number of flaring blazars to look for upward going muon events produced from the charge current interaction of the muon neutrinos. We use the same list of flaring blazars to look for a possible positional correlation with the IceCube neutrino events. In the context of the photohadronic model we propose that the neutrinos are produced within the nuclear region of the blazar where Fermi accelerated high energy protons interact with the background synchrotron/SSC photons. Although we found that some objects from the ANTARES list are within the error circles of a few IceCube events, the statistical analysis shows that none of these sources have a significant correlation. (orig.)
Roma-BZCAT: a multifrequency catalogue of blazars
Massaro, E.; Giommi, P.; Leto, C.; Marchegiani, P.; Maselli, A.; Perri, M.; Piranomonte, S.; Sclavi, S.
2009-02-01
We present a new catalogue of blazars based on multifrequency surveys and on an extensive review of the literature. Blazars are classified as BL Lacertae objects, as flat spectrum radio quasars or as blazars of uncertain/transitional type. Each object is identified by a root name, coded as BZB, BZQ and BZU for these three subclasses respectively, and by its coordinates. This catalogue is being built as a tool useful for the identification of the extragalactic sources that will be detected by present and future experiments for X and gamma-ray astronomy, like Swift, AGILE, Fermi-GLAST and Simbol-X. An electronic version is available from the ASI Science Data Center web site at http://www.asdc.asi.it/bzcat.
Models for High-Energy Radiation from Blazars G. E. Romero1 ...
Indian Academy of Sciences (India)
Abstract. We discuss on the modelling of blazar jets as emitters of multiwavelength radiation with the implementation of a lepto-hadronic treatment. Assuming that injection of non-thermal electrons and protons can take place at the base of the jet, the stationary particle distributions can be found using an inhomogeneous ...
The role of plasma instabilities in the propagation of gamma-rays from distant Blazars
Energy Technology Data Exchange (ETDEWEB)
Saveliev, A.; Evoli, C.; Sigl, G. [Hamburg Univ. (Germany). 2. Inst. fuer Theoretische Physik
2013-11-15
The observation in the GeV band of distant blazars has been recently used to put constraints on the Extragalactic Background Light (EBL) and Extragalactic Magnetic Fields (EGMF). To support such claims one has to assume that the leptonic component of the electromagnetic cascade initiated by blazar gamma-rays is deflected away by strong enough EGMF, suppressing the signal in the Fermi window. Apart from magnetic fields, the development of such a cascade might be affected by plasma instabilities due to interactions with the ionized component of the Intergalactic Medium (IGM). In this paper we model the electromagnetic cascade through a Monte Carlo simulation in which both effects are taken into account separately, and we derive constraints on these scenarios from the combined Fermi-HESS data set. In the specific case of 1ES 0229+200 observations, we show that both explanations of the GeV flux suppression are compatible with the available data, specifically by assuming a magnetic field of B >or similar 10{sup -16} G or an IGM temperature of T
16 CFR 1101.42 - Imminent hazard exception.
2010-01-01
... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Imminent hazard exception. 1101.42 Section 1101.42 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION CONSUMER PRODUCT SAFETY ACT REGULATIONS... court. Once the exception applies, information may be disclosed to the public while the proceeding is...
40 CFR 62.1101 - Identification of sources.
2010-07-01
... 40 Protection of Environment 8 2010-07-01 2010-07-01 false Identification of sources. 62.1101 Section 62.1101 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS... Company in San Joaquin County. (b) Simplot Company in Kings County. (c) Valley Nitrogen Products, Inc., in...
Exploring the Variability of the Fermi LAT Blazar Population
Macomb, Daryl J.; Shrader, C. R.
2014-01-01
The flux variability of the approximately 2000 point sources cataloged by the Fermi Gamma-Ray Space Telescope provide important clues to population characteristics. This is particularly true of the more than 1100 source that are likely AGN. By characterizing the intrinsic flux variability and distinguishing this variability from flaring behavior, we can better address questions of flare amplitudes, durations, recurrence times, and temporal profiles. A better understanding of the responsible physical environments, such as the scale and location of jet structures responsible for the high-energy emission, may emerge from such studies. Assessing these characteristics as a function of blazar sub-class is a further goal in order to address questions about the fundamentals of blazar AGN physics. Here we report on progress made in categorizing blazar flare behavior, and correlate these behaviors with blazar sub-type and other source parameters.
28 CFR 5.1101 - Copies of the Report of the Attorney General.
2010-07-01
... Attorney General. Copies of the Report of the Attorney General to the Congress on the Administration of the... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Copies of the Report of the Attorney General. 5.1101 Section 5.1101 Judicial Administration DEPARTMENT OF JUSTICE ADMINISTRATION AND...
Hafiz, Shopan; Andrade, Nicolas; Monavarian, Morteza; Izyumskaya, Natalia; Das, Saikat; Zhang, Fan; Avrutin, Vitaliy; Morkoç, Hadis; Özgür, Ümit
2016-02-01
Near-field scanning optical microscopy was applied to investigate the spatial variations of extended defects and their effects on the optical quality for semi-polar (1-101) and (11-22) InGaN light emitting diodes (LEDs). (1-101) and (11-22) oriented InGaN LEDs emitting at 450-470 nm were grown on patterned Si (001) 7° offcut substrates and m-sapphire substrates by means of nano-epitaxial lateral overgrowth (ELO), respectively. For (1-101) structures, the photoluminescence (PL) at 85 K from the near surface c+ wings was found to be relatively uniform and strong across the sample. However, emission from the c- wings was substantially weaker due to the presence of high density of threading dislocations (TDs) and basal plane stacking faults (BSFs) as revealed from the local PL spectra. In case of (11-22) LED structures, near-field PL intensity correlated with the surface features and the striations along the direction parallel to the c-axis projection exposed facets where the Indium content was higher as deduced from shift in the PL peak energy.
High-redshift Blazars through NuSTAR Eyes
Energy Technology Data Exchange (ETDEWEB)
Marcotulli, L.; Paliya, V. S.; Ajello, M.; Kaur, A.; Hartmann, D. H. [Department of Physics and Astronomy, Clemson University, Kinard Lab of Physics, Clemson, SC 29634-0978 (United States); Gasparrini, D. [Agenzia Spaziale Italiana (ASI) Science Data Center, I-00133 Roma (Italy); Greiner, J.; Rau, A.; Schady, P. [Max Planck Institute für extraterrestrische Physik, Giessenbachstrasse 1, D-85748 Garching (Germany); Baloković, M. [Cahill Center for Astronomy and Astrophysics, California Institute of Technology, Pasadena, CA 91125 (United States); Stern, D. [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States); Madejski, G., E-mail: lmarcot@g.clemson.edu, E-mail: vpaliya@g.clemson.edu [Kavli Institute for Particle Astrophysics and Cosmology, SLAC National Accelerator Laboratory, Menlo Park, CA 94025 (United States)
2017-04-20
The most powerful sources among the blazar family are MeV blazars. Often detected at z > 2, they usually display high X- and γ -ray luminosities, larger-than-average jet powers, and black hole masses ≳10{sup 9} M {sub ☉}. In the present work, we perform a multiwavelength study of three high-redshift blazars: 3FGL J0325.5+2223 ( z = 2.06), 3FGL J0449.0+1121 ( z = 2.15), and 3FGL J0453.2−2808 ( z = 2.56), analyzing quasi-simultaneous data from GROND, Swift -UVOT and XRT, Nuclear Spectroscopic Telescope Array ( NuSTAR ), and Fermi -LAT. Our main focus is on the hard X-ray band recently unveiled by NuSTAR (3–79 keV) where these objects show a hard spectrum that enables us to constrain the inverse Compton (IC) peak and the jet power. We found that all three targets resemble the most powerful blazars, with the synchrotron peak located in the submillimeter range and the IC peak in the MeV range, and therefore belong to the MeV blazar class. Using a simple one-zone leptonic emission model to reproduce the spectral energy distributions, we conclude that a simple combination of synchrotron and accretion disk emission reproduces the infrared–optical spectra, while the X-ray to γ -ray part is well reproduced by the IC scattering of low-energy photons supplied by the broad-line region. The black hole masses for each of the three sources are calculated to be ≳4 × 10{sup 8} M {sub ☉}. The three studied sources have jet power at the level of, or beyond, the accretion luminosity.
High-redshift Blazars through NuSTAR Eyes
International Nuclear Information System (INIS)
Marcotulli, L.; Paliya, V. S.; Ajello, M.; Kaur, A.; Hartmann, D. H.; Gasparrini, D.; Greiner, J.; Rau, A.; Schady, P.; Baloković, M.; Stern, D.; Madejski, G.
2017-01-01
The most powerful sources among the blazar family are MeV blazars. Often detected at z > 2, they usually display high X- and γ -ray luminosities, larger-than-average jet powers, and black hole masses ≳10 9 M ☉ . In the present work, we perform a multiwavelength study of three high-redshift blazars: 3FGL J0325.5+2223 ( z = 2.06), 3FGL J0449.0+1121 ( z = 2.15), and 3FGL J0453.2−2808 ( z = 2.56), analyzing quasi-simultaneous data from GROND, Swift -UVOT and XRT, Nuclear Spectroscopic Telescope Array ( NuSTAR ), and Fermi -LAT. Our main focus is on the hard X-ray band recently unveiled by NuSTAR (3–79 keV) where these objects show a hard spectrum that enables us to constrain the inverse Compton (IC) peak and the jet power. We found that all three targets resemble the most powerful blazars, with the synchrotron peak located in the submillimeter range and the IC peak in the MeV range, and therefore belong to the MeV blazar class. Using a simple one-zone leptonic emission model to reproduce the spectral energy distributions, we conclude that a simple combination of synchrotron and accretion disk emission reproduces the infrared–optical spectra, while the X-ray to γ -ray part is well reproduced by the IC scattering of low-energy photons supplied by the broad-line region. The black hole masses for each of the three sources are calculated to be ≳4 × 10 8 M ☉ . The three studied sources have jet power at the level of, or beyond, the accretion luminosity.
Simultaneous Planck, Swift, and Fermi Observations of X-ray and Gamma-ray Selected Blazars
Giommi, P.; Polenta, G.; Laehteenmaeki, A.; Thompson, D. J.; Capalbi, M.; Cutini, S.; Gasparrini, D.; Gonzalez, Nuevo, J.; Leon-Tavares, J.; Lopez-Caniego, M.;
2012-01-01
We present simultaneous Planck, Swift, Fermi, and ground-based data for 105 blazars belonging to three samples with flux limits in the soft X-ray, hard X-ray, and gamma-ray bands, with additional 5 GHz flux-density limits to ensure a good probability of a Planck detection. We compare our results to those of a companion paper presenting simultaneous Planck and multi-frequency observations of 104 radio-loud northern active galactic nuclei selected at radio frequencies. While we confirm several previous results, our unique data set allows us to demonstrate that the selection method strongly influences the results, producing biases that cannot be ignored. Almost all the BL Lac objects have been detected by the Fermi Large Area Telescope (LAT), whereas 30% to 40% of the flat-spectrum radio quasars (FSRQs) in the radio, soft X-ray, and hard X-ray selected samples are still below the gamma-ray detection limit even after integrating 27 months of Fermi-LAT data. The radio to sub-millimetre spectral slope of blazars is quite flat, with (alpha) approx 0 up to about 70GHz, above which it steepens to (alpha) approx -0.65. The BL Lacs have significantly flatter spectra than FSRQs at higher frequencies. The distribution of the rest-frame synchrotron peak frequency (nu(sup s)(sub peak)) in the spectral energy distribution (SED) of FSRQs is the same in all the blazar samples with (nu(sup s)(sub peak)) = 10(exp 13.1 +/- 0.1) Hz, while the mean inverse Compton peak frequency, (nu(sup IC)(sub peak)), ranges from 10(exp 21) to 10(exp 22) Hz. The distributions of nu(sup s)(sub peak) and nu(sup IC)(sub peak) of BL Lacs are much broader and are shifted to higher energies than those of FSRQs; their shapes strongly depend on the selection method. The Compton dominance of blazars. defined as the ratio of the inverse Compton to synchrotron peak luminosities, ranges from less than 0.2 to nearly 100, with only FSRQs reaching values larger than about 3. Its distribution is broad and depends
16 CFR 1101.71 - Delegation of authority.
2010-01-01
... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Delegation of authority. 1101.71 Section... INFORMATION DISCLOSURE UNDER SECTION 6(b) OF THE CONSUMER PRODUCT SAFETY ACT Delegation of Authority to Information Group § 1101.71 Delegation of authority. (a) Delegation. Pursuant to section 27(b)(9) of the CPSA...
Effective spectral index properties for Fermi blazars
Yang, JiangHe; Fan, JunHui; Liu, Yi; Zhang, YueLian; Tuo, ManXian; Nie, JianJun; Yuan, YuHai
2018-05-01
Blazars are a special subclass of active galactic nuclei with extreme observation properties. This subclass can be divided into two further subclasses of flat spectrum radio quasars (FSRQs) and BL Lacertae objects (BL Lacs) according to their emission line features. To compare the spectral properties of FSRQs and BL Lacs, the 1.4 GHz radio, optical R-band, 1 keV X-ray, and 1 GeV γ-ray flux densities for 1108 Fermi blazars are calculated to discuss the properties of the six effective spectral indices of radio to optical ( α RO), radio to X-ray ( α RX), radio to γ ray ( α Rγ), optical to X-ray ( α OX), optical to γ ray ( α Oγ), and X-ray to γ ray ( α Xγ). The main results are as follows: For the averaged effective spectral indices, \\overline {{α _{OX}}} > \\overline {{α _{Oγ }}} > \\overline {{α _{Xγ }}} > \\overline {{α _{Rγ }}} > \\overline {{α _{RX}}} > \\overline {{α _{RO}}} for samples of whole blazars and BL Lacs; \\overline {{α _{Xγ }}} ≈ \\overline {{α _{Rγ }}} ≈ \\overline {{α _{RX}}} for FSRQs and low-frequency-peaked BL Lacs (LBLs); and \\overline {{α _{OX}}} ≈ \\overline {{α _{Oγ }}} ≈ \\overline {{α _{Xγ }}} for high-synchrotron-frequency-peaked BL Lacs (HBLs). The distributions of the effective spectral indices involving optical emission ( α RO, α OX, and α Oγ) for LBLs are different from those for FSRQs, but if the effective spectral index does not involve optical emission ( α RX, α Rγ, and α Xγ), the distributions for LBLs and FSRQs almost come from the same parent population. X-ray emissions from blazars include both synchrotron and inverse Compton (IC) components; the IC component for FSRQs and LBLs accounts for a larger proportion than that for HBLs; and the radiation mechanism for LBLs is similar to that for FSRQs, but the radiation mechanism for HBLs is different from that for both FSRQs and LBLs in X-ray bands. The tendency of α Rγ decreasing from LBLs to HBLs suggests that the synchrotron self
International Nuclear Information System (INIS)
Bottacini, E.; Schady, P.; Rau, A.; Zhang, X.-L.; Greiner, J.; Boettcher, M.; Ajello, M.; Fendt, C.
2010-01-01
1ES 1959+650 is one of the most remarkable high-peaked BL Lacertae objects (HBL). In 2002, it exhibited a TeV γ-ray flare without a similar brightening of the synchrotron component at lower energies. This orphan TeV flare remained a mystery. We present the results of a multifrequency campaign, triggered by the INTEGRAL IBIS detection of 1ES 1959+650. Our data range from the optical to hard X-ray energies, thus covering the synchrotron and inverse-Compton components simultaneously. We observed the source with INTEGRAL, the Swift X-Ray Telescope, and the UV-Optical Telescope, and nearly simultaneously with a ground-based optical telescope. The steep spectral component at X-ray energies is most likely due to synchrotron emission, while at soft γ-ray energies the hard spectral index may be interpreted as the onset of the high-energy component of the blazar spectral energy distribution (SED). This is the first clear measurement of a concave X-ray-soft γ-ray spectrum for an HBL. The SED can be well modeled with a leptonic synchrotron self-Compton model. When the SED is fitted this model requires a very hard electron spectral index of q ∼ 1.85, possibly indicating the relevance of second-order Fermi acceleration.
Six-year optical monitoring of the BL Lacertae object 1ES 0806+52.4
Energy Technology Data Exchange (ETDEWEB)
Man, Zhongyi; Zhang, Xiaoyuan; Wu, Jianghua [Department of Astronomy, Beijing Normal University, Beijing 100875 (China); Zhou, Xu [Key Laboratory of Optical Astronomy, National Astronomical Observatories, Chinese Academy of Sciences, 20A Datun Road, Beijing 100012 (China); Yuan, Qirong, E-mail: jhwu@bnu.edu.cn [Department of Physics and Institute of Theoretical Physics, Nanjing Normal University, Nanjing 210046 (China)
2014-12-01
We present the results of the first systematic long-term multicolor optical monitoring of the BL Lacertae object 1ES 0806+52.4. The monitoring was performed in multiple passbands with a 60/90 cm Schmidt telescope from 2005 December to 2011 February. The overall brightness of this object decreased from 2005 December to 2008 December but was regained after that. A sharp outburst probably occurred around the end of our monitoring program. Overlapping the long-term trend are some short-term small-amplitude oscillations. No intranight variability was found in the object, which is in accordance with the historical observations before 2005. By investigating the color behavior, we found a strong bluer-when-brighter chromatism for the long-term variability of 1ES 0806+52.4. The total amplitudes at the c, i, and o bands are 1.18, 1.12, and 1.02 mag, respectively. The amplitudes tend to increase toward shorter wavelengths, which may be a major cause of the bluer-when-brighter chromatism. Such bluer-when-brighter chromatisms are also found in other blazars, such as S5 0716+714, OJ 287. The hard-X-ray data collected from the Swift/BAT archive was correlated with our optical data. No positive result was found, the reason for which may be that the hard-X-ray flux is a combination of the synchrotron and inverse Compton emission, but with different timescales and cadences under the leptonic synchrotron self-Compton model.
SMARTScience Tools: Interacting With Blazar Data In The Web Browser
Hasan, Imran; Isler, Jedidah; Urry, C. Megan; MacPherson, Emily; Buxton, Michelle; Bailyn, Charles D.; Coppi, Paolo S.
2014-08-01
The Yale-SMARTS blazar group has accumulated 6 years of optical-IR photometry of more than 70 blazars, mostly bright enough in gamma-rays to be detected with Fermi. Observations were done with the ANDICAM instrument on the SMARTS 1.3 m telescope at the Cerro Tololo Inter-American Observatory. As a result of this long-term, multiwavelength monitoring, we have produced a calibrated, publicly available data set (see www.astro.yale.edu/smarts/glast/home.php), which we have used to find that (i) optical-IR and gamma-ray light curves are well correlated, supporting inverse-Compton models for gamma-ray production (Bonning et al. 2009, 2012), (ii) at their brightest, blazar jets can contribute significantly to the photoionization of the broad-emission-line region, indicating that gamma-rays are produced within 0.1 pc of the black hole in at least some cases (Isler et al. 2014), and (iii) optical-IR and gamma-ray flares are symmetric, implying the time scales are dominated by light-travel-time effects rather than acceleration or cooling (Chatterjee et al. 2012). The volume of data and diversity of projects for which it is used calls out for an efficient means of visualization. To this end, we have developed a suite of visualization tools called SMARTScience Tools, which allow users to interact dynamically with our dataset. The SMARTScience Tools is publicly available via our webpage and can be used to customize multiwavelength light curves and color magnitude diagrams quickly and intuitively. Users can choose specific bands to construct plots, and the plots include features such as band-by-band panning, dynamic zooming, and direct mouse interaction with individual data points. Human and machine readable tables of the plotted data can be directly printed for the user's convenience and for further independent study. The SMARTScience Tools significantly improves the public’s ability to interact with the Yale-SMARTS 6-year data base of blazar photometry, and should make
The Gamma-Ray Blazar Content of the Northern Sky
Energy Technology Data Exchange (ETDEWEB)
Michelson, Peter
2003-07-16
Using survey data, we have re-evaluated the correlation of flat spectrum radio sources with EGRET sources in the Northern sky. An analysis incorporating the radio and X-ray properties and the {gamma}-ray source localization is used to gauge the reliability of associations and to search for counterparts of previously unidentified EGRET sources. Above |b|=10{sup o}, where the classification is complete, we find that 70% of the Northern EGRET sources have counterparts similar to the bright EGRET blazars. For several of these we identify known blazar counterparts more likely than the earlier proposed 3EG association; for {approx}20 we have new identifications. Spectroscopic confirmation of these candidates is in progress and we have found flat spectrum radio quasars and BL Lac counterparts with redshifts as high as 4. We also find strong evidence for a set of 28 objects with no plausible counterpart like the known EGRET blazars. These thus represent either a new extragalactic population or a population of Galactic objects with a large scale height. The survey has been extended into the plane, where we find several new blazar candidates; the bulk of the sources are, however, Galactic. Looking ahead to the GLAST era, we predict that several of the present 3EG sources are composite and that higher resolution data will break these into multiple blazar IDs.
22 CFR 1101.17 - Annual report to Congress.
2010-04-01
... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Annual report to Congress. 1101.17 Section 1101.17 Foreign Relations INTERNATIONAL BOUNDARY AND WATER COMMISSION, UNITED STATES AND MEXICO, UNITED... the House of Representatives and the President of the Senate for referral to the appropriate...
46 CFR 232.1 - Purpose and applicability.
2010-10-01
... ACTIVITIES UNIFORM FINANCIAL REPORTING REQUIREMENTS § 232.1 Purpose and applicability. (a) Purpose. The purpose of this regulation is to establish uniform reporting requirements for the preparation of financial reports and submissions of information to the Maritime Administration. The Maritime Administration will...
Infrared polarimetry of the nucleus of Centaurus A: the nearest blazar
Energy Technology Data Exchange (ETDEWEB)
Bailey, J; Sparks, W B; Hough, J H; Axon, D J
1986-07-10
As one of the nearest examples of an active galaxy, NGC5128 (Centaurus A) has been studied in detail over a wide range of wavelengths. The authors have made polarization observations of the infrared nucleus at wavelengths from 1.2 to 3.8 ..mu..m. The nucleus is found to have a large intrinsic polarization of approx.=9% at position angle 147/sup 0/. This position angle is perpendicular to the direction of the X-ray and radio jet. The polarized emission from the nucleus is interpreted as synchrotron radiation from a region whose magnetic field is parallel to the jet direction. The properties of the Cen A nucleus are essentially identical to those of the much more luminous blazars. This suggest that blazar-type activity extends over a very wide range in luminosity, and low-luminosity blazars may be common in elliptical galaxies.
The radio-γ-ray connection in Fermi blazars
Ghirlanda, G.; Ghisellini, G.; Tavecchio, F.; Foschini, L.; Bonnoli, G.
2011-05-01
We study the correlation between the γ-ray flux (Fγ), averaged over the first 11 months of the Fermi survey and integrated above 100 MeV, and the radio flux density (Fr at 20 GHz) of Fermi sources associated with a radio counterpart in the 20-GHz Australia Telescope Compact Array (AT20G) survey. Considering the blazars detected in both bands, the correlation is highly significant and has the form Fγ∝F0.85±0.04r, similar to BL Lacertae objects and flat-spectrum radio quasars. However, only a small fraction (˜1/15) of the AT20G radio sources with flat radio spectra are detected by Fermi. To understand if this correlation is real, we examine the selection effects introduced by the flux limits of both the radio and the γ-ray surveys, and the importance of variability of the γ-ray flux. After accounting for these effects, we find that the radio-γ-ray flux correlation is real, but its slope is steeper than the observed one, that is, Fγ∝Fδr with δ in the range 1.25-1.5. The observed Fγ-Fr correlation and the fraction of radio sources detected by Fermi are reproduced assuming a long-term γ-ray flux variability, following a lognormal probability distribution with standard deviation σ≥ 0.5 (corresponding to Fγ varying by at least a factor of 3). Such a variability is compatible, even if not necessarily equal, with what is observed when comparing, for the sources in common, the EGRET and the Fermi γ-ray fluxes (even if the Fermi fluxes are averaged over ˜1 yr). Another indication of variability is the non-detection of 12 out of 66 EGRET blazars by Fermi, despite its higher sensitivity. We also study the strong linear correlation between the γ-ray and the radio luminosity of the 144 AT20G-Fermi associations with known redshift and show, through partial correlation analysis, that it is statistically robust. Two possible implications of these correlations are discussed: the contribution of blazars to the extragalactic γ-ray background and the prediction
Agarwal, A.; Mohan, P.; Gupta, Alok C.; Mangalam, A.; Volvach, A. E.; Aller, M. F.; Aller, H. D.; Gu, M. F.; Lähteenmäki, A.; Tornikoski, M.; Volvach, L. N.
2017-07-01
We studied the pc-scale core shift effect using radio light curves for three blazars, S5 0716+714, 3C 279 and BL Lacertae, which were monitored at five frequencies (ν) between 4.8 and 36.8 GHz using the University of Michigan Radio Astronomical Observatory (UMRAO), the Crimean Astrophysical Observatory (CrAO) and Metsähovi Radio Observatory for over 40 yr. Flares were Gaussian fitted to derive time delays between observed frequencies for each flare (Δt), peak amplitude (A) and their half width. Using A ∝ να, we infer α in the range of -16.67-2.41 and using Δ t ∝ ν ^{1/k_r}, we infer kr ∼ 1, employed in the context of equipartition between magnetic and kinetic energy density for parameter estimation. From the estimated core position offset (Ωrν) and the core radius (rcore), we infer that opacity model may not be valid in all cases. The mean magnetic field strengths at 1 pc (B1) and at the core (Bcore) are in agreement with previous estimates. We apply the magnetically arrested disc model to estimate black hole spins in the range of 0.15-0.9 for these blazars, indicating that the model is consistent with expected accretion mode in such sources. The power-law-shaped power spectral density has slopes -1.3 to -2.3 and is interpreted in terms of multiple shocks or magnetic instabilities.
International Nuclear Information System (INIS)
Ricci, F.; Massaro, F.; Landoni, M.; D’Abrusco, R.; Milisavljevic, D.; Paggi, A.; Smith, Howard A.; Stern, D.; Masetti, N.; Tosti, G.
2015-01-01
The extragalactic γ-ray sky is dominated by the emission arising from blazars, one of the most peculiar classes of radio-loud active galaxies. Since the launch of Fermi several methods were developed to search for blazars as potential counterparts of unidentified γ-ray sources (UGSs). To confirm the nature of the selected candidates, optical spectroscopic observations are necessary. In 2013 we started a spectroscopic campaign to investigate γ-ray blazar candidates selected according to different procedures. The main goals of our campaign are: (1) to confirm the nature of these candidates, and (2) whenever possible, determine their redshifts. Optical spectroscopic observations will also permit us to verify the robustness of the proposed associations and check for the presence of possible source class contaminants to our counterpart selection. This paper reports the results of observations carried out in 2014 in the northern hemisphere with Kitt Peak National Observatory and in the southern hemisphere with the Southern Astrophysical Research telescopes. We also report three sources observed with the Magellan and Palomar telescopes. Our selection of blazar-like sources that could be potential counterparts of UGSs is based on their peculiar infrared colors and on their combination with radio observations both at high and low frequencies (i.e., above and below ∼1 GHz) in publicly available large radio surveys. We present the optical spectra of 27 objects. We confirm the blazar-like nature of nine sources that appear to be potential low-energy counterparts of UGSs. Then we present new spectroscopic observations of 10 active galaxies of uncertain type associated with Fermi sources, classifying all of them as blazars. In addition, we present the spectra for five known γ-ray blazars with uncertain redshift estimates and three BL Lac candidates that were observed during our campaign. We also report the case for WISE J173052.85−035247.2, candidate counterpart of the
Energy Technology Data Exchange (ETDEWEB)
Ricci, F. [Dipartimento di Matematica e Fisica, Università Roma Tre, via della Vasca Navale 84, I-00146, Roma (Italy); Massaro, F. [Dipartimento di Fisica, Università degli Studi di Torino, via Pietro Giuria 1, I-10125 Torino (Italy); Landoni, M. [INAF-Osservatorio Astronomico di Brera, Via Emilio Bianchi 46, I-23807 Merate (Italy); D’Abrusco, R.; Milisavljevic, D.; Paggi, A.; Smith, Howard A. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Stern, D. [Jet Propulsion Laboratory, California Institute of Technology, 4800 Oak Grove Drive, Mail Stop 169-221, Pasadena, CA 91109 (United States); Masetti, N. [INAF-Istituto di Astrofisica Spaziale e Fisica Cosmica di Bologna, via Gobetti 101, I-40129, Bologna (Italy); Tosti, G., E-mail: riccif@fis.uniroma3.it [Dipartimento di Fisica, Università degli Studi di Perugia, I-06123 Perugia (Italy)
2015-05-15
The extragalactic γ-ray sky is dominated by the emission arising from blazars, one of the most peculiar classes of radio-loud active galaxies. Since the launch of Fermi several methods were developed to search for blazars as potential counterparts of unidentified γ-ray sources (UGSs). To confirm the nature of the selected candidates, optical spectroscopic observations are necessary. In 2013 we started a spectroscopic campaign to investigate γ-ray blazar candidates selected according to different procedures. The main goals of our campaign are: (1) to confirm the nature of these candidates, and (2) whenever possible, determine their redshifts. Optical spectroscopic observations will also permit us to verify the robustness of the proposed associations and check for the presence of possible source class contaminants to our counterpart selection. This paper reports the results of observations carried out in 2014 in the northern hemisphere with Kitt Peak National Observatory and in the southern hemisphere with the Southern Astrophysical Research telescopes. We also report three sources observed with the Magellan and Palomar telescopes. Our selection of blazar-like sources that could be potential counterparts of UGSs is based on their peculiar infrared colors and on their combination with radio observations both at high and low frequencies (i.e., above and below ∼1 GHz) in publicly available large radio surveys. We present the optical spectra of 27 objects. We confirm the blazar-like nature of nine sources that appear to be potential low-energy counterparts of UGSs. Then we present new spectroscopic observations of 10 active galaxies of uncertain type associated with Fermi sources, classifying all of them as blazars. In addition, we present the spectra for five known γ-ray blazars with uncertain redshift estimates and three BL Lac candidates that were observed during our campaign. We also report the case for WISE J173052.85−035247.2, candidate counterpart of the
Multi-Band Spectral Properties of Fermi Blazars Benzhong Dai ...
Indian Academy of Sciences (India)
... FSRQs, 41 AGNs of other types and 72 AGNs of unknown type (Abdo et al. 2010a). This large sample enable us to investigate the spectral shapes of blazars from optical to X-ray to γ-ray in more detail than has been done before. For this purpose, we collected data for all Fermi blazars having available spectral information.
Extended Radio Emission in MOJAVE Blazars: Challenges to Unification
Kharb, P.; Lister, M. L.; Cooper, N. J.
2010-02-01
We present the results of a study on the kiloparsec-scale radio emission in the complete flux density limited MOJAVE sample, comprising 135 radio-loud active galactic nuclei. New 1.4 GHz Very Large Array (VLA) radio images of six quasars and previously unpublished images of 21 blazars are presented, along with an analysis of the high-resolution (VLA A-array) 1.4 GHz emission for the entire sample. While extended emission is detected in the majority of the sources, about 7% of the sources exhibit only radio core emission. We expect more sensitive radio observations, however, to detect faint emission in these sources, as we have detected in the erstwhile "core-only" source, 1548+056. The kiloparsec-scale radio morphology varies widely across the sample. Many BL Lac objects exhibit extended radio power and kiloparsec-scale morphology typical of powerful FRII jets, while a substantial number of quasars possess radio powers intermediate between FRIs and FRIIs. This poses challenges to the simple radio-loud unified scheme, which links BL Lac objects to FRIs and quasars to FRIIs. We find a significant correlation between extended radio emission and parsec-scale jet speeds: the more radio powerful sources possess faster jets. This indicates that the 1.4 GHz (or low-frequency) radio emission is indeed related to jet kinetic power. Various properties such as extended radio power and apparent parsec-scale jet speeds vary smoothly between different blazar subclasses, suggesting that, at least in terms of radio jet properties, the distinction between quasars and BL Lac objects, at an emission-line equivalent width of 5 Å, is essentially an arbitrary one. While the two blazar subclasses display a smooth continuation in properties, they often reveal differences in the correlation test results when considered separately. This can be understood if, unlike quasars, BL Lac objects do not constitute a homogeneous population, but rather include both FRI and FRII radio galaxies for
EXTENDED RADIO EMISSION IN MOJAVE BLAZARS: CHALLENGES TO UNIFICATION
International Nuclear Information System (INIS)
Kharb, P.; Lister, M. L.; Cooper, N. J.
2010-01-01
We present the results of a study on the kiloparsec-scale radio emission in the complete flux density limited MOJAVE sample, comprising 135 radio-loud active galactic nuclei. New 1.4 GHz Very Large Array (VLA) radio images of six quasars and previously unpublished images of 21 blazars are presented, along with an analysis of the high-resolution (VLA A-array) 1.4 GHz emission for the entire sample. While extended emission is detected in the majority of the sources, about 7% of the sources exhibit only radio core emission. We expect more sensitive radio observations, however, to detect faint emission in these sources, as we have detected in the erstwhile 'core-only' source, 1548+056. The kiloparsec-scale radio morphology varies widely across the sample. Many BL Lac objects exhibit extended radio power and kiloparsec-scale morphology typical of powerful FRII jets, while a substantial number of quasars possess radio powers intermediate between FRIs and FRIIs. This poses challenges to the simple radio-loud unified scheme, which links BL Lac objects to FRIs and quasars to FRIIs. We find a significant correlation between extended radio emission and parsec-scale jet speeds: the more radio powerful sources possess faster jets. This indicates that the 1.4 GHz (or low-frequency) radio emission is indeed related to jet kinetic power. Various properties such as extended radio power and apparent parsec-scale jet speeds vary smoothly between different blazar subclasses, suggesting that, at least in terms of radio jet properties, the distinction between quasars and BL Lac objects, at an emission-line equivalent width of 5 A, is essentially an arbitrary one. While the two blazar subclasses display a smooth continuation in properties, they often reveal differences in the correlation test results when considered separately. This can be understood if, unlike quasars, BL Lac objects do not constitute a homogeneous population, but rather include both FRI and FRII radio galaxies for
NCBI nr-aa BLAST: CBRC-MLUC-01-1101 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MLUC-01-1101 ref|NP_001136139.1| feline leukemia virus subgroup A receptor [Su...s scrofa] gb|ACJ60911.1| feline leukemia virus subgroup A receptor [Sus scrofa] NP_001136139.1 0.0 89% ...
Frequency dependent polarization in blazars
International Nuclear Information System (INIS)
Bjoernsson, C.I.
1984-10-01
It is argued that the intrinsic frequency dependent polarization in blazars finds its most straightforward explanations in terms of a single rather than a multicomponent sourcemodel. In order to reproduce the observations, under the assumption that the emission mechanism is optically thin synchrotron radiation, both a well ordered magnetic field and an electron distribution with a sharp break or cuttoff are necessary. Non-uniform pitch angle distribution and/or environments where synchrotron losses are important are both conducive to producing strong frequency dependent polarization. Reasons are put forth as to why such conditions ar expected to occur in blazars. Two specific models are discussed in detail and it is shown that they are both able to produce strong frequency dependent polarization, even when the spectral index changes by a small amount only. (orig.)
No indications of axionlike particles from Fermi
International Nuclear Information System (INIS)
Belikov, Alexander V.; Goodenough, Lisa; Hooper, Dan
2011-01-01
As very high energy (> or approx. 100 GeV) gamma rays travel over cosmological distances, their flux is attenuated through interactions with the extragalactic background light. Observations of distant gamma ray sources at energies between ∼200 GeV and a few TeV by ground-based gamma-ray telescopes such as HESS, however, have motivated the possibility that the universe is more transparent to very high energy photons than had been anticipated. One proposed explanation for this is the existence of axionlike particles (ALPs) which gamma rays can efficiently oscillate into, enabling them to travel cosmological distances without attenuation. In this article, we use a state-of-the-art model for the extragalactic background light (which is somewhat lower at ∼μm wavelengths than in previous models) and data from the Fermi Gamma Ray Space Telescope to calculate the spectra at 1-100 GeV of two gamma-ray sources, 1ES1101-232 at redshift z=0.186 and H2356-309 at z=0.165, in conjunction with the measurements of ground-based telescopes, to test the ALP hypothesis. We find that these observations can be well fit by an intrinsic power-law source spectrum with indices of -1.72 and -2.1 for 1ES1101-232 and H2356-309, respectively, and that no ALPs or other exotic physics is necessary to explain the observed degree of attenuation. While this does not exclude the possibility that ALPs are involved in the cosmological propagation of gamma rays, it does reduce the motivation for such new physics.
UV and X-ray Variability of Blazars Alok C. Gupta
Indian Academy of Sciences (India)
mostly soft X-rays hardness ratio show correlations with blazar luminos- ity and different modes of variability might be operating for different time scales and ... The real cause of blazar variability on diverse time scales is not yet well under- stood. ... stereoscopic system (HESS) at a 45σ significance level (Aharonian et al.
On the intrinsic shape of the gamma-ray spectrum for Fermi blazars
Kang, Shi-Ju; Wu, Qingwen; Zheng, Yong-Gang; Yin, Yue; Song, Jia-Li; Zou, Hang; Feng, Jian-Chao; Dong, Ai-Jun; Wu, Zhong-Zu; Zhang, Zhi-Bin; Wu, Lin-Hui
2018-05-01
The curvature of the γ-ray spectrumin blazarsmay reflect the intrinsic distribution of emitting electrons, which will further give some information on the possible acceleration and cooling processes in the emitting region. The γ-ray spectra of Fermi blazars are normally fitted either by a single power-law (PL) or a log-normal (call Logarithmic Parabola, LP) form. The possible reason for this difference is not clear. We statistically explore this issue based on the different observational properties of 1419 Fermi blazars in the 3LAC Clean Sample.We find that the γ-ray flux (100MeV–100GeV) and variability index follow bimodal distributions for PL and LP blazars, where the γ-ray flux and variability index show a positive correlation. However, the distributions of γ-ray luminosity and redshift follow a unimodal distribution. Our results suggest that the bimodal distribution of γ-ray fluxes for LP and PL blazars may not be intrinsic and all blazars may have an intrinsically curved γ-ray spectrum, and the PL spectrum is just caused by the fitting effect due to less photons.
Molecular characteristic and pathogenicity of Indonesian H5N1 clade 2.3.2 viruses
Directory of Open Access Journals (Sweden)
Dharmayanti NLPI
2013-06-01
Full Text Available The outbreak of disease in late 2012 in Indonesia caused high duck mortality. The agent of the disease was identified as H5N1 clade 2.3.2. The disease caused economic loss to the Indonesian duck farmer. The clade 2.3.2 of H5N1 virus has not previously been identified, so this study was conducted to characterize 4 of H5N1 clade 2.3.2 viruses by DNA sequencing in eight genes segment virus namely HA, NA, NS, M, PB1, PB2, PA and NP. The pathogenicity test of clade 2.3.2 viruses in ducks was compared to clade 2.1.3 viruses which predominat circulating in Indonesia. Results of phylogenetic tree analysis showed that the four of clade 2.3.2 viruses isolated in 2012 was the new introduced virus from abroad. Further analysis showed eight genes were in one group with the clade 2.3.2 viruses, especially those from VietNam and did not belong to Indonesia viruses group. The pathogenicity test in ducks showed that virus H5N1 clade 2.3.2 and clade 2.1.3 have similar clinical symptoms and pathogenicity and cause death in 75% of ducks on days 3-6 after infection.
Probing the Diffuse Optical-IR Background with TeV Blazars Detected with the MAGIC Telescopes
Energy Technology Data Exchange (ETDEWEB)
Prandini, Elisa [Dipartimento di Fisica e Astronomia “G. Galilei”, University of Padova, Padua (Italy); Domínguez, Alberto [Departamento de Física Atómica, Universidad Complutense, Madrid (Spain); Fallah Ramazani, Vandad [Tuorla observatory, University of Turku, Turku (Finland); Hassan, Tarek [IFAE, The Barcelona Institute of Science and Technology, Bellaterra (Spain); Mazin, Daniel [Max Planck Institute for Physics, Munich (Germany); Institute for Cosmic Ray Research, University of Tokyo, Tokyo (Japan); Moralejo, Abelardo [IFAE, The Barcelona Institute of Science and Technology, Bellaterra (Spain); Nievas Rosillo, Mireia [Departamento de Física Atómica, Universidad Complutense, Madrid (Spain); Vanzo, Gaia; Vazquez Acosta, Monica, E-mail: prandini@pd.infn.it [Instituto de Astrofísica de Canarias, Tenerife (Spain); Departamento de Astrofisica, Universidad de La Laguna, Tenerife (Spain)
2017-11-22
Blazars are radio loud quasars whose jet points toward the observer. The observed emission is mostly non-thermal, dominated by the jet emission, and in some cases extends up to the very high energy gamma rays (VHE; E > 100 GeV). To date, more than 60 blazars have been detected at VHE mainly with ground-based imaging atmospheric Cherenkov telescopes (IACTs) such as MAGIC, H.E.S.S., and VERITAS. Energetic photons from a blazar may interact with the diffuse optical and IR background (the extragalactic background light, EBL) leaving an imprint on the blazar energy spectrum. This effect can be used to constrain the EBL, with basic assumptions on the intrinsic energy spectrum. Current generation of IACTs is providing valuable measurements of the EBL density and energy spectrum from optical to infrared frequencies. In this contribution, we present the latest results obtained with the data taken with the MAGIC telescopes: using 32 spectra from 12 blazars, the scale factor of the optical density predicted by the EBL model from Domínguez et al. (2011) is constrained to be 0.95 (+0.11, −0.12){sub stat} (+0.16, −0.07){sub sys}, where a value of 1 means the perfect match with the model.
Probing the Diffuse Optical-IR Background with TeV Blazars Detected with the MAGIC Telescopes
Directory of Open Access Journals (Sweden)
Elisa Prandini
2017-11-01
Full Text Available Blazars are radio loud quasars whose jet points toward the observer. The observed emission is mostly non-thermal, dominated by the jet emission, and in some cases extends up to the very high energy gamma rays (VHE; E > 100 GeV. To date, more than 60 blazars have been detected at VHE mainly with ground-based imaging atmospheric Cherenkov telescopes (IACTs such as MAGIC, H.E.S.S., and VERITAS. Energetic photons from a blazar may interact with the diffuse optical and IR background (the extragalactic background light, EBL leaving an imprint on the blazar energy spectrum. This effect can be used to constrain the EBL, with basic assumptions on the intrinsic energy spectrum. Current generation of IACTs is providing valuable measurements of the EBL density and energy spectrum from optical to infrared frequencies. In this contribution, we present the latest results obtained with the data taken with the MAGIC telescopes: using 32 spectra from 12 blazars, the scale factor of the optical density predicted by the EBL model from Domínguez et al. (2011 is constrained to be 0.95 (+0.11, −0.12stat (+0.16, −0.07sys, where a value of 1 means the perfect match with the model.
Detecting The EBL Attenuation Of Blazars With GLAST
Reyes, Luis C.
2006-09-01
The Large Area Telescope (LAT) on board GLAST (Gamma-ray Large Area Space Telescope) due for launch in Fall 2007 will study the gamma-ray sky in the energy range 20 MeV to >300 GeV. GLAST-LAT's improved sensitivity with respect to previous missions will increase the number of known Blazars from about 100 to thousands, with redshifts up to z 5. Since Gamma rays with energy above 10 GeV interact via pair-production with photons from the Extragalactic Background Light (EBL), the systematic attenuation of GLAST-detected Blazars as a function of redshift would constitute and effective and unique probe to the optical-UV EBL density and its evolution over cosmic history. Based on the GLAST-LAT instrument performance, detailed simulations of expected blazar populations attenuated by EBL have been performed. In this poster we present an analysis of such simulations in order to measure the EBL attenuation, ensuing a clear distinction between competing EBL models.
Signature of inverse Compton emission from blazars
Gaur, Haritma; Mohan, Prashanth; Wierzcholska, Alicja; Gu, Minfeng
2018-01-01
Blazars are classified into high-, intermediate- and low-energy-peaked sources based on the location of their synchrotron peak. This lies in infra-red/optical to ultra-violet bands for low- and intermediate-peaked blazars. The transition from synchrotron to inverse Compton emission falls in the X-ray bands for such sources. We present the spectral and timing analysis of 14 low- and intermediate-energy-peaked blazars observed with XMM-Newton spanning 31 epochs. Parametric fits to X-ray spectra help constrain the possible location of transition from the high-energy end of the synchrotron to the low-energy end of the inverse Compton emission. In seven sources in our sample, we infer such a transition and constrain the break energy in the range 0.6-10 keV. The Lomb-Scargle periodogram is used to estimate the power spectral density (PSD) shape. It is well described by a power law in a majority of light curves, the index being flatter compared to general expectation from active galactic nuclei, ranging here between 0.01 and 1.12, possibly due to short observation durations resulting in an absence of long-term trends. A toy model involving synchrotron self-Compton and external Compton (EC; disc, broad line region, torus) mechanisms are used to estimate magnetic field strength ≤0.03-0.88 G in sources displaying the energy break and infer a prominent EC contribution. The time-scale for variability being shorter than synchrotron cooling implies steeper PSD slopes which are inferred in these sources.
DETECTION OF VERY HARD γ -RAY SPECTRUM FROM THE TEV BLAZAR MRK 501
Energy Technology Data Exchange (ETDEWEB)
Shukla, A.; Chitnis, V. R.; Acharya, B. S. [Department of High Energy Physics, Tata Institute of Fundamental Research, Mumbai 400005 (India); Mannheim, K.; Dorner, D. [Institute for Theoretical Physics and Astrophysics, Universität Würzburg, D-97074 Würzburg (Germany); Roy, J. [UM-DAE Center for Excellence in Basic Sciences, Mumbai 400098 (India); Hughes, G.; Biland, A. [ETH Zurich, Institute for Particle Physics, Otto-Stern-Weg 5, 8093 Zurich (Switzerland)
2016-12-01
The occasional hardening of the GeV-to-TeV spectrum observed from the blazar Mrk 501 has reopened the debate on the physical origin of radiation and particle acceleration processes in TeV blazars. We have used the ∼7 years of Fermi -LAT data to search for the time intervals with unusually hard spectra from the nearby TeV blazar Mrk 501. We detected hard spectral components above 10 GeV with photon index <1.5 at a significance level of more than 5 sigma on 17 occasions, each with 30 day integration time. The photon index of the hardest component reached a value of 0.89 ± 0.29. We interpret these hard spectra as signatures of intermittent injection of sharply peaked and localized particle distributions from the base of the jet.
14 CFR 1214.1101 - Announcement.
2010-01-01
... Recruitment and Selection Program § 1214.1101 Announcement. (a) Astronaut candidate opportunities Will be... continuing pool of applicants. The military services will convene their internal selection boards and provide...
Simultaneous Planck, Swift, and Fermi observations of X-ray and γ-ray selected blazars
International Nuclear Information System (INIS)
Giommi, P.; Polenta, G.; Lähteenmäki, A.; Thompson, D. J.; Capalbi, M.
2012-01-01
We present simultaneous Planck, Swift, Fermi, and ground-based data for 105 blazars belonging to three samples with flux limits in the soft X-ray, hard X-ray, and γ-ray bands, with additional 5GHz flux-density limits to ensure a good probability of a Planck detection. We compare our results to those of a companion paper presenting simultaneous Planck and multi-frequency observations of 104 radio-loud northern active galactic nuclei selected at radio frequencies. While we confirm several previous results, our unique data set allows us to demonstrate that the selection method strongly influences the results, producing biases that cannot be ignored. Almost all the BL Lac objects have been detected by the Fermi Large AreaTelescope (LAT), whereas 30% to 40% of the flat-spectrum radio quasars (FSRQs) in the radio, soft X-ray, and hard X-ray selected samples are still below the γ-ray detection limit even after integrating 27 months of Fermi-LAT data. The radio to sub-millimetre spectral slope of blazars is quite flat, with >α> ~ 0 up to about 70GHz, above which it steepens to ~ -0.65. The BL Lacs have significantly flatter spectra than FSRQs at higher frequencies. The distribution of the rest-frame synchrotron peak frequency (ν_p_e_a_k"S) in the spectral energy distribution (SED) of FSRQs is the same in all the blazar samples with ν_p_e_a_k"I"C>, ranges from 1021 to 1022 Hz. The distributions of ν_p_e_a_k"S and ν_p_e_a_k"I"C of BL Lacs are much broader and are shifted to higher energies than those of FSRQs; their shapes strongly depend on the selection method. The Compton dominance of blazars, defined as the ratio of the inverse Compton to synchrotron peak luminosities, ranges from less than 0.2 to nearly 100, with only FSRQs reaching values larger than about 3. Its distribution is broad and depends strongly on the selection method, with γ-ray selected blazars peaking at ~7 or more, and radio-selected blazars at values close to 1, thus implying that the common
41 CFR 50-201.1101 - Minimum wages.
2010-07-01
... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Minimum wages. 50-201... Contracts PUBLIC CONTRACTS, DEPARTMENT OF LABOR 201-GENERAL REGULATIONS § 50-201.1101 Minimum wages. Determinations of prevailing minimum wages or changes therein will be published in the Federal Register by the...
GAMMA-RAY OBSERVATIONAL PROPERTIES OF TeV-DETECTED BLAZARS
International Nuclear Information System (INIS)
Şentürk, G. D.; Errando, M.; Mukherjee, R.; Böttcher, M.
2013-01-01
The synergy between the Fermi-LAT and ground-based Cherenkov telescope arrays gives us the opportunity for the first time to characterize the high-energy emission from blazars over 5 decades in energy, from 100 MeV to 10 TeV. In this study, we perform a Fermi-LAT spectral analysis for TeV-detected blazars and combine it with archival TeV data. We examine the observational properties in the γ-ray band of our sample of TeV-detected blazars and compare the results with X-ray and GeV-selected populations. The spectral energy distributions (SEDs) that result from combining Fermi-LAT and ground-based spectra are studied in detail. Simple parameterizations such as a power-law function do not always reproduce the high-energy SEDs, where spectral features that could indicate intrinsic absorption are observed.
“Orphan” γ-Ray Flares and Stationary Sheaths of Blazar Jets
MacDonald, Nicholas R.; Jorstad, Svetlana G.; Marscher, Alan P.
2017-11-01
Blazars exhibit flares across the entire electromagnetic spectrum. Many γ-ray flares are highly correlated with flares detected at longer wavelengths; however, a small subset appears to occur in isolation, with little or no correlated variability at longer wavelengths. These “orphan” γ-ray flares challenge current models of blazar variability, most of which are unable to reproduce this type of behavior. MacDonald et al. have developed the Ring of Fire model to explain the origin of orphan γ-ray flares from within blazar jets. In this model, electrons contained within a blob of plasma moving relativistically along the spine of the jet inverse-Compton scatter synchrotron photons emanating off of a ring of shocked sheath plasma that enshrouds the jet spine. As the blob propagates through the ring, the scattering of the ring photons by the blob electrons creates an orphan γ-ray flare. This model was successfully applied to modeling a prominent orphan γ-ray flare observed in the blazar PKS 1510-089. To further support the plausibility of this model, MacDonald et al. presented a stacked radio map of PKS 1510-089 containing the polarimetric signature of a sheath of plasma surrounding the spine of the jet. In this paper, we extend our modeling and stacking techniques to a larger sample of blazars: 3C 273, 4C 71.01, 3C 279, 1055+018, CTA 102, and 3C 345, the majority of which have exhibited orphan γ-ray flares. We find that the model can successfully reproduce these flares, while our stacked maps reveal the existence of jet sheaths within these blazars.
SYSTEMATIC STUDY OF GAMMA-RAY-BRIGHT BLAZARS WITH OPTICAL POLARIZATION AND GAMMA-RAY VARIABILITY
Energy Technology Data Exchange (ETDEWEB)
Itoh, Ryosuke; Fukazawa, Yasushi; Kanda, Yuka; Shiki, Kensei; Kawabata, Miho; Nakaoka, Tatsuya; Takaki, Katsutoshi; Takata, Koji; Ui, Takahiro [Department of Physical Science, Hiroshima University, Higashi-Hiroshima, Hiroshima 739-8526 (Japan); Nalewajko, Krzysztof; Madejski, Greg M. [Kavli Institute for Particle Astrophysics and Cosmology, SLAC National Accelerator Laboratory, Stanford University, 2575 Sand Hill Road M/S 29, Menlo Park, CA 94025 (United States); Uemura, Makoto; Tanaka, Yasuyuki T.; Kawabata, Koji S.; Akitaya, Hiroshi; Ohsugi, Takashi [Hiroshima Astrophysical Science Center, Hiroshima University, Higashi-Hiroshima, Hiroshima 739-8526 (Japan); Schinzel, Frank K. [Department of Physics and Astronomy, University of New Mexico, Albuquerque, NM 87131 (United States); Moritani, Yuki [Kavli Institute for the Physics and Mathematics of the Universe (WPI), The University of Tokyo Institutes for Advanced Study, The University of Tokyo, Kashiwa, Chiba 277-8583 (Japan); Sasada, Mahito [Institute for Astrophysical Research, Boston University, 725 Commonwealth Avenue, Boston, MA 02215 (United States); Yamanaka, Masayuki, E-mail: itoh@hep01.hepl.hiroshima-u.ac.jp, E-mail: itoh@hp.phys.titech.ac.jp [Department of Physics, Faculty of Science and Engineering, Konan University, Okamoto, Kobe, Hyogo 658-8501 (Japan); and others
2016-12-10
Blazars are highly variable active galactic nuclei that emit radiation at all wavelengths from radio to gamma rays. Polarized radiation from blazars is one key piece of evidence for synchrotron radiation at low energies, and it also varies dramatically. The polarization of blazars is of interest for understanding the origin, confinement, and propagation of jets. However, even though numerous measurements have been performed, the mechanisms behind jet creation, composition, and variability are still debated. We performed simultaneous gamma-ray and optical photopolarimetry observations of 45 blazars between 2008 July and 2014 December to investigate the mechanisms of variability and search for a basic relation between the several subclasses of blazars. We identify a correlation between the maximum degree of optical linear polarization and the gamma-ray luminosity or the ratio of gamma-ray to optical fluxes. Since the maximum polarization degree depends on the condition of the magnetic field (chaotic or ordered), this result implies a systematic difference in the intrinsic alignment of magnetic fields in parsec-scale relativistic jets between different types of blazars (flat-spectrum radio quasars vs. BL Lacs) and consequently between different types of radio galaxies (FR I versus FR II).
GAMMA-RAY EMISSION FROM TWO BLAZARS BEHIND THE GALACTIC PLANE: B2013+370 AND B2023+336
International Nuclear Information System (INIS)
Kara, E.; Errando, M.; Aliu, E.; Mukherjee, R.; Max-Moerbeck, W.; Readhead, A. C. S.; Richards, J. L.; Böttcher, M.; Fortin, P.; Halpern, J. P.
2012-01-01
B2013+370 and B2023+336 are two blazars at low-galactic latitude that were previously proposed to be the counterparts for the EGRET unidentified sources 3EG J2016+3657 and 3EG J2027+3429. Gamma-ray emission associated with the EGRET sources has been detected by the Fermi Gamma-ray Space Telescope, and the two sources, 1FGL J2015.7+3708 and 1FGL J2027.6+3335, have been classified as unidentified in the 1 year catalog. This analysis of the Fermi Large Area Telescope (LAT) data collected during 31 months reveals that the 1FGL sources are spatially compatible with the blazars and are significantly variable, supporting the hypothesis of extragalactic origin for the gamma-ray emission. The gamma-ray light curves are compared with 15 GHz radio light curves from the 40 m telescope at the Owens Valley Radio Observatory. Simultaneous variability is seen in both bands for the two blazar candidates. The study is completed with the X-ray analysis of 1FGL J2015.7+3708 using Swift observations that were triggered in 2010 August by a Fermi-detected flare. The resulting spectral energy distribution shows a two-component structure typical of blazars. We also identify a second source in the field of view of 1FGL J2027.6+3335 with similar characteristics to the known LAT pulsars. This study gives solid evidence favoring blazar counterparts for these two unidentified EGRET and Fermi sources, supporting the hypothesis that a number of unidentified gamma-ray sources at low-galactic latitudes are indeed of extragalactic origin.
High-energy sources at low radio frequency: the Murchison Widefield Array view of Fermi blazars
International Nuclear Information System (INIS)
Giroletti, M.; Massaro, F.; D’Abrusco, R.; Lico, R.; Burlon, D.
2016-01-01
Low-frequency radio arrays are opening a new window for the study of the sky, both to study new phenomena and to better characterize known source classes. Being flat-spectrum sources, blazars are so far poorly studied at low radio frequencies. In this paper, we characterize the spectral properties of the blazar population at low radio frequency, compare the radio and high-energy properties of the gamma-ray blazar population, and search for radio counterparts of unidentified gamma-ray sources. We cross-correlated the 6100 deg"2 Murchison Widefield Array Commissioning Survey catalogue with the Roma blazar catalogue, the third catalogue of active galactic nuclei detected by Fermi-LAT, and the unidentified members of the entire third catalogue of gamma-ray sources detected by Fermi-LAT. When available, we also added high-frequency radio data from the Australia Telescope 20 GHz catalogue. We find low-frequency counterparts for 186 out of 517 (36%) blazars, 79 out of 174 (45%) gamma-ray blazars, and 8 out of 73 (11%) gamma-ray blazar candidates. The mean low-frequency (120–180 MHz) blazar spectral index is (α_l_o_w) = 0.57 ± 0.02: blazar spectra are flatter than the rest of the population of low-frequency sources, but are steeper than at ~GHz frequencies. Low-frequency radio flux density and gamma-ray energy flux display a mildly significant and broadly scattered correlation. Ten unidentified gamma-ray sources have a (probably fortuitous) positional match with low radio frequency sources. Low-frequency radio astronomy provides important information about sources with a flat radio spectrum and high energy. However, the relatively low sensitivity of the present surveys still misses a significant fraction of these objects. Finally, upcoming deeper surveys, such as the GaLactic and Extragalactic All-Sky MWA (GLEAM) survey, will provide further insight into this population.
Jets, black holes and disks in blazars
Directory of Open Access Journals (Sweden)
Ghisellini Gabriele
2013-12-01
Full Text Available The Fermi and Swift satellites, together with ground based Cherenkov telescopes, has greatly improved our knowledge of blazars, namely Flat Spectrum Radio Quasars and BL Lac objects, since all but the most powerful emit most of their electro–magnetic output at γ–ray energies, while the very powerful blazars emit mostly in the hard X–ray region of the spectrum. Often they show coordinated variability at different frequencies, suggesting that in these cases the same population of electrons is at work, in a single zone of the jet. The location of this region along the jet is a matter of debate. The jet power correlates with the mass accretion rate, with jets existing at all values of disk luminosities, measured in Eddington units, sampled so far. The most powerful blazars show clear evidence of the emission from their disks, and this has revived methods of finding the black hole mass and accretion rate by modelling a disk spectrum to the data. Being so luminous, blazars can be detected also at very high redshift, and therefore are a useful tool to explore the far universe. One interesting line of research concerns how heavy are their black holes at high redshifts. If we associate the presence of a relativistic jets with a fastly spinning black hole, then we naively expect that the accretion efficiency is larger than for non–spinning holes. As a consequence, the black hole mass in jetted systems should grow at a slower rate. In turn, this would imply that, at high redshifts, the heaviest black holes should be in radio–quiet quasars. We instead have evidences of the opposite, challenging our simple ideas of how a black hole grows.
A Model of Polarisation Rotations in Blazars from Kink Instabilities in Relativistic Jets
Directory of Open Access Journals (Sweden)
Krzysztof Nalewajko
2017-10-01
Full Text Available This paper presents a simple model of polarisation rotation in optically thin relativistic jets of blazars. The model is based on the development of helical (kink mode of current-driven instability. A possible explanation is suggested for the observational connection between polarisation rotations and optical/gamma-ray flares in blazars, if the current-driven modes are triggered by secular increases of the total jet power. The importance of intrinsic depolarisation in limiting the amplitude of coherent polarisation rotations is demonstrated. The polarisation rotation amplitude is thus very sensitive to the viewing angle, which appears to be inconsistent with the observational estimates of viewing angles in blazars showing polarisation rotations. Overall, there are serious obstacles to explaining large-amplitude polarisation rotations in blazars in terms of current-driven kink modes.
Intrinsic brightness temperatures of blazar jets at 15 GHz
Directory of Open Access Journals (Sweden)
Hovatta Talvikki
2013-12-01
Full Text Available We have developed a new Bayesian Markov Chain Monte Carlo method to deconvolve light curves of blazars into individual flares, including proper estimation of the fit errors. We use the method to fit 15GHzlight curves obtained within the OVRO 40-m blazar monitoring program where a large number of AGN have been monitored since 2008 in support of the Fermi Gamma-Ray Space Telescope mission. The time scales obtained from the fitted models are used to calculate the variability brightness temperature of the sources. Additionally, we have calculated brightness temperatures of a sample of these objects using Very Long Baseline Array data from the MOJAVE survey. Combining these two data sets enables us to study the intrinsic brightness temperature distribution in these blazars at 15 GHz. Our preliminary results indicate that the mean intrinsic brightness temperature in a sample of 14 sources is near the equipartition brightness temperature of ~ 1011K.
Yamaguchi, K; Kasahara, T; Yanagisawa, Y; Nanba, T; Aze, Y; Shinomiya, K; Yonezawa, H; Fujita, T
1997-12-01
Single dose toxicity studies of landiolol hydrochloride (ONO-1101), a novel ultra short acting beta-blocker, were conducted in Sprague-Dawley (SD) rats and beagle dogs. ONO-1101 was administered intravenously at a dose level of 37.5, 75, 150 or 300 mg/kg to rats of both sexes and 25, 50 or 100 mg/kg to male dogs. In the rat study, 5/6 males in the 150 mg/kg group and all animals in the 300 mg/kg group died during or right after administration. Survivors in the 150 mg/kg group showed temporal hypoactivity, bradypnea, dyspnea, tremor, loss of righting reflex and reddish lacrimation up to 5 min after injection. One male in the 150 mg/kg group had a tendency of suppression on body weight gain. No effects on clinical signs and body weight gain were seen in the 75 mg/kg group or lower. Necropsy findings showed only red tear in the majority of the decedents. In the dog study, all animals died within 6 min after administration in the 100 mg/kg group, showed ataxic gait, rolling and tachypnea followed by bradypnea and gasping/apnea. Incontinence of urine, defecation and vocalization were also seen in each one of two animals before death. Temporal hypoactivity was seen 1 min after administration in the 50 mg/kg group. No clinical signs were seen in the 25 mg/kg group. ONO-1101 did not affect bodyweight or food consumption. Necropsy findings of the decedents showed no abnormalities. It is indicated that the minimum lethal doses are 150 mg/kg in rats and 100 mg/kg in dogs.
Yet another NIR flare of the Blazar BZBJ1454+5124
Carrasco, L.; Porras, A.; Recillas, E.; Escobedo, G.; Chavushyan, V.
2018-05-01
We call attention on our recent observation of the Gamma Ray source 3FGLJ1454.5+5124 related with the quasar SBS1452+516 (z=1.0831) On March 28th,2018,(JD24582015.0015), we found this blazar to be in a new outburst.
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Background. 23.2 Section 23.2 Judicial Administration DEPARTMENT OF JUSTICE CRIMINAL INTELLIGENCE SYSTEMS OPERATING POLICIES § 23.2 Background. It is... potential threats to the privacy of individuals to whom such data relates, policy guidelines for Federally...
BLAZAR OPTICAL VARIABILITY IN THE PALOMAR-QUEST SURVEY
International Nuclear Information System (INIS)
Bauer, Anne; Baltay, Charles; Coppi, Paolo; Ellman, Nancy; Jerke, Jonathan; Rabinowitz, David; Scalzo, Richard
2009-01-01
We study the ensemble optical variability of 276 flat-spectrum radio quasars (FSRQs) and 86 BL Lacs in the Palomar-QUEST Survey with the goal of searching for common fluctuation properties, examining the range of behavior across the sample, and characterizing the appearance of blazars in such a survey so that future work can more easily identify such objects. The survey, which covers 15,000 deg 2 multiple times over 3.5 years, allows for the first ensemble blazar study of this scale. Variability amplitude distributions are shown for the FSRQ and BL Lac samples for numerous time lags, and also studied through structure function analyses. Individual blazars show a wide range of variability amplitudes, timescales, and duty cycles. Of the best-sampled objects, 35% are seen to vary by more than 0.4 mag; for these, the fraction of measurements contributing to the high-amplitude variability ranges constantly from about 5% to 80%. Blazar variability has some similarities to that of type I quasi-stellar objects (QSOs) but includes larger amplitude fluctuations on all timescales. FSRQ variability amplitudes are particularly similar to those of QSOs on timescales of several months, suggesting significant contributions from the accretion disk to the variable flux at these timescales. Optical variability amplitudes are correlated with the maximum apparent velocities of the radio jet for the subset of FSRQs with MOJAVE Very Long Baseline Array measurements, implying that the optically variable flux's strength is typically related to that of the radio emission. We also study CRATES radio-selected FSRQ candidates, which show similar variability characteristics to known FSRQs; this suggests a high purity for the CRATES sample.
The Electrostatic Instability for Realistic Pair Distributions in Blazar/EBL Cascades
Vafin, S.; Rafighi, I.; Pohl, M.; Niemiec, J.
2018-04-01
This work revisits the electrostatic instability for blazar-induced pair beams propagating through the intergalactic medium (IGM) using linear analysis and PIC simulations. We study the impact of the realistic distribution function of pairs resulting from the interaction of high-energy gamma-rays with the extragalactic background light. We present analytical and numerical calculations of the linear growth rate of the instability for the arbitrary orientation of wave vectors. Our results explicitly demonstrate that the finite angular spread of the beam dramatically affects the growth rate of the waves, leading to the fastest growth for wave vectors quasi-parallel to the beam direction and a growth rate at oblique directions that is only a factor of 2–4 smaller compared to the maximum. To study the nonlinear beam relaxation, we performed PIC simulations that take into account a realistic wide-energy distribution of beam particles. The parameters of the simulated beam-plasma system provide an adequate physical picture that can be extrapolated to realistic blazar-induced pairs. In our simulations, the beam looses only 1% of its energy, and we analytically estimate that the beam would lose its total energy over about 100 simulation times. An analytical scaling is then used to extrapolate the parameters of realistic blazar-induced pair beams. We find that they can dissipate their energy slightly faster by the electrostatic instability than through inverse-Compton scattering. The uncertainties arising from, e.g., details of the primary gamma-ray spectrum are too large to make firm statements for individual blazars, and an analysis based on their specific properties is required.
Breiding, Peter; Georganopoulos, Markos; Meyer, Eileen T.
2018-01-01
Recent multiwavelength work led by the Boston University blazar group (e.g., Marscher et al.) strongly suggests that a fraction of the blazar flares seen by the Fermi Large Area Telescope (LAT) take place a few to several pc away from the central engine. However, at such distances from the central engine, there is no adequate external photon field to provide the seed photons required for producing the observed GeV emission under leptonic inverse Compton (IC) models. A possible solution is a spine-sheath geometry for the emitting region (MacDonald et al., but see Nalewajko et al.). Here we use the current view of the molecular torus (e.g., Elitzur; Netzer), in which the torus extends a few pc beyond the dust sublimation radius with dust clouds distributed with a declining density for decreasing polar angle. We show that for a spine-sheath blazar jet embedded in the torus, the wide beaming pattern of the synchrotron radiation of the relatively slow sheath will heat molecular clouds with subsequent IR radiation that will be highly boosted in the spine comoving frame, and that under reasonable conditions this photon field can dominate over the sheath photons directly entering the spine. If the sheath is sufficiently luminous it will sublimate the dust, and if the sheath synchrotron radiation extends to optical-UV energies (as may happen during flares), this will illuminate the sublimated dust clouds to produce emission lines that will vary in unison with the optical-UV continuum, as has been very recently reported for blazar CTA 102 (Jorstad et al.).
CERES ERBE-like Monthly Geographical Averages (ES-4) in HDF (CER_ES4_PFM+FM1_Edition1)
Wielicki, Bruce A. (Principal Investigator)
The ERBE-like Monthly Geographical Averages (ES-4) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-4 is also produced for combinations of scanner instruments. For each observed 2.5-degree spatial region, the daily average, the hourly average over the month, and the overall monthly average of shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-9 product are spatially nested up from 2.5-degree regions to 5- and 10-degree regions, to 2.5-, 5-, and 10-degree zonal averages, and to global monthly averages. For each nested area, the albedo and net flux are given. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The following CERES ES4 data sets are currently available: CER_ES4_FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition2 CER_ES4_PFM+FM1_Edition1 CER_ES4_PFM+FM2_Edition1 CER_ES4_TRMM-PFM_Edition1 CER_ES4_TRMM-PFM_Edition2 CER_ES4_Terra-FM1_Edition1 CER_ES4_Terra-FM2_Edition1 CER_ES4_FM1+FM2_Edition2 CER_ES4_Terra-FM1_Edition2 CER_ES4_Terra-FM2_Edition2 CER_ES4_Aqua-FM3_Edition1 CER_ES4_Aqua-FM4_Edition1 CER_ES4_FM1+FM2+FM3+FM4_Edition1 CER_ES4_Aqua-FM3_Edition2 CER_ES4_Aqua-FM4_Edition2 CER_ES4_FM1+FM3_Edition2 CER_ES4_FM1+FM4_Edition2 CER_ES4_PFM+FM1_Edition2 CER_ES4_PFM+FM2_Edition2 CER_ES4_Aqua-FM3_Edition1-CV CER_ES4_Aqua-FM4_Edition1-CV CER_ES4_Terra-FM1_Edition1-CV CER_ES4_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2000-03-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost_Longitude=180] [Data_Resolution: Latitude_Resolution=2.5 degree; Longitude_Resolution=2.5 degree; Horizontal
CERES ERBE-like Monthly Geographical Averages (ES-4) in HDF (CER_ES4_Terra-FM1_Edition1)
Wielicki, Bruce A. (Principal Investigator)
The ERBE-like Monthly Geographical Averages (ES-4) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-4 is also produced for combinations of scanner instruments. For each observed 2.5-degree spatial region, the daily average, the hourly average over the month, and the overall monthly average of shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-9 product are spatially nested up from 2.5-degree regions to 5- and 10-degree regions, to 2.5-, 5-, and 10-degree zonal averages, and to global monthly averages. For each nested area, the albedo and net flux are given. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The following CERES ES4 data sets are currently available: CER_ES4_FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition2 CER_ES4_PFM+FM1_Edition1 CER_ES4_PFM+FM2_Edition1 CER_ES4_TRMM-PFM_Edition1 CER_ES4_TRMM-PFM_Edition2 CER_ES4_Terra-FM1_Edition1 CER_ES4_Terra-FM2_Edition1 CER_ES4_FM1+FM2_Edition2 CER_ES4_Terra-FM1_Edition2 CER_ES4_Terra-FM2_Edition2 CER_ES4_Aqua-FM3_Edition1 CER_ES4_Aqua-FM4_Edition1 CER_ES4_FM1+FM2+FM3+FM4_Edition1 CER_ES4_Aqua-FM3_Edition2 CER_ES4_Aqua-FM4_Edition2 CER_ES4_FM1+FM3_Edition2 CER_ES4_FM1+FM4_Edition2 CER_ES4_PFM+FM1_Edition2 CER_ES4_PFM+FM2_Edition2 CER_ES4_Aqua-FM3_Edition1-CV CER_ES4_Aqua-FM4_Edition1-CV CER_ES4_Terra-FM1_Edition1-CV CER_ES4_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2005-10-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost_Longitude=180] [Data_Resolution: Latitude_Resolution=2.5 degree; Longitude_Resolution=2.5 degree; Horizontal
Comparisons of Jet Properties between GeV Radio Galaxies and Blazars
Xue, Zi-Wei; Zhang, Jin; Cui, Wei; Liang, En-Wei; Zhang, Shuang-Nan
2017-09-01
We compile a sample of spectral energy distributions (SEDs) of 12 GeV radio galaxies (RGs), including eight FR I RGs and four FR II RGs. These SEDs can be represented with the one-zone leptonic model. No significant unification, as expected in the unification model, is found for the derived jet parameters between FR I RGs and BL Lacertae objects (BL Lacs) and between FR II RGs and flat spectrum radio quasars (FSRQs). However, on average FR I RGs have a larger {γ }{{b}} (break Lorentz factor of electrons) and lower B (magnetic field strength) than FR II RGs, analogous to the differences between BL Lacs and FSRQs. The derived Doppler factors (δ) of RGs are on average smaller than those of blazars, which is consistent with the unification model such that RGs are the misaligned parent populations of blazars with smaller δ. On the basis of jet parameters from SED fits, we calculate their jet powers and the powers carried by each component, and compare their jet compositions and radiation efficiencies with blazars. Most of the RG jets may be dominated by particles, like BL Lacs, not FSRQs. However, the jets of RGs with higher radiation efficiencies tend to have higher jet magnetization. A strong anticorrelation between synchrotron peak frequency and jet power is observed for GeV RGs and blazars in both the observer and co-moving frames, indicating that the “sequence” behavior among blazars, together with the GeV RGs, may be intrinsically dominated by jet power.
PATCHY BLAZAR HEATING: DIVERSIFYING THE THERMAL HISTORY OF THE INTERGALACTIC MEDIUM
International Nuclear Information System (INIS)
Lamberts, Astrid; Chang, Philip; Pfrommer, Christoph; Puchwein, Ewald; Broderick, Avery E.; Shalaby, Mohamad
2015-01-01
TeV-blazars potentially heat the intergalactic medium (IGM) as their gamma rays interact with photons of the extragalactic background light to produce electron–positron pairs, which lose their kinetic energy to the surrounding medium through plasma instabilities. This results in a heating mechanism that is only weakly sensitive to the local density, and therefore approximately spatially uniform, naturally producing an inverted temperature–density relation in underdense regions. In this paper we go beyond the approximation of uniform heating and quantify the heating rate fluctuations due to the clustered distribution of blazars and how this impacts the thermal history of the IGM. We analytically compute a filtering function that relates the heating rate fluctuations to the underlying dark matter density field. We implement it in the cosmological code GADGET-3 and perform large-scale simulations to determine the impact of inhomogeneous heating. We show that because of blazar clustering, blazar heating is inhomogeneous for z ≳ 2. At high redshift, the temperature–density relation shows an important scatter and presents a low temperature envelope of unheated regions, in particular at low densities and within voids. However, the median temperature of the IGM is close to that in the uniform case, albeit slightly lower at low redshift. We find that blazar heating is more complex than initially assumed and that the temperature–density relation is not unique. Our analytic model for the heating rate fluctuations couples well with large-scale simulations and provides a cost-effective alternative to subgrid models
CERES ERBE-like Monthly Regional Averages (ES-9) in HDF (CER_ES9_PFM+FM1_Edition1)
Wielicki, Bruce A. (Principal Investigator)
The ERBE-like Monthly Regional Averages (ES-9) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-9 is also produced for combinations of scanner instruments. All instantaneous shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-8 product for a month are sorted by 2.5-degree spatial regions, by day number, and by the local hour of observation. The mean of the instantaneous fluxes for a given region-day-hour bin is determined and recorded on the ES-9 along with other flux statistics and scene information. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The ES-9 also contains hourly average fluxes for the month and an overall monthly average for each region. These average fluxes are given for both clear-sky and total-sky scenes. The following CERES ES9 data sets are currently available: CER_ES9_FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition2 CER_ES9_PFM+FM1_Edition1 CER_ES9_PFM+FM2_Edition1 CER_ES9_PFM+FM1_Edition2 CER_ES9_PFM+FM2_Edition2 CER_ES9_TRMM-PFM_Edition1 CER_ES9_TRMM-PFM_Edition2 CER_ES9_Terra-FM1_Edition1 CER_ES9_Terra-FM2_Edition1 CER_ES9_FM1+FM2_Edition2 CER_ES9_Terra-FM1_Edition2 CER_ES9_Terra-FM2_Edition2 CER_ES9_Aqua-FM3_Edition1 CER_ES9_Aqua-FM4_Edition1 CER_ES9_FM1+FM2+FM3+FM4_Edition1 CER_ES9_Aqua-FM3_Edition2 CER_ES9_Aqua-FM4_Edition2 CER_ES9_FM1+FM3_Edition2 CER_ES9_FM1+FM4_Edition2 CER_ES9_Aqua-FM3_Edition1-CV CER_ES9_Aqua-FM4_Edition1-CV CER_ES9_Terra-FM1_Edition1-CV CER_ES9_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2000-03-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost
CERES ERBE-like Monthly Regional Averages (ES-9) in HDF (CER_ES9_Terra-FM1_Edition1)
Wielicki, Bruce A. (Principal Investigator)
The ERBE-like Monthly Regional Averages (ES-9) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-9 is also produced for combinations of scanner instruments. All instantaneous shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-8 product for a month are sorted by 2.5-degree spatial regions, by day number, and by the local hour of observation. The mean of the instantaneous fluxes for a given region-day-hour bin is determined and recorded on the ES-9 along with other flux statistics and scene information. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The ES-9 also contains hourly average fluxes for the month and an overall monthly average for each region. These average fluxes are given for both clear-sky and total-sky scenes. The following CERES ES9 data sets are currently available: CER_ES9_FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition2 CER_ES9_PFM+FM1_Edition1 CER_ES9_PFM+FM2_Edition1 CER_ES9_PFM+FM1_Edition2 CER_ES9_PFM+FM2_Edition2 CER_ES9_TRMM-PFM_Edition1 CER_ES9_TRMM-PFM_Edition2 CER_ES9_Terra-FM1_Edition1 CER_ES9_Terra-FM2_Edition1 CER_ES9_FM1+FM2_Edition2 CER_ES9_Terra-FM1_Edition2 CER_ES9_Terra-FM2_Edition2 CER_ES9_Aqua-FM3_Edition1 CER_ES9_Aqua-FM4_Edition1 CER_ES9_FM1+FM2+FM3+FM4_Edition1 CER_ES9_Aqua-FM3_Edition2 CER_ES9_Aqua-FM4_Edition2 CER_ES9_FM1+FM3_Edition2 CER_ES9_FM1+FM4_Edition2 CER_ES9_Aqua-FM3_Edition1-CV CER_ES9_Aqua-FM4_Edition1-CV CER_ES9_Terra-FM1_Edition1-CV CER_ES9_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2005-10-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost
THE CONTRIBUTION OF FERMI -2LAC BLAZARS TO DIFFUSE TEV–PEV NEUTRINO FLUX
Energy Technology Data Exchange (ETDEWEB)
Aartsen, M. G. [Department of Physics, University of Adelaide, Adelaide, 5005 (Australia); Abraham, K. [Physik-department, Technische Universität München, D-85748 Garching (Germany); Ackermann, M. [DESY, D-15735 Zeuthen (Germany); Adams, J. [Dept. of Physics and Astronomy, University of Canterbury, Private Bag 4800, Christchurch (New Zealand); Aguilar, J. A.; Ansseau, I. [Université Libre de Bruxelles, Science Faculty CP230, B-1050 Brussels (Belgium); Ahlers, M. [Dept. of Physics and Wisconsin IceCube Particle Astrophysics Center, University of Wisconsin, Madison, WI 53706 (United States); Ahrens, M. [Oskar Klein Centre and Dept. of Physics, Stockholm University, SE-10691 Stockholm (Sweden); Altmann, D.; Anton, G. [Erlangen Centre for Astroparticle Physics, Friedrich-Alexander-Universität Erlangen-Nürnberg, D-91058 Erlangen (Germany); Andeen, K. [Department of Physics, Marquette University, Milwaukee, WI, 53201 (United States); Anderson, T.; Arlen, T. C. [Dept. of Physics, Pennsylvania State University, University Park, PA 16802 (United States); Archinger, M.; Baum, V. [Institute of Physics, University of Mainz, Staudinger Weg 7, D-55099 Mainz (Germany); Arguelles, C.; Axani, S. [Dept. of Physics, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Auffenberg, J. [III. Physikalisches Institut, RWTH Aachen University, D-52056 Aachen (Germany); Bai, X. [Physics Department, South Dakota School of Mines and Technology, Rapid City, SD 57701 (United States); Barwick, S. W., E-mail: thorsten.gluesenkamp@fau.de [Dept. of Physics and Astronomy, University of California, Irvine, CA 92697 (United States); Collaboration: IceCube Collaboration; and others
2017-01-20
The recent discovery of a diffuse cosmic neutrino flux extending up to PeV energies raises the question of which astrophysical sources generate this signal. Blazars are one class of extragalactic sources which may produce such high-energy neutrinos. We present a likelihood analysis searching for cumulative neutrino emission from blazars in the 2nd Fermi -LAT AGN catalog (2LAC) using IceCube neutrino data set 2009-12, which was optimized for the detection of individual sources. In contrast to those in previous searches with IceCube, the populations investigated contain up to hundreds of sources, the largest one being the entire blazar sample in the 2LAC catalog. No significant excess is observed, and upper limits for the cumulative flux from these populations are obtained. These constrain the maximum contribution of 2LAC blazars to the observed astrophysical neutrino flux to 27% or less between around 10 TeV and 2 PeV, assuming the equipartition of flavors on Earth and a single power-law spectrum with a spectral index of −2.5. We can still exclude the fact that 2LAC blazars (and their subpopulations) emit more than 50% of the observed neutrinos up to a spectral index as hard as −2.2 in the same energy range. Our result takes into account the fact that the neutrino source count distribution is unknown, and it does not assume strict proportionality of the neutrino flux to the measured 2LAC γ -ray signal for each source. Additionally, we constrain recent models for neutrino emission by blazars.
Redshift measurement of Fermi blazars for the Cherenkov telescope array
Pita, S.; Goldoni, P.; Boisson, C.; Cotter, G.; Lefaucheur, J.; Lenain, J.-P.; Lindfors, E.; Williams, D. A.
2017-01-01
Blazars are active galactic nuclei, and the most numerous High Energy (HE) and Very High Energy (VHE) γ-ray emitters. Their optical emission is often dominated by non-thermal, and, in the case of BL Lacs, featureless continuum radiation. This makes the determination of their redshift extremely difficult. Indeed, as of today only about 50% of γ-ray blazars have a measured spectroscopic redshift. The knowledge of redshift is fundamental because it allows the precise modeling of the VHE emission and also of its interaction with the extragalactic background light (EBL). The beginning of the Cherenkov Telescope Array (CTA) operations in the near future will allow the detection of several hundreds of new blazars. Using the Fermi catalogue of sources above 50 GeV (2FHL), we performed simulations which indicate that a significant fraction of the 2FHL blazars detectable by CTA will not have a measured redshift. As a matter of fact, the organization of observing campaigns to measure the redshift of these blazars has been recognized as a necessary support for the AGN Key Science Project of CTA. We are planning such an observing campaign. In order to optimize our chances of success, we will perform preliminary deep imaging observations aimed at detecting or setting upper limits to the host galaxy. We will then take spectra of the candidates with the brightest host galaxies. Taking advantage of the recent success of an X-shooter GTO observing campaign, these observations will be different with respect to previous ones due to the use of higher resolution spectrographs and of 8 meter class telescopes. We are starting to submit proposals for these observations. In this paper we briefly describe how candidates are selected and the corresponding observation program.
Observations Of Gamma-ray Loud Blazars With The VLBA At 5 GHz
Linford, Justin; Taylor, G. B.; Romani, R.; Readhead, A. C. S.; Reeves, R.; Richards, J. L.; Helmboldt, J. F.
2011-01-01
The Fermi Gamma-ray Space Telescope has been scanning the sky for more than a year. About half of the sources detected by Fermi's Large Area Telesope (LAT) are active galactic nuclei (AGN). Nearly all of these gamma-ray loud AGN are blazars; strong, compact radio emitters that exhibit variability in their flux and apparent superluminal motion in their jets. Several groups are currently monitoring the radio properties of these gamma-ray loud blazars. We present results from both archival and contemporaneous observations of 200 LAT-detected blazars using the Very Long Baseline Array (VLBA) at a frequency of 5 GHz (wavelength of 6 cm). Our large, flux-limited sample provides unique insights into the mechanism that produces strong gamma-ray emissions. We explore the parsec-scale properties of the cores and jets of these highly energetic objects, including core polarization. We compare the gamma-ray loud blazars to their gamma-ray quiet counterparts in the VLBA Imaging and Polarimetry Survey (VIPS). We also investigate the differences between the BL Lacertae objects (BL Lacs) and flat-spectrum radio quasars (FSRQs).
VizieR Online Data Catalog: Blazars equivalent widths and radio luminosity (Landt+, 2004)
Landt, H.; Padovani, P.; Perlman, E. S.; Giommi, P.
2004-07-01
Blazars are currently separated into BL Lacertae objects (BL Lacs) and flat spectrum radio quasars based on the strength of their emission lines. This is performed rather arbitrarily by defining a diagonal line in the Ca H&K break value-equivalent width plane, following Marcha et al. (1996MNRAS.281..425M). We readdress this problem and put the classification scheme for blazars on firm physical grounds. We study ~100 blazars and radio galaxies from the Deep X-ray Radio Blazar Survey (DXRBS, Cat. and ) and 2-Jy radio survey and find a significant bimodality for the narrow emission line [OIII]{lambda}5007. This suggests the presence of two physically distinct classes of radio-loud active galactic nuclei (AGN). We show that all radio-loud AGN, blazars and radio galaxies, can be effectively separated into weak- and strong-lined sources using the [OIII]{lambda}5007-[OII]{lambda}3727 equivalent width plane. This plane allows one to disentangle orientation effects from intrinsic variations in radio-loud AGN. Based on DXRBS, the strongly beamed sources of the new class of weak-lined radio-loud AGN are made up of BL Lacs at the ~75 per cent level, whereas those of the strong-lined radio-loud AGN include mostly (~97 per cent) quasars. (4 data files).
Neutrinos and ultra-high-energy cosmic-ray nuclei from blazars
International Nuclear Information System (INIS)
Rodrigues, Xavier; Fedynitch, Anatoli; Gao, Shan; Boncioli, Denise; Winter, Walter
2017-11-01
We discuss the production of ultra-high-energy cosmic ray (UHECR) nuclei and neutrinos from blazars. We compute the nuclear cascade in the jet for both BL Lac objects and flat-spectrum radio quasars (FSRQs), and in the ambient radiation zones for FSRQs as well. By modeling representative spectral energy distributions along the blazar sequence, two distinct regimes are identified, which we call ''nuclear survival'' - typically found in low-luminosity BL Lacs, and ''nuclear cascade'' - typically found in high-luminosity FSRQs. We quantify how the neutrino and cosmic-ray (CR) emission efficiencies evolve over the blazar sequence, and demonstrate that neutrinos and CRs come from very different object classes. For example, high-frequency peaked BL Lacs (HBLs) tend to produce CRs, and HL-FSRQs are the more efficient neutrino emitters. This conclusion does not depend on the CR escape mechanism, for which we discuss two alternatives (diffusive and advective escape). Finally, the neutrino spectrum from blazars is shown to significantly depend on the injection composition into the jet, especially in the nuclear cascade case: Injection compositions heavier than protons lead to reduced neutrino production at the peak, which moves at the same time to lower energies. Thus, these sources will exhibit better compatibility with the observed IceCube and UHECR data.
Neutrinos and ultra-high-energy cosmic-ray nuclei from blazars
Energy Technology Data Exchange (ETDEWEB)
Rodrigues, Xavier; Fedynitch, Anatoli; Gao, Shan; Boncioli, Denise; Winter, Walter
2017-11-15
We discuss the production of ultra-high-energy cosmic ray (UHECR) nuclei and neutrinos from blazars. We compute the nuclear cascade in the jet for both BL Lac objects and flat-spectrum radio quasars (FSRQs), and in the ambient radiation zones for FSRQs as well. By modeling representative spectral energy distributions along the blazar sequence, two distinct regimes are identified, which we call ''nuclear survival'' - typically found in low-luminosity BL Lacs, and ''nuclear cascade'' - typically found in high-luminosity FSRQs. We quantify how the neutrino and cosmic-ray (CR) emission efficiencies evolve over the blazar sequence, and demonstrate that neutrinos and CRs come from very different object classes. For example, high-frequency peaked BL Lacs (HBLs) tend to produce CRs, and HL-FSRQs are the more efficient neutrino emitters. This conclusion does not depend on the CR escape mechanism, for which we discuss two alternatives (diffusive and advective escape). Finally, the neutrino spectrum from blazars is shown to significantly depend on the injection composition into the jet, especially in the nuclear cascade case: Injection compositions heavier than protons lead to reduced neutrino production at the peak, which moves at the same time to lower energies. Thus, these sources will exhibit better compatibility with the observed IceCube and UHECR data.
RELAXATION OF BLAZAR-INDUCED PAIR BEAMS IN COSMIC VOIDS
Energy Technology Data Exchange (ETDEWEB)
Miniati, Francesco [Physics Department, Wolfgang-Pauli-Strasse 27, ETH-Zuerich, CH-8093 Zuerich (Switzerland); Elyiv, Andrii, E-mail: fm@phys.ethz.ch [Institut d' Astrophysique et de Geophysique, Universite de Liege, B-4000 Liege (Belgium)
2013-06-10
The stability properties of a low-density ultrarelativistic pair beam produced in the intergalactic medium (IGM) by multi-TeV gamma-ray photons from blazars are analyzed. The problem is relevant for probes of magnetic field in cosmic voids through gamma-ray observations. In addition, dissipation of such beams could considerably affect the thermal history of the IGM and structure formation. We use a Monte Carlo method to quantify the properties of the blazar-induced electromagnetic shower, in particular the bulk Lorentz factor and the angular spread of the pair beam generated by the shower, as a function of distance from the blazar itself. We then use linear and nonlinear kinetic theory to study the stability of the pair beam against the growth of electrostatic plasma waves, employing the Monte Carlo results for our quantitative estimates. We find that the fastest growing mode, like any perturbation mode with even a very modest component perpendicular to the beam direction, cannot be described in the reactive regime. Due to the effect of nonlinear Landau damping, which suppresses the growth of plasma oscillations, the beam relaxation timescale is found to be significantly longer than the inverse Compton loss time. Finally, density inhomogeneities associated with cosmic structure induce loss of resonance between the beam particles and plasma oscillations, strongly inhibiting their growth. We conclude that relativistic pair beams produced by blazars in the IGM are stable on timescales that are long compared with the electromagnetic cascades. There appears to be little or no effect of pair beams on the IGM.
Multiwavelength Emission from Blazars – Conference Summary ...
Indian Academy of Sciences (India)
emission—radio emission—host galaxies—blazar demographics— .... We still need a comprehensive analysis of the selection effects operating in existing ... to the M-sigma relation, or to investigate the evolution of the fundamental plane for.
2010-10-01
... SERVICES Wireless Medical Telemetry Service (WMTS) General Provisions § 95.1101 Scope. This subpart sets out the regulations governing the operation of Wireless Medical Telemetry Devices in the 608-614 MHz, 1395-1400 MHz, and 1427-1432 MHz frequency bands. See § 95.630 regarding permissible frequencies. [75...
30 CFR 75.1101 - Deluge-type water sprays, foam generators; main and secondary belt-conveyor drives.
2010-07-01
... and secondary belt-conveyor drives. 75.1101 Section 75.1101 Mineral Resources MINE SAFETY AND HEALTH... Fire Protection § 75.1101 Deluge-type water sprays, foam generators; main and secondary belt-conveyor... be installed at main and secondary belt-conveyor drives. ...
Position Angle Changes of Inner-Jets in a Sample of Blazars Ligong ...
Indian Academy of Sciences (India)
Position Angle Changes of Inner-Jets in a Sample of Blazars. Ligong Mi1,3,∗ & Xiang Liu1,2. 1Xinjiang Astronomical Observatory, CAS, 150 Science 1-Street, Urumqi 830011,. People's Republic of China. 2Key Laboratory of Radio Astronomy, CAS, Nanjing 210008, People's Republic of China. 3University of Chinese ...
CERES ERBE-like Monthly Geographical Averages (ES-4) in HDF (CER_ES4_FM1+FM2_Edition1)
Wielicki, Bruce A. (Principal Investigator)
The ERBE-like Monthly Geographical Averages (ES-4) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-4 is also produced for combinations of scanner instruments. For each observed 2.5-degree spatial region, the daily average, the hourly average over the month, and the overall monthly average of shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-9 product are spatially nested up from 2.5-degree regions to 5- and 10-degree regions, to 2.5-, 5-, and 10-degree zonal averages, and to global monthly averages. For each nested area, the albedo and net flux are given. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The following CERES ES4 data sets are currently available: CER_ES4_FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition2 CER_ES4_PFM+FM1_Edition1 CER_ES4_PFM+FM2_Edition1 CER_ES4_TRMM-PFM_Edition1 CER_ES4_TRMM-PFM_Edition2 CER_ES4_Terra-FM1_Edition1 CER_ES4_Terra-FM2_Edition1 CER_ES4_FM1+FM2_Edition2 CER_ES4_Terra-FM1_Edition2 CER_ES4_Terra-FM2_Edition2 CER_ES4_Aqua-FM3_Edition1 CER_ES4_Aqua-FM4_Edition1 CER_ES4_FM1+FM2+FM3+FM4_Edition1 CER_ES4_Aqua-FM3_Edition2 CER_ES4_Aqua-FM4_Edition2 CER_ES4_FM1+FM3_Edition2 CER_ES4_FM1+FM4_Edition2 CER_ES4_PFM+FM1_Edition2 CER_ES4_PFM+FM2_Edition2 CER_ES4_Aqua-FM3_Edition1-CV CER_ES4_Aqua-FM4_Edition1-CV CER_ES4_Terra-FM1_Edition1-CV CER_ES4_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2003-12-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost_Longitude=180] [Data_Resolution: Latitude_Resolution=2.5 degree; Longitude_Resolution=2.5 degree; Horizontal
CERES ERBE-like Monthly Regional Averages (ES-9) in HDF ( CER_ES9_Terra-FM1_Edition1-CV)
Wielicki, Bruce A. (Principal Investigator)
The ERBE-like Monthly Regional Averages (ES-9) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-9 is also produced for combinations of scanner instruments. All instantaneous shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-8 product for a month are sorted by 2.5-degree spatial regions, by day number, and by the local hour of observation. The mean of the instantaneous fluxes for a given region-day-hour bin is determined and recorded on the ES-9 along with other flux statistics and scene information. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The ES-9 also contains hourly average fluxes for the month and an overall monthly average for each region. These average fluxes are given for both clear-sky and total-sky scenes. The following CERES ES9 data sets are currently available: CER_ES9_FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition2 CER_ES9_PFM+FM1_Edition1 CER_ES9_PFM+FM2_Edition1 CER_ES9_PFM+FM1_Edition2 CER_ES9_PFM+FM2_Edition2 CER_ES9_TRMM-PFM_Edition1 CER_ES9_TRMM-PFM_Edition2 CER_ES9_Terra-FM1_Edition1 CER_ES9_Terra-FM2_Edition1 CER_ES9_FM1+FM2_Edition2 CER_ES9_Terra-FM1_Edition2 CER_ES9_Terra-FM2_Edition2 CER_ES9_Aqua-FM3_Edition1 CER_ES9_Aqua-FM4_Edition1 CER_ES9_FM1+FM2+FM3+FM4_Edition1 CER_ES9_Aqua-FM3_Edition2 CER_ES9_Aqua-FM4_Edition2 CER_ES9_FM1+FM3_Edition2 CER_ES9_FM1+FM4_Edition2 CER_ES9_Aqua-FM3_Edition1-CV CER_ES9_Aqua-FM4_Edition1-CV CER_ES9_Terra-FM1_Edition1-CV CER_ES9_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2006-09-30] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost
International Nuclear Information System (INIS)
Ruan, John J.; Anderson, Scott F.; MacLeod, Chelsea L.; Becker, Andrew C.; Davenport, James R. A.; Ivezić, Željko; Burnett, T. H.; Kochanek, Christopher S.; Plotkin, Richard M.; Sesar, Branimir; Stuart, J. Scott
2012-01-01
We investigate the use of optical photometric variability to select and identify blazars in large-scale time-domain surveys, in part to aid in the identification of blazar counterparts to the ∼30% of γ-ray sources in the Fermi 2FGL catalog still lacking reliable associations. Using data from the optical LINEAR asteroid survey, we characterize the optical variability of blazars by fitting a damped random walk model to individual light curves with two main model parameters, the characteristic timescales of variability τ, and driving amplitudes on short timescales σ-circumflex. Imposing cuts on minimum τ and σ-circumflex allows for blazar selection with high efficiency E and completeness C. To test the efficacy of this approach, we apply this method to optically variable LINEAR objects that fall within the several-arcminute error ellipses of γ-ray sources in the Fermi 2FGL catalog. Despite the extreme stellar contamination at the shallow depth of the LINEAR survey, we are able to recover previously associated optical counterparts to Fermi active galactic nuclei with E ≥ 88% and C = 88% in Fermi 95% confidence error ellipses having semimajor axis r < 8'. We find that the suggested radio counterpart to Fermi source 2FGL J1649.6+5238 has optical variability consistent with other γ-ray blazars and is likely to be the γ-ray source. Our results suggest that the variability of the non-thermal jet emission in blazars is stochastic in nature, with unique variability properties due to the effects of relativistic beaming. After correcting for beaming, we estimate that the characteristic timescale of blazar variability is ∼3 years in the rest frame of the jet, in contrast with the ∼320 day disk flux timescale observed in quasars. The variability-based selection method presented will be useful for blazar identification in time-domain optical surveys and is also a probe of jet physics.
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLE232 (Link to dictyBase) - - - Contig-U16255-1 SLE232F (Link... to Original site) SLE232F 614 - - - - - - Show SLE232 Library SL (Link to library) Clone ID SLE232 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16255-1 Original site URL http://dict...PSSGFTDFIPSNATCSSLNCNAQQMSCKYVQQACHETSCCPDIPQC QIPATGGGPATGSATGQGTSGGTPGSCDKVNCPNGYICTIVNQLAVCVSPSSSSSSSSST ...CHETSCCPDIPQC QIPATGGGPATGSATGQGTSGGTPGSCDKVNCPNGYICTIVNQLAVCVSPSSSSSSSSST TGSHTTTGGSTTGSHTTTGGSTTGSHTTTGGSA
Modeling Blazar Spectra by Solving an Electron Transport Equation
Lewis, Tiffany; Finke, Justin; Becker, Peter A.
2018-01-01
Blazars are luminous active galaxies across the entire electromagnetic spectrum, but the spectral formation mechanisms, especially the particle acceleration, in these sources are not well understood. We develop a new theoretical model for simulating blazar spectra using a self-consistent electron number distribution. Specifically, we solve the particle transport equation considering shock acceleration, adiabatic expansion, stochastic acceleration due to MHD waves, Bohm diffusive particle escape, synchrotron radiation, and Compton radiation, where we implement the full Compton cross-section for seed photons from the accretion disk, the dust torus, and 26 individual broad lines. We used a modified Runge-Kutta method to solve the 2nd order equation, including development of a new mathematical method for normalizing stiff steady-state ordinary differential equations. We show that our self-consistent, transport-based blazar model can qualitatively fit the IR through Fermi g-ray data for 3C 279, with a single-zone, leptonic configuration. We use the solution for the electron distribution to calculate multi-wavelength SED spectra for 3C 279. We calculate the particle and magnetic field energy densities, which suggest that the emitting region is not always in equipartition (a common assumption), but sometimes matter dominated. The stratified broad line region (based on ratios in quasar reverberation mapping, and thus adding no free parameters) improves our estimate of the location of the emitting region, increasing it by ~5x. Our model provides a novel view into the physics at play in blazar jets, especially the relative strength of the shock and stochastic acceleration, where our model is well suited to distinguish between these processes, and we find that the latter tends to dominate.
CERES ERBE-like Instantaneous TOA Estimates (ES-8) in HDF (CER_ES8_Terra-FM1_Edition1-CV)
Wielicki, Bruce A. (Principal Investigator)
The ES-8 archival data product contains a 24-hour, single-satellite, instantaneous view of scanner fluxes at the top-of-atmosphere (TOA) reduced from spacecraft altitude unfiltered radiances using Earth Radiation Budget Experiment (ERBE) scanner Inversion algorithms and the ERBE shortwave (SW) and longwave (LW) Angular Distribution Models (ADMs). The ES-8 also includes the total (TOT), SW, LW, and window (WN) channel radiometric data; SW, LW, and WN unfiltered radiance values; and the ERBE scene identification for each measurement. These data are organized according to the CERES 3.3-second scan into 6.6-second records. As long as there is one valid scanner measurement within a record, the ES-8 record will be generated. The following CERES ES8 data sets are currently available: CER_ES8_TRMM-PFM_Edition1 CER_ES8_TRMM-PFM_Edition2 CER_ES8_TRMM-PFM_Transient-Ops2 CER_ES8_Terra-FM1_Edition1 CER_ES8_Terra-FM2_Edition1 CER_ES8_Terra-FM1_Edition2 CER_ES8_Terra-FM2_Edition2 CER_ES8_Aqua-FM3_Edition1 CER_ES8_Aqua-FM4_Edition1 CER_ES8_Aqua-FM3_Edition2 CER_ES8_Aqua-FM4_Edition2 CER_ES8_Aqua-FM3_Edition1-CV CER_ES8_Aqua-FM4_Edition1-CV CER_ES8_Terra-FM1_Edition1-CV CER_ES8_Terra-FM1_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1997-12-27; Stop_Date=2006-09-30] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost_Longitude=180] [Data_Resolution: Temporal_Resolution=1 day; Temporal_Resolution_Range=Daily - < Weekly].
Multi-Frequency Observations of Gamma-Ray Blazar 1633+382 SG ...
Indian Academy of Sciences (India)
Gamma-rays—quasars: 1633+382(4C+38.41)—radio jets— polarization. 1. Introduction. Blazars are the most numerous objects in the γ-ray sky (Abdo et al. 2010). They show dramatic variability across the electromagnetic spectrum (e.g., Jorstad et al. 2010; Marscher et al. 2010). Both these properties (strong γ-ray emission.
8 CFR 232.3 - Arriving aliens.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Arriving aliens. 232.3 Section 232.3 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS DETENTION OF ALIENS FOR PHYSICAL AND MENTAL EXAMINATION § 232.3 Arriving aliens. When a district director has reasonable grounds...
Polarization and brightness of the blazar S5 0716+714 in 1991-2004
Doroshenko, V. T.; Kiselev, N. N.
2017-06-01
We investigate the photometric and polarimetric behavior of the blazar S5 0716+714 based on the observations carried out in 1991-2004 at the 125-cm Crimean Astrophysical Observatory telescope (AZT11) with a photopolarimeter that allows simultaneous polarization and brightness measurements to be made in the U BV RI bands. We also provide the U BV photometry for the blazar obtained in 2000-2009 with a 60-cm telescope at the Crimean Station of the Sternberg Astronomical Institute. The pattern of flux variability and the correlation between the brightness, color, and polarization variations have been investigated. In this time interval the blazar showed a significant brightness and polarization variability similar to noise processes.
TeV Blazars and Cosmic Infrared Background Radiation
Aharonian, F. A.
2001-01-01
The recent developments in studies of TeV radiation from blazars are highlighted and the implications of these results for derivation of cosmologically important information about the cosmic infrared background radiation are discussed.
FACT. Flare alerts from blazar monitoring
Energy Technology Data Exchange (ETDEWEB)
Dorner, Daniela [Universitaet Wuerzburg (Germany); Bretz, Thomas [RWTH Aachen (Germany); Collaboration: FACT-Collaboration
2015-07-01
One of the major goals of the First G-APD Cherenkov Telescope is the longterm monitoring of bright TeV blazars. For more than three years, FACT has observed the blazars Mrk 421 and Mrk 501 and a few other sources on a regular basis. To understand these highly variable objects, simultaneous data at different wavelengths are very useful. FACT is not only taking part in multi-wavelength campaigns, but also sending alerts to other instruments in case of enhanced flux, to study flares within the multi-wavelength frame. To send fast alerts, an automatic quick look analysis was set up on site. Once the data are written on disk, they are automatically processed, and the analysis results are published on a website where other observers can monitor the activity of the source in the very high energy band. In addition, alerts are sent in case the flux is higher than a certain predefined value. In 2014, more than five alerts have been sent. Results from three years of monitoring are presented.
24 CFR 200.1101 - Cross-reference.
2010-04-01
... URBAN DEVELOPMENT GENERAL INTRODUCTION TO FHA PROGRAMS Social Security Numbers and Employer Identification Numbers; Applicants in Unassisted Programs § 200.1101 Cross-reference. The provisions in subpart B of part 5 of this title apply to Social Security Numbers and Employer Identification Numbers for...
Ruan, John J.; Anderson, Scott F.; MacLeod, Chelsea L.; Becker, Andrew C.; Burnett, T. H.; Davenport, James R. A.; Ivezić, Željko; Kochanek, Christopher S.; Plotkin, Richard M.; Sesar, Branimir; Stuart, J. Scott
2012-11-01
We investigate the use of optical photometric variability to select and identify blazars in large-scale time-domain surveys, in part to aid in the identification of blazar counterparts to the ~30% of γ-ray sources in the Fermi 2FGL catalog still lacking reliable associations. Using data from the optical LINEAR asteroid survey, we characterize the optical variability of blazars by fitting a damped random walk model to individual light curves with two main model parameters, the characteristic timescales of variability τ, and driving amplitudes on short timescales \\hat{\\sigma }. Imposing cuts on minimum τ and \\hat{\\sigma } allows for blazar selection with high efficiency E and completeness C. To test the efficacy of this approach, we apply this method to optically variable LINEAR objects that fall within the several-arcminute error ellipses of γ-ray sources in the Fermi 2FGL catalog. Despite the extreme stellar contamination at the shallow depth of the LINEAR survey, we are able to recover previously associated optical counterparts to Fermi active galactic nuclei with E >= 88% and C = 88% in Fermi 95% confidence error ellipses having semimajor axis r beaming. After correcting for beaming, we estimate that the characteristic timescale of blazar variability is ~3 years in the rest frame of the jet, in contrast with the ~320 day disk flux timescale observed in quasars. The variability-based selection method presented will be useful for blazar identification in time-domain optical surveys and is also a probe of jet physics.
33 CFR 127.1101 - Piping systems.
2010-07-01
...) WATERFRONT FACILITIES WATERFRONT FACILITIES HANDLING LIQUEFIED NATURAL GAS AND LIQUEFIED HAZARDOUS GAS Waterfront Facilities Handling Liquefied Hazardous Gas Design and Construction § 127.1101 Piping systems... pipeline on a pier or wharf must be located so that it is not exposed to physical damage from vehicular...
Spectral Index Changes with Brightness for γ-Ray Loud Blazars J. H. ...
Indian Academy of Sciences (India)
spectral index changes depending on γ-ray brightness is obtained. ... the γ-ray band. Key words. Active galactic nuclei (AGN): blazars: γ-ray emission: spectral index. 1. Introduction. Generally, the spectrum of one source changes with its .... Pearl River Scholar Funded Scheme (GDUPS) (2009), Yangcheng Scholar Funded.
The CLASS blazar survey - II. Optical properties
Caccianiga, A; Marcha, MJ; Anton, S; Mack, KH; Neeser, MJ
2002-01-01
This paper presents the optical properties of the objects selected in the CLASS blazar survey. Because an optical spectrum is now available for 70 per cent of the 325 sources present in the sample, a spectral classification, based on the appearance of the emission/absorption lines, is possible. A
QUASI-PERIODICITIES AT YEAR-LIKE TIMESCALES IN BLAZARS
Energy Technology Data Exchange (ETDEWEB)
Sandrinelli, A.; Treves, A. [Università degli Studi dell’Insubria, Dipartimento di Scienza ed Alta Tecnologia, Via Valleggio 11, I-22100 Como (Italy); Covino, S. [INAF—Istituto Nazionale di Astrofisica, Osservatorio Astronomico di Brera, Via Emilio Bianchi 46, I-23807 Merate (Italy); Dotti, M. [Università degli Studi di Milano Bicocca, Dipartimento di Fisica G. Occhialini, Piazza della Scienza 3, I-20126 Milano (Italy)
2016-03-15
We searched for quasi-periodicities on year-like timescales in the light curves of six blazars in the optical—near-infrared bands and we made a comparison with the high energy emission. We obtained optical/NIR light curves from Rapid Eye Mounting photometry plus archival Small and Moderate Aperture Research Telescope System data and we accessed the Fermi light curves for the γ-ray data. The periodograms often show strong peaks in the optical and γ-ray bands, which in some cases may be inter-related. The significance of the revealed peaks is then discussed, taking into account that the noise is frequency dependent. Quasi-periodicities on a year-like timescale appear to occur often in blazars. No straightforward model describing these possible periodicities is yet available, but some plausible interpretations for the physical mechanisms causing periodic variabilities of these sources are examined.
27 CFR 20.232 - Reconsignment in transit.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Reconsignment in transit. 20.232 Section 20.232 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... and Disposition of Specially Denatured Spirits § 20.232 Reconsignment in transit. (a) Reconsignment...
Production of 231Pa and 232U by irradiation of 230Th/232Th mixtures
International Nuclear Information System (INIS)
Kluge, E.; Lieser, K.H.
1981-01-01
The production of 231 Pa and of 232 U by irradiating a 230 Th/ 232 Th mixture (containing 12 mol per cent 230 Th) in form of ThO 2 at a thermal neutron flux of 6.9 x 10 13 cm -2 s -1 for 4 months was investigated. Pa, U and Th were separated and the chemical yields were determined. 2.6% of the 230 Th were transformed into 231 Pa and 0.13% into 232 U. These values are higher than those calculated for a thermal flux, but lower than those calculated for a flux ratio epithermal to thermal = 0.03. 231 Pa and 232 U were isolated in form of a protactinium solution and of U 3 O 8 with 94.9 and 89.1% chemical yields, respectively. Foreign activities were not detected. Thorium was recuperated and isolated as ThO 2 , with a chemical yield of 93.6%. (orig.)
Lefaucheur, Julien; Pita, Santiago
2017-06-01
Context. In the recently published 3FGL catalogue, the Fermi/LAT collaboration reports the detection of γ-ray emission from 3034 sources obtained after four years of observations. The nature of 1010 of those sources is unknown, whereas 2023 have well-identified counterparts in other wavelengths. Most of the associated sources are labelled as blazars (1717/2023), but the BL Lac or FSRQ nature of 573 of these blazars is still undetermined. Aims: The aim of this study was two-fold. First, to significantly increase the number of blazar candidates from a search among the large number of Fermi/LAT 3FGL unassociated sources (case A). Second, to determine the BL Lac or FSRQ nature of the blazar candidates, including those determined as such in this work and the blazar candidates of uncertain type (BCU) that are already present in the 3FGL catalogue (case B). Methods: For this purpose, multivariate classifiers - boosted decision trees and multilayer perceptron neural networks - were trained using samples of labelled sources with no caution flag from the 3FGL catalogue and carefully chosen discriminant parameters. The decisions of the classifiers were combined in order to obtain a high level of source identification along with well controlled numbers of expected false associations. Specifically for case A, dedicated classifications were generated for high (| b | >10◦) and low (| b | ≤10◦) galactic latitude sources; in addition, the application of classifiers to samples of sources with caution flag was considered separately, and specific performance metrics were estimated. Results: We obtained a sample of 595 blazar candidates (high and low galactic latitude) among the unassociated sources of the 3FGL catalogue. We also obtained a sample of 509 BL Lacs and 295 FSRQs from the blazar candidates cited above and the BCUs of the 3FGL catalogue. The number of expected false associations is given for different samples of candidates. It is, in particular, notably low ( 9
Directory of Open Access Journals (Sweden)
Protti Maria
2005-12-01
Full Text Available Abstract Background MHC class I-peptide tetramers are currently utilised to characterize CD8+ T cell responses at single cell level. The generation and use of MHC class II tetramers to study antigen-specific CD4+ T cells appears less straightforward. Most MHC class II tetramers are produced with a homogeneously built-in peptide, reducing greatly their flexibility of use. We attempted the generation of "empty" functional HLA-DR*1101 tetramers, receptive for loading with synthetic peptides by incubation. No such reagent is in fact available for this HLA-DR allele, one of the most frequent in the Caucasian population. Results We compared soluble MHC class II-immunoglobulin fusion proteins (HLA-DR*1101-Ig with soluble MHC class II protein fused with an optimised Bir site for enzymatic biotynilation (HLA-DR*1101-Bir, both produced in insect cells. The molecules were multimerised by binding fluorochrome-protein A or fluorochrome-streptavidin, respectively. We find that HLA-DR*1101-Bir molecules are superior to the HLA-DR*1101-Ig ones both in biochemical and functional terms. HLA-DR*1101-Bir molecules can be pulsed with at least three different promiscuous peptide epitopes, derived from Tetanus Toxoid, influenza HA and the tumour associated antigen MAGE-3 respectively, to stain specific CD4+ T cells. Both staining temperature and activation state of CD4+ T cells are critical for the binding of peptide-pulsed HLA-DR*1101-Bir to the cognate TCR. Conclusion It is therefore possible to generate a soluble recombinant HLA-DR*1101 backbone that is receptive for loading with different peptides to stain specific CD4+ T cells. As shown for other HLA-DR alleles, we confirm that not all the strategies to produce soluble HLA-DR*1101 multimers are equivalent.
SDSS J14584479+3720215: A BENCHMARK JHK{sub S} BLAZAR LIGHT CURVE FROM THE 2MASS CALIBRATION SCANS
Energy Technology Data Exchange (ETDEWEB)
Davenport, James R. A.; Ruan, John J.; Becker, Andrew C. [Department of Astronomy, University of Washington, Box 351580, Seattle, WA 98195 (United States); Macleod, Chelsea L. [Physics Department, The United States Naval Academy, 572c Holloway Road, Annapolis, MD 21402 (United States); Cutri, Roc M., E-mail: jrad@astro.washington.edu [Infrared Processing and Analysis Center, California Institute of Technology, Pasadena, CA 91125 (United States)
2015-04-10
Active galactic nuclei (AGNs) are well-known to exhibit flux variability across a wide range of wavelength regimes, but the precise origin of the variability at different wavelengths remains unclear. To investigate the relatively unexplored near-IR (NIR) variability of the most luminous AGNs, we conduct a search for variability using well sampled JHK{sub s}-band light curves from the Two Micron All Sky Survey (2MASS) calibration fields. Our sample includes 27 known quasars with an average of 924 epochs of observation over three years, as well as one spectroscopically confirmed blazar (SDSS J14584479+3720215) with 1972 epochs of data. This is the best-sampled NIR photometric blazar light curve to date, and it exhibits correlated, stochastic variability that we characterize with continuous auto-regressive moving average (CARMA) models. None of the other 26 known quasars had detectable variability in the 2MASS bands above the photometric uncertainty. A blind search of the 2MASS calibration field light curves for active galactic nucleus (AGN) candidates based on fitting CARMA(1,0) models (damped-random walk) uncovered only seven candidates. All seven were young stellar objects within the ρ Ophiuchus star forming region, five with previous X-ray detections. A significant γ-ray detection (5σ) for the known blazar using 4.5 yr of Fermi photon data is also found. We suggest that strong NIR variability of blazars, such as seen for SDSS J14584479+3720215, can be used as an efficient method of identifying previously unidentified γ-ray blazars, with low contamination from other AGNs.
Multi-TeV flaring from blazars: Markarian 421 as a case study
Energy Technology Data Exchange (ETDEWEB)
Sahu, Sarira; Miranda, Luis Salvador [Universidad Nacional Autonoma de Mexico, Instituto de Ciencias Nucleares, Mexico, DF (Mexico); Rajpoot, Subhash [California State University, Department of Physics and Astronomy, Long Beach, CA (United States)
2016-03-15
The TeV blazar Markarian 421 underwent multi-TeV flaring during April 2004 and simultaneously observations in the X-ray and TeV energies were made. It was observed that the TeV outbursts had no counterparts in the lower energy range. One implication of this is that it might be an orphan flare. We show that Fermi-accelerated protons of energy ≤ 168 TeV can interact with the low energy tail of the background synchrotron self-Compton photons in the inner region of the blazar to produce the multi-TeV flare and our results fit very well with the observed spectrum. Based on our study, we predict that the blazars with a deep valley in between the end of the synchrotron spectrum and the beginning of the SSC spectrum are possible candidates for orphan flaring. Future possible candidates for this scenario are the HBLs Mrk 501 and PG 1553 + 113 objects. (orig.)
The RINGO2 and DIPOL optical polarization catalogue of blazars
Jermak, H.; Steele, I. A.; Lindfors, E.; Hovatta, T.; Nilsson, K.; Lamb, G. P.; Mundell, C.; Barres de Almeida, U.; Berdyugin, A.; Kadenius, V.; Reinthal, R.; Takalo, L.
2016-11-01
We present ˜2000 polarimetric and ˜3000 photometric observations of 15 γ-ray bright blazars over a period of 936 days (2008-10-11 to 2012-10-26) using data from the Tuorla blazar monitoring program (KVA DIPOL) and Liverpool Telescope (LT) RINGO2 polarimeters (supplemented with data from SkyCamZ (LT) and Fermi-LAT γ-ray data). In 11 out of 15 sources we identify a total of 19 electric vector position angle (EVPA) rotations and 95 flaring episodes. We group the sources into subclasses based on their broad-band spectral characteristics and compare their observed optical and γ-ray properties. We find that (1) the optical magnitude and γ-ray flux are positively correlated, (2) EVPA rotations can occur in any blazar subclass, four sources show rotations that go in one direction and immediately rotate back, (3) we see no difference in the γ-ray flaring rates in the sample; flares can occur during and outside of rotations with no preference for this behaviour, (4) the average degree of polarization (DoP), optical magnitude and γ-ray flux are lower during an EVPA rotation compared with during non-rotation and the distribution of the DoP during EVPA rotations is not drawn from the same parent sample as the distribution outside rotations, (5) the number of observed flaring events and optical polarization rotations are correlated, however we find no strong evidence for a temporal association between individual flares and rotations and (6) the maximum observed DoP increases from ˜10 per cent to ˜30 per cent to ˜40 per cent for subclasses with synchrotron peaks at high, intermediate and low frequencies, respectively.
2010-01-01
... 7 Agriculture 1 2010-01-01 2010-01-01 false Administration. 23.2 Section 23.2 Agriculture Office... Administration. (a) Title V will be administered by the Administrators of the Extension Service and the... Act of 1914 and the Hatch Act (as amended), August 11, 1955, the administration of the programs shall...
17 CFR 232.11 - Definition of terms used in part 232.
2010-04-01
... effect by a person executing or issuing it. If data are stored in a computer or similar device, any... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Definition of terms used in part 232. 232.11 Section 232.11 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION...
Directory of Open Access Journals (Sweden)
Chen Zhou
2013-06-01
Full Text Available YK-1101, with its structure as S-((E-4-((7S,10S,Z-4-ethylidene-7-isopropyl-2,5,8,12-tetraoxo -9-oxa-16-thia-3,6,13,18-tetraazabicyclo[13.2.1]octadeca-1(17,15(18-dien-10-ylbut-3-en-1-yl ethanethioate, is synthesized as a potential histone deacetylase inhibitor. Its quality and stability under various stress conditions are not fully understood. In this study, a high performance liquid chromatographic (HPLC method was established and validated for the analysis of YK-1101 bulk drug samples. The chromatographic separation was performed on a C18 column with acetonitrile and water as mobile phase in a gradient elution. Based on the established method, the stability studies of YK-1101 under various stress conditions were carried out. YK-1101 was shown to undergo degradation under basic and acidic stress conditions, while it was stable under oxidative, photolytic and thermal conditions. In addition, a time of flight mass spectrometer (TOF/MS was coupled to HPLC for the characterization of major degradation products produced under basic and acidic stress conditions. Their degradation pathways were also discussed. Keywords: YK-1101, Degradation products, Stress study, Liquid chromatography, Time of flight mass spectrometer
THE SPECTRAL INDEX PROPERTIES OF FERMI BLAZARS
Energy Technology Data Exchange (ETDEWEB)
Fan, J. H.; Yang, J. H.; Yuan, Y. H.; Wang, J.; Gao, Y., E-mail: jhfan_cn@yahoo.com.cn [Center for Astrophysics, Guangzhou University, Guangzhou 510006 (China)
2012-12-20
In this paper, a sample of 451 blazars (193 flat spectrum radio quasars (FSRQs), 258 BL Lacertae objects) with corresponding X-ray and Fermi {gamma}-ray data is compiled to investigate the correlation both between the X-ray spectral index and the {gamma}-ray spectral index and between the spectral index and the luminosity, and to compare the spectral indexes {alpha}{sub X}, {alpha}{sub {gamma}}, {alpha}{sub X{gamma}}, and {alpha}{sub {gamma}X{gamma}} for different subclasses. We also investigated the correlation between the X-ray and the {gamma}-ray luminosity. The following results have been obtained. Our analysis indicates that an anti-correlation exists between the X-ray and the {gamma}-ray spectral indexes for the whole sample. However, when we considered the subclasses of blazars (FSRQs, the low-peaked BL Lacertae objects (LBLs) and the high-peaked BL Lacertae objects (HBLs)) separately, there is not a clear relationship for each subclass. Based on the Fermi-detected sources, we can say that the HBLs are different from FSRQs, while the LBLs are similar to FSRQs.
48 CFR 1825.1101 - Acquisition of supplies.
2010-10-01
....225-8, Duty-Free Entry of Space Articles, in solicitations and contracts when the supplies that will... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Acquisition of supplies... ADMINISTRATION SOCIOECONOMIC PROGRAMS FOREIGN ACQUISITION Solicitation Provisions and Contract Clauses 1825.1101...
UPPER LIMITS FROM FIVE YEARS OF BLAZAR OBSERVATIONS WITH THE VERITAS CHERENKOV TELESCOPES
Energy Technology Data Exchange (ETDEWEB)
Archambault, S. [Physics Department, McGill University, Montreal, QC H3A 2T8 (Canada); Archer, A.; Buckley, J. H.; Bugaev, V. [Department of Physics, Washington University, St. Louis, MO 63130 (United States); Benbow, W.; Cerruti, M. [Fred Lawrence Whipple Observatory, Harvard-Smithsonian Center for Astrophysics, Amado, AZ 85645 (United States); Bird, R. [School of Physics, University College Dublin, Belfield, Dublin 4 (Ireland); Biteau, J. [Santa Cruz Institute for Particle Physics and Department of Physics, University of California, Santa Cruz, CA 95064 (United States); Buchovecky, M. [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States); Byrum, K. [Argonne National Laboratory, 9700 S. Cass Avenue, Argonne, IL 60439 (United States); Chen, X. [Institute of Physics and Astronomy, University of Potsdam, D-14476 Potsdam-Golm (Germany); Ciupik, L. [Astronomy Department, Adler Planetarium and Astronomy Museum, Chicago, IL 60605 (United States); Connolly, M. P. [School of Physics, National University of Ireland Galway, University Road, Galway (Ireland); Cui, W.; Feng, Q.; Finley, J. P. [Department of Physics and Astronomy, Purdue University, West Lafayette, IN 47907 (United States); Eisch, J. D. [Department of Physics and Astronomy, Iowa State University, Ames, IA 50011 (United States); Errando, M. [Department of Physics and Astronomy, Barnard College, Columbia University, NY 10027 (United States); Falcone, A. [Department of Astronomy and Astrophysics, 525 Davey Lab, Pennsylvania State University, University Park, PA 16802 (United States); Fleischhack, H., E-mail: wystan.benbow@cfa.harvard.edu, E-mail: matteo.cerruti@lpnhe.in2p3.fr, E-mail: caajohns@ucsc.edu [DESY, Platanenallee 6, D-15738 Zeuthen (Germany); Collaboration: VERITAS collaboration; and others
2016-06-01
Between the beginning of its full-scale scientific operations in 2007 and 2012, the VERITAS Cherenkov telescope array observed more than 130 blazars; of these, 26 were detected as very-high-energy (VHE; E > 100 GeV) γ -ray sources. In this work, we present the analysis results of a sample of 114 undetected objects. The observations constitute a total live-time of ∼570 hr. The sample includes several unidentified Fermi -Large Area Telescope (LAT) sources (located at high Galactic latitude) as well as all the sources from the second Fermi -LAT catalog that are contained within the field of view of the VERITAS observations. We have also performed optical spectroscopy measurements in order to estimate the redshift of some of these blazars that do not have spectroscopic distance estimates. We present new optical spectra from the Kast instrument on the Shane telescope at the Lick observatory for 18 blazars included in this work, which allowed for the successful measurement or constraint on the redshift of four of them. For each of the blazars included in our sample, we provide the flux upper limit in the VERITAS energy band. We also study the properties of the significance distributions and we present the result of a stacked analysis of the data set, which shows a 4 σ excess.
UPPER LIMITS FROM FIVE YEARS OF BLAZAR OBSERVATIONS WITH THE VERITAS CHERENKOV TELESCOPES
International Nuclear Information System (INIS)
Archambault, S.; Archer, A.; Buckley, J. H.; Bugaev, V.; Benbow, W.; Cerruti, M.; Bird, R.; Biteau, J.; Buchovecky, M.; Byrum, K.; Chen, X.; Ciupik, L.; Connolly, M. P.; Cui, W.; Feng, Q.; Finley, J. P.; Eisch, J. D.; Errando, M.; Falcone, A.; Fleischhack, H.
2016-01-01
Between the beginning of its full-scale scientific operations in 2007 and 2012, the VERITAS Cherenkov telescope array observed more than 130 blazars; of these, 26 were detected as very-high-energy (VHE; E > 100 GeV) γ -ray sources. In this work, we present the analysis results of a sample of 114 undetected objects. The observations constitute a total live-time of ∼570 hr. The sample includes several unidentified Fermi -Large Area Telescope (LAT) sources (located at high Galactic latitude) as well as all the sources from the second Fermi -LAT catalog that are contained within the field of view of the VERITAS observations. We have also performed optical spectroscopy measurements in order to estimate the redshift of some of these blazars that do not have spectroscopic distance estimates. We present new optical spectra from the Kast instrument on the Shane telescope at the Lick observatory for 18 blazars included in this work, which allowed for the successful measurement or constraint on the redshift of four of them. For each of the blazars included in our sample, we provide the flux upper limit in the VERITAS energy band. We also study the properties of the significance distributions and we present the result of a stacked analysis of the data set, which shows a 4 σ excess.
CERES ERBE-like Instantaneous TOA Estimates (ES-8) in HDF (CER_ES4_TRMM-PFM_Edition1)
Wielicki, Bruce A. (Principal Investigator)
The ERBE-like Monthly Geographical Averages (ES-4) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-4 is also produced for combinations of scanner instruments. For each observed 2.5-degree spatial region, the daily average, the hourly average over the month, and the overall monthly average of shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-9 product are spatially nested up from 2.5-degree regions to 5- and 10-degree regions, to 2.5-, 5-, and 10-degree zonal averages, and to global monthly averages. For each nested area, the albedo and net flux are given. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The following CERES ES4 data sets are currently available: CER_ES4_FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition2 CER_ES4_PFM+FM1_Edition1 CER_ES4_PFM+FM2_Edition1 CER_ES4_TRMM-PFM_Edition1 CER_ES4_TRMM-PFM_Edition2 CER_ES4_Terra-FM1_Edition1 CER_ES4_Terra-FM2_Edition1 CER_ES4_FM1+FM2_Edition2 CER_ES4_Terra-FM1_Edition2 CER_ES4_Terra-FM2_Edition2 CER_ES4_Aqua-FM3_Edition1 CER_ES4_Aqua-FM4_Edition1 CER_ES4_FM1+FM2+FM3+FM4_Edition1 CER_ES4_Aqua-FM3_Edition2 CER_ES4_Aqua-FM4_Edition2 CER_ES4_FM1+FM3_Edition2 CER_ES4_FM1+FM4_Edition2 CER_ES4_PFM+FM1_Edition2 CER_ES4_PFM+FM2_Edition2 CER_ES4_Aqua-FM3_Edition1-CV CER_ES4_Aqua-FM4_Edition1-CV CER_ES4_Terra-FM1_Edition1-CV CER_ES4_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=1998-08-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost_Longitude=180] [Data_Resolution: Latitude_Resolution=2.5 degree; Longitude_Resolution=2.5 degree; Horizontal
CERES ERBE-like Monthly Regional Averages (ES-9) in HDF (CER_ES9_TRMM-PFM_Edition1)
Wielicki, Bruce A. (Principal Investigator)
The ERBE-like Monthly Regional Averages (ES-9) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-9 is also produced for combinations of scanner instruments. All instantaneous shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-8 product for a month are sorted by 2.5-degree spatial regions, by day number, and by the local hour of observation. The mean of the instantaneous fluxes for a given region-day-hour bin is determined and recorded on the ES-9 along with other flux statistics and scene information. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The ES-9 also contains hourly average fluxes for the month and an overall monthly average for each region. These average fluxes are given for both clear-sky and total-sky scenes. The following CERES ES9 data sets are currently available: CER_ES9_FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition2 CER_ES9_PFM+FM1_Edition1 CER_ES9_PFM+FM2_Edition1 CER_ES9_PFM+FM1_Edition2 CER_ES9_PFM+FM2_Edition2 CER_ES9_TRMM-PFM_Edition1 CER_ES9_TRMM-PFM_Edition2 CER_ES9_Terra-FM1_Edition1 CER_ES9_Terra-FM2_Edition1 CER_ES9_FM1+FM2_Edition2 CER_ES9_Terra-FM1_Edition2 CER_ES9_Terra-FM2_Edition2 CER_ES9_Aqua-FM3_Edition1 CER_ES9_Aqua-FM4_Edition1 CER_ES9_FM1+FM2+FM3+FM4_Edition1 CER_ES9_Aqua-FM3_Edition2 CER_ES9_Aqua-FM4_Edition2 CER_ES9_FM1+FM3_Edition2 CER_ES9_FM1+FM4_Edition2 CER_ES9_Aqua-FM3_Edition1-CV CER_ES9_Aqua-FM4_Edition1-CV CER_ES9_Terra-FM1_Edition1-CV CER_ES9_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=1998-08-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost
The broadband spectral energy distributions of SDSS blazars
Li, Huai-Zhen; Chen, Luo-En; Jiang, Yun-Guo; Yi, Ting-Feng
2015-07-01
We compiled the radio, optical and X-ray data of blazars from the Sloan Digital Sky Survey database, and presented the distribution of luminosities and broadband spectral indices. The distribution of luminosities shows that the averaged luminosity of flat spectrum radio quasars (FSRQs) is larger than that of BL Lacertae (BL Lac) objects. On the other hand, the broadband spectral energy distribution reveals that FSRQs and low energy peaked BL Lac objects have similar spectral properties, but high energy peaked BL Lac objects have a distinct spectral property. This may be due to the fact that different subclasses of blazars have different intrinsic environments and are at different cooling levels. Even so, a unified scheme is also revealed from the color-color diagram, which hints that there are similar physical processes operating in all objects under a range of intrinsic physical conditions or beaming parameters. Supported by the National Natural Science Foundation of China.
Search for neutrino emission from gamma-ray flaring blazars with the ANTARES telescope
Adrián-Martínez, S.; Al Samarai, Imen; Albert, A.; André, Michel; Anghinolfi, M.; Anton, G.; Anvar, S.; Ardid, M.; Astraatmadja, T.; Aubert, J.-J.; Baret, B.; Basa, S.; Bertin, V.; Biagi, S.; Bigongiari, C.
2011-01-01
The ANTARES telescope is well-suited to detect neutrinos produced in astrophysical transient sources as it can observe a full hemisphere of the sky at all times with a high duty cycle. Radio-loud active galactic nuclei with jets pointing almost directly towards the observer, the so-called blazars, are particularly attractive potential neutrino point sources. The all-sky monitor LAT on board the Fermi satellite probes the variability of any given gamma-ray bright blazar in the sky on time scal...
International Nuclear Information System (INIS)
Miyake, Yasuo; Sugimura, Yukio; Yasujima, Tadahide.
1978-01-01
The concentration of thorium isotopes and the activity ratios of 230 Th/ 232 Th and 228 Th/ 232 Th in 500 l sea water samples collected in the Pacific Ocean were determined. Thorium isotopes were analyzed by alpha-ray spectrometry after separating them from other elements with an anion exchange resin. The average content of thorium ( 232 Th) of 0.9 ng l -1 was obtained in the open Pacific water. The average contents of 230 Th and 228 Th were 2.1 x 10 -2 pgl -1 and 1.2 agl -1 respectively. It was found that the ratios of 230 Th/ 232 Th and 228 Th/ 232 Th ranged respectively from 1.0 to 29, and from 0.4 to as high as 128. (author)
Rau, A.; Schady, P.; Greiner, J.; Salvato, M.; Ajello, M.; Bottacini, E.; Gehrels, N.; Afonso, P. M. J.; Elliott, J.; Filgas, R.;
2011-01-01
Context. Observations of the gamma-ray sky with Fermi led to significant advances towards understanding blazars, the most extreme class of Active Galactic Nuclei. A large fraction of the population detected by Fermi is formed by BL Lacertae (BL Lac) objects, whose sample has always suffered from a severe redshift incompleteness due to the quasi-featureless optical spectra. Aims. Our goal is to provide a significant increase of the number of confirmed high-redshift BL Lac objects contained in the 2 LAC Fermi/LAT catalog. Methods. For 103 Fermi/LAT blazars, photometric redshifts using spectral energy distribution fitting have been obtained. The photometry includes 13 broad-band filters from the far ultraviolet to the near-IR observed with Swift/UVOT and the multi-channel imager GROND at the MPG/ESO 2.2m telescope. Data have been taken quasi-simultaneously and the remaining source-intrinsic variability has been corrected for. Results. We release the UV-to-near-IR 13-band photometry for all 103 sources and provide redshift constraints for 75 sources without previously known redshift. Out of those, eight have reliable photometric redshifts at z > or approx. 1.3, while for the other 67 sources we provide upper limits. Six of the former eight are BL Lac objects, which quadruples the sample of confirmed high-redshift BL Lac. This includes three sources with redshifts higher than the previous record for BL Lac, including CRATES J0402-2615, with the best-fit solution at z approx. = 1.9.
Relation between X-Ray and γ-Ray Emissions for Fermi Blazars ...
Indian Academy of Sciences (India)
Abstract. Using γ-ray band data detected by Fermi Large Area Tele- scope (LAT) and X-ray band data for 78 blazars, we find a medium cor- relation between X-ray and γ-ray fluxes in the average state. A medium anticorrelation is also found between X-ray (1 KeV) mean spectral index αx and γ-ray mean spectral index αγ for ...
International Nuclear Information System (INIS)
Ghisellini, G.; Maraschi, L.; Treves, A.; Tanzi, E. G.; Milano Universita, Italy; CNR, Istituto di Fisica Cosmica, Milan, Italy)
1986-01-01
All blazars observed with the IUE are studied and shown to form a well-defined subgroup according to their spectral properties. These properties are discussed with respect to theoretical models and are compared with those of quasars. Radio, ultraviolet, and X-ray fluxes are used to construct composite spectral indices, and systematic differences between X-ray selected and otherwise selected objects are discussed. It is confirmed that X-ray selected objects have flatter overall spectra, and are therefore weaker radio emitters relative to their X-ray emission than objects selected otherwise. It is found that X-ray selected blazars have the same average X-ray luminosity as blazars selected otherwise and are underluminous at UV and radio frequencies. This finding is used to argue that the radio-weak, X-ray selected BL Lac objects are, in terms of space density, the dominant members of the blazar population. The results are interpreted in the framework of synchrotron emission models involving relativistic plasma jets. 134 references
Energy Technology Data Exchange (ETDEWEB)
Ghisellini, G.; Maraschi, L.; Treves, A.; Tanzi, E. G.
1986-11-01
All blazars observed with the IUE are studied and shown to form a well-defined subgroup according to their spectral properties. These properties are discussed with respect to theoretical models and are compared with those of quasars. Radio, ultraviolet, and X-ray fluxes are used to construct composite spectral indices, and systematic differences between X-ray selected and otherwise selected objects are discussed. It is confirmed that X-ray selected objects have flatter overall spectra, and are therefore weaker radio emitters relative to their X-ray emission than objects selected otherwise. It is found that X-ray selected blazars have the same average X-ray luminosity as blazars selected otherwise and are underluminous at UV and radio frequencies. This finding is used to argue that the radio-weak, X-ray selected BL Lac objects are, in terms of space density, the dominant members of the blazar population. The results are interpreted in the framework of synchrotron emission models involving relativistic plasma jets. 134 references.
Discovery of a GeV Blazar Shining Through the Galactic Plane
Energy Technology Data Exchange (ETDEWEB)
Vandenbroucke, J.; Buehler, R.; Ajello, M.; Bechtol, K.; /Stanford U., HEPL /KIPAC, Menlo Park /SLAC; Bellini, A.; /Padua U., Astron. Dept. /Baltimore, Space Telescope Sci.; Bolte, M.; /UC, Santa Cruz; Cheung, C.C.; /Naval Research Lab, Wash., D.C. /NAS, Washington, D.C.; Civano, F.; /Smithsonian Astrophys. Observ.; Donato, D.; /NASA, Goddard; Fuhrmann, L.; /Bonn, Max Planck Inst., Radioastron.; Funk, S.; Healey, S.E.; /Stanford U., HEPL /KIPAC, Menlo Park /SLAC; Hill, A.B.; /Joseph Fourier U.; Knigge, C.; /Southampton U.; Madejski, G.M.; Romani, R.W.; /Stanford U., HEPL /KIPAC, Menlo Park /SLAC; Santander-Garcia, M.; /IAC, La Laguna /Isaac Newton Group /Laguna U., Tenerife; Shaw, M.S.; /Stanford U., HEPL /KIPAC, Menlo Park /SLAC; Steeghs, D.; /Warwick U.; Torres, M.A.P.; /Smithsonian Astrophys. Observ.; Van Etten, A.; /Stanford U., HEPL /KIPAC, Menlo Park /SLAC /Texas U., Astron. Dept.
2011-08-11
The Fermi Large Area Telescope (LAT) discovered a new gamma-ray source near the Galactic plane, Fermi J0109+6134, when it flared brightly in 2010 February. The low Galactic latitude (b = -1.2{sup o}) indicated that the source could be located within the Galaxy, which motivated rapid multi-wavelength follow-up including radio, optical, and X-ray observations. We report the results of analyzing all 19 months of LAT data for the source, and of X-ray observations with both Swift and the Chandra X-ray Observatory. We determined the source redshift, z = 0.783, using a Keck LRIS observation. Finally, we compiled a broadband spectral energy distribution (SED) from both historical and new observations contemporaneous with the 2010 February flare. The redshift, SED, optical line width, X-ray obsorption, and multi-band variability indicate that this new Gev source is a blazar seen through the Galactic plane. Because several of the optical emission lines have equivalent width > 5 {angstrom}, this blazar belongs in the flat-spectrum radio quasar category.
20 CFR 408.1101 - Can you appoint someone to represent you?
2010-04-01
... WORLD WAR II VETERANS Representation of Parties § 408.1101 Can you appoint someone to represent you? (a... clause in paragraph (b), the second sentences in paragraphs (b)(1) and (b)(2), and paragraph (c)(2) do... this part, the rules on representation of parties in §§ 416.1500-416.1505, 416.1507-416.1515 and 416...
27 CFR 31.232 - Wine bottling.
2010-04-01
.... The decanting of wine by caterers or other retail dealers for table or room service, banquets, and... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Wine bottling. 31.232... OF THE TREASURY LIQUORS ALCOHOL BEVERAGE DEALERS Miscellaneous § 31.232 Wine bottling. Each person...
Comparison of Optical and Multi-Waveband Variations of Selected Gamma-ray Bright Blazars in 2012
Schultz, Benjamin; Jorstad, S. G.; Marscher, A. P.; Williamson, K. E.; Walker, G. E.
2013-01-01
We present multi-wavelength observations of several gamma-ray bright blazars. We combine optical data obtained with the 17-inch CCD telescope of Maria Mitchell Observatory with space- and ground-based observations carried out with a variety of instruments. These include a number of other optical telescopes, the Fermi Gamma-Ray Space Telescope at photon energies of 0.1-200 GeV, and the Swift satellite at 0.3-10 keV plus optical and UV wavelengths. Three of the observed blazars proved to be particularly active - BL Lac, Mrk501, and CTA-102. BL Lac was of special interest, displaying remarkable activity in multiple wavelengths during this observation period, including the optical, in which it underwent its largest observed flare in a number of years. In addition, CTA-102 has recently undergone an unprecedented multi-wavelength outburst. We cross-correlate the variations in the different wavebands in an effort to guide theoretical interpretations of the optical and high-energy emission from blazars. This project was supported by NSF/REU grant AST-0851892 and the Nantucket Maria Mitchell Association. The research at Boston University was supported in part by NSF grant AST-0907893 and by NASA through Fermi grant NNX11AQ03G.
CERES ERBE-like Monthly Geographical Averages (ES-4) in HDF (CER_ES4_Aqua-FM4_Edition1)
Wielicki, Bruce A. (Principal Investigator)
The ERBE-like Monthly Geographical Averages (ES-4) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-4 is also produced for combinations of scanner instruments. For each observed 2.5-degree spatial region, the daily average, the hourly average over the month, and the overall monthly average of shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-9 product are spatially nested up from 2.5-degree regions to 5- and 10-degree regions, to 2.5-, 5-, and 10-degree zonal averages, and to global monthly averages. For each nested area, the albedo and net flux are given. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The following CERES ES4 data sets are currently available: CER_ES4_FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition2 CER_ES4_PFM+FM1_Edition1 CER_ES4_PFM+FM2_Edition1 CER_ES4_TRMM-PFM_Edition1 CER_ES4_TRMM-PFM_Edition2 CER_ES4_Terra-FM1_Edition1 CER_ES4_Terra-FM2_Edition1 CER_ES4_FM1+FM2_Edition2 CER_ES4_Terra-FM1_Edition2 CER_ES4_Terra-FM2_Edition2 CER_ES4_Aqua-FM3_Edition1 CER_ES4_Aqua-FM4_Edition1 CER_ES4_FM1+FM2+FM3+FM4_Edition1 CER_ES4_Aqua-FM3_Edition2 CER_ES4_Aqua-FM4_Edition2 CER_ES4_FM1+FM3_Edition2 CER_ES4_FM1+FM4_Edition2 CER_ES4_PFM+FM1_Edition2 CER_ES4_PFM+FM2_Edition2 CER_ES4_Aqua-FM3_Edition1-CV CER_ES4_Aqua-FM4_Edition1-CV CER_ES4_Terra-FM1_Edition1-CV CER_ES4_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2005-03-29] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost_Longitude=180] [Data_Resolution: Latitude_Resolution=2.5 degree; Longitude_Resolution=2.5 degree; Horizontal
CERES ERBE-like Monthly Geographical Averages (ES-4) in HDF (CER_ES4_Terra-FM1_Edition2)
Wielicki, Bruce A. (Principal Investigator)
The ERBE-like Monthly Geographical Averages (ES-4) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-4 is also produced for combinations of scanner instruments. For each observed 2.5-degree spatial region, the daily average, the hourly average over the month, and the overall monthly average of shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-9 product are spatially nested up from 2.5-degree regions to 5- and 10-degree regions, to 2.5-, 5-, and 10-degree zonal averages, and to global monthly averages. For each nested area, the albedo and net flux are given. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The following CERES ES4 data sets are currently available: CER_ES4_FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition2 CER_ES4_PFM+FM1_Edition1 CER_ES4_PFM+FM2_Edition1 CER_ES4_TRMM-PFM_Edition1 CER_ES4_TRMM-PFM_Edition2 CER_ES4_Terra-FM1_Edition1 CER_ES4_Terra-FM2_Edition1 CER_ES4_FM1+FM2_Edition2 CER_ES4_Terra-FM1_Edition2 CER_ES4_Terra-FM2_Edition2 CER_ES4_Aqua-FM3_Edition1 CER_ES4_Aqua-FM4_Edition1 CER_ES4_FM1+FM2+FM3+FM4_Edition1 CER_ES4_Aqua-FM3_Edition2 CER_ES4_Aqua-FM4_Edition2 CER_ES4_FM1+FM3_Edition2 CER_ES4_FM1+FM4_Edition2 CER_ES4_PFM+FM1_Edition2 CER_ES4_PFM+FM2_Edition2 CER_ES4_Aqua-FM3_Edition1-CV CER_ES4_Aqua-FM4_Edition1-CV CER_ES4_Terra-FM1_Edition1-CV CER_ES4_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2005-12-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost_Longitude=180] [Data_Resolution: Latitude_Resolution=2.5 degree; Longitude_Resolution=2.5 degree; Horizontal
CERES ERBE-like Monthly Geographical Averages (ES-4) in HDF (CER_ES4_PFM+FM2_Edition1)
Wielicki, Bruce A. (Principal Investigator)
The ERBE-like Monthly Geographical Averages (ES-4) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-4 is also produced for combinations of scanner instruments. For each observed 2.5-degree spatial region, the daily average, the hourly average over the month, and the overall monthly average of shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-9 product are spatially nested up from 2.5-degree regions to 5- and 10-degree regions, to 2.5-, 5-, and 10-degree zonal averages, and to global monthly averages. For each nested area, the albedo and net flux are given. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The following CERES ES4 data sets are currently available: CER_ES4_FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition2 CER_ES4_PFM+FM1_Edition1 CER_ES4_PFM+FM2_Edition1 CER_ES4_TRMM-PFM_Edition1 CER_ES4_TRMM-PFM_Edition2 CER_ES4_Terra-FM1_Edition1 CER_ES4_Terra-FM2_Edition1 CER_ES4_FM1+FM2_Edition2 CER_ES4_Terra-FM1_Edition2 CER_ES4_Terra-FM2_Edition2 CER_ES4_Aqua-FM3_Edition1 CER_ES4_Aqua-FM4_Edition1 CER_ES4_FM1+FM2+FM3+FM4_Edition1 CER_ES4_Aqua-FM3_Edition2 CER_ES4_Aqua-FM4_Edition2 CER_ES4_FM1+FM3_Edition2 CER_ES4_FM1+FM4_Edition2 CER_ES4_PFM+FM1_Edition2 CER_ES4_PFM+FM2_Edition2 CER_ES4_Aqua-FM3_Edition1-CV CER_ES4_Aqua-FM4_Edition1-CV CER_ES4_Terra-FM1_Edition1-CV CER_ES4_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2000-03-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost_Longitude=180] [Data_Resolution: Latitude_Resolution=2.5 degree; Longitude_Resolution=2.5 degree; Horizontal
CERES ERBE-like Monthly Geographical Averages (ES-4) in HDF (CER_ES4_Aqua-FM3_Edition1)
Wielicki, Bruce A. (Principal Investigator)
The ERBE-like Monthly Geographical Averages (ES-4) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-4 is also produced for combinations of scanner instruments. For each observed 2.5-degree spatial region, the daily average, the hourly average over the month, and the overall monthly average of shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-9 product are spatially nested up from 2.5-degree regions to 5- and 10-degree regions, to 2.5-, 5-, and 10-degree zonal averages, and to global monthly averages. For each nested area, the albedo and net flux are given. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The following CERES ES4 data sets are currently available: CER_ES4_FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition2 CER_ES4_PFM+FM1_Edition1 CER_ES4_PFM+FM2_Edition1 CER_ES4_TRMM-PFM_Edition1 CER_ES4_TRMM-PFM_Edition2 CER_ES4_Terra-FM1_Edition1 CER_ES4_Terra-FM2_Edition1 CER_ES4_FM1+FM2_Edition2 CER_ES4_Terra-FM1_Edition2 CER_ES4_Terra-FM2_Edition2 CER_ES4_Aqua-FM3_Edition1 CER_ES4_Aqua-FM4_Edition1 CER_ES4_FM1+FM2+FM3+FM4_Edition1 CER_ES4_Aqua-FM3_Edition2 CER_ES4_Aqua-FM4_Edition2 CER_ES4_FM1+FM3_Edition2 CER_ES4_FM1+FM4_Edition2 CER_ES4_PFM+FM1_Edition2 CER_ES4_PFM+FM2_Edition2 CER_ES4_Aqua-FM3_Edition1-CV CER_ES4_Aqua-FM4_Edition1-CV CER_ES4_Terra-FM1_Edition1-CV CER_ES4_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2005-10-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost_Longitude=180] [Data_Resolution: Latitude_Resolution=2.5 degree; Longitude_Resolution=2.5 degree; Horizontal
CERES ERBE-like Monthly Geographical Averages (ES-4) in HDF (CER_ES4_Terra-FM2_Edition1)
Wielicki, Bruce A. (Principal Investigator)
The ERBE-like Monthly Geographical Averages (ES-4) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-4 is also produced for combinations of scanner instruments. For each observed 2.5-degree spatial region, the daily average, the hourly average over the month, and the overall monthly average of shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-9 product are spatially nested up from 2.5-degree regions to 5- and 10-degree regions, to 2.5-, 5-, and 10-degree zonal averages, and to global monthly averages. For each nested area, the albedo and net flux are given. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The following CERES ES4 data sets are currently available: CER_ES4_FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition2 CER_ES4_PFM+FM1_Edition1 CER_ES4_PFM+FM2_Edition1 CER_ES4_TRMM-PFM_Edition1 CER_ES4_TRMM-PFM_Edition2 CER_ES4_Terra-FM1_Edition1 CER_ES4_Terra-FM2_Edition1 CER_ES4_FM1+FM2_Edition2 CER_ES4_Terra-FM1_Edition2 CER_ES4_Terra-FM2_Edition2 CER_ES4_Aqua-FM3_Edition1 CER_ES4_Aqua-FM4_Edition1 CER_ES4_FM1+FM2+FM3+FM4_Edition1 CER_ES4_Aqua-FM3_Edition2 CER_ES4_Aqua-FM4_Edition2 CER_ES4_FM1+FM3_Edition2 CER_ES4_FM1+FM4_Edition2 CER_ES4_PFM+FM1_Edition2 CER_ES4_PFM+FM2_Edition2 CER_ES4_Aqua-FM3_Edition1-CV CER_ES4_Aqua-FM4_Edition1-CV CER_ES4_Terra-FM1_Edition1-CV CER_ES4_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2005-10-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost_Longitude=180] [Data_Resolution: Latitude_Resolution=2.5 degree; Longitude_Resolution=2.5 degree; Horizontal
CERES ERBE-like Monthly Regional Averages (ES-9) in HDF (CER_ES9_Aqua-FM3_Edition1)
Wielicki, Bruce A. (Principal Investigator)
The ERBE-like Monthly Regional Averages (ES-9) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-9 is also produced for combinations of scanner instruments. All instantaneous shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-8 product for a month are sorted by 2.5-degree spatial regions, by day number, and by the local hour of observation. The mean of the instantaneous fluxes for a given region-day-hour bin is determined and recorded on the ES-9 along with other flux statistics and scene information. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The ES-9 also contains hourly average fluxes for the month and an overall monthly average for each region. These average fluxes are given for both clear-sky and total-sky scenes. The following CERES ES9 data sets are currently available: CER_ES9_FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition2 CER_ES9_PFM+FM1_Edition1 CER_ES9_PFM+FM2_Edition1 CER_ES9_PFM+FM1_Edition2 CER_ES9_PFM+FM2_Edition2 CER_ES9_TRMM-PFM_Edition1 CER_ES9_TRMM-PFM_Edition2 CER_ES9_Terra-FM1_Edition1 CER_ES9_Terra-FM2_Edition1 CER_ES9_FM1+FM2_Edition2 CER_ES9_Terra-FM1_Edition2 CER_ES9_Terra-FM2_Edition2 CER_ES9_Aqua-FM3_Edition1 CER_ES9_Aqua-FM4_Edition1 CER_ES9_FM1+FM2+FM3+FM4_Edition1 CER_ES9_Aqua-FM3_Edition2 CER_ES9_Aqua-FM4_Edition2 CER_ES9_FM1+FM3_Edition2 CER_ES9_FM1+FM4_Edition2 CER_ES9_Aqua-FM3_Edition1-CV CER_ES9_Aqua-FM4_Edition1-CV CER_ES9_Terra-FM1_Edition1-CV CER_ES9_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2005-10-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost
CERES ERBE-like Monthly Regional Averages (ES-9) in HDF (CER_ES9_Terra-FM2_Edition1)
Wielicki, Bruce A. (Principal Investigator)
The ERBE-like Monthly Regional Averages (ES-9) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-9 is also produced for combinations of scanner instruments. All instantaneous shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-8 product for a month are sorted by 2.5-degree spatial regions, by day number, and by the local hour of observation. The mean of the instantaneous fluxes for a given region-day-hour bin is determined and recorded on the ES-9 along with other flux statistics and scene information. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The ES-9 also contains hourly average fluxes for the month and an overall monthly average for each region. These average fluxes are given for both clear-sky and total-sky scenes. The following CERES ES9 data sets are currently available: CER_ES9_FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition2 CER_ES9_PFM+FM1_Edition1 CER_ES9_PFM+FM2_Edition1 CER_ES9_PFM+FM1_Edition2 CER_ES9_PFM+FM2_Edition2 CER_ES9_TRMM-PFM_Edition1 CER_ES9_TRMM-PFM_Edition2 CER_ES9_Terra-FM1_Edition1 CER_ES9_Terra-FM2_Edition1 CER_ES9_FM1+FM2_Edition2 CER_ES9_Terra-FM1_Edition2 CER_ES9_Terra-FM2_Edition2 CER_ES9_Aqua-FM3_Edition1 CER_ES9_Aqua-FM4_Edition1 CER_ES9_FM1+FM2+FM3+FM4_Edition1 CER_ES9_Aqua-FM3_Edition2 CER_ES9_Aqua-FM4_Edition2 CER_ES9_FM1+FM3_Edition2 CER_ES9_FM1+FM4_Edition2 CER_ES9_Aqua-FM3_Edition1-CV CER_ES9_Aqua-FM4_Edition1-CV CER_ES9_Terra-FM1_Edition1-CV CER_ES9_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2005-10-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost
CERES ERBE-like Monthly Regional Averages (ES-9) in HDF (CER_ES9_PFM+FM2_Edition1)
Wielicki, Bruce A. (Principal Investigator)
The ERBE-like Monthly Regional Averages (ES-9) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-9 is also produced for combinations of scanner instruments. All instantaneous shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-8 product for a month are sorted by 2.5-degree spatial regions, by day number, and by the local hour of observation. The mean of the instantaneous fluxes for a given region-day-hour bin is determined and recorded on the ES-9 along with other flux statistics and scene information. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The ES-9 also contains hourly average fluxes for the month and an overall monthly average for each region. These average fluxes are given for both clear-sky and total-sky scenes. The following CERES ES9 data sets are currently available: CER_ES9_FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition2 CER_ES9_PFM+FM1_Edition1 CER_ES9_PFM+FM2_Edition1 CER_ES9_PFM+FM1_Edition2 CER_ES9_PFM+FM2_Edition2 CER_ES9_TRMM-PFM_Edition1 CER_ES9_TRMM-PFM_Edition2 CER_ES9_Terra-FM1_Edition1 CER_ES9_Terra-FM2_Edition1 CER_ES9_FM1+FM2_Edition2 CER_ES9_Terra-FM1_Edition2 CER_ES9_Terra-FM2_Edition2 CER_ES9_Aqua-FM3_Edition1 CER_ES9_Aqua-FM4_Edition1 CER_ES9_FM1+FM2+FM3+FM4_Edition1 CER_ES9_Aqua-FM3_Edition2 CER_ES9_Aqua-FM4_Edition2 CER_ES9_FM1+FM3_Edition2 CER_ES9_FM1+FM4_Edition2 CER_ES9_Aqua-FM3_Edition1-CV CER_ES9_Aqua-FM4_Edition1-CV CER_ES9_Terra-FM1_Edition1-CV CER_ES9_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2000-03-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost
CERES ERBE-like Monthly Regional Averages (ES-9) in HDF (CER_ES9_Aqua-FM4_Edition1)
Wielicki, Bruce A. (Principal Investigator)
The ERBE-like Monthly Regional Averages (ES-9) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-9 is also produced for combinations of scanner instruments. All instantaneous shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-8 product for a month are sorted by 2.5-degree spatial regions, by day number, and by the local hour of observation. The mean of the instantaneous fluxes for a given region-day-hour bin is determined and recorded on the ES-9 along with other flux statistics and scene information. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The ES-9 also contains hourly average fluxes for the month and an overall monthly average for each region. These average fluxes are given for both clear-sky and total-sky scenes. The following CERES ES9 data sets are currently available: CER_ES9_FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition2 CER_ES9_PFM+FM1_Edition1 CER_ES9_PFM+FM2_Edition1 CER_ES9_PFM+FM1_Edition2 CER_ES9_PFM+FM2_Edition2 CER_ES9_TRMM-PFM_Edition1 CER_ES9_TRMM-PFM_Edition2 CER_ES9_Terra-FM1_Edition1 CER_ES9_Terra-FM2_Edition1 CER_ES9_FM1+FM2_Edition2 CER_ES9_Terra-FM1_Edition2 CER_ES9_Terra-FM2_Edition2 CER_ES9_Aqua-FM3_Edition1 CER_ES9_Aqua-FM4_Edition1 CER_ES9_FM1+FM2+FM3+FM4_Edition1 CER_ES9_Aqua-FM3_Edition2 CER_ES9_Aqua-FM4_Edition2 CER_ES9_FM1+FM3_Edition2 CER_ES9_FM1+FM4_Edition2 CER_ES9_Aqua-FM3_Edition1-CV CER_ES9_Aqua-FM4_Edition1-CV CER_ES9_Terra-FM1_Edition1-CV CER_ES9_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2005-03-29] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost
Neutron radiative capture cross section of 232Th in the energy range 0.1 to 1.2 MeV
International Nuclear Information System (INIS)
Jain, H.M.; Kailas, S.
1987-01-01
Recently reported neutron radiative capture cross section of 232 Th measurements in the energy range 0.1 to 1.2 MeV are compared with the calculations based on the statistical model Hauser-Feshbach theory using the spherical optical model transmission coefficients and simple Fermi gas level density formula. The calculations are in good agreement with the recent experimental data, reproducing both the absolute magnitude and the shape exhibited by the excitation function. The results of this comparative study can be used for improving the evaluation of the neutron radiative capture cross section of 232 Th. 16 refs., 3 tables, 4 figures. (author)
Neutron radiative capture cross section of 232Th in the energy range 0.1 to 1.2 MeV
International Nuclear Information System (INIS)
Jain, H.M.; Kailas, S.
1987-03-01
Recently reported neutron radiative capture cross section of Th-232 measurements in the energy range 0.1 to 1.2 MeV are compared with the calculations based on the statistical model Hauser-Feshbach theory using the spherical optical model transmission coefficients and simple Fermi gas level density formula. The calculations are in good agreement with the recent experimental data, reproducing both the absolute magnitude and the shape exhibited by the excitation function. The results of this comparative study can be used for improving the evaluation of the neutron radiative capture cross section of Th-232. (author)
Equipartition gamma-ray blazars and the location of the gamma-ray emission site in 3C 279
International Nuclear Information System (INIS)
Dermer, Charles D.; Cerruti, Matteo; Lott, Benoit; Boisson, Catherine; Zech, Andreas
2014-01-01
Blazar spectral models generally have numerous unconstrained parameters, leading to ambiguous values for physical properties like Doppler factor δ D or fluid magnetic field B'. To help remedy this problem, a few modifications of the standard leptonic blazar jet scenario are considered. First, a log-parabola function for the electron distribution is used. Second, analytic expressions relating energy loss and kinematics to blazar luminosity and variability, written in terms of equipartition parameters, imply δ D , B', and the peak electron Lorentz factor γ pk ′ . The external radiation field in a blazar is approximated by Lyα radiation from the broad-line region (BLR) and ≈0.1 eV infrared radiation from a dusty torus. When used to model 3C 279 spectral energy distributions from 2008 and 2009 reported by Hayashida et al., we derive δ D ∼ 20-30, B' ∼ few G, and total (IR + BLR) external radiation field energy densities u ∼ 10 –2 -10 –3 erg cm –3 , implying an origin of the γ-ray emission site in 3C 279 at the outer edges of the BLR. This is consistent with the γ-ray emission site being located at a distance R ≲ Γ 2 ct var ∼ 0.1(Γ/30) 2 (t var /10 4 s) pc from the black hole powering 3C 279's jets, where t var is the variability timescale of the radiation in the source frame, and at farther distances for narrow-jet and magnetic-reconnection models. Excess ≳ 5 GeV γ-ray emission observed with Fermi LAT from 3C 279 challenges the model, opening the possibility of a second leptonic component or a hadronic origin of the emission. For low hadronic content, absolute jet powers of ≈10% of the Eddington luminosity are calculated.
CERES ERBE-like Instantaneous TOA Estimates (ES-8) in HDF (CER_ES8_Terra-FM1_Edition2)
Wielicki, Bruce A. (Principal Investigator)
The ES-8 archival data product contains a 24-hour, single-satellite, instantaneous view of scanner fluxes at the top-of-atmosphere (TOA) reduced from spacecraft altitude unfiltered radiances using Earth Radiation Budget Experiment (ERBE) scanner Inversion algorithms and the ERBE shortwave (SW) and longwave (LW) Angular Distribution Models (ADMs). The ES-8 also includes the total (TOT), SW, LW, and window (WN) channel radiometric data; SW, LW, and WN unfiltered radiance values; and the ERBE scene identification for each measurement. These data are organized according to the CERES 3.3-second scan into 6.6-second records. As long as there is one valid scanner measurement within a record, the ES-8 record will be generated. The following CERES ES8 data sets are currently available: CER_ES8_TRMM-PFM_Edition1 CER_ES8_TRMM-PFM_Edition2 CER_ES8_TRMM-PFM_Transient-Ops2 CER_ES8_Terra-FM1_Edition1 CER_ES8_Terra-FM2_Edition1 CER_ES8_Terra-FM1_Edition2 CER_ES8_Terra-FM2_Edition2 CER_ES8_Aqua-FM3_Edition1 CER_ES8_Aqua-FM4_Edition1 CER_ES8_Aqua-FM3_Edition2 CER_ES8_Aqua-FM4_Edition2 CER_ES8_Aqua-FM3_Edition1-CV CER_ES8_Aqua-FM4_Edition1-CV CER_ES8_Terra-FM1_Edition1-CV CER_ES8_Terra-FM1_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1997-12-27; Stop_Date=2006-01-01] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost_Longitude=180] [Data_Resolution: Temporal_Resolution=1 day; Temporal_Resolution_Range=Daily - < Weekly].
CERES ERBE-like Instantaneous TOA Estimates (ES-8) in HDF (CER_ES8_Terra-FM2_Edition1)
Wielicki, Bruce A. (Principal Investigator)
The ES-8 archival data product contains a 24-hour, single-satellite, instantaneous view of scanner fluxes at the top-of-atmosphere (TOA) reduced from spacecraft altitude unfiltered radiances using Earth Radiation Budget Experiment (ERBE) scanner Inversion algorithms and the ERBE shortwave (SW) and longwave (LW) Angular Distribution Models (ADMs). The ES-8 also includes the total (TOT), SW, LW, and window (WN) channel radiometric data; SW, LW, and WN unfiltered radiance values; and the ERBE scene identification for each measurement. These data are organized according to the CERES 3.3-second scan into 6.6-second records. As long as there is one valid scanner measurement within a record, the ES-8 record will be generated. The following CERES ES8 data sets are currently available: CER_ES8_TRMM-PFM_Edition1 CER_ES8_TRMM-PFM_Edition2 CER_ES8_TRMM-PFM_Transient-Ops2 CER_ES8_Terra-FM1_Edition1 CER_ES8_Terra-FM2_Edition1 CER_ES8_Terra-FM1_Edition2 CER_ES8_Terra-FM2_Edition2 CER_ES8_Aqua-FM3_Edition1 CER_ES8_Aqua-FM4_Edition1 CER_ES8_Aqua-FM3_Edition2 CER_ES8_Aqua-FM4_Edition2 CER_ES8_Aqua-FM3_Edition1-CV CER_ES8_Aqua-FM4_Edition1-CV CER_ES8_Terra-FM1_Edition1-CV CER_ES8_Terra-FM1_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1997-12-27; Stop_Date=2005-11-01] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost_Longitude=180] [Data_Resolution: Temporal_Resolution=1 day; Temporal_Resolution_Range=Daily - < Weekly].
Power-law to Power-law Mapping of Blazar Spectra from Intergalactic Absorption
International Nuclear Information System (INIS)
Stecker, F W; Scully, S T
2007-01-01
We have derived a useful analytic approximation for determining the effect of intergalactic absorption on the γ-ray spectra of TeV blazars the energy range 0.2 TeV γ γ ) is approximately logarithmic. The effect of this energy dependence is to steepen intrinsic source spectra such that a source with an approximate power-law spectral index Γ s is converted to one with an observed spectral index Γ o ≅ Γ s + ΔΓ(z) where ΔΓ(z) is a linear function of z in the redshift range 0.05-0.4. We apply this approximation to the spectra of 7 TeV blazars
2010-07-01
... insects; exemption from the requirement of a tolerance. 180.1101 Section 180.1101 Protection of... predatory insects; exemption from the requirement of a tolerance. Parasitic (parasitoid) and predatory insects are exempted from the requirement of a tolerance for residues when they are used in accordance...
BLAZAR ANTI-SEQUENCE OF SPECTRAL VARIATION WITHIN INDIVIDUAL BLAZARS: CASES FOR MRK 501 AND 3C 279
Energy Technology Data Exchange (ETDEWEB)
Zhang, Jin; Zhang, Shuang-Nan; Liang, En-Wei, E-mail: zhang.jin@hotmail.com [National Astronomical Observatories, Chinese Academy of Sciences, Beijing 100012 (China)
2013-04-10
The jet properties of Mrk 501 and 3C 279 are derived by fitting broadband spectral energy distributions (SEDs) with lepton models. The derived {gamma}{sub b} (the break Lorenz factor of the electron distribution) is 10{sup 4}-10{sup 6} for Mrk 501 and 200 {approx} 600 for 3C 279. The magnetic field strength (B) of Mrk 501 is usually one order of magnitude lower than that of 3C 279, but their Doppler factors ({delta}) are comparable. A spectral variation feature where the peak luminosity is correlated with the peak frequency, which is opposite from the blazar sequence, is observed in the two sources. We find that (1) the peak luminosities of the two bumps in the SEDs for Mrk 501 depend on {gamma}{sub b} in both the observer and co-moving frames, but they are not correlated with B and {delta} and (2) the luminosity variation of 3C 279 is dominated by the external Compton (EC) peak and its peak luminosity is correlated with {gamma}{sub b} and {delta}, but anti-correlated with B. These results suggest that {gamma}{sub b} may govern the spectral variation of Mrk 501 and {delta} and B would be responsible for the spectral variation of 3C 279. The narrow distribution of {gamma}{sub b} and the correlation of {gamma}{sub b} and B in 3C 279 would be due to the cooling from the EC process and the strong magnetic field. Based on our brief discussion, we propose that this spectral variation feature may originate from the instability of the corona but not from the variation of the accretion rate as does the blazar sequence.
Directory of Open Access Journals (Sweden)
Indriani R
2015-03-01
Full Text Available Highly Pathogenic Avian Influenza (HPAI subtype H5N1 clade 2.3.2 has infected chickens in farms, causing mortality and a decrease in egg production. Vaccination is one of the strategies to control disease of AI subtype H5N1. AI H5N1 clade 2.1.3 vaccine is available commercially. The effectiveness of two vaccines of AI H5N1 clade 2.1.3 (product A and B, and AI H5N1 clade 2.3.2 (Sukoharjo against AI H5N1 clade 2.3.2 (Sukoharjo virus SPF chickens was tested in laboratory. Four groups of SPF chickens were used in this study, there were (1 vaccinated with H5N1 clade 2.1.3 (product A, (2 vaccinated with H5N1 clade 2.1.3 (product B, (3 vaccinated with AI H5N1 clade 2.3.2 and (4 unvaccinated (as a control. Each vaccinated group consisted of 10 chicken except 8 chicken for control group. SPF chicken were vaccinated with 1 dose of vaccine at 3 weeks olds, and then after 3 weeks post vaccination (at 6 weeks olds. All group of chicken were challenged with 106 EID50 per 0.1 ml via intranasal. The results showed, chicken vaccinated with H5N1 clade 2.1.3 product A and B gave 100 and 80% protection respectively, but showed challenged virus shedding, whereas vaccine of H5N1 clade 2.3.2 gave 100% protection from mortality and without virus shedding. Vaccines of AI H5N1 clade 2.1.3 product A was better than vaccine product B, and when chicken vaccinated against H5N1 clade 2.3.2, H5N1 clade 2.3.2 vaccine was the best to be used. In order to protect chicken from AI subtype H5N1 clade 2.1.3 and 2.3.2 in the field, a bivalent vaccine of H5N1 clade 2.1.3 and 2.3.2 subtypes should be developed.
On the origin of gamma rays in Fermi blazars: beyond the broad line region.
Costamante, L.; Cutini, S.; Tosti, G.; Antolini, E.; Tramacere, A.
2018-05-01
The gamma-ray emission in broad-line blazars is generally explained as inverse Compton (IC) radiation of relativistic electrons in the jet scattering optical-UV photons from the Broad Line Region (BLR), the so-called BLR External Compton scenario. We test this scenario on the Fermi gamma-ray spectra of 106 broad-line blazars detected with the highest significance or largest BLR, by looking for cut-off signatures at high energies compatible with γ-γ interactions with BLR photons. We do not find evidence for the expected BLR absorption. For 2/3 of the sources, we can exclude any significant absorption (τmax 5). We conclude that for 9 out of 10 objects, the jet does not interact with BLR photons. Gamma-rays seem either produced outside the BLR most of the time, or the BLR is ˜100 × larger than given by reverberation mapping. This means that i) External Compton on BLR photons is disfavoured as the main gamma-ray mechanism, vs IC on IR photons from the torus or synchrotron self-Compton; ii) the Fermi gamma-ray spectrum is mostly intrinsic, determined by the interaction of the particle distribution with the seed-photons spectrum; iii) without suppression by the BLR, broad-line blazars can become copious emitters above 100 GeV, as demonstrated by 3C 454.3. We expect the CTA sky to be much richer of broad-line blazars than previously thought.
CERES ERBE-like Monthly Geographical Averages (ES-4) in HDF (CER_ES4_FM1+FM4_Edition2)
Wielicki, Bruce A. (Principal Investigator)
The ERBE-like Monthly Geographical Averages (ES-4) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-4 is also produced for combinations of scanner instruments. For each observed 2.5-degree spatial region, the daily average, the hourly average over the month, and the overall monthly average of shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-9 product are spatially nested up from 2.5-degree regions to 5- and 10-degree regions, to 2.5-, 5-, and 10-degree zonal averages, and to global monthly averages. For each nested area, the albedo and net flux are given. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The following CERES ES4 data sets are currently available: CER_ES4_FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition2 CER_ES4_PFM+FM1_Edition1 CER_ES4_PFM+FM2_Edition1 CER_ES4_TRMM-PFM_Edition1 CER_ES4_TRMM-PFM_Edition2 CER_ES4_Terra-FM1_Edition1 CER_ES4_Terra-FM2_Edition1 CER_ES4_FM1+FM2_Edition2 CER_ES4_Terra-FM1_Edition2 CER_ES4_Terra-FM2_Edition2 CER_ES4_Aqua-FM3_Edition1 CER_ES4_Aqua-FM4_Edition1 CER_ES4_FM1+FM2+FM3+FM4_Edition1 CER_ES4_Aqua-FM3_Edition2 CER_ES4_Aqua-FM4_Edition2 CER_ES4_FM1+FM3_Edition2 CER_ES4_FM1+FM4_Edition2 CER_ES4_PFM+FM1_Edition2 CER_ES4_PFM+FM2_Edition2 CER_ES4_Aqua-FM3_Edition1-CV CER_ES4_Aqua-FM4_Edition1-CV CER_ES4_Terra-FM1_Edition1-CV CER_ES4_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2005-03-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost_Longitude=180] [Data_Resolution: Latitude_Resolution=2.5 degree; Longitude_Resolution=2.5 degree; Horizontal
CERES ERBE-like Monthly Geographical Averages (ES-4) in HDF (CER_ES4_FM1+FM3_Edition2)
Wielicki, Bruce A. (Principal Investigator)
The ERBE-like Monthly Geographical Averages (ES-4) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-4 is also produced for combinations of scanner instruments. For each observed 2.5-degree spatial region, the daily average, the hourly average over the month, and the overall monthly average of shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-9 product are spatially nested up from 2.5-degree regions to 5- and 10-degree regions, to 2.5-, 5-, and 10-degree zonal averages, and to global monthly averages. For each nested area, the albedo and net flux are given. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The following CERES ES4 data sets are currently available: CER_ES4_FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition2 CER_ES4_PFM+FM1_Edition1 CER_ES4_PFM+FM2_Edition1 CER_ES4_TRMM-PFM_Edition1 CER_ES4_TRMM-PFM_Edition2 CER_ES4_Terra-FM1_Edition1 CER_ES4_Terra-FM2_Edition1 CER_ES4_FM1+FM2_Edition2 CER_ES4_Terra-FM1_Edition2 CER_ES4_Terra-FM2_Edition2 CER_ES4_Aqua-FM3_Edition1 CER_ES4_Aqua-FM4_Edition1 CER_ES4_FM1+FM2+FM3+FM4_Edition1 CER_ES4_Aqua-FM3_Edition2 CER_ES4_Aqua-FM4_Edition2 CER_ES4_FM1+FM3_Edition2 CER_ES4_FM1+FM4_Edition2 CER_ES4_PFM+FM1_Edition2 CER_ES4_PFM+FM2_Edition2 CER_ES4_Aqua-FM3_Edition1-CV CER_ES4_Aqua-FM4_Edition1-CV CER_ES4_Terra-FM1_Edition1-CV CER_ES4_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2005-12-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost_Longitude=180] [Data_Resolution: Latitude_Resolution=2.5 degree; Longitude_Resolution=2.5 degree; Horizontal
CERES ERBE-like Monthly Geographical Averages (ES-4) in HDF (CER_ES4_Terra-FM2_Edition1-CV)
Wielicki, Bruce A. (Principal Investigator)
The ERBE-like Monthly Geographical Averages (ES-4) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-4 is also produced for combinations of scanner instruments. For each observed 2.5-degree spatial region, the daily average, the hourly average over the month, and the overall monthly average of shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-9 product are spatially nested up from 2.5-degree regions to 5- and 10-degree regions, to 2.5-, 5-, and 10-degree zonal averages, and to global monthly averages. For each nested area, the albedo and net flux are given. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The following CERES ES4 data sets are currently available: CER_ES4_FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition2 CER_ES4_PFM+FM1_Edition1 CER_ES4_PFM+FM2_Edition1 CER_ES4_TRMM-PFM_Edition1 CER_ES4_TRMM-PFM_Edition2 CER_ES4_Terra-FM1_Edition1 CER_ES4_Terra-FM2_Edition1 CER_ES4_FM1+FM2_Edition2 CER_ES4_Terra-FM1_Edition2 CER_ES4_Terra-FM2_Edition2 CER_ES4_Aqua-FM3_Edition1 CER_ES4_Aqua-FM4_Edition1 CER_ES4_FM1+FM2+FM3+FM4_Edition1 CER_ES4_Aqua-FM3_Edition2 CER_ES4_Aqua-FM4_Edition2 CER_ES4_FM1+FM3_Edition2 CER_ES4_FM1+FM4_Edition2 CER_ES4_PFM+FM1_Edition2 CER_ES4_PFM+FM2_Edition2 CER_ES4_Aqua-FM3_Edition1-CV CER_ES4_Aqua-FM4_Edition1-CV CER_ES4_Terra-FM1_Edition1-CV CER_ES4_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2006-10-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost_Longitude=180] [Data_Resolution: Latitude_Resolution=2.5 degree; Longitude_Resolution=2.5 degree; Horizontal
CERES ERBE-like Monthly Geographical Averages (ES-4) in HDF (CER_ES4_FM1+FM2_Edition2)
Wielicki, Bruce A. (Principal Investigator)
The ERBE-like Monthly Geographical Averages (ES-4) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-4 is also produced for combinations of scanner instruments. For each observed 2.5-degree spatial region, the daily average, the hourly average over the month, and the overall monthly average of shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-9 product are spatially nested up from 2.5-degree regions to 5- and 10-degree regions, to 2.5-, 5-, and 10-degree zonal averages, and to global monthly averages. For each nested area, the albedo and net flux are given. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The following CERES ES4 data sets are currently available: CER_ES4_FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition2 CER_ES4_PFM+FM1_Edition1 CER_ES4_PFM+FM2_Edition1 CER_ES4_TRMM-PFM_Edition1 CER_ES4_TRMM-PFM_Edition2 CER_ES4_Terra-FM1_Edition1 CER_ES4_Terra-FM2_Edition1 CER_ES4_FM1+FM2_Edition2 CER_ES4_Terra-FM1_Edition2 CER_ES4_Terra-FM2_Edition2 CER_ES4_Aqua-FM3_Edition1 CER_ES4_Aqua-FM4_Edition1 CER_ES4_FM1+FM2+FM3+FM4_Edition1 CER_ES4_Aqua-FM3_Edition2 CER_ES4_Aqua-FM4_Edition2 CER_ES4_FM1+FM3_Edition2 CER_ES4_FM1+FM4_Edition2 CER_ES4_PFM+FM1_Edition2 CER_ES4_PFM+FM2_Edition2 CER_ES4_Aqua-FM3_Edition1-CV CER_ES4_Aqua-FM4_Edition1-CV CER_ES4_Terra-FM1_Edition1-CV CER_ES4_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2002-12-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost_Longitude=180] [Data_Resolution: Latitude_Resolution=2.5 degree; Longitude_Resolution=2.5 degree; Horizontal
CERES ERBE-like Monthly Geographical Averages (ES-4) in HDF (CER_ES4_Aqua-FM4_Edition1-CV)
Wielicki, Bruce A. (Principal Investigator)
The ERBE-like Monthly Geographical Averages (ES-4) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-4 is also produced for combinations of scanner instruments. For each observed 2.5-degree spatial region, the daily average, the hourly average over the month, and the overall monthly average of shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-9 product are spatially nested up from 2.5-degree regions to 5- and 10-degree regions, to 2.5-, 5-, and 10-degree zonal averages, and to global monthly averages. For each nested area, the albedo and net flux are given. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The following CERES ES4 data sets are currently available: CER_ES4_FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition2 CER_ES4_PFM+FM1_Edition1 CER_ES4_PFM+FM2_Edition1 CER_ES4_TRMM-PFM_Edition1 CER_ES4_TRMM-PFM_Edition2 CER_ES4_Terra-FM1_Edition1 CER_ES4_Terra-FM2_Edition1 CER_ES4_FM1+FM2_Edition2 CER_ES4_Terra-FM1_Edition2 CER_ES4_Terra-FM2_Edition2 CER_ES4_Aqua-FM3_Edition1 CER_ES4_Aqua-FM4_Edition1 CER_ES4_FM1+FM2+FM3+FM4_Edition1 CER_ES4_Aqua-FM3_Edition2 CER_ES4_Aqua-FM4_Edition2 CER_ES4_FM1+FM3_Edition2 CER_ES4_FM1+FM4_Edition2 CER_ES4_PFM+FM1_Edition2 CER_ES4_PFM+FM2_Edition2 CER_ES4_Aqua-FM3_Edition1-CV CER_ES4_Aqua-FM4_Edition1-CV CER_ES4_Terra-FM1_Edition1-CV CER_ES4_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2005-03-29] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost_Longitude=180] [Data_Resolution: Latitude_Resolution=2.5 degree; Longitude_Resolution=2.5 degree; Horizontal
Comparison Of Optical, UV, X-ray, And Gamma-ray Variations Of Selected Blazars In 2011
Consiglio, Santina; Marscher, A. P.; Jorstad, S. G.; Walker, G.
2012-01-01
We present multi-wavelength observations of several gamma-ray bright blazars. We combine optical data obtained at Maria Mitchell Observatory on Nantucket Island with space- and ground-based observations carried out with a variety of instruments. These include a number of other optical telescopes, the Fermi Gamma-ray Space Telescope at photon energies of 0.1-200 GeV, the Rossi X-Ray Timing Explorer at 2.4-10 keV, and the Swift satellite at 0.3-10 keV plus optical and UV wavelengths. Three of the observed blazars proved to be particularly active - BL Lac, 3C 279, and PKS 1510-089. BL Lac was of special interest, varying greatly in optical brightness from night to night. In addition, as reported by the VERITAS group, it exhibited a remarkable, short-lived flare at TeV gamma-ray energies on one of the nights. We cross-correlate the variations in the different wavebands in an effort to guide theoretical interpretations of the optical and high-energy emission from blazars. This project was supported by NSF/REU grant AST-0851892 and by the Nantucket Maria Mitchell Association. The research at Boston University was supported in part by NSF grants AST-0907893, and by NASA through Fermi grants NNX08AV65G and NNX11AQ03G.
Kang, H. C.; Mullins, C. B.; Weinberg, W. H.
1990-01-01
Experimental results, obtained using a reflectivity method, for the probability of physical adsorption of ethane on the Ir(110)-(1×2) surface are presented. We analyze these results using Monte Carlo simulations and show that physical adsorption can occur either directly or through a precursor state in which an ethane molecule is trapped in a second layer above a first layer of physically adsorbed ethane. From the Monte Carlo simulations, we are able to establish that the energy barrier for d...
Revisiting the incidence of Mg II absorbers along the blazar sightlines
Mishra, Sapna; Chand, Hum; Gopal-Krishna; Joshi, Ravi
2018-04-01
It is believed that the cool gas clouds traced by Mg II absorption, within a velocity offset of 5000 km/s from the background quasar, are associated with the quasar itself, whereas the absorbers seen at larger velocity offsets towards us are intervening systems and hence their existence is completely independent of the background quasar. Recent evidence by Bergeron et al. 2011 (hereafter BBM), however, seriously questions this canonical view, by showing that the number density of intervening Mg II absorbers along the sightlines towards 45 blazars is, on average, 2 times the expectation based on the Mg II absorption systems seen on the sightlines to normal QSOs. Given the serious implications of this finding, it becomes important to revisit this issue by enlarging the source sample and subjecting it to an independent analysis. Here, we first report our results based on a re-analysis of the spectroscopic data for the BBM sample; this has reproduced their factor 2 excess in dN/dz along blazar sightlines, vis-a-vis the normal QSOs. Next, we assemble a 6 times larger sample of blazar sightlines, albeit with lower SNR. Using this enlarged sample together with the BBM sample, our analysis shows that the dN/dz of Mg II absorbers statistically matches that known for normal QSO sightlines.
CERES ERBE-like Monthly Regional Averages (ES-9) in HDF (CERES:CER_ES9_PFM+FM1_Edition2)
Wielicki, Bruce A. (Principal Investigator)
The ERBE-like Monthly Regional Averages (ES-9) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-9 is also produced for combinations of scanner instruments. All instantaneous shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-8 product for a month are sorted by 2.5-degree spatial regions, by day number, and by the local hour of observation. The mean of the instantaneous fluxes for a given region-day-hour bin is determined and recorded on the ES-9 along with other flux statistics and scene information. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The ES-9 also contains hourly average fluxes for the month and an overall monthly average for each region. These average fluxes are given for both clear-sky and total-sky scenes. The following CERES ES9 data sets are currently available: CER_ES9_FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition2 CER_ES9_PFM+FM1_Edition1 CER_ES9_PFM+FM2_Edition1 CER_ES9_PFM+FM1_Edition2 CER_ES9_PFM+FM2_Edition2 CER_ES9_TRMM-PFM_Edition1 CER_ES9_TRMM-PFM_Edition2 CER_ES9_Terra-FM1_Edition1 CER_ES9_Terra-FM2_Edition1 CER_ES9_FM1+FM2_Edition2 CER_ES9_Terra-FM1_Edition2 CER_ES9_Terra-FM2_Edition2 CER_ES9_Aqua-FM3_Edition1 CER_ES9_Aqua-FM4_Edition1 CER_ES9_FM1+FM2+FM3+FM4_Edition1 CER_ES9_Aqua-FM3_Edition2 CER_ES9_Aqua-FM4_Edition2 CER_ES9_FM1+FM3_Edition2 CER_ES9_FM1+FM4_Edition2 CER_ES9_Aqua-FM3_Edition1-CV CER_ES9_Aqua-FM4_Edition1-CV CER_ES9_Terra-FM1_Edition1-CV CER_ES9_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2000-03-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost
CERES ERBE-like Monthly Regional Averages (ES-9) in HDF ( CER_ES9_Aqua-FM3_Edition1-CV)
Wielicki, Bruce A. (Principal Investigator)
The ERBE-like Monthly Regional Averages (ES-9) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-9 is also produced for combinations of scanner instruments. All instantaneous shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-8 product for a month are sorted by 2.5-degree spatial regions, by day number, and by the local hour of observation. The mean of the instantaneous fluxes for a given region-day-hour bin is determined and recorded on the ES-9 along with other flux statistics and scene information. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The ES-9 also contains hourly average fluxes for the month and an overall monthly average for each region. These average fluxes are given for both clear-sky and total-sky scenes. The following CERES ES9 data sets are currently available: CER_ES9_FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition2 CER_ES9_PFM+FM1_Edition1 CER_ES9_PFM+FM2_Edition1 CER_ES9_PFM+FM1_Edition2 CER_ES9_PFM+FM2_Edition2 CER_ES9_TRMM-PFM_Edition1 CER_ES9_TRMM-PFM_Edition2 CER_ES9_Terra-FM1_Edition1 CER_ES9_Terra-FM2_Edition1 CER_ES9_FM1+FM2_Edition2 CER_ES9_Terra-FM1_Edition2 CER_ES9_Terra-FM2_Edition2 CER_ES9_Aqua-FM3_Edition1 CER_ES9_Aqua-FM4_Edition1 CER_ES9_FM1+FM2+FM3+FM4_Edition1 CER_ES9_Aqua-FM3_Edition2 CER_ES9_Aqua-FM4_Edition2 CER_ES9_FM1+FM3_Edition2 CER_ES9_FM1+FM4_Edition2 CER_ES9_Aqua-FM3_Edition1-CV CER_ES9_Aqua-FM4_Edition1-CV CER_ES9_Terra-FM1_Edition1-CV CER_ES9_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2006-10-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost
CERES ERBE-like Monthly Regional Averages (ES-9) in HDF (CER_ES9_FM1+FM4_Edition2)
Wielicki, Bruce A. (Principal Investigator)
The ERBE-like Monthly Regional Averages (ES-9) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-9 is also produced for combinations of scanner instruments. All instantaneous shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-8 product for a month are sorted by 2.5-degree spatial regions, by day number, and by the local hour of observation. The mean of the instantaneous fluxes for a given region-day-hour bin is determined and recorded on the ES-9 along with other flux statistics and scene information. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The ES-9 also contains hourly average fluxes for the month and an overall monthly average for each region. These average fluxes are given for both clear-sky and total-sky scenes. The following CERES ES9 data sets are currently available: CER_ES9_FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition2 CER_ES9_PFM+FM1_Edition1 CER_ES9_PFM+FM2_Edition1 CER_ES9_PFM+FM1_Edition2 CER_ES9_PFM+FM2_Edition2 CER_ES9_TRMM-PFM_Edition1 CER_ES9_TRMM-PFM_Edition2 CER_ES9_Terra-FM1_Edition1 CER_ES9_Terra-FM2_Edition1 CER_ES9_FM1+FM2_Edition2 CER_ES9_Terra-FM1_Edition2 CER_ES9_Terra-FM2_Edition2 CER_ES9_Aqua-FM3_Edition1 CER_ES9_Aqua-FM4_Edition1 CER_ES9_FM1+FM2+FM3+FM4_Edition1 CER_ES9_Aqua-FM3_Edition2 CER_ES9_Aqua-FM4_Edition2 CER_ES9_FM1+FM3_Edition2 CER_ES9_FM1+FM4_Edition2 CER_ES9_Aqua-FM3_Edition1-CV CER_ES9_Aqua-FM4_Edition1-CV CER_ES9_Terra-FM1_Edition1-CV CER_ES9_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2005-03-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost
CERES ERBE-like Monthly Regional Averages (ES-9) in HDF ( CER_ES9_Aqua-FM4_Edition1-CV)
Wielicki, Bruce A. (Principal Investigator)
The ERBE-like Monthly Regional Averages (ES-9) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-9 is also produced for combinations of scanner instruments. All instantaneous shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-8 product for a month are sorted by 2.5-degree spatial regions, by day number, and by the local hour of observation. The mean of the instantaneous fluxes for a given region-day-hour bin is determined and recorded on the ES-9 along with other flux statistics and scene information. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The ES-9 also contains hourly average fluxes for the month and an overall monthly average for each region. These average fluxes are given for both clear-sky and total-sky scenes. The following CERES ES9 data sets are currently available: CER_ES9_FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition2 CER_ES9_PFM+FM1_Edition1 CER_ES9_PFM+FM2_Edition1 CER_ES9_PFM+FM1_Edition2 CER_ES9_PFM+FM2_Edition2 CER_ES9_TRMM-PFM_Edition1 CER_ES9_TRMM-PFM_Edition2 CER_ES9_Terra-FM1_Edition1 CER_ES9_Terra-FM2_Edition1 CER_ES9_FM1+FM2_Edition2 CER_ES9_Terra-FM1_Edition2 CER_ES9_Terra-FM2_Edition2 CER_ES9_Aqua-FM3_Edition1 CER_ES9_Aqua-FM4_Edition1 CER_ES9_FM1+FM2+FM3+FM4_Edition1 CER_ES9_Aqua-FM3_Edition2 CER_ES9_Aqua-FM4_Edition2 CER_ES9_FM1+FM3_Edition2 CER_ES9_FM1+FM4_Edition2 CER_ES9_Aqua-FM3_Edition1-CV CER_ES9_Aqua-FM4_Edition1-CV CER_ES9_Terra-FM1_Edition1-CV CER_ES9_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2005-03-29] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost
NUSTAR, SWIFT, and GROND Observations of the Flaring MEV Blazar PMN J0641-0320
DEFF Research Database (Denmark)
Ajello, M.; Ghisellini, G.; Paliya, V. S.
2016-01-01
Area Telescope and subsequent follow-up observations with NuSTAR, Swift, and GROND of a new member of the MeV blazar family: PMN J0641-0320. Our optical spectroscopy provides confirmation that this is a flat-spectrum radio quasar located at a redshift of z = 1.196. Its very hard NuSTAR spectrum (power...
Identification of the OGLE Blazars behind the Large and Small Magellanic Clouds
Directory of Open Access Journals (Sweden)
Natalia Żywucka
2017-11-01
Full Text Available We report the selection of blazar candidates behind the Large and Small Magellanic Clouds. Both flat spectrum radio quasar and BL Lacreate objects were selected based on the long-term, multi-colour Optical Gravitational Lensing Experiment photometric data. We cross-correlated the Magellanic Quasar Survey catalogue of spectroscopically confirmed quasars and quasar candidates located behind the Magellanic Clouds with the radio data at six frequencies from 0.8 to 20 GHz. Among the 1654 objects visible in optical range, we identified a sample of 44 newly selected blazar candidates, including 27 flat spectrum radio quasars and 17 BL Lacs. We examined selected objects with respect to their radio, optical, and mid-infrared properties.
2010-01-01
... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Circumstances when the Commission does not provide notice and opportunity to comment. 1101.26 Section 1101.26 Commercial Practices CONSUMER PRODUCT... information is disclosed in testimony in response to an order of the court during litigation to which the...
Relation between Radio Polarization and Spectral Index of Blazars ...
Indian Academy of Sciences (India)
Introduction. Blazars are a very special class of extragalactic objects showing some special proper- ties, including rapid variability, high and variability polarization, high luminosity and superluminal motion, etc. Their optical variability timescales can cover a range of hours to years from radio to γ-rays (Fan et al. 2004; Ulrich ...
Rosales, Daniel; Gil, Bernard; Monavarian, Morteza; Zhang, Fan; Okur, Serdal; Izyumskaya, Natalia; Avrutin, Vitaliy; Özgür, Ümit; Morkoç, Hadis
2015-03-01
We studied the temperature dependence and the recombination dynamics of the photoluminescence of (1-101)-oriented semi-polar Al0.2Ga0.8N/GaN multiple quantum wells (MQW). The polarized low-temperature PL measurements reveal that radiative recombination exhibit an anisotropic behavior. The PL intensity at room temperature is reduced by one order of magnitude with respect to low temperature. The radiative decay time exhibits a mixed behavior: it is roughly constant between 8K to ranging near 140-150K and then rapidly increases with a slope of 10 ps.K-1. This behavior is indicative of coexistence of localized excitons and free excitons which relative proportion are statistically computed.
On the origin of X-ray spectra in luminous blazars
International Nuclear Information System (INIS)
Sikora, Marek; Janiak, Mateusz; Moderski, Rafał; Nalewajko, Krzysztof; Madejski, Greg M.
2013-01-01
Gamma-ray luminosities of some quasar-associated blazars imply jet powers reaching values comparable to the accretion power even if assuming very strong Doppler boosting and very high efficiency of gamma-ray production. With much lower radiative efficiencies of protons than of electrons, and the recent reports of very strong coupling of electrons with shock-heated protons indicated by particle-in-cell simulations, the leptonic models seem to be strongly favored over the hadronic ones. However, the electron-proton coupling combined with the external-radiation-Compton (ERC) models of gamma-ray production in leptonic models predict extremely hard X-ray spectra, with energy indices α x ∼ 0. This is inconsistent with the observed 2-10 keV slopes of blazars, which cluster around α x ∼ 0.6. This problem can be resolved by assuming that electrons can be efficiently cooled down radiatively to non-relativistic energies, or that blazar spectra are entirely dominated by the synchrotron self-Compton (SSC) component up to at least 10 keV. Here, we show that the required cooling can be sufficiently efficient only at distances r < 0.03 pc. SSC spectra, on the other hand, can be produced roughly co-spatially with the observed synchrotron and ERC components, which are most likely located roughly at a parsec scale. We show that the dominant SSC component can also be produced much further than the dominant synchrotron and ERC components, at distances of ≳ 10 pc. Hence, depending on the spatial distribution of the energy dissipation along the jet, one may expect to see γ-ray/optical events with either correlated or uncorrelated X-rays. In all cases the number of e + e – pairs per proton is predicted to be very low. The direct verification of the proposed SSC scenario, and particularly the question of the co-spatiality of the SSC component with other spectral components, requires sensitive observations in the hard X-ray band. This is now possible with the deployment of the Nu
New Gener. High-Energy Spectra of the Blazar 3C 279 with XMM-Newton and GLAST
Collmar, Werner
2007-10-01
We propose two 20 ksec XMM-Newton observations of the X-ray bright gamma-ray blazar 3C~279 simultaneous with GLAST/LAT. The main goal is to measure its X-ray properties (spectrum, variability) in order to (1) improve our knowledge on the X-ray emission of the blazar, and (2) to supplement and correlate them to simultaneous GLAST/LAT Gamma-ray observations (30 MeV-300 GeV). Simultaneous GLAST observations of 3C 279 are guaranteed (assuming proper operation then). The high-energy data will be supplemented by ground-based measurements, adding finally up to multifrequency spectra which have unprecedented accuracy and will extend up to high-energy gamma-rays. Such high-quality SEDs will provide severe constraints on their modeling and have the potential to discriminate among models.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Policy. 232.702 Section 232.702 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Contract Funding 232.702 Policy. Fixed-price...
CERES ERBE-like Instantaneous TOA Estimates (ES-8) in HDF (CER_ES8_Aqua-FM4_Edition1-CV)
Wielicki, Bruce A. (Principal Investigator)
The ES-8 archival data product contains a 24-hour, single-satellite, instantaneous view of scanner fluxes at the top-of-atmosphere (TOA) reduced from spacecraft altitude unfiltered radiances using Earth Radiation Budget Experiment (ERBE) scanner Inversion algorithms and the ERBE shortwave (SW) and longwave (LW) Angular Distribution Models (ADMs). The ES-8 also includes the total (TOT), SW, LW, and window (WN) channel radiometric data; SW, LW, and WN unfiltered radiance values; and the ERBE scene identification for each measurement. These data are organized according to the CERES 3.3-second scan into 6.6-second records. As long as there is one valid scanner measurement within a record, the ES-8 record will be generated. The following CERES ES8 data sets are currently available: CER_ES8_TRMM-PFM_Edition1 CER_ES8_TRMM-PFM_Edition2 CER_ES8_TRMM-PFM_Transient-Ops2 CER_ES8_Terra-FM1_Edition1 CER_ES8_Terra-FM2_Edition1 CER_ES8_Terra-FM1_Edition2 CER_ES8_Terra-FM2_Edition2 CER_ES8_Aqua-FM3_Edition1 CER_ES8_Aqua-FM4_Edition1 CER_ES8_Aqua-FM3_Edition2 CER_ES8_Aqua-FM4_Edition2 CER_ES8_Aqua-FM3_Edition1-CV CER_ES8_Aqua-FM4_Edition1-CV CER_ES8_Terra-FM1_Edition1-CV CER_ES8_Terra-FM1_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1997-12-27; Stop_Date=2005-03-29] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost_Longitude=180] [Data_Resolution: Temporal_Resolution=1 day; Temporal_Resolution_Range=Daily - < Weekly].
International Nuclear Information System (INIS)
Zhang, Haocheng; Taylor, Greg; Li, Hui; Guo, Fan
2017-01-01
Kink instabilities are likely to occur in the current-carrying magnetized plasma jets. Recent observations of the blazar radiation and polarization signatures suggest that the blazar emission region may be considerably magnetized. While the kink instability has been studied with first-principle magnetohydrodynamic (MHD) simulations, the corresponding time-dependent radiation and polarization signatures have not been investigated. In this paper, we perform comprehensive polarization-dependent radiation modeling of the kink instability in the blazar emission region based on relativistic MHD (RMHD) simulations. We find that the kink instability may give rise to strong flares with polarization angle (PA) swings or weak flares with polarization fluctuations, depending on the initial magnetic topology and magnetization. These findings are consistent with observations. Compared with the shock model, the kink model generates polarization signatures that are in better agreement with the general polarization observations. Therefore, we suggest that kink instabilities may widely exist in the jet environment and provide an efficient way to convert the magnetic energy and produce multiwavelength flares and polarization variations.
Energy Technology Data Exchange (ETDEWEB)
Zhang, Haocheng; Taylor, Greg [Department of Physics and Astronomy, University of New Mexico, Albuquerque, NM 87131 (United States); Li, Hui; Guo, Fan [Theoretical Division, Los Alamos National Laboratory, Los Alamos, NM 87545 (United States)
2017-02-01
Kink instabilities are likely to occur in the current-carrying magnetized plasma jets. Recent observations of the blazar radiation and polarization signatures suggest that the blazar emission region may be considerably magnetized. While the kink instability has been studied with first-principle magnetohydrodynamic (MHD) simulations, the corresponding time-dependent radiation and polarization signatures have not been investigated. In this paper, we perform comprehensive polarization-dependent radiation modeling of the kink instability in the blazar emission region based on relativistic MHD (RMHD) simulations. We find that the kink instability may give rise to strong flares with polarization angle (PA) swings or weak flares with polarization fluctuations, depending on the initial magnetic topology and magnetization. These findings are consistent with observations. Compared with the shock model, the kink model generates polarization signatures that are in better agreement with the general polarization observations. Therefore, we suggest that kink instabilities may widely exist in the jet environment and provide an efficient way to convert the magnetic energy and produce multiwavelength flares and polarization variations.
NuSTAR DETECTION OF THE BLAZAR B2 1023+25 AT REDSHIFT 5.3
Energy Technology Data Exchange (ETDEWEB)
Sbarrato, T. [Dipartimento di Scienza e Alta Tecnologia, Università dell' Insubria, Via Valleggio 11, I-22100 Como (Italy); Tagliaferri, G.; Ghisellini, G. [INAF-Osservatorio Astronomico di Brera, via E. Bianchi 46, I-23807 Merate (Italy); Perri, M.; Puccetti, S.; Giommi, P. [ASI-Science Data Center, via Galileo Galilei, I-00044 Frascati (Italy); Baloković, M.; Harrison, F. A.; Hovatta, T. [Cahill Center for Astronomy and Astrophysics, California Institute of Technology, Pasadena, CA 91125 (United States); Nardini, M. [Dipartimento di Fisica G. Occhialini, Università di Milano Bicocca, Piazza della Scienza 3, I-20126 Milano (Italy); Stern, D. [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States); Boggs, S. E. [Space Sciences Laboratory, University of California, Berkeley, CA 94720 (United States); Brandt, W. N. [Department of Astronomy and Astrophysics, The Pennsylvania State University, 525 Davey Lab, University Park, PA 16802 (United States); Christensen, F. E. [DTU Space-National Space Institute, Technical University of Denmark, Elektrovej 327, DK-2800 Lyngby (Denmark); Greiner, J.; Rau, A.; Schady, P.; Sudilovsky, V. [Max-Planck-Institut für extraterrestrische Physik, Giessenbachstrasse 1, D-85748 Garching (Germany); Hailey, C. J. [Columbia Astrophysics Laboratory, Columbia University, New York, NY 10027 (United States); Madejski, G. M., E-mail: tullia.sbarrato@brera.inaf.it [Kavli Institute for Particle Astrophysics and Cosmology, SLAC National Accelerator Laboratory, Menlo Park, CA 94025 (United States); and others
2013-11-10
B2 1023+25 is an extremely radio-loud quasar at z = 5.3 that was first identified as a likely high-redshift blazar candidate in the SDSS+FIRST quasar catalog. Here, we use the Nuclear Spectroscopic Telescope Array (NuSTAR) to investigate its non-thermal jet emission, whose high-energy component we detected in the hard X-ray energy band. The X-ray flux is ∼ 5.5 x 10{sup -14} erg cm{sup -2} s{sup -1} (5-10 keV) and the photon spectral index is Γ{sub X} ≅ 1.3-1.6. Modeling the full spectral energy distribution, we find that the jet is oriented close to the line of sight, with a viewing angle of ∼3°, and has significant Doppler boosting, with a large bulk Lorentz factor ∼13, which confirms the identification of B2 1023+25 as a blazar. B2 1023+25 is the first object at redshift larger than 5 detected by NuSTAR, demonstrating the ability of NuSTAR to investigate the early X-ray universe and to study extremely active supermassive black holes located at very high redshift.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Milk. 58.232 Section 58.232 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections....232 Milk. Raw milk shall meet the requirements as outlined in §§ 58.132 through 58.138 and, unless...
The Evolution of Swift/BAT blazars and the origin of the MeV background
Energy Technology Data Exchange (ETDEWEB)
Ajello, M.; /SLAC /KIPAC, Menlo Park; Costamante, L.; /Stanford U., HEPL /KIPAC, Menlo Park; Sambruna, R.M.; Gehrels, N.; /NASA, Goddard; Chiang, J.; /SLAC /KIPAC, Menlo Park; Rau, A.; /Caltech; Escala, A.; /SLAC /KIPAC, Menlo Park /Cerro Calan Observ.; Greiner, J.; /Garching, Max Planck Inst., MPE; Tueller, J.; /NASA, Goddard; Wall, J.V.; /British Columbia U.; Mushotzky, R.F.; /NASA, Goddard
2009-10-17
We use 3 years of data from the Swift/BAT survey to select a complete sample of X-ray blazars above 15 keV. This sample comprises 26 Flat-Spectrum Radio Quasars (FSRQs) and 12 BL Lac objects detected over a redshift range of 0.03 < z < 4.0. We use this sample to determine, for the first time in the 15-55 keV band, the evolution of blazars. We find that, contrary to the Seyfert-like AGNs detected by BAT, the population of blazars shows strong positive evolution. This evolution is comparable to the evolution of luminous optical QSOs and luminous X-ray selected AGNs. We also find evidence for an epoch-dependence of the evolution as determined previously for radio-quiet AGNs. We interpret both these findings as a strong link between accretion and jet activity. In our sample, the FSRQs evolve strongly, while our best-fit shows that BL Lacs might not evolve at all. The blazar population accounts for 10-20% (depending on the evolution of the BL Lacs) of the Cosmic X-ray background (CXB) in the 15-55 keV band. We find that FSRQs can explain the entire CXB emission for energies above 500 keV solving the mystery of the generation of the MeV background. The evolution of luminous FSRQs shows a peak in redshift (z{sub c} = 4.3 {+-} 0.5) which is larger than the one observed in QSOs and X-ray selected AGNs. We argue that FSRQs can be used as tracers of massive elliptical galaxies in the early Universe.
Parsec-Scale Radio Properties of Gamma-ray Bright Blazars
Linford, Justin
2012-01-01
The parsec-scale radio properties of blazars detected by the Large Area Telescope (LAT) on board the Fermi Gamma-ray Space Telescope have been investigated using observations with the Very Long Baseline Array (VLBA). Comparisons between LAT and non-LAT detected samples were made using both archival and contemporaneous data. In total, 244 sources were used in the LAT-detected sample. This very large, radio flux-limited sample of active galactic nuclei (AGN) provides insights into the mechanism that produces strong gamma-ray emission. It has been found that LAT-detected BL Lac objects are very similar to the non-LAT BL Lac objects in most properties, although LAT BL Lac objects may have longer jets. The LAT flat spectrum radio quasars (FSRQs) are significantly different from non-LAT FSRQs and are likely extreme members of the FSRQ population. Archival radio data indicated that there was no significant correlation between radio flux density and gamma-ray flux, especially at lower flux levels. However, contemporaneous observations showed a strong correlation. Most of the differences between the LAT and non-LAT populations are related to the cores of the sources, indicating that the gamma-ray emission may originate near the base of the jets (i.e., within a few pc of the central engine). There is some indication that LAT-detected sources may have larger jet opening angles than the non-LAT sources. Strong core polarization is significantly more common among the LAT sources, suggesting that gamma-ray emission is related to strong, uniform magnetic fields at the base of the jets of the blazars. Observations of sources in two epochs indicate that core fractional polarization was higher when the objects were detected by the LAT. Included in our sample are several non-blazar AGN such as 3C84, M82, and NGC 6251.
Alvarado, David M; Aferol, Hyuliya; McCall, Kevin; Huang, Jason B; Techy, Matthew; Buchan, Jillian; Cady, Janet; Gonzales, Patrick R; Dobbs, Matthew B; Gurnett, Christina A
2010-07-09
Clubfoot is a common musculoskeletal birth defect for which few causative genes have been identified. To identify the genes responsible for isolated clubfoot, we screened for genomic copy-number variants with the Affymetrix Genome-wide Human SNP Array 6.0. A recurrent chromosome 17q23.1q23.2 microduplication was identified in 3 of 66 probands with familial isolated clubfoot. The chromosome 17q23.1q23.2 microduplication segregated with autosomal-dominant clubfoot in all three families but with reduced penetrance. Mild short stature was common and one female had developmental hip dysplasia. Subtle skeletal abnormalities consisted of broad and shortened metatarsals and calcanei, small distal tibial epiphyses, and thickened ischia. Several skeletal features were opposite to those described in the reciprocal chromosome 17q23.1q23.2 microdeletion syndrome associated with developmental delay and cardiac and limb abnormalities. Of note, during our study, we also identified a microdeletion at the locus in a sibling pair with isolated clubfoot. The chromosome 17q23.1q23.2 region contains the T-box transcription factor TBX4, a likely target of the bicoid-related transcription factor PITX1 previously implicated in clubfoot etiology. Our result suggests that this chromosome 17q23.1q23.2 microduplication is a relatively common cause of familial isolated clubfoot and provides strong evidence linking clubfoot etiology to abnormal early limb development. Copyright 2010 The American Society of Human Genetics. Published by Elsevier Inc. All rights reserved.
Equipartition gamma-ray blazars and the location of the gamma-ray emission site in 3C 279
Energy Technology Data Exchange (ETDEWEB)
Dermer, Charles D. [Code 7653, Space Science Division, U.S. Naval Research Laboratory, Washington, DC 20375 (United States); Cerruti, Matteo [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Lott, Benoit [Centre d' Études Nucléaires Bordeaux Gradignan, Université de Bordeaux, CNRS/IN2P3, UMR 5797, F-33175 Gradignan (France); Boisson, Catherine; Zech, Andreas, E-mail: charles.dermer@nrl.navy.mil, E-mail: matteo.cerruti@cfa.harvard.edu [Laboratoire Univers et THeories (LUTH), Observatoire de Paris-Meudon, 5 Place Jules Janssen, F-92195 Meudon Cedex (France)
2014-02-20
Blazar spectral models generally have numerous unconstrained parameters, leading to ambiguous values for physical properties like Doppler factor δ{sub D} or fluid magnetic field B'. To help remedy this problem, a few modifications of the standard leptonic blazar jet scenario are considered. First, a log-parabola function for the electron distribution is used. Second, analytic expressions relating energy loss and kinematics to blazar luminosity and variability, written in terms of equipartition parameters, imply δ{sub D}, B', and the peak electron Lorentz factor γ{sub pk}{sup ′}. The external radiation field in a blazar is approximated by Lyα radiation from the broad-line region (BLR) and ≈0.1 eV infrared radiation from a dusty torus. When used to model 3C 279 spectral energy distributions from 2008 and 2009 reported by Hayashida et al., we derive δ{sub D} ∼ 20-30, B' ∼ few G, and total (IR + BLR) external radiation field energy densities u ∼ 10{sup –2}-10{sup –3} erg cm{sup –3}, implying an origin of the γ-ray emission site in 3C 279 at the outer edges of the BLR. This is consistent with the γ-ray emission site being located at a distance R ≲ Γ{sup 2} ct {sub var} ∼ 0.1(Γ/30){sup 2}(t {sub var}/10{sup 4} s) pc from the black hole powering 3C 279's jets, where t {sub var} is the variability timescale of the radiation in the source frame, and at farther distances for narrow-jet and magnetic-reconnection models. Excess ≳ 5 GeV γ-ray emission observed with Fermi LAT from 3C 279 challenges the model, opening the possibility of a second leptonic component or a hadronic origin of the emission. For low hadronic content, absolute jet powers of ≈10% of the Eddington luminosity are calculated.
BeppoSAX Observations of the TeV Blazar Mkn 421
Energy Technology Data Exchange (ETDEWEB)
Fossati, G.; Chiappetti, L.; Celotti, A.; Ghisellini, G.; Maraschi, L.; Tagliaferri, G.; Tanzi, E.G.; Treves, A.; Bassani, L.; Cappi, M.; Comastri, A.; Frontera, F.; Giarrusso, S.; Grandi, P.; Molendi, S.; Palumbo, G.; Perola, C.; Pian, E.; Salvati, M.; Raiteri, C.; Villata, M.; Urry, C.M
1999-01-01
The blazar Mkn 421 has been observed, as part of the AO1 Core Program, five times from 2 to 7 May 1997. In the LECS+MECS energy band the spectrum shows convex curvature, well represented by a broken power-law. Flux variability (more than a factor 2) has been detected over the entire 0.1-10 keV range, accompanying which the spectrum steepens with the decrease in intensity. Mkn 421 has been also detected with the PDS instrument. Our preliminary analysis indicates that the PDS spectrum lies significantly above the extrapolation from the MECS, suggesting a contribution from a flatter high energy component.
BeppoSAX Observations of the TeV Blazar Mkn 421
International Nuclear Information System (INIS)
Fossati, G.; Chiappetti, L.; Celotti, A.; Ghisellini, G.; Maraschi, L.; Tagliaferri, G.; Tanzi, E.G.; Treves, A.; Bassani, L.; Cappi, M.; Comastri, A.; Frontera, F.; Giarrusso, S.; Grandi, P.; Molendi, S.; Palumbo, G.; Perola, C.; Pian, E.; Salvati, M.; Raiteri, C.; Villata, M.; Urry, C.M.
1999-01-01
The blazar Mkn 421 has been observed, as part of the AO1 Core Program, five times from 2 to 7 May 1997. In the LECS+MECS energy band the spectrum shows convex curvature, well represented by a broken power-law. Flux variability (more than a factor 2) has been detected over the entire 0.1-10 keV range, accompanying which the spectrum steepens with the decrease in intensity. Mkn 421 has been also detected with the PDS instrument. Our preliminary analysis indicates that the PDS spectrum lies significantly above the extrapolation from the MECS, suggesting a contribution from a flatter high energy component
2010-10-01
... hazard of death or injury to persons, or has caused death or injury, a penalty not to exceed $100,000 per... 49 Transportation 4 2010-10-01 2010-10-01 false Penalties. 232.11 Section 232.11 Transportation...-TRAIN DEVICES General § 232.11 Penalties. (a) Any person (including but not limited to a railroad; any...
Directory of Open Access Journals (Sweden)
Aprilia Kusumastuti
2015-10-01
Full Text Available The aim of the study was to know avian influenza (AI infection in field by using serology test in threemarketing area of AI vaccines. Haemagglutination inhibition methode was used in this test. There werefour antigen strains of AI subtype H5N1 clade 2.1.3 (AIstrainA/Chicken/West Java/PWT-WIJ/2006, AIstrain A/Chicken/Garut/BBVW-223/2007, AI strain A/Chicken/West Java-Nagrak/30/2007, and AI strainA/Chicken/Pekalongan/BBVW-208/2007 and 2 antigen strains of AI subtype H5N1 clade 2.3.2 (AI strainA/duck/Sukoharjo/BBVW-1428-9/2012 and AI strain A/duck/Sleman/BBVW-1463-10/2012 was used inthis study for HI test. The result presents that 93,33% chicken farms in three marketing area of PT. SanbioLaboratories have positive antibody titre to AI subtype H5N1 clade 2.1.3. This titre may be obtained fromAI clade 2.1.3 vaccination. From 15 samples, 92,86% are positive to AI subtype H5N1 clade 2.3.2A/duck/Sukoharjo/BBVW-1428-9/2012 and 92,31% are positive to A/duck/Sleman/BBVW-1463-10/2012 evenwithout AI clade 2.3.2 vaccination. This antibody titre may be obtained from AI clade 2.1.3 vaccine crossprotection or field infection.
SPECTRAL PROPERTIES OF BRIGHT FERMI-DETECTED BLAZARS IN THE GAMMA-RAY BAND
International Nuclear Information System (INIS)
Abdo, A. A.; Ackermann, M.; Ajello, M.; Bechtol, K.; Berenji, B.; Blandford, R. D.; Bloom, E. D.; Borgland, A. W.; Bouvier, A.; Atwood, W. B.; Axelsson, M.; Baldini, L.; Bellazzini, R.; Bregeon, J.; Brez, A.; Ballet, J.; Barbiellini, G.; Bastieri, D.; Bonamente, E.; Brigida, M.
2010-01-01
The gamma-ray energy spectra of bright blazars of the LAT Bright AGN Sample (LBAS) are investigated using Fermi-LAT data. Spectral properties (hardness, curvature, and variability) established using a data set accumulated over 6 months of operation are presented and discussed for different blazar classes and subclasses: flat spectrum radio quasars (FSRQs), low-synchrotron peaked BLLacs (LSP-BLLacs), intermediate-synchrotron peaked BLLacs (ISP-BLLacs), and high-synchrotron peaked BLLacs (HSP-BLLacs). The distribution of photon index (Γ, obtained from a power-law fit above 100 MeV) is found to correlate strongly with blazar subclass. The change in spectral index from that averaged over the 6 months observing period is < 0.2-0.3 when the flux varies by about an order of magnitude, with a tendency toward harder spectra when the flux is brighter for FSRQs and LSP-BLLacs. A strong departure from a single power-law spectrum appears to be a common feature for FSRQs. This feature is also present for some high-luminosity LSP-BLLacs, and a small number of ISP-BLLacs. It is absent in all LBAS HSP-BLLacs. For 3C 454.3 and AO 0235+164, the two brightest FSRQ source and LSP-BLLac source, respectively, a broken power law (BPL) gives the most acceptable of power law, BPL, and curved forms. The consequences of these findings are discussed.
Production of 232,233Pa in 6Li+232Th Collisions in the Classical Trajectory Approach
International Nuclear Information System (INIS)
Aleshin, V.P.
2000-01-01
The semiclassical model of nuclear reactions with loosely bound projectiles (V.P. Aleshin, B.I. Sidorenko, Acta Phys. Pol. B29, 325 (1998)) is refined and compared with experimental data of Rama Rao et al. on the excitation function for the production of 232,233 Pa in 6 Li+ 232 Th collisions at E = 30-50 MeV. The main contribution to the production of 232 Pa is the 2 neutron emission from excited states of 234 Pa formed in the ( 6 Li,α) reaction. The main source of 233 Pa is the ( 6 Li,αp) reaction followed by γ transitions from excited states of 233 Th to 233 Th (g.s.) which transforms to 233 Pa through β - decay. The ground state of 6 Li regarded as a combination of n+p+α is modeled with the K=2, l x =l y =0 hyperspherical function. The calculation underpredicts the excitation function of 232 Pa by a factor of 0.6 and overpredicts the excitation function of 233 Pa by a factor of 2.3, on the average. With the more realistic wave function of 6 Li both factors are expected to be closer to 1. (author)
Energy Technology Data Exchange (ETDEWEB)
Álvarez Crespo, N.; Massaro, F. [Dipartimento di Fisica, Università degli Studi di Torino, via Pietro Giuria 1, I-10125 Torino (Italy); Milisavljevic, D.; Paggi, A.; Smith, Howard A. [Harvard—Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Landoni, M. [INAF-Osservatorio Astronomico di Brera, Via Emilio Bianchi 46, I-23807 Merate (Italy); Chavushyan, V.; Patiño-Álvarez, V. [Instituto Nacional de Astrofísica, Óptica y Electrónica, Apartado Postal 51-216, 72000 Puebla, México (Mexico); Masetti, N. [INAF—Istituto di Astrofisica Spaziale e Fisica Cosmica di Bologna, via Gobetti 101, I-40129, Bologna (Italy); Jiménez-Bailón, E. [Instituto de Astronomía, Universidad Nacional Autónoma de México, Apdo. Postal 877, Ensenada, 22800 Baja California, México (Mexico); Strader, J.; Chomiuk, L. [Department of Physics and Astronomy, Michigan State University, East Lansing, MI 48824 (United States); Katagiri, H.; Kagaya, M. [College of Science, Ibaraki University, 2-1-1, Bunkyo, Mito 310-8512 (Japan); Cheung, C. C. [Space Science Division, Naval Research Laboratory, Washington, DC 20375 (United States); D’Abrusco, R. [Department of Physical Sciences, University of Napoli Federico II, via Cinthia 9, I-80126 Napoli (Italy); Ricci, F.; La Franca, F. [Dipartimento di Matematica e Fisica, Università Roma Tre, via della Vasca Navale 84, I-00146, Roma (Italy); and others
2016-04-15
Blazars, one of the most extreme classes of active galaxies, constitute so far the largest known population of γ-ray sources, and their number is continuously growing in the Fermi catalogs. However, in the latest release of the Fermi catalog there is still a large fraction of sources that are classified as blazar candidates of uncertain type (BCUs) for which optical spectroscopic observations are necessary to confirm their nature and their associations. In addition, about one-third of the γ-ray point sources listed in the Third Fermi-LAT Source Catalog (3FGL) are still unassociated and lacking an assigned lower-energy counterpart. Since 2012 we have been carrying out an optical spectroscopic campaign to observe blazar candidates to confirm their nature. In this paper, the sixth of the series, we present optical spectroscopic observations for 30 γ-ray blazar candidates from different observing programs we carried out with the Telescopio Nazionale Galileo, William Herschel Telescope, Observatorio Astronómico Nacional, Southern Astrophysical Research Telescope, and Magellan Telescopes. We found that 21 out of 30 sources investigated are BL Lac objects, while the remaining targets are classified as flat-spectrum radio quasars showing the typical broad emission lines of normal quasi-stellar objects. We conclude that our selection of γ-ray blazar candidates based on their multifrequency properties continues to be a successful way to discover potential low-energy counterparts of the Fermi unidentified gamma-ray sources and to confirm the nature of BCUs.
48 CFR 1553.232 - Contract financing.
2010-10-01
... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Contract financing. 1553.232 Section 1553.232 Federal Acquisition Regulations System ENVIRONMENTAL PROTECTION AGENCY CLAUSES AND FORMS FORMS Prescription of Forms 1553.232 Contract financing. ...
Shaping the GeV-spectra of bright blazars
Hunger, L.; Reimer, A.
2016-05-01
Aims: The non-thermal spectra of jetted active galactic nuclei (AGN) show a variety of shapes and degrees of curvature in their low- and high energy components. From some of the brightest Fermi-LAT blazars, prominent spectral breaks at a few GeV have been regularly detected, which is inconsistent with conventional cooling effects. We study the effects of continuous time-dependent injection of electrons into the jet with differing rates, durations, locations, and power-law spectral indices, and evaluate its impact on the ambient emitting particle spectrum that is observed at a given snapshot time in the framework of a leptonic blazar emission model. With this study, we provide a basis for analyzing ambient electron spectra in terms of injection requirements, with implications for particle acceleration modes. Methods: The emitting electron spectrum is calculated by Compton cooling the continuously injected electrons, where target photons are assumed to be provided by the accretion disk and broad line region (BLR). From this setup, we calculate the non-thermal photon spectra produced by inverse Compton scattering of these external target radiation fields using the full Compton cross-section in the head-on approximation. Results: By means of a comprehensive parameter study we present the resulting ambient electron and photon spectra, and discuss the influence of each injection parameter individually. We found that varying the injection parameters has a notable influence on the spectral shapes, which in turn can be used to set interesting constraints on the particle injection scenarios. By applying our model to the flare state spectral energy distribution (SED) of 3C 454.3, we confirm a previous suggestion that explained the observed spectral changes at a few GeV by a combination of the Compton-scattered disk and BLR radiation. We determine the required injection parameters for this scenario. We also show that this spectral turn-over can also be understood as Compton
Landoni, M.; Massaro, F.; Paggi, A.; D'Abrusco, R.; Milisavljevic, D.; Masetti, N.; Smith, H. A.; Tosti, G.; Chomiuk, L.; Strader, J.; Cheung, C. C.
2015-05-01
We report the results of our exploratory program carried out with the southern Astrophysical Research telescope aimed at associating counterparts and establishing the nature of the Fermi Unidentified γ-ray Sources (UGSs). We selected the optical counterparts of six UGSs from the Fermi catalog on the basis of our recently discovered tight connection between infrared and γ-ray emission found for the γ-ray blazars detected by the Wide-Field Infrared Survey Explorer in its all-sky survey. We perform for the first time a spectroscopic study of the low-energy counterparts of the Fermi UGSs, in the optical band, confirming the blazar-like nature of the whole sample. We also present new spectroscopic observations of six active galaxies of uncertain type associated with Fermi sources which appear to be BL Lac objects. Finally, we report the spectra collected for six known γ-ray blazars belonging to the Roma BZCAT that were obtained to establish their nature or better estimate their redshifts. Two interesting cases of high redshift and extremely luminous BL Lac objects (z ≥ 1.18 and z ≥ 1.02, based on the detection of Mg ii intervening systems) are also discussed. Based on observations obtained at the southern Astrophysical Research (SOAR) telescope, which is a joint project of the Ministério da Ciência, Tecnologia, e Inovação (MCTI) da República Federativa do Brasil, the U.S. National Optical Astronomy Observatory (NOAO), the University of North Carolina at Chapel Hill (UNC), and Michigan State University (MSU).
A propósito de los orígenes de don Pedro, obispo de Osma (1101-1109
Directory of Open Access Journals (Sweden)
Juan Pablo Rubio Sadia
2007-01-01
Full Text Available La procedencia del obispo francés Pedro de Osma (1101-1109, el primero tras la restauración diocesana, ha sido objeto de muy diversas consideraciones. De hecho, aparece citado como oriundo de Bourges, pero también de Béziers, como monje cluniacense de Auch, pero al mismo tiempo de Aurillac y de Sahagún. En estas páginas vamos a valorar de forma crítica la base documental existente detrás de cada una de estas aserciones en vistas a esclarecer, en el mayor grado posible, cuál es el verdadero origen (la ciudad y el supuesto monasterio de profesión del santo patrono de la Iglesia oxomense y dónde se hallan los límites entre la creencia tradicional y el dato documentado.The origin of the French bishop Pedro de Osma (1101-1109, the first one after the diocesan restoration, has been the object of very diverse considerations. In fact, he appears mentioned as native of Bourges, but also of Béziers, as a Cluniac monk of Auch, and at the same time of Aurillac and Sahagún. In these pages we are going to assess in a critical way, the existing documentary base behind each one of these assertions in order to clarify, as much as possible, which is the true origin (the city and the supposed monastery of profession of the Oxonian Church Patron Saint, and where are the limits between the traditional belief and the documented data.
76 FR 27649 - HIV/AIDS Bureau Policy Notice 11-01 (Replaces Policy Notice 99-02)
2011-05-12
... Bureau Policy Notice 11-01 (Replaces Policy Notice 99- 02) AGENCY: Health Resources and Services.../AIDS Bureau (HAB) Policy Notice 99-02 established policies for the use of Ryan White HIV/AIDS Program... and short-term or emergency housing needs. Amendment 1 to Policy Notice 99-02, effective March 27...
49 CFR 232.13 - Preemptive effect.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Preemptive effect. 232.13 Section 232.13 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... EQUIPMENT; END-OF-TRAIN DEVICES General § 232.13 Preemptive effect. (a) Under 49 U.S.C. 20106, issuance of...
Variability of Spectral Energy Distribution of Blazar S5 0716+714 B ...
Indian Academy of Sciences (India)
one-zone BPL model is over-simplified in accounting for the radio-optical blazar emission. ... a number of authors (e.g., Vittorini et al. 2009; Raiteri et ... contribution from starlight to the optical bands, which will modify the calculated synchrotron ...
Blazars with arcminute-scale radio halos
International Nuclear Information System (INIS)
Ulvestad, J.S.; Antonucci, R.R.J.; Space Telescope Science Institute, Baltimore, MD)
1986-01-01
About 10-arcsec resolution 20-cm wavelength maps are presented for three nearby BL Lac objects: Mkn 180, whose halo has a linear size of 85 kpc, 2155-304, with a halo about 375 kpc across, and 1727 + 502, whose one-sided diffuse emission extends to a distance of about 145 kpc from its radio core. Little evidence is found for strong radio variability in the cores of the three blazars; these and other results obtained are consistent with the assertion that the three objects should be classified as normal low luminosity double radio galaxies with optically dull nuclei, if seen from other directions. 20 references
24 CFR 232.560 - Interest rate.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Interest rate. 232.560 Section 232... Equipment Eligible Security Instruments § 232.560 Interest rate. (a) The loan shall bear interest at the rate agreed upon by the lender and the borrower. (b) Interest shall be payable in monthly installments...
Linford, J. D.; Taylor, G. B.; Schinzel, F. K.
2012-09-01
The parsec-scale radio properties of 232 active galactic nuclei, most of which are blazars, detected by the Large Area Telescope (LAT) on board the Fermi Gamma-ray Space Telescope have been observed contemporaneously by the Very Long Baseline Array (VLBA) at 5 GHz. Data from both the first 11 months (1FGL) and the first 2 years (2FGL) of the Fermi mission were used to investigate these sources' γ-ray properties. We use the ratio of the γ-ray-to-radio luminosity as a measure of γ-ray loudness. We investigate the relationship of several radio properties to γ-ray loudness and to the synchrotron peak frequency. There is a tentative correlation between γ-ray loudness and synchrotron peak frequency for BL Lac objects in both 1FGL and 2FGL, and for flat-spectrum radio quasars (FSRQs) in 2FGL. We find that the apparent opening angle tentatively correlates with γ-ray loudness for FSRQs, but only when we use the 2FGL data. We also find that the total VLBA flux density correlates with the synchrotron peak frequency for BL Lac objects and FSRQs. The core brightness temperature also correlates with synchrotron peak frequency, but only for the BL Lac objects. The low-synchrotron-peaked (LSP) BL Lac object sample shows indications of contamination by FSRQs which happen to have undetectable emission lines. There is evidence that the LSP BL Lac objects are more strongly beamed than the rest of the BL Lac object population.
Energy Technology Data Exchange (ETDEWEB)
Linford, J. D.; Taylor, G. B.; Schinzel, F. K., E-mail: jlinford@unm.edu [Department of Physics and Astronomy, University of New Mexico, MSC07 4220, Albuquerque, NM 87131-0001 (United States)
2012-09-20
The parsec-scale radio properties of 232 active galactic nuclei, most of which are blazars, detected by the Large Area Telescope (LAT) on board the Fermi Gamma-ray Space Telescope have been observed contemporaneously by the Very Long Baseline Array (VLBA) at 5 GHz. Data from both the first 11 months (1FGL) and the first 2 years (2FGL) of the Fermi mission were used to investigate these sources' {gamma}-ray properties. We use the ratio of the {gamma}-ray-to-radio luminosity as a measure of {gamma}-ray loudness. We investigate the relationship of several radio properties to {gamma}-ray loudness and to the synchrotron peak frequency. There is a tentative correlation between {gamma}-ray loudness and synchrotron peak frequency for BL Lac objects in both 1FGL and 2FGL, and for flat-spectrum radio quasars (FSRQs) in 2FGL. We find that the apparent opening angle tentatively correlates with {gamma}-ray loudness for FSRQs, but only when we use the 2FGL data. We also find that the total VLBA flux density correlates with the synchrotron peak frequency for BL Lac objects and FSRQs. The core brightness temperature also correlates with synchrotron peak frequency, but only for the BL Lac objects. The low-synchrotron-peaked (LSP) BL Lac object sample shows indications of contamination by FSRQs which happen to have undetectable emission lines. There is evidence that the LSP BL Lac objects are more strongly beamed than the rest of the BL Lac object population.
International Nuclear Information System (INIS)
Linford, J. D.; Taylor, G. B.; Schinzel, F. K.
2012-01-01
The parsec-scale radio properties of 232 active galactic nuclei, most of which are blazars, detected by the Large Area Telescope (LAT) on board the Fermi Gamma-ray Space Telescope have been observed contemporaneously by the Very Long Baseline Array (VLBA) at 5 GHz. Data from both the first 11 months (1FGL) and the first 2 years (2FGL) of the Fermi mission were used to investigate these sources' γ-ray properties. We use the ratio of the γ-ray-to-radio luminosity as a measure of γ-ray loudness. We investigate the relationship of several radio properties to γ-ray loudness and to the synchrotron peak frequency. There is a tentative correlation between γ-ray loudness and synchrotron peak frequency for BL Lac objects in both 1FGL and 2FGL, and for flat-spectrum radio quasars (FSRQs) in 2FGL. We find that the apparent opening angle tentatively correlates with γ-ray loudness for FSRQs, but only when we use the 2FGL data. We also find that the total VLBA flux density correlates with the synchrotron peak frequency for BL Lac objects and FSRQs. The core brightness temperature also correlates with synchrotron peak frequency, but only for the BL Lac objects. The low-synchrotron-peaked (LSP) BL Lac object sample shows indications of contamination by FSRQs which happen to have undetectable emission lines. There is evidence that the LSP BL Lac objects are more strongly beamed than the rest of the BL Lac object population.
Methods for the Quasi-Periodic Variability Analysis in Blazars Y. Liu ...
Indian Academy of Sciences (India)
the variability analysis in blazars in optical and radio bands, to search for possible quasi-periodic signals. 2. Power spectral density (PSD). In statistical signal processing and physics, the power spectral density (PSD) is a positive real function of a frequency variable associated with a stationary stochas- tic process. Intuitively ...
22 CFR 1101.5 - Security, confidentiality and protection of records.
2010-04-01
... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Security, confidentiality and protection of... Bureau of Standard's booklet “Computer Security Guidelines for Implementing the Privacy Act of 1974” (May... STATES AND MEXICO, UNITED STATES SECTION PRIVACY ACT OF 1974 § 1101.5 Security, confidentiality and...
48 CFR 52.232-10 - Payments Under Fixed-Price Architect-Engineer Contracts.
2010-10-01
... Architect-Engineer Contracts. 52.232-10 Section 52.232-10 Federal Acquisition Regulations System FEDERAL... Provisions and Clauses 52.232-10 Payments Under Fixed-Price Architect-Engineer Contracts. As prescribed in 32.111(c)(1), insert the following clause: Payments Under Fixed-Price Architect-Engineer Contracts (APR...
VizieR Online Data Catalog: The CLASS blazar survey. I. (Marcha+, 2001)
Marcha, M. J.; Caccianiga, A.; Browne, I. W. A.; Jackson, N.
2002-04-01
This paper presents a new complete and well-defined sample of flat-spectrum radio sources (FSRS) selected from the Cosmic Lens All-Sky Survey (CLASS), with the further constraint of a bright (mag<=17.5) optical counterpart. The sample has been designed to produce a large number of low-luminosity blazars in order to test the current unifying models in the low-luminosity regime. In this first paper the new sample is presented and the radio properties of the 325 sources contained therein are discussed. (1 data file).
BROADBAND OBSERVATIONS OF HIGH REDSHIFT BLAZARS
Energy Technology Data Exchange (ETDEWEB)
Paliya, Vaidehi S. [Department of Physics and Astronomy, Clemson University, Kinard Lab of Physics, Clemson, SC 29634-0978 (United States); Parker, M. L.; Fabian, A. C. [Institute of Astronomy, Madingley Road, Cambridge CB3 0HA (United Kingdom); Stalin, C. S., E-mail: vpaliya@g.clemson.edu [Indian Institute of Astrophysics, Block II, Koramangala, Bangalore-560034 (India)
2016-07-01
We present a multi-wavelength study of four high redshift blazars, S5 0014+81 ( z = 3.37), CGRaBS J0225+1846 ( z = 2.69), BZQ J1430+4205 ( z = 4.72), and 3FGL J1656.2−3303 ( z = 2.40) using quasi-simultaneous data from the Swift , Nuclear Spectroscopic Telescope Array ( NuSTAR ) and the Fermi -Large Area Telescope (LAT) and also archival XMM-Newton observations. Other than 3FGL J1656.2−3303, none of the sources were known as γ -ray emitters, and our analysis of ∼7.5 yr of LAT data reveals the first time detection of statistically significant γ -ray emission from CGRaBS J0225+1846. We generate the broadband spectral energy distributions (SED) of all the objects, centering at the epoch of NuSTAR observations and reproduce them using a one-zone leptonic emission model. The optical−UV emission in all the objects can be explained by radiation from the accretion disk, whereas the X-ray to γ -ray windows of the SEDs are found to be dominated by inverse Compton scattering off the broad line region photons. All of them host black holes that are billions of solar masses. Comparing the accretion disk luminosity and the jet power of these sources with a large sample of blazars, we find them to occupy a high disk luminosity–jet power regime. We also investigate the X-ray spectral properties of the sources in detail with a major focus on studying the causes of soft X-ray deficit, a feature generally seen in high redshift radio-loud quasars. We summarize that this feature could be explained based on the intrinsic curvature in the jet emission rather than being due to the external effects predicted in earlier studies, such as host galaxy and/or warm absorption.
Yamaguchi, K; Yanagi, H; Shimizu, K; Sakai, M; Nishibata, K; Oida, H; Shinomiya, K; Suzuki, Y; Yonezawa, H; Fujita, T
1997-12-01
4-week repeated dose toxicity study with 4-week recovery test of landiolol hydrochloride (ONO-1101), a novel ultra short acting beta-blocker, was conducted in Sprague-Dawley (SD) rats. ONO-1101 was administered intravenously to rats of both sexes at a dose level of 0 (control), 12.5, 25, 50 or 100 mg/kg/day. In the 100 mg/kg/day group, bradypnea or dyspnea was seen in all animals, pale in ear, eye and foot, tremor, reddish lacrimation and loss of righting reflex were also observed in some animals right after administration, and then those signs disappeared within 1 min after administration. During the treatment period, 3/20 animals of each sex in the 100 mg/kg/day showed clonic convulsion and died within 2 min after administration. No clinical changes were seen in the 50 mg/kg/day group or lower. Histopathological findings showed atrophy of the submaxillary gland in females and vessel-wall thickening and perivascular fibrosis of the injection site (tail) in both sexes at 100 mg/kg/day, however those changes were reversible. ONO-1101 did not effect on body weight, food consumption, ophthalmology, urinalysis, hematology, blood chemistry, organ weights or necropsy at any doses. These results indicate that the no-adverse-effect level of ONO-1101 in rats is 50 mg/kg/day for both sexes in this study.
Prototype of A/Duck/Sukoharjo/Bbvw-1428-9/2012 subtipe H5N1 clade 2.3.2 as vaccine on local duck
Directory of Open Access Journals (Sweden)
Risa Indriani
2014-06-01
Full Text Available A/Duck/Sukoharjo/Bbvw-1428-9/2012 virus subtipe H5N1 clade 2.3.2 as seed vaccine on local duck. AI H5N1 clade 2.3.2 vaccine containing 256 HAU per dose was formulated using adjuvant ISA 71VG Montanide ™. Six groups of one day old local duck were used in this study. Three groups (10 ducks per group were vaccinated and 3 groups (9 duck per group were served control. Vaccination was conducted when the duck were three weeks old of age using single dose. Three weeks after vaccination when the duck were challenged either with HPAI H5N1 clade 2.3.2, or HPAI H5N1 clade 2.1.3 virus at dose 106 EID50/ 0.1 ml by drops intranasaly. Result showed that vaccination produced 100% protection compared to unvaccinated ducks againt HPAI subtipe H5N1 clade 2.3.2, and 100% protection againt HPAI H5N1 clade 2.1.3 (A/ck/wj/Subang-29/2007 and A/ck/wj/Smi-Part/2006, while unvaccinated ducks showed virus shedding on day 3 post infection.
Models for Very Rapid High-Energy γ-Ray Variability in Blazars G. E. ...
Indian Academy of Sciences (India)
blazar PKS 2155−304 and present synthetic light-curves of the kind that ... radio wavelengths led to a similar situation (see Wagner & Witzel 1995 for a review). Some of the ... If the instabilities grow, the two components will eventually mix.
Seismic analysis of safety class 1 incinerator glovebox in building 232-Z 200 W Area
International Nuclear Information System (INIS)
Ocoma, E.C.
1994-09-01
This report documents the seismic evaluation for the existing safety class 1 incinerator glovebox in 232Z Building. The glovebox is no longer in use and most of the internal mechanical equipment have been removed. However, the insulation firebricks are still in the glovebox for proper disposal
VizieR Online Data Catalog: Jet kinematics of blazars at 43GHz with the VLBA (Jorstad+, 2017)
Jorstad, S. G.; Marscher, A. P.; Morozova, D. A.; Troitsky, I. S.; Agudo, I.; Casadio, C.; Foord, A.; Gomez, J. L.; MacDonald, N. R.; Molina, S. N.; Lahteenmaki, A.; Tammi, J.; Tornikoski, M.
2018-04-01
The VLBA-BU-BLAZAR monitoring program consists of approximately monthly observations with the VLBA at 43GHz of a sample of AGNs detected as γ-ray sources. In this paper, we present the results of observations from 2007 June to 2013 January. The sample consists of 21 FSRQs, 12 BLLacs, and 3 radio galaxies (RGs). It includes the blazars and radio galaxies detected at γ-ray energies by EGRET with average flux density at 43GHz exceeding 0.5Jy, declination north of -30°, and optical magnitude in the R band brighter than 18.5. (5 data files).
The WEBT Campaign on the Blazar 3C 279 in 2006
Czech Academy of Sciences Publication Activity Database
Böttcher, M.; Basu, S.; Joshi, M.; Villata, M.; Arai, A.; Aryan, N.; Asfandiyarov, I. M.; Bach, U.; Bachev, R.; Berdyugin, A.; Blažek, Martin; Buemi, C.S.; Castro-Tirado, A.J.; de Ugarte Postigo, A.; Frasca, A.; Fuhrmann, L.; Hagen-Thorn, V.A.; Henson, G.; Hovatta, T.; Hudec, René; Ibrahimov, M.A.; Ishii, Y.; Ivanidze, R.; Jelínek, M.; Kamada, M.; Kapanadze, B.; Katsuura, M.; Kotaka, D.; Kovalev, Y.Y.; Kovalev, Yu.A.; Kubánek, Petr; Kurosaki, M.; Kurtanidze, O.M.; Lähteenmäki, A.; Lanteri, L.; Larionov, V.M.; Larionova, L.; Lee, C.-U.; Leto, P.; Lindfors, E.; Marilli, E.; Marshall, K.; Miller, H.R.; Mingaliev, M.G.; Mirabal, N.; Mizoguchi, S.; Nakamura, K.; Nieppola, E.; Nikolashvili, M.G.; Nilsson, K.; Nishiyama, S.; Ohlert, J.M.; Osterman, M.A.; Pak, S.; Pasanen, M.; Peters, C.S.; Pursimo, T.; Raiteri, C.M.; Robertson, J.; Robertson, T.; Ryle, W.T.; Sadakane, K.; Sadun, A.C.; Sigua, L.A.; Sohn, B.-W.; Strigachev, A.; Sumitomo, N.; Takalo, L.O.; Tamesue, Y.; Tanaka, K.; Thorstensen, J.R.; Tosti, G.; Trigilio, C.; Umana, G.; Vennes, S.; Vítek, S.; Volvach, A.; Webb, J.; Yamanaka, M.; Yim, S.-H.
2007-01-01
Roč. 670, č. 2 (2007), s. 968-977 ISSN 0004-637X Grant - others:EU(XE) ESA-PECS project No. 98023 Institutional research plan: CEZ:AV0Z10030501 Source of funding: V - iné verejné zdroje Keywords : blazars * active galactic nuclei Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 6.405, year: 2007
46 CFR 232.4 - Balance sheet accounts.
2010-10-01
... 46 Shipping 8 2010-10-01 2010-10-01 false Balance sheet accounts. 232.4 Section 232.4 Shipping... ACTIVITIES UNIFORM FINANCIAL REPORTING REQUIREMENTS Balance Sheet § 232.4 Balance sheet accounts. (a.... (b) Purpose of balance sheet accounts. The balance sheet accounts are intended to disclose the...
Energy Technology Data Exchange (ETDEWEB)
Broderick, Avery E; Chang, Philip; Pfrommer, Christoph [Canadian Institute for Theoretical Astrophysics, 60 St. George Street, Toronto, ON M5S 3H8 (Canada)
2012-06-10
Inverse Compton cascades (ICCs) initiated by energetic gamma rays (E {approx}> 100 GeV) enhance the GeV emission from bright, extragalactic TeV sources. The absence of this emission from bright TeV blazars has been used to constrain the intergalactic magnetic field (IGMF), and the stringent limits placed on the unresolved extragalactic gamma-ray background (EGRB) by Fermi have been used to argue against a large number of such objects at high redshifts. However, these are predicated on the assumption that inverse Compton scattering is the primary energy-loss mechanism for the ultrarelativistic pairs produced by the annihilation of the energetic gamma rays on extragalactic background light photons. Here, we show that for sufficiently bright TeV sources (isotropic-equivalent luminosities {approx}> 10{sup 42} erg s{sup -1}) plasma beam instabilities, specifically the 'oblique' instability, present a plausible mechanism by which the energy of these pairs can be dissipated locally, heating the intergalactic medium. Since these instabilities typically grow on timescales short in comparison to the inverse Compton cooling rate, they necessarily suppress the ICCs. As a consequence, this places a severe constraint on efforts to limit the IGMF from the lack of a discernible GeV bump in TeV sources. Similarly, it considerably weakens the Fermi limits on the evolution of blazar populations. Specifically, we construct a TeV-blazar luminosity function from those objects currently observed and find that it is very well described by the quasar luminosity function at z {approx} 0.1, shifted to lower luminosities and number densities, suggesting that both classes of sources are regulated by similar processes. Extending this relationship to higher redshifts, we show that the magnitude and shape of the EGRB above {approx}10 GeV are naturally reproduced with this particular example of a rapidly evolving TeV-blazar luminosity function.
Simultaneous optical and infrared polarization measurements of blazars
International Nuclear Information System (INIS)
Brindle, C.; Hough, J.H.; Bailey, J.A.; Axon, D.J.; Hyland, A.R.
1986-01-01
Measurements are presented of the polarization and flux of a sample of 28 blazars (21 BL Lacs and 7 OVV quasars) at optical and near-infrared wavelengths, with repeated observations for some objects. For 20 objects, these are the first reported polarization measurements in either the optical or infrared, and for most of them the first simultaneous measurements at these wavelengths. Out of a total of 42 observations a spectral dependence of polarization level and position angle is found, although not necessarily occurring together, on 15 occasions. (author)
2010-07-01
... TERMS OF CONSUMER CREDIT EXTENDED TO SERVICE MEMBERS AND DEPENDENTS § 232.7 Preemption. (a) Inconsistent..., including any State usury law, to the extent such law, rule or regulation is inconsistent with this part...) Different treatment under State law of covered borrowers is prohibited. States may not: (1) Authorize...
Through the Ring of Fire: A Study of the Origin of Orphan Gamma-ray Flares in Blazars
MacDonald, Nicholas R.; Marscher, Alan P.; Jorstad, Svetlana G.; Joshi, Manasvita
2014-06-01
Blazars exhibit flares across the electromagnetic spectrum. Many gamma-ray flares are highly correlated with flares detected at optical wavelengths; however, a small subset appear to occur in isolation, with no counterpart in the other wave bands. These "orphan" gamma-ray flares challenge current models of blazar variability, most of which are unable to reproduce this type of behavior. We present numerical calculations of the time variable emission of a blazar based on a proposal by Marscher et al. (2010) to explain such events. In this model, a plasmoid ("blob") consisting of a power-law distribution of electrons propagates relativistically along the spine of a blazar jet and passes through a synchrotron emitting ring of electrons representing a shocked portion of the jet sheath. This ring supplies a source of seed photons that are inverse-Compton scattered by the electrons in the moving blob. As the blob approaches the ring, the photon density in the co-moving frame of the plasma increases, resulting in an orphan gamma-ray flare that then dissipates as the blob passes through and then moves away from the ring. The model includes the effects of radiative cooling and a spatially varying magnetic field. Support for the plausibility of this model is provided by observations by Marscher et al.(2010) of an isolated gamma-ray flare that was correlated with the passage of a superluminal knot through the inner jet of quasar PKS 1510-089. Synthetic light-curves produced by this new model are compared to the observed light-curves from this event. In addition, we present polarimetric observations that point to the existence of a jet sheath in the quasar 3C 273. A rough estimate of the bolometric luminosity of the sheath results in a value of ~10^45 erg s^-1 10% of the jet luminosity). This inferred sheath luminosity indicates that the jet sheath in 3C 273 can provide a significant source of seed photons that need to be taken into account when modeling the non
International Nuclear Information System (INIS)
Cheng Yong; Zhang Xiong; Wu Lin; Mao Weiming; You Lisha
2006-01-01
The authors collect 119 γ-ray-loud Blazar (97 flat spectrum radio quasars (FSRQs) and 22 BL Lacertae objects (BL Lac)), and investigate respectively the correlation between the γ-ray emission (maximum, minimum, and average data) at 1 GeV and the radio emission at 8.4 GHz by discrete correlation function (DCF) method. Our main results are as follows: there is good correlation between the γ-ray in high state and average state and radio emissions for the whole 119 Blazar and 97 FSRQs. And there are no correlation between γ-ray emission and radio emission in low state. Our result shows that the γ-rays are associated with the radio emission from the jet, and that the γ-ray emission is likely to have come from the synchrotron self-compton model (SSC) process in this case. (authors)
FACT — LONGTERM MONITORING OF BRIGHT TeV BLAZARS
Directory of Open Access Journals (Sweden)
Katja Meier
2014-06-01
Full Text Available The First G-APD Cherenkov Telescope (FACT, located on the Canary Island of La Palma, has been taking data since October 2011. FACT has been optimized for longterm monitoring of bright TeV blazars, to study their variability time scales and flare probability. G-APD photo-sensors allow for observations even under strong moonlight conditions, and the telescope can be operated remotely. The monitoring strategy of FACT is discussed and preliminary results of the flare of Mrk501 in June 2012 are shown.
Multiwavelength Study of Gamma-Ray Bright Blazars
Morozova, Daria; Larionov, V. M.; Hagen-Thorn, V. A.; Jorstad, S. G.; Marscher, A. P.; Troitskii, I. S.
2011-01-01
We investigate total intensity radio images of 6 gamma-ray bright blazars (BL Lac, 3C 279, 3C 273, W Com, PKS 1510-089, and 3C 66A) and their optical and gamma-ray light curves to study connections between gamma-ray and optical brightness variations and changes in the parsec-scale radio structure. We use high-resolution maps obtained by the BU group at 43 GHz with the VLBA, optical light curves constructed by the St.Petersburg State U. (Russia) team using measurements with the 0.4 m telescope of St.Petersburg State U. (LX200) and the 0.7 m telescope of the Crimean Astrophysical Observatory (AZT-8), and gamma-ray light curves, which we have constructed with data provided by the Fermi Large Area Telescope. Over the period from August 2008 to November 2009, superluminal motion is found in all 6 objects with apparent speed ranging from 2c to 40c. The blazars with faster apparent speeds, 3C 273, 3C 279, PKS 1510-089, and 3C 66A, exhibit stronger variability of the gamma-ray emission. There is a tendency for sources with sharply peaked gamma-ray flares to have faster jet speed than sources with gamma-ray light curves with no sharp peaks. Gamma-ray light curves with sharply peaked gamma-ray flares possess a stronger gamma-ray/optical correlations. The research at St.Petersburg State U. was funded by the Minister of Education and Science of the Russian Federation (state contract N#P123). The research at BU was funded in part by NASA Fermi Guest Investigator grant NNX08AV65G and by NSF grant AST-0907893. The VLBA is an instrument of the National Radio Astronomy Observatory, a facility of the National Science Foundation operated under cooperative agreement by Associated Universities, Inc.
48 CFR 53.232 - Contract financing (SF 1443).
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Contract financing (SF 1443). 53.232 Section 53.232 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION (CONTINUED) CLAUSES AND FORMS FORMS Prescription of Forms 53.232 Contract financing (SF 1443). SF 1443 (JUL...
46 CFR 232.6 - Financial report filing requirement.
2010-10-01
... RELATED ACTIVITIES UNIFORM FINANCIAL REPORTING REQUIREMENTS Income Statement § 232.6 Financial report filing requirement. (a) Reporting Frequency and Due Dates. The contractor shall file a semiannual... 46 Shipping 8 2010-10-01 2010-10-01 false Financial report filing requirement. 232.6 Section 232.6...
43 CFR 17.232 - Postsecondary education.
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Postsecondary education. 17.232 Section 17... Postsecondary education. This section applies to postsecondary education and activities, including postsecondary vocational education programs or activities, that receive Federal financial assistance and to recipients that...
Multi-waveband Behavior of Blazars
Directory of Open Access Journals (Sweden)
Marscher Alan P.
2013-12-01
Full Text Available The author reviews recent progress toward understanding blazars that multi-waveband monitoring observations have advanced. The primary techniques include the compilation of multi-waveband light curves, multi-epoch VLBI images at radio wavelengths, plots of linear polarization vs. time at radio through optical wavelengths, and spectral energy distributions (SEDs. Correlations and the coincidence or lag of events across wavebands and in the images indicate where the events take place relative to the “core” that lies ≳ 0.5 pc from the central engine. Rotations of the polarization electric vector suggest a helical geometry of the magnetic field upstream of the millimeter-wave core, while rapid fluctuations in degree and position angle of polarization imply that the jet plasma is turbulent in and downstream of the core. The author is developing a numerical model that simulates the emission from such turbulence as it interacts with a conical standing shock in the core region.
A Diagnostic Test for Determining the Location of the GeV Emission in Powerful Blazars
Dotson, Amanda; Georganopoulos, Markos; Kazanas, Demosthenes; Perlman, Eric
2011-01-01
An issue currently under debate in the literature is how far from the black hole is the Fermi-observed GeV emission of powerful blazars emitted. Here we present a clear diagnostic tool for testing whether the Ge V emission site is located within the sub-pc broad emission line (BLR) region or further out in the few pc scale molecular torus (MT) environment. Within the BLR the scatteri takes place at the onset of the Klein-Nishina regime, causing the electron cooling time to become almost energy independent and as a result, the variation of high-energy emission is expected to be achromatic. Contrarily, if the emission site is located outside the BLR, the expected GeY variability is energy-dependent and with amplitude increasing with energy. We demonstrate this using time-dependent numerical simulations of blazar variability.
24 CFR 232.885 - Insurance benefits.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance benefits. 232.885 Section 232.885 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued....885 Insurance benefits. (a) Method of payment. Payment of claim shall be made in the following manner...
20 CFR 410.232 - Withdrawal of a claim.
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Withdrawal of a claim. 410.232 Section 410.232 Employees' Benefits SOCIAL SECURITY ADMINISTRATION FEDERAL COAL MINE HEALTH AND SAFETY ACT OF 1969... Claims and Evidence § 410.232 Withdrawal of a claim. (a) Before adjudication of claim. A claimant (or an...
24 CFR 232.805 - Insurance premiums.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance premiums. 232.805 Section... FACILITIES Contract Rights and Obligations Premiums § 232.805 Insurance premiums. (a) First premium. The... insurance premium equal to one percent of the original face amount of the note. (b) Second premium. The...
49 CFR 232.305 - Single car air brake tests.
2010-10-01
... from a train or when placed on a shop or repair track, as defined in § 232.303(a); (2) A car is on a shop or repair track, as defined in § 232.303(a), for any reason and has not received a single car air... 49 Transportation 4 2010-10-01 2010-10-01 false Single car air brake tests. 232.305 Section 232...
3 mm GMVA Observations of Total and Polarized Emission from Blazar and Radio Galaxy Core Regions
Directory of Open Access Journals (Sweden)
Carolina Casadio
2017-10-01
Full Text Available We present total and linearly polarized 3 mm Global mm-VLBI Array (GMVA; mm-VLBI: Very Long Baseline Interferometry observations at millimetre wavelengths images of a sample of blazars and radio galaxies from the VLBA-BU-BLAZAR 7 mm monitoring program designed to probe the innermost regions of active galactic nuclei (AGN jets and locate the sites of gamma-ray emission observed by the Fermi-LAT. The lower opacity at 3 mm and improved angular resolution—on the order of 50 microarcseconds—allow us to distinguish features in the jet not visible in the 7 mm VLBA data. We also compare two different methods used for the calibration of instrumental polarisation and we analyze the resulting images for some of the sources in the sample.
Czech Academy of Sciences Publication Activity Database
Pian, E.; Ubertini, P.; Bazzano, A.; Beckmann, V.; Eckert, D.; Ghisellini, G.; Pursimo, T.; Tagliaferri, G.; Tavecchio, F.; Türler, M.; Bianchi, S.; Bianchin, V.; Hudec, René; Maraschi, L.; Raiteri, C.M.; Soldi, S.; Treves, A.; Villata, M.
2011-01-01
Roč. 526, February (2011), A125/1-A125/7 ISSN 0004-6361 Grant - others:ESA(XE) ESA PECS project No.98023; GA ČR(CZ) ga102/09/0997 Institutional research plan: CEZ:AV0Z10030501 Keywords : active galaxies * blazar PKS 1502+106 Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.587, year: 2011
Testing the Equivalence Principle and Lorentz Invariance with PeV Neutrinos from Blazar Flares.
Wang, Zi-Yi; Liu, Ruo-Yu; Wang, Xiang-Yu
2016-04-15
It was recently proposed that a giant flare of the blazar PKS B1424-418 at redshift z=1.522 is in association with a PeV-energy neutrino event detected by IceCube. Based on this association we here suggest that the flight time difference between the PeV neutrino and gamma-ray photons from blazar flares can be used to constrain the violations of equivalence principle and the Lorentz invariance for neutrinos. From the calculated Shapiro delay due to clusters or superclusters in the nearby universe, we find that violation of the equivalence principle for neutrinos and photons is constrained to an accuracy of at least 10^{-5}, which is 2 orders of magnitude tighter than the constraint placed by MeV neutrinos from supernova 1987A. Lorentz invariance violation (LIV) arises in various quantum-gravity theories, which predicts an energy-dependent velocity of propagation in vacuum for particles. We find that the association of the PeV neutrino with the gamma-ray outburst set limits on the energy scale of possible LIV to >0.01E_{pl} for linear LIV models and >6×10^{-8}E_{pl} for quadratic order LIV models, where E_{pl} is the Planck energy scale. These are the most stringent constraints on neutrino LIV for subluminal neutrinos.
History of 232-F, tritium extraction processing
International Nuclear Information System (INIS)
Blackburn, G.W.
1994-08-01
In 1950 the Atomic Energy Commission authorized the Savannah River Project principally for the production of tritium and plutonium-239 for use in thermonuclear weapons. 232-F was built as an interim facility in 1953--1954, at a cost of $3.9M. Tritium extraction operations began in October, 1955, after the reactor and separations startups. In July, 1957 a larger tritium facility began operation in 232-H. In 1958 the capacity of 232-H was doubled. Also, in 1957 a new task was assigned to Savannah River, the loading of tritium into reservoirs that would be actual components of thermonuclear weapons. This report describes the history of 232-F, the process for tritium extraction, and the lessons learned over the years that were eventually incorporated into the new Replacement Tritium Facility
Detection of the cosmic γ-ray horizon from multiwavelength observations of blazars
Energy Technology Data Exchange (ETDEWEB)
Dominguez, A. [Univ. of California, Riverside, CA (United States); Finke, J. D. [U.S. Naval Research Lab., Washington, DC (United States); Prada, F. [Campus of International Excellence UAM_CSIC, Madrid (Spain); Universidad Autonoma de Madrid (Spain); Instituto de Astrofisica de Andalucia, Granada (Spain); Primack, J. R. [Univ. of California, Santa Cruz, CA (United States); Kitaura, F. S. [Leibniz-Institut fuer Astrophysik, Potsdam (Germany); Siana, B. [Univ. Of California, Riverside, CA (United States); Paneque, D. [Stanford Univ., Stanford, CA (United States). Kavli Inst. sor Particle Astrophysics and Cosmology; Max-Planck-Institut fuer Physik, Munich (Germany)
2013-05-24
The first statistically significant detection of the cosmic γ-ray horizon (CGRH) that is independent of any extragalactic background light (EBL) model is presented. The CGRH is a fundamental quantity in cosmology. It gives an estimate of the opacity of the Universe to very high energy (VHE) γ-ray photons due to photon-photon pair production with the EBL. The only estimations of the CGRH to date are predictions from EBL models and lower limits from γ-ray observations of cosmological blazars and γ-ray bursts. Here, we present homogeneous synchrotron/synchrotron self-Compton (SSC) models of the spectral energy distributions of 15 blazars based on (almost) simultaneous observations from radio up to the highest energy γ-rays taken with the Fermi satellite. These synchrotron/SSC models predict the unattenuated VHE fluxes, which are compared with the observations by imaging atmospheric Cherenkov telescopes. The comparison provides an estimate of the optical depth of the EBL, which allows a derivation of the CGRH through a maximum likelihood analysis that is EBL-model independent. We find that the observed CGRH is compatible with the current knowledge of the EBL.
Bovenhuis, H.; Visker, M.H.P.W.; Poulsen, N.A.; Sehested, J.; Valenberg, van H.J.F.; Arendonk, van J.A.M.; Larsen, L.B.; Buitenhuis, A.J.
2016-01-01
Several studies have described associations between the diacylglycerol o-acyltransferase 1 (DGAT1) K232A polymorphism and routinely collected milk production traits but not much is known about effects of the DGAT1 polymorphism on detailed milk composition. The aim of this study was to estimate
48 CFR 232.102 - Description of contract financing methods.
2010-10-01
... financing methods. 232.102 Section 232.102 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 232.102 Description of contract financing methods. (e)(2) Progress payments...
230,232Th in milk, meat, and grain in Korea
International Nuclear Information System (INIS)
Lin, Xiujing; Choi, Minseok; Kim, Wan; Kang, Heedong; Doh, Sihhong; Kim, Dosung; Kim, Changkyu
2004-01-01
The concentrations of natural radioisotopes 230 Th and 232 Th in Korean foods were measured by the method of calcium oxalate co-precipitation in addition to the conventional anion-exchange method and alpha spectroscopic measurement. The 230 Th concentrations (mBq/kg-fresh) in Korean foods were found to be as follows: milk 0.14-2.45, pork 2.98-8.97, beef 1.94-9.80, chicken 1.22-13.0, rice 0.43-2.35, wheat 0.53-14.4, and soybeans, 8.44-91.6. The 232 Th concentrations (mBq/kg-fresh) in Korean foods were found to be as follows: milk 0.01-2.46, pork 0.28-9.32, beef 1.02-5.34, chicken 0.56-4.98, rice 0.32-2.54, wheat 0.53-20.0, and soybeans, 2.30-42.2. The annual internal dose of Th was also estimated. The annual internal dose of 230 Th and 232 Th in milk was about 0.006 μSv/yr and much lower than that of other countries because of the low intake of milk in Korea compared to other countries. The annual internal dose of 230 Th and 232 Th in the rice was about 0.043 μSv/yr and highest because rice is the staple food of Koreans. (author)
Uptake and distribution of 232U in peas and barley
International Nuclear Information System (INIS)
Schreckhise, R.G.; Cline, J.F.
1980-01-01
The uptake of 232 U from soil and its distribution in peas and barley were examined under conditions which isolated root uptake from deposition on aboveground plant parts. Aboveground plant parts were harvested at maturity and analyzed for 232 U content by alpha-energy-analysis. The ratio of concentration (CR) of 232 U in the dry barley seeds to dry soil was 1.6 x 10 -4 while the CR values of the stem/leaf to dry soil fraction was 3.6 x 10 -3 . The Cr values for the pea seed, stem/pod and leaf components were 5.4 x 10 -4 , 3.3 x 10 -3 and 1.7 x 10 -2 , respectively. This indicates that the CR values used in certain radiological dose-assessment models may be high by about a factor of 100 when evaluating the consumption of seeds of legumes or cereal grains by man. (author)
48 CFR 232.202-4 - Security for Government financing.
2010-10-01
... financing. 232.202-4 Section 232.202-4 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Commercial Item Purchase Financing 232.202-4 Security for Government financing. (a)(2) When determining whether an offeror...
17 CFR 232.306 - Foreign language documents and symbols.
2010-04-01
... symbols. 232.306 Section 232.306 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... § 232.306 Foreign language documents and symbols. (a) All electronic filings and submissions must be in... words or letters in the English language rather than representative symbols, except that HTML documents...
48 CFR 2452.232-71 - Voucher submission (cost-reimbursement).
2010-10-01
...-reimbursement). 2452.232-71 Section 2452.232-71 Federal Acquisition Regulations System DEPARTMENT OF HOUSING AND... Clauses 2452.232-71 Voucher submission (cost-reimbursement). As prescribed in 2432.908(c)(2), insert a clause substantially the same as the following in all cost-reimbursement solicitations and contracts...
Energy Technology Data Exchange (ETDEWEB)
Chang, Philip; Broderick, Avery E; Pfrommer, Christoph [Canadian Institute for Theoretical Astrophysics, 60 St. George Street, Toronto, ON M5S 3H8 (Canada)
2012-06-10
The universe is opaque to extragalactic very high energy gamma rays (VHEGRs, E > 100 GeV) because they annihilate and pair produce on the extragalactic background light. The resulting ultrarelativistic pairs are commonly assumed to lose energy primarily through inverse Compton scattering of cosmic microwave background (CMB) photons, reprocessing the original emission from TeV to GeV energies. In Broderick et al., we argued that this is not the case; powerful plasma instabilities driven by the highly anisotropic nature of the ultrarelativistic pair distribution provide a plausible way to dissipate the kinetic energy of the TeV-generated pairs locally, heating the intergalactic medium (IGM). Here, we explore the effect of this heating on the thermal history of the IGM. We collate the observed extragalactic VHEGR sources to determine a local VHEGR heating rate. Given the pointed nature of VHEGR observations, we estimate the correction for the various selection effects using Fermi observations of high- and intermediate-peaked BL Lac objects. As the extragalactic component of the local VHEGR flux is dominated by TeV blazars, we then estimate the evolution of the TeV blazar luminosity density by tying it to the well-observed quasar luminosity density and producing a VHEGR heating rate as a function of redshift. This heating is relatively homogeneous for z {approx}< 4, but there is greater spatial variation at higher redshift (order unity at z {approx} 6) because of the reduced number of blazars that contribute to local heating. We show that this new heating process dominates photoheating in the low-redshift evolution of the IGM and calculate the effect of this heating in a one-zone model. As a consequence, the inclusion of TeV blazar heating qualitatively and quantitatively changes the structure and history of the IGM. Due to the homogeneous nature of the extragalactic background light, TeV blazars produce a uniform volumetric heating rate. This heating is sufficient to
International Nuclear Information System (INIS)
Chang, Philip; Broderick, Avery E.; Pfrommer, Christoph
2012-01-01
The universe is opaque to extragalactic very high energy gamma rays (VHEGRs, E > 100 GeV) because they annihilate and pair produce on the extragalactic background light. The resulting ultrarelativistic pairs are commonly assumed to lose energy primarily through inverse Compton scattering of cosmic microwave background (CMB) photons, reprocessing the original emission from TeV to GeV energies. In Broderick et al., we argued that this is not the case; powerful plasma instabilities driven by the highly anisotropic nature of the ultrarelativistic pair distribution provide a plausible way to dissipate the kinetic energy of the TeV-generated pairs locally, heating the intergalactic medium (IGM). Here, we explore the effect of this heating on the thermal history of the IGM. We collate the observed extragalactic VHEGR sources to determine a local VHEGR heating rate. Given the pointed nature of VHEGR observations, we estimate the correction for the various selection effects using Fermi observations of high- and intermediate-peaked BL Lac objects. As the extragalactic component of the local VHEGR flux is dominated by TeV blazars, we then estimate the evolution of the TeV blazar luminosity density by tying it to the well-observed quasar luminosity density and producing a VHEGR heating rate as a function of redshift. This heating is relatively homogeneous for z ∼< 4, but there is greater spatial variation at higher redshift (order unity at z ∼ 6) because of the reduced number of blazars that contribute to local heating. We show that this new heating process dominates photoheating in the low-redshift evolution of the IGM and calculate the effect of this heating in a one-zone model. As a consequence, the inclusion of TeV blazar heating qualitatively and quantitatively changes the structure and history of the IGM. Due to the homogeneous nature of the extragalactic background light, TeV blazars produce a uniform volumetric heating rate. This heating is sufficient to increase
Study of the sensitivity of integral parameters related to 232 Thorium cross sections
International Nuclear Information System (INIS)
Guimaraes, L.N.F.; Menezes, A.
1986-01-01
The THOR critical assembly is used to test 232 Th basic nuclear data from ENDL-78, ENDF/B-IV, INDL-83, JENDL-1 and JENDL-2. The FORSS and UNISENS systems are used to calculate integral parameters and sensitivity profiles. The results show that 232 Th from JENDL-2 is superior to the others, with ENDL-78 showing the worst performance. The discrepancies can be credited to the different evaluations for the 232 Thorium scattering cross section. (Author) [pt
17 CFR 232.308 - Type size and font; legibility.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Type size and font; legibility. 232.308 Section 232.308 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... § 232.308 Type size and font; legibility. Provisions relating to type size, font and other legibility...
The WEBT Campaign on the Blazar 3C 279 in 2006
Böttcher, M.; Basu, S.; Joshi, M.; Villata, M.; Arai, A.; Aryan, N.; Asfandiyarov, I. M.; Bach, U.; Bachev, R.; Berduygin, A.; Blaek, M.; Buemi, C.; Castro-Tirado, A. J.; De Ugarte Postigo, A.; Frasca, A.; Fuhrmann, L.; Hagen-Thorn, V. A.; Henson, G.; Hovatta, T.; Hudec, R.; Ibrahimov, M.; Ishii, Y.; Ivanidze, R.; Jelínek, M.; Kamada, M.; Kapanadze, B.; Katsuura, M.; Kotaka, D.; Kovalev, Y. Y.; Kovalev, Yu. A.; Kubánek, P.; Kurosaki, M.; Kurtanidze, O.; Lähteenmäki, A.; Lanteri, L.; Larionov, V. M.; Larionova, L.; Lee, C.-U.; Leto, P.; Lindfors, E.; Marilli, E.; Marshall, K.; Miller, H. R.; Mingaliev, M. G.; Mirabal, N.; Mizoguchi, S.; Nakamura, K.; Nieppola, E.; Nikolashvili, M.; Nilsson, K.; Nishiyama, S.; Ohlert, J.; Osterman, M. A.; Pak, S.; Pasanen, M.; Peters, C. S.; Pursimo, T.; Raiteri, C. M.; Robertson, J.; Robertson, T.; Ryle, W. T.; Sadakane, K.; Sadun, A.; Sigua, L.; Sohn, B.-W.; Strigachev, A.; Sumitomo, N.; Takalo, L. O.; Tamesue, Y.; Tanaka, K.; Thorstensen, J. R.; Tosti, G.; Trigilio, C.; Umana, G.; Vennes, S.; Vitek, S.; Volvach, A.; Webb, J.; Yamanaka, M.; Yim, H.-S.
2007-12-01
The quasar 3C 279 was the target of an extensive multiwavelength monitoring campaign from 2006 January through April. An optical-IR-radio monitoring campaign by the Whole Earth Blazar Telescope (WEBT) collaboration was organized around target-of-opportunity X-ray and soft γ-ray observations with Chandra and INTEGRAL in 2006 mid-January, with additional X-ray coverage by RXTE and Swift XRT. In this paper we focus on the results of the WEBT campaign. The source exhibited substantial variability of optical flux and spectral shape, with a characteristic timescale of a few days. The variability patterns throughout the optical BVRI bands were very closely correlated with each other, while there was no obvious correlation between the optical and radio variability. After the ToO trigger, the optical flux underwent a remarkably clean quasi-exponential decay by about 1 mag, with a decay timescale of τd~12.8 days. In intriguing contrast to other (in particular, BL Lac type) blazars, we find a lag of shorter wavelength behind longer wavelength variability throughout the RVB wavelength ranges, with a time delay increasing with increasing frequency. Spectral hardening during flares appears delayed with respect to a rising optical flux. This, in combination with the very steep IR-optical continuum spectral index of α0~1.5-2.0, may indicate a highly oblique magnetic field configuration near the base of the jet, leading to inefficient particle acceleration and a very steep electron injection spectrum. An alternative explanation through a slow (timescale of several days) acceleration mechanism would require an unusually low magnetic field of B<~0.2 G, about an order of magnitude lower than inferred from previous analyses of simultaneous SEDs of 3C 279 and other flat-spectrum radio quasars with similar properties. For questions regarding the availability of the data from the WEBT campaign presented in this paper, please contact the WEBT President Massimo Villata at villata@oato.inaf.it.
International Nuclear Information System (INIS)
Ammerich, Marc; Frot, Patricia; Gambini, Denis-Jean; Gauron, Christine; Moureaux, Patrick; Herbelet, Gilbert; Lahaye, Thierry; Pihet, Pascal; Rannou, Alain; Vial, Eric
2013-12-01
This sheet belongs to a collection which relates to the use of radionuclides essentially in unsealed sources. Its goal is to gather on a single document the most relevant information as well as the best prevention practices to be implemented. These sheets are made for the persons in charge of radiation protection: users, radioprotection-skill persons, labor physicians. Each sheet treats of: 1 - the radio-physical and biological properties; 2 - the main uses; 3 - the dosimetric parameters; 4 - the measurement; 5 - the protection means; 6 - the areas delimitation and monitoring; 7 - the personnel classification, training and monitoring; 8 - the effluents and wastes; 9 - the authorization and declaration administrative procedures; 10 - the transport; and 11 - the right conduct to adopt in case of incident or accident. This sheet deals specifically with Thorium-232
The Ringo2 Optical Polarisation Catalogue of 13 High-Energy Blazars
Barres de Almeida, Ulisses; Jermak, Helen; Mundell, Carole; Lindfors, Elina; Nilsson, Kari; Steele, Iain
2015-08-01
We present the findings of the Ringo2 3-year survey of 13 blazars (3 FSRQs and 10 BL Lacs) with regular coverage and reasonably fast cadence of one to three observations a week. Ringo2 was installed on the Liverpool Robotic Telescope (LT) on the Canary Island of La Palma between 2009 and 2012 and monitored thirteen high-energy-emitting blazars in the northern sky. The objects selected as well as the observational strategy were tuned to maximise the synergies with high-energy X- to gamma-ray observations. Therefore this sample stands out as a well-sampled, long-term view of high-energy AGN jets in polarised optical light. Over half of the sources exhibited an increase in optical flux during this period and almost a quarter were observed in outburst. We compare the optical data to gamma (Fermi/LAT) and X-ray data during these periods of outburst. In this talk we present the data obtained for all sources over the lifetime of Ringo2 with additional optical data from the KVA telescope and the SkyCamZ wide-field camera (on the LT), we explore the relationship between the change in polarisation angle as a function of time (dEVPA/dMJD), flux and polarisation degree along with cross correlation comparisons of optical and high-energy flux.
Structure of HLA-A*1101 in complex with a hepatitis B peptide homologue
DEFF Research Database (Denmark)
Blicher, Thomas; Kastrup, Jette Sandholm; Pedersen, Lars Østergaard
2006-01-01
A high-resolution structure of the human MHC-I molecule HLA-A*1101 is presented in which it forms a complex with a sequence homologue of a peptide that occurs naturally in hepatitis B virus DNA polymerase. The sequence of the bound peptide is AIMPARFYPK, while that of the corresponding natural...
Blazar Variability from Turbulence in Jets Launched by Magnetically Arrested Accretion Flows
International Nuclear Information System (INIS)
Riordan, Michael O’; Pe’er, Asaf; McKinney, Jonathan C.
2017-01-01
Blazars show variability on timescales ranging from minutes to years, the former being comparable to and in some cases even shorter than the light-crossing time of the central black hole. The observed γ -ray light curves can be described by a power-law power density spectrum (PDS), with a similar index for both BL Lacs and flat-spectrum radio quasars. We show that this variability can be produced by turbulence in relativistic jets launched by magnetically arrested accretion flows (MADs). We perform radiative transport calculations on the turbulent, highly magnetized jet launching region of a MAD with a rapidly rotating supermassive black hole. The resulting synchrotron and synchrotron self-Compton emission, originating from close to the black hole horizon, is highly variable. This variability is characterized by PDS, which is remarkably similar to the observed power-law spectrum at frequencies less than a few per day. Furthermore, turbulence in the jet launching region naturally produces fluctuations in the plasma on scales much smaller than the horizon radius. We speculate that similar turbulent processes, operating in the jet at large radii (and therefore a high bulk Lorentz factor), are responsible for blazar variability over many decades in frequency, including on minute timescales.
Blazar Variability from Turbulence in Jets Launched by Magnetically Arrested Accretion Flows
Energy Technology Data Exchange (ETDEWEB)
Riordan, Michael O’; Pe’er, Asaf [Physics Department, University College Cork, Cork (Ireland); McKinney, Jonathan C., E-mail: michael_oriordan@umail.ucc.ie [Department of Physics and Joint Space-Science Institute, University of Maryland, College Park, MD 20742 (United States)
2017-07-10
Blazars show variability on timescales ranging from minutes to years, the former being comparable to and in some cases even shorter than the light-crossing time of the central black hole. The observed γ -ray light curves can be described by a power-law power density spectrum (PDS), with a similar index for both BL Lacs and flat-spectrum radio quasars. We show that this variability can be produced by turbulence in relativistic jets launched by magnetically arrested accretion flows (MADs). We perform radiative transport calculations on the turbulent, highly magnetized jet launching region of a MAD with a rapidly rotating supermassive black hole. The resulting synchrotron and synchrotron self-Compton emission, originating from close to the black hole horizon, is highly variable. This variability is characterized by PDS, which is remarkably similar to the observed power-law spectrum at frequencies less than a few per day. Furthermore, turbulence in the jet launching region naturally produces fluctuations in the plasma on scales much smaller than the horizon radius. We speculate that similar turbulent processes, operating in the jet at large radii (and therefore a high bulk Lorentz factor), are responsible for blazar variability over many decades in frequency, including on minute timescales.
48 CFR 232.501-3 - Contract price.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Contract price. 232.501-3... 232.501-3 Contract price. (b) The contracting officer may approve progress payments when the contract price exceeds the funds obligated under the contract, provided the contract limits the Government's...
Measurement of the blazar Mrk421 flux above 60 GeV with the CELESTE experiment
International Nuclear Information System (INIS)
Le Gallou, R.
2001-11-01
The CELESTE experiment is based on an ancient solar plant that has been turned into a detector able to detect the particle showers triggered by the interactions of high energy cosmic photons with the earth atmosphere nuclei. The purpose of the CELESTE experiment is to study the emissions of photons by cosmic objects like supernovae remnants, pulsars or active cores of galaxies such as blazars. Blazars are very interesting objects to study because they allow us to investigate matter that is in extreme conditions and to probe a very far past. The aim of this work has been to develop methods for the analysis of the data collected by CELESTE and to validate them. A specific effort has been achieved for the selection of efficient hadronic rejection criteria in order to optimize the sensitivity of the detector. The physics of the detector is detailed from the particle showers to the data analysis. The detector acceptance has been assessed through Monte-Carlo simulations that have been shown that the detection threshold is 30 GeV at the triggering point and 60 GeV after the analysis cuts. The validation tests have been performed on the Crab nebula that is a standard in gamma astronomy for its stability and intensity. CELESTE has been operating since November 1999 in a satisfactory way and has accumulated data on 4 blazars among them Mrk421. Several bursts have been detected on Mrk421 and an average photon flux has been determined. A correlation has been deduced from the activity detected by CELESTE and the activities in the TeV and X ranges which agrees with the simulations
Hints of an axion-like particle mixing in the GeV gamma-ray blazar data?
Energy Technology Data Exchange (ETDEWEB)
Mena, Olga [IFIC, Universidad de Valencia-CSIC, E-46071, Valencia (Spain); Razzaque, Soebur, E-mail: omena@ific.uv.es, E-mail: srazzaque@uj.ac.za [Department of Physics, University of Johannesburg, PO Box 524, Auckland Park 2006 (South Africa)
2013-11-01
Axion-Like Particles (ALPs), if exist in nature, are expected to mix with photons in the presence of an external magnetic field. The energy range of photons which undergo strong mixing with ALPs depends on the ALP mass, on its coupling with photons as well as on the external magnetic field and particle density configurations. Recent observations of blazars by the Fermi Gamma-Ray Space Telescope in the 0.1–300 GeV energy range show a break in their spectra in the 1–10 GeV range. We have modeled this spectral feature for the flat-spectrum radio quasar 3C454.3 during its November 2010 outburst, assuming that a significant fraction of the gamma rays convert to ALPs in the large scale jet of this blazar. Using theoretically motivated models for the magnetic field and particle density configurations in the kiloparsec scale jet, outside the broad-line region, we find an ALP mass m{sub a} ∼ (1−3)⋅10{sup −7} eV and coupling g{sub aγ} ∼ (1−3)⋅10{sup −10} GeV{sup −1} after performing an illustrative statistical analysis of spectral data in four different epochs of emission. The precise values of m{sub a} and g{sub aγ} depend weakly on the assumed particle density configuration and are consistent with the current experimental bounds on these quantities. We apply this method and ALP parameters found from fitting 3C454.3 data to another flat-spectrum radio quasar PKS1222+216 (4C+21.35) data up to 400 GeV, as a consistency check, and found good fit. We find that the ALP-photon mixing effect on the GeV spectra may not be washed out for any reasonable estimate of the magnetic field in the intergalactic media.
The 1.3GeV electron synchrotron INS-ES
International Nuclear Information System (INIS)
Yoshida, Katsuhide
2006-01-01
The 1.3GeV electron synchrotron at Institute for Nuclear Study, University of Tokyo (INS-ES) is the first high energy accelerator in Japan. It was constructed during 1956-1961 and shut down in 1999. It had played key roles in originating high energy physics in Japan. Based upon accelerator technologies developed in the construction and the operation of INS-ES, a 12 GeV proton synchrotron was built at KEK. INS-ES was also the base to promote synchrotron radiation science in Japan and to establish Photon Factory at KEK. After 1980, it was operated mainly to deliver tagged photon beam for high energy nuclear physics. (K.Y.)
24 CFR 232.840 - Date of default.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Date of default. 232.840 Section 232.840 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued....840 Date of default. In computing loan insurance benefits, the date of default shall be considered as...
48 CFR 1552.232-74 - Payments-simplified acquisition procedures financing.
2010-10-01
... acquisition procedures financing. 1552.232-74 Section 1552.232-74 Federal Acquisition Regulations System... Provisions and Clauses 1552.232-74 Payments—simplified acquisition procedures financing. As prescribed in... acquisition procedures financing. Payments—Simplified Acquisition Procedures Financing (JUN 2006) Simplified...
International Nuclear Information System (INIS)
Bhatta, G.; Stawarz, Ł.; Ostrowski, M.; Markowitz, A.; Akitaya, H.; Arkharov, A. A.; Bachev, R.; Benítez, E.; Borman, G. A.; Carosati, D.; Cason, A. D.; Chanishvili, R.; Damljanovic, G.; Dhalla, S.; Frasca, A.; Hiriart, D.; Hu, S-M.
2016-01-01
Here we report on the results of the Whole Earth Blazar Telescope photo-polarimetric campaign targeting the blazar S5 0716+71, organized in 2014 March to monitor the source simultaneously in BVRI and near-IR filters. The campaign resulted in an unprecedented data set spanning ∼110 hr of nearly continuous, multiband observations, including two sets of densely sampled polarimetric data mainly in the R filter. During the campaign, the source displayed pronounced variability with peak-to-peak variations of about 30% and “bluer-when-brighter” spectral evolution, consisting of a day-timescale modulation with superimposed hour-long microflares characterized by ∼0.1 mag flux changes. We performed an in-depth search for quasi-periodicities in the source light curve; hints for the presence of oscillations on timescales of ∼3 and ∼5 hr do not represent highly significant departures from a pure red-noise power spectrum. We observed that, at a certain configuration of the optical polarization angle (PA) relative to the PA of the innermost radio jet in the source, changes in the polarization degree (PD) led the total flux variability by about 2 hr; meanwhile, when the relative configuration of the polarization and jet angles altered, no such lag could be noted. The microflaring events, when analyzed as separate pulse emission components, were found to be characterized by a very high PD (>30%) and PAs that differed substantially from the PA of the underlying background component, or from the radio jet positional angle. We discuss the results in the general context of blazar emission and energy dissipation models.
Energy Technology Data Exchange (ETDEWEB)
Bhatta, G.; Stawarz, Ł.; Ostrowski, M. [Astronomical Observatory of Jagiellonian University, ul. Orla 171, 30-244 Krakow (Poland); Markowitz, A. [Center for Astrophysics and Space Sciences, University of California, San Diego, 9500 Gilman Dr., La Jolla, CA 92093-0424 (United States); Akitaya, H. [Hiroshima Astrophysical Science Center, Hiroshima University, Higashi-Hiroshima, Hiroshima 739-8526 (Japan); Arkharov, A. A. [Main (Pulkovo) Astronomical Observatory of RAS, Pulkovskoye shosse, 60, 196140 St. Petersburg (Russian Federation); Bachev, R. [Institute of Astronomy, Bulgarian Academy of Sciences, 72, Tsarigradsko Shosse Blvd., 1784 Sofia (Bulgaria); Benítez, E. [Instituto de Astronomía, Universidad Nacional Autónoma de México, Mexico DF (Mexico); Borman, G. A. [Crimean Astrophysical Observatory, P/O Nauchny, Crimea, 298409 (Russian Federation); Carosati, D. [EPT Observatories, Tijarafe, La Palma (Spain); Cason, A. D. [Private address, 105 Glen Pine Trail, Dawnsonville, GA 30534 (United States); Chanishvili, R. [Abastumani Observatory, Mt. Kanobili, 0301 Abastumani, Georgia (United States); Damljanovic, G. [Astronomical Observatory, Volgina 7, 11060 Belgrade (Serbia); Dhalla, S. [Florida International University, Miami, FL 33199 (United States); Frasca, A. [INAF—Osservatorio Astrofisico di Catania (Italy); Hiriart, D. [Instituto de Astronomía, Universidad Nacional Autónoma de México, Ensenada (Mexico); Hu, S-M., E-mail: gopalbhatta716@gmail.com [Shandong Provincial Key Laboratory of Optical Astronomy and Solar-Terrestrial Environment, Institute of Space Sciences, Shandong University at Weihai, 264209 Weihai (China); and others
2016-11-01
Here we report on the results of the Whole Earth Blazar Telescope photo-polarimetric campaign targeting the blazar S5 0716+71, organized in 2014 March to monitor the source simultaneously in BVRI and near-IR filters. The campaign resulted in an unprecedented data set spanning ∼110 hr of nearly continuous, multiband observations, including two sets of densely sampled polarimetric data mainly in the R filter. During the campaign, the source displayed pronounced variability with peak-to-peak variations of about 30% and “bluer-when-brighter” spectral evolution, consisting of a day-timescale modulation with superimposed hour-long microflares characterized by ∼0.1 mag flux changes. We performed an in-depth search for quasi-periodicities in the source light curve; hints for the presence of oscillations on timescales of ∼3 and ∼5 hr do not represent highly significant departures from a pure red-noise power spectrum. We observed that, at a certain configuration of the optical polarization angle (PA) relative to the PA of the innermost radio jet in the source, changes in the polarization degree (PD) led the total flux variability by about 2 hr; meanwhile, when the relative configuration of the polarization and jet angles altered, no such lag could be noted. The microflaring events, when analyzed as separate pulse emission components, were found to be characterized by a very high PD (>30%) and PAs that differed substantially from the PA of the underlying background component, or from the radio jet positional angle. We discuss the results in the general context of blazar emission and energy dissipation models.
Measurement of the neutron capture cross-section of 232Th using the neutron activation technique
International Nuclear Information System (INIS)
Naik, H.; Singh, Sarbjit; Goswami, A.; Manchanda, V.K.; Prajapati, P.M.; Surayanarayana, S.V.; Nayak, B.K.; Sharma, S.C.; Jagadeesan, K.C.; Thakare, S.V.; Raj, D.; Ganesan, S.; Mulik, V.K.; Sivashankar, B.S.; Mukherjee, S.
2011-01-01
The 232 Th(n, γ) reaction cross-section at average neutron energies of 3.7±0.3 MeV and 9.85±0.38 MeV from the 7 Li(p, n) reaction has been determined for the first time using activation and off-line γ -ray spectrometric technique. The 232 Th(n, 2n) reaction cross-section at the average neutron energy of 9.85±0.38 MeV has been also determined using the same technique. The experimentally determined 232 Th(n, γ) and 232 Th(n, 2n) reaction cross-sections were compared with the evaluated data of ENDF/B-VII, JENDL-4.0 and JEFF-3.1 and were found to be in good agreement. The present data along with literature data in a wide range of neutron energies were interpreted in terms of competition between different reaction channels including fission. The 232 Th(n, γ) and 232 Th(n, 2n) reaction cross-sections were also calculated theoretically using the TALYS 1.2 computer code and were found to be slightly higher than the experimental data. (orig.)
International Nuclear Information System (INIS)
Ohno, Yuichi; Matsushima, Tatsuo; Tanaka, Shin-ichiro; Kamada, Masao
1993-01-01
The desorption, dissociation and orientation of oxygen admolecules on a reconstructed Pt(110)(1x2) were studied by means of TDS combined with isotope tracer, NEXAFS, and angle-resolved TDS. The admolecules below half a monolayer lie on the bottom of the trough, being oriented along it. The molecules adsorbed additionally are lying on declining terraces. The desorption flux of the former species shows a simple cosine distribution, suggesting that the molecule is not localized on the bottom in the desorption event. (author)
The VLBA-BU-BLAZAR Multi-Wavelength Monitoring Program
Directory of Open Access Journals (Sweden)
Svetlana Jorstad
2016-10-01
Full Text Available We describe a multiwavelength program of monitoring of a sample of bright γ-ray blazars, which the Boston University (BU group has being carrying out since June 2007. The program includes monthly monitoring with the Very Long Baseline Array at 43 GHz, optical photometric and polarimetric observations, construction and analysis of UV and X-ray light curves obtained with the Rossi X-ray Timing Explorer (RXTE and Swift satellites, and construction and analysis of γ-ray light curves based on data provided by the Large Area Telescope of the Fermi Gamma-ray Space Telescope. We present general results about the kinematics of parsec-scale radio jets, as well as the connection between γ-ray outbursts and jet events.
Radio variability of the blazar AO 0235 + 164
International Nuclear Information System (INIS)
O'dell, S.L.; Dennison, B.; Broderick, J.J.; Altschuler, D.R.; Condon, J.J.; Payne, H.E.; Mitchell, K.J.
1988-01-01
The high-redshift blazar A0 0235 + 164 exhibits flux-density variations which are primarily of the less common variety in which low-frequency flux-density variations track the high-frequency variations but are delayed and of smaller amplitude. Observational results based on five years of monitoring are presented which are correlated over at least a factor of 50 frequency range in the sense expected for an expanding synchrotron component: outbursts propagating toward lower frequencies with diminishing amplitudes. A simple, semiempirical jet model is developed which accounts reasonably well for the radio properties of the object. The predictions of the model are compared with observations, examining the radio flux-density histories, the radio spectral evolution, the radio structure, and evidence for relativistic bulk motion. 59 references
24 CFR 232.830 - Definition of default.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Definition of default. 232.830... Insurance § 232.830 Definition of default. (a) If the borrower fails to make any payments due under or... default for the purposes of this subpart. (b) The failure to perform any other covenant under the note or...
Levels of 232Th activity in the South Adriatic Sea marine environment of Montenegro
International Nuclear Information System (INIS)
Antovic, N.M.
2010-01-01
232 Th activities in the South Adriatic Sea-water, surface sediment, mud with detritus, seagrass (Posidonia oceanica) samples, and the mullet (Mugilidae) species Mugil cephalus, as well as soil and sand from the Montenegrin Coast, were measured using the six-crystal spectrometer PRIPYAT-2M, which has relatively high detection efficiency and a good sensitivity, and allows a short acquisition time, and measuring samples of any shape, without preliminary preparation and calibration measurements for different sample geometries. An average 232 Th activity concentration in surface soil layer is found to be 40.33 Bq kg -1 , while in sand-4.7 Bq kg -1 . The absorbed dose rate in air due to 232 Th gamma radiation from surface soil layer ranged from 11.76 to 63.39 nGy h -1 , with a mean of 24.06 nGy h -1 . Corresponding average annual effective dose rate has been found to be 0.03 mSv y -1 . The absorbed dose rates due to the thorium gamma radiation in air at 1 m above sand surface on the Montenegrin beaches have been found to be from 0.41 to 9.08 nGy h -1 , while annual effective dose rates ranged from 0.0005 to 0.011 mSv y -1 . 232 Th activity concentration in seawater ranged from 0.06 to 0.22 Bq L -1 , as in the mullet (Mugil cephalus) whole individuals from 0.63 to 1.67 Bq kg -1 . Annual intake of 232 Th by human consumers of this fish species has been estimated to provide an effective dose of about 0.003 mSv y -1 . (author)
Mrdakovic Popic, Jelena; Meland, Sondre; Salbu, Brit; Skipperud, Lindis
2014-05-01
Investigation of radionuclides (232Th and 238U) and trace elements (Cr, As and Pb) in soil from two legacy NORM (former mining sites) and one undisturbed naturally 232Th-rich site was conducted as a part of the ongoing environmental impact assessment in the Fen Complex area (Norway). The major objectives were to determine the radionuclide and trace element distribution and mobility in soils as well as to analyze possible differences between legacy NORM and surrounding undisturbed naturally 232Th-rich soils. Inhomogeneous soil distribution of radionuclides and trace elements was observed for each of the investigated sites. The concentration of 232Th was high (up to 1685 mg kg(-1), i.e., ∼7000 Bq kg(-1)) and exceeded the screening value for the radioactive waste material in Norway (1 Bq g(-1)). Based on the sequential extraction results, the majority of 232Th and trace elements were rather inert, irreversibly bound to soil. Uranium was found to be potentially more mobile, as it was associated with pH-sensitive soil phases, redox-sensitive amorphous soil phases and soil organic compounds. Comparison of the sequential extraction datasets from the three investigated sites revealed increased mobility of all analyzed elements at the legacy NORM sites in comparison with the undisturbed 232Th-rich site. Similarly, the distribution coefficients Kd (232Th) and Kd (238U) suggested elevated dissolution, mobility and transportation at the legacy NORM sites, especially at the decommissioned Nb-mining site (346 and 100 L kg(-1) for 232Th and 238U, respectively), while the higher sorption of radionuclides was demonstrated at the undisturbed 232Th-rich site (10,672 and 506 L kg(-1) for 232Th and 238U, respectively). In general, although the concentration ranges of radionuclides and trace elements were similarly wide both at the legacy NORM and at the undisturbed 232Th-rich sites, the results of soil sequential extractions together with Kd values supported the expected differences
Uptake and distribution of /sup 232/U in peas and barley
Energy Technology Data Exchange (ETDEWEB)
Schreckhise, R G; Cline, J F [Battelle Pacific Northwest Labs., Richland, WA (USA)
1980-03-01
The uptake of /sup 232/U from soil and its distribution in peas and barley were examined under conditions which isolated root uptake from deposition on aboveground plant parts. Aboveground plant parts were harvested at maturity and analyzed for /sup 232/U content by alpha-energy-analysis. The ratio of concentration (CR) of /sup 232/U in the dry barley seeds to dry soil was 1.6 x 10/sup -4/ while the CR values of the stem/leaf to dry soil fraction was 3.6 x 10/sup -3/. The Cr values for the pea seed, stem/pod and leaf components were 5.4 x 10/sup -4/, 3.3 x 10/sup -3/ and 1.7 x 10/sup -2/, respectively. This indicates that the CR values used in certain radiological dose-assessment models may be high by about a factor of 100 when evaluating the consumption of seeds of legumes or cereal grains by man.
Extremes of the jet-accretion power relation of blazars, as explored by NuSTAR
DEFF Research Database (Denmark)
Sbarrato, T.; Ghisellini, G.; Tagliaferri, G.
2016-01-01
.366) and B0222+185 (at z = 2.690) have been observed twice by the Nuclear Spectroscopic Telescope Array (NuSTAR) simultaneously with Swift/X-ray Telescope, showing different variability behaviours. We found that NuSTAR is instrumental to explore the variability of powerful high-redshift blazars, even when...
Energy Technology Data Exchange (ETDEWEB)
Massaro, F.; Funk, S. [SLAC National Laboratory and Kavli Institute for Particle Astrophysics and Cosmology, 2575 Sand Hill Road, Menlo Park, CA 94025 (United States); D' Abrusco, R.; Paggi, A. [Harvard-Smithsonian Astrophysical Observatory, 60 Garden Street, Cambridge, MA 02138 (United States); Giroletti, M. [INAF Istituto di Radioastronomia, via Gobetti 101, I-40129 Bologna (Italy); Masetti, N. [INAF-Istituto di Astrofisica Spaziale e Fisica Cosmica di Bologna, via Gobetti 101, I-40129 Bologna (Italy); Tosti, G. [Dipartimento di Fisica, Universita degli Studi di Perugia, I-06123 Perugia (Italy); Nori, M. [Department of Physics and Astronomy, University of Bologna, viale Berti Pichat 6/2, I-40127 Bologna (Italy)
2013-07-01
About one-third of the {gamma}-ray sources listed in the second Fermi Large Area Telescope catalog (2FGL) have no firmly established counterpart at lower energies and so are classified as unidentified gamma-ray sources (UGSs). Here, we propose a new approach to find candidate counterparts for the UGSs based on the 325 MHz radio survey performed with the Westerbork Synthesis Radio Telescope in the northern hemisphere. First, we investigate the low-frequency radio properties of blazars, the largest known population of {gamma}-ray sources; then we search for sources with similar radio properties combining the information derived from the Westerbork Northern Sky Survey (WENSS) with those of the NRAO Very Large Array Sky Survey. We present a list of candidate counterparts for 32 UGSs with at least one counterpart in the WENSS. We also performed an extensive research in the literature to look for infrared and optical counterparts of the {gamma}-ray blazar candidates selected using the low-frequency radio observations to confirm their nature. On the basis of our multifrequency research, we identify 23 new {gamma}-ray blazar candidates out of the 32 UGSs investigated. Comparison with previous results on the UGSs is also presented. Finally, we speculate on the advantages of using low-frequency radio observations to associate UGSs and to search for {gamma}-ray pulsar candidates.
48 CFR 52.232-31 - Invitation To Propose Financing Terms.
2010-10-01
... Financing Terms. 52.232-31 Section 52.232-31 Federal Acquisition Regulations System FEDERAL ACQUISITION... Clauses 52.232-31 Invitation To Propose Financing Terms. As prescribed in 32.205(b) and 32.206, insert the following provision: Invitation To Propose Financing Terms (OCT 1995) (a) The offeror is invited to propose...
Pi, Qing-feng; Zhang, Li-yun; Bi, Shao-lan; Han, Xianming L.; Wang, Dai-mei; Lu, Hong-peng
2017-12-01
In this paper, we present new BVRI light curves of short-period contact eclipsing binaries V1101 Her and AD Phe from our observations carried out from 2014 to 2015 using the SARA KP and SARA CT telescopes. There is an eclipsing binary located at α(2000) = 01h16m36.ˢ15 and δ(2000) = -39°49‧55.″7 in the field of view of AD Phe. We derived an updated ephemeris and found there a cyclic variation overlaying a continuous period increase (V1101 Her) and decrease (AD Phe). This kind of cyclic variation may be attributed to the light time effect via the presence of the third body or magnetic activity cycle. The orbital period increase suggests that V1101 Her is undergoing a mass-transfer from the primary to the secondary component (dM 1/dt = 2.64(±0.11) × 10-6 M ⊙ yr-1) with the third body (P 3 = 13.9(±1.9) years), or 2.81(±0.07) × 10-6 M ⊙ yr-1 for an increase andmagnetic cycle (12.4(±0.5) years). The long-term period decrease suggests that AD Phe is undergoing a mass-transfer from the secondary component to the primary component at a rate of -8.04(±0.09) × 10-8 M ⊙ yr-1 for a period decrease and the third body (P 3 = 56.2(±0.8) years), or -7.11(±0.04) × 10-8 M ⊙ yr-1 for a decrease and magnetic cycle (50.3(±0.5) years). We determined their orbital and geometrical parameters. For AD Phe, we simultaneously analyzed our BVRI light curves and the spectroscopic observations obtained by Duerbeck & Rucinski. The spectral type of V1101 Her was classified as G0 ± 2V by LAMOST stellar spectra survey. The asymmetry of the R-band light curve of AD Phe obtained by McFarlane & Hilditch in 1987 is explained by a cool spot on the primary component.
Parsec-Scale Properties of Gamma-Ray Bright Blazars
Linford, Justin Dee
The parsec-scale radio properties of blazars detected by the Large Area Telescope (LAT) on board the Fermi Gamma-ray Space Telescope have been investigated using observations with the Very Long Baseline Array (VLBA). Comparisons between LAT and non-LAT detected samples were made using both archival and contemporaneous data. In total, 244 sources were used in the LAT-detected sample. This very large, radio flux-limited sample of active galactic nuclei (AGN) provides insights into the mechanism that produces strong gamma-ray emission. It has been found that LAT-detected BL Lac objects are very similar to the non-LAT BL Lac objects in most properties, although LAT BL Lac objects may have longer jets. The LAT flat spectrum radio quasars (FSRQs) are significantly different from non-LAT FSRQs and are likely extreme members of the FSRQ population. Archival radio data indicated that there was no significant correlation between radio flux density and gamma-ray flux, especially at lower flux levels. However, contemporaneous observations showed a strong correlation. Most of the differences between the LAT and non-LAT populations are related to the cores of the sources, indicating that the gamma-ray emission may originate near the base of the jets (i.e., within a few pc of the central engine). There is some indication that LAT-detected sources may have larger jet opening angles than the non-LAT sources. Strong core polarization is significantly more common among the LAT sources, suggesting that gamma-ray emission is related to strong, uniform magnetic fields at the base of the jets of the blazars. Observations of sources in two epochs indicate that core fractional polarization was higher when the objects were detected by the LAT. The low-synchrotron peaked (LSP) BL Lac object sample shows indications of contamination by FSRQs which happen to have undetectable emission lines. There is evidence that the LSP BL Lac objects are more strongly beamed than the rest of the BL Lac
Fine Structure of the Core of the Blazar OJ 287-I
Matveyenko, L. I.; Sivakon', S. S.
2017-12-01
The fine structure of the active region, the bulge, of the blazar OJ 287 has been investigated with a resolution of 20 μas (0.1 pc) at a wavelength of 7 mm, the epochs of 2007-2017. The structure and kinematics correspond to a vortex nature. The surrounding matter, the plasma, is transferred to the center along two arms from opposite directions. The emerging excess angular momentum is carried away along the rotation axis by bipolar outflows, rotating coaxial tubes, in a direction X ≈ -120° in the plane of the sky as it is accumulated. The central high-velocity bipolar outflow has a helical shape. The diameters of the low-velocity flows are ø1 ≈ 0.3 and ø2 ≈ 0.65 mas, or 1.4 and 3 pc, respectively. Ring currents whose tangential directions are observed as parallel chains of components are excited in the flow walls. The peak brightness temperature of the nozzle reaches Tb ≈ 1012-1013 K. A "disk" with a diameter ø ≈ 0.5 mas (≈2.2 pc) is observed by the absorption of synchrotron radiation. The disk is inclined to the plane of the sky at an angle of 60° in the jet direction. The fragments are seen from a distance of ˜0.2 mas outside the absorption zone. The jet sizes exceed considerably the counterjet ones. An enhanced supply of plasma from the northern arm gives rise to an independent vortex 0.2 mas away from the central one in the NW direction. As in the first case, the helical central bipolar outflow is surrounded by a low-velocity component ø ≈ 0.28 mas in diameter with built-in ring currents. The jet is ejected in the direction X = -50° in the plane of the sky. The jet orientation changes, X = -130° at a distance of 1 mas. A high activity of the central and two side nozzles spaced 0.22 mas apart in the direction X = -40° is occasionally observed simultaneously. The active region of the blazar is observed through an ionized medium, a screen, whose influence is significant even at a wavelength of 7 mm. The absorption and refraction of the
The extreme blazar AO 0235+164 as seen by extensive ground and space radio observations
Kutkin, A. M.; Pashchenko, I. N.; Lisakov, M. M.; Voytsik, P. A.; Sokolovsky, K. V.; Kovalev, Y. Y.; Lobanov, A. P.; Ipatov, A. V.; Aller, M. F.; Aller, H. D.; Lahteenmaki, A.; Tornikoski, M.; Gurvits, L. I.
2018-04-01
Clues to the physical conditions in radio cores of blazars come from measurements of brightness temperatures as well as effects produced by intrinsic opacity. We study the properties of the ultra-compact blazar AO 0235+164 with RadioAstron ground-space radio interferometer, multifrequency VLBA, EVN, and single-dish radio observations. We employ visibility modelling and image stacking for deriving structure and kinematics of the source, and use Gaussian process regression to find the relative multiband time delays of the flares. The multifrequency core size and time lags support prevailing synchrotron self-absorption. The intrinsic brightness temperature of the core derived from ground-based very long baseline interferometry (VLBI) is close to the equipartition regime value. In the same time, there is evidence for ultra-compact features of the size of less than 10 μas in the source, which might be responsible for the extreme apparent brightness temperatures of up to 1014 K as measured by RadioAstron. In 2007-2016 the VLBI components in the source at 43 GHz are found predominantly in two directions, suggesting a bend of the outflow from southern to northern direction. The apparent opening angle of the jet seen in the stacked image at 43 GHz is two times wider than that at 15 GHz, indicating a collimation of the flow within the central 1.5 mas. We estimate the Lorentz factor Γ = 14, the Doppler factor δ = 21, and the viewing angle θ = 1.7° of the apparent jet base, derive the gradients of magnetic field strength and electron density in the outflow, and the distance between jet apex and the core at each frequency.
International Nuclear Information System (INIS)
Weidner, J.R.; Stoots, P.R.
1990-10-01
The In Situ Vitrification Engineering-Scale Tests ES-4, ES-5, ES-6, and ES-7 Product Characterization Test Plan describes the methods and procedures to be used or the physical and chemical characterization of the solid product(s) resulting from the Idaho National Engineering Laboratory engineering scale in situ vitrification tests ES-4, ES-5, ES-6, and ES-7. The goals of this Test Plan are to insure that the product characterization results are sufficient to meet the data needs of the In Situ Vitrification Program and are technically and legally defensible. Important issues addressed by the test plan include sampling and analysis strategy, sampling procedures, laboratory analysis, sample control and document management, equipment, data reporting and validation, quality assurance, specific routine procedures to assess data representativeness, safety and training program, and data management. 9 refs., 1 fig., 3 tabs
48 CFR 232.072-3 - Cash flow forecasts.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Cash flow forecasts. 232..., DEPARTMENT OF DEFENSE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING 232.072-3 Cash flow forecasts. (a... contractor to submit a cash flow forecast covering the duration of the contract. (b) A contractor's inability...
The Imprint of the Extragalactic Background Light in the Gamma-Ray Spectra of Blazars
Ackermann, M.; Ajello, M.; Allafort, A.; Schady, P.; Baldini, L.; Ballet, J.; Barbiellini, G.; Bastieri, D.; Bellazzini, R; Blandford, R. D.;
2012-01-01
The light emitted by stars and accreting compact objects through the history of the universe is encoded in the intensity of the extragalactic background light (EBL). Knowledge of the EBL isimportant to understand the nature of star formation and galaxy evolution, but direct measurements of the EBL are limited by galactic and other foreground emissions. Here, we report an absorption feature seen in the combined spectra of a sample of gamma-ray blazars out to a redshift of z approx. 1.6. This feature is caused by attenuation of gamma rays by the EBL at optical to ultraviolet frequencies and allowed us to measure the EBL flux density in this frequency band.
Results of the first simultaneous X-ray, optical, and radio campaign on the blazar PKS 1622-297
Meyer, Angela Osterman; Miller, H. Richard; Marshall, Kevin; Ryle, Wesley T.; Aller, Hugh; Aller, Margo; McFarland, John P.; Pollock, Joseph T.; Reichart, Daniel E.; Crain, J. Adam; Ivarsen, Kevin M.; LaCluyze, Aaron P.; Nysewander, Melissa C.
Coordinated X-ray, optical, and radio observations of the blazar PKS 1622-297 were obtained during a three-week campaign in 2006 using the Rossi X-Ray Timing Explorer (RXTE), the University of Michigan Radio Astronomy Observatory, and optical telescopes at Cerro Tololo Inter-American Observatory.
International Nuclear Information System (INIS)
Lancman, H.
1981-02-01
Intense proton beam currents from the Dynamitron at Brooklyn College have been used to generate gamma rays of variable energy from a number of (p,γ) resonances in various nuclei. Spectra of photofission fragments of 238 U and 232 Th have been measured with an average gamma ray energy resolution of approx. 300 eV. Structure in the photofission cross section of 232 Th was observed at approx. 6176 keV
40 CFR 170.232 - Knowledge of labeling and site-specific information.
2010-07-01
... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Knowledge of labeling and site-specific information. 170.232 Section 170.232 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS WORKER PROTECTION STANDARD Standard for Pesticide Handlers § 170.232 Knowledge...
Binary and ternary photofission of thorium 232
Energy Technology Data Exchange (ETDEWEB)
Titterton, E W; Brinkley, T A
1950-05-01
Work by Titterton and Goward (1949) has shown that uranium undergoes photofission into three charged fragments. Experiments have been conducted to determine whether a similar process takes place in the photofission of thorium. Some difficulties were encountered in loading plates with /sup 232/Th atoms, but this was finally accomplished by means of a technique described in detail. Plates loaded by this method were irradiated with a continuous spectrum of ..gamma.. rays of maximum energy 24 MeV from the (Atomic Energy Research Establishment) Synchrotron. Three irradiations, of 100, 150, and 180 r, were made and the resulting plates showed a fission density of 2.5 x 10/sup 4//cc at the 150 r level. In an examination involving 2500 binary photofissions, 5 cases of ternary fission involving the emission of a long range light fragment, probably an ..cap alpha..-particle, were observed. These events are described. A number-range curve was determined for the photofission tracks and is compared with a similar curve for tracks formed by the slow neutron fission of /sup 235/U in a D/sub 1/ emulsion under conditions of similar emulsion sensitivity. It appears that the energy release in the photofission of /sup 232/Th is smaller than that in the slow neutron fission of /sup 235/U. The data indicate that 124 MeV is the mean kinetic energy released in the photofission of /sup 232/Th.
29 CFR 500.232 - Consent findings and order.
2010-07-01
... Administrative Law Judge; and (4) A waiver of any right to challenge or contest the validity of the findings and... 29 Labor 3 2010-07-01 2010-07-01 false Consent findings and order. 500.232 Section 500.232 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR REGULATIONS MIGRANT AND...
Multiwavelength Observations of the Blazar BL Lacertae: A New Fast TeV Gamma-Ray Flare
Abeysekara, A. U.; Benbow, W.; Bird, R.; Brantseg, T.; Brose, R.; Buchovecky, M.; Buckley, J. H.; Bugaev, V.; Connolly, M. P.; Cui, W.; Daniel, M. K.; Falcone, A.; Feng, Q.; Finley, J. P.; Fortson, L.; Furniss, A.; Gillanders, G. H.; Gunawardhana, I.; Hütten, M.; Hanna, D.; Hervet, O.; Holder, J.; Hughes, G.; Humensky, T. B.; Johnson, C. A.; Kaaret, P.; Kar, P.; Kertzman, M.; Krennrich, F.; Lang, M. J.; Lin, T. T. Y.; McArthur, S.; Moriarty, P.; Mukherjee, R.; O’Brien, S.; Ong, R. A.; Otte, A. N.; Park, N.; Petrashyk, A.; Pohl, M.; Pueschel, E.; Quinn, J.; Ragan, K.; Reynolds, P. T.; Richards, G. T.; Roache, E.; Rulten, C.; Sadeh, I.; Santander, M.; Sembroski, G. H.; Shahinyan, K.; Wakely, S. P.; Weinstein, A.; Wells, R. M.; Wilcox, P.; Williams, D. A.; Zitzer, B.; The VERITAS Collaboration; Jorstad, S. G.; Marscher, A. P.; Lister, M. L.; Kovalev, Y. Y.; Pushkarev, A. B.; Savolainen, T.; Agudo, I.; Molina, S. N.; Gómez, J. L.; Larionov, V. M.; Borman, G. A.; Mokrushina, A. A.; Tornikoski, M.; Lähteenmäki, A.; Chamani, W.; Enestam, S.; Kiehlmann, S.; Hovatta, T.; Smith, P. S.; Pontrelli, P.
2018-04-01
Combined with measurements made by very-long-baseline interferometry, the observations of fast TeV gamma-ray flares probe the structure and emission mechanism of blazar jets. However, only a handful of such flares have been detected to date, and only within the last few years have these flares been observed from lower-frequency-peaked BL Lac objects and flat-spectrum radio quasars. We report on a fast TeV gamma-ray flare from the blazar BL Lacertae observed by the Very Energetic Radiation Imaging Telescope Array System (VERITAS). with a rise time of ∼2.3 hr and a decay time of ∼36 min. The peak flux above 200 GeV is (4.2 ± 0.6) × 10‑6 photon m‑2 s‑1 measured with a 4-minute-binned light curve, corresponding to ∼180% of the flux that is observed from the Crab Nebula above the same energy threshold. Variability contemporaneous with the TeV gamma-ray flare was observed in GeV gamma-ray, X-ray, and optical flux, as well as in optical and radio polarization. Additionally, a possible moving emission feature with superluminal apparent velocity was identified in Very Long Baseline Array observations at 43 GHz, potentially passing the radio core of the jet around the time of the gamma-ray flare. We discuss the constraints on the size, Lorentz factor, and location of the emitting region of the flare, and the interpretations with several theoretical models that invoke relativistic plasma passing stationary shocks.
Calibration of 232U solution; Calibracion de una disolucion de 232U
Energy Technology Data Exchange (ETDEWEB)
Galan Valera, M P; Acena Berrenechea, M L
1988-07-01
A method for as certain the activity by alpha spectroscopy with semiconductor detectors, of a solution of 232U is presented. It consists of the comparison with a 233U solution activity previously measured in a gridded ionization chamber of 2{pi} geometry. The total measurement uncertainty is about + - 0,02. (Author) 9 refs.
International Nuclear Information System (INIS)
Zal U'yun Wan Mahmood; Norfaizal Mohamed; Nita Salina Abu Bakar
2014-01-01
Preliminary results on the study of bioaccumulation, depuration and total dose rate of Th-232 in the whole body of Anabas testudineus are presented. The objective of this study was to evaluate the effect of Th-232 concentration activity on the laboratory bioaccumulation, depuration and total dose rate in Anabas testudineus. Anabas testudineus adults were exposed to different waterborne Th-232 levels: 0 BqL -1 (control), 50 BqL -1 and 100 BqL -1 for 30 day (uptake phase), followed by exposure to radionuclide-free water for 30 days (loss phase). Radionuclide concentration ratios between the whole body levels and water levels, percentage of Th-232 remaining in fish were calculated and total dose rates using ERICA Assessment Tool were also estimated. The results showed the increase of waterborne Th-232 concentration corresponded to a progressive increase of Th accumulation and total dose rate (internal and external) in the whole body of Anabas testudineus. Considering the ERICA dose rate screening value of 10 μGyh -1 , the findings can be concluded the estimated of total dose rate (< 5 μGyh -1 ) in Anabas testudineus is in order of small magnitude. Nevertheless, these preliminary results showed that the Anabas testudineus has a potential to accumulate thorium. (author)
Broad Band Observations of Gravitationally Lensed Blazar during a Gamma-Ray Outburst
Directory of Open Access Journals (Sweden)
Julian Sitarek
2016-09-01
Full Text Available QSO B0218+357 is a gravitationally lensed blazar located at a cosmological redshift of 0.944. In July 2014 a GeV flare was observed by Fermi-LAT, triggering follow-up observations with the MAGIC telescopes at energies above 100 GeV. The MAGIC observations at the expected time of arrival of the trailing component resulted in the first detection of QSO B0218+357 in Very-High-Energy (VHE, >100 GeV gamma rays. We report here the observed multiwavelength emission during the 2014 flare.
75 FR 41877 - Insured Healthcare Facilities 232 Loan Application
2010-07-19
... DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT [Docket No. FR-5376-N-65] Insured Healthcare Facilities 232 Loan Application AGENCY: Office of the Chief Information Officer, HUD. ACTION: Notice. SUMMARY... Proposal: Insured Healthcare Facilities 232 Loan Application. OMB Approval Number: 2502-New. Form Numbers...
75 FR 16821 - Insured Healthcare Facilities 232 Loan Application
2010-04-02
... DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT [Docket No. FR-5376-N-23] Insured Healthcare Facilities 232 Loan Application AGENCY: Office of the Chief Information Officer, HUD. ACTION: Notice. SUMMARY...: Title of Proposal: Insured Healthcare Facilities 232 Loan Application. OMB Approval Number: 2502-New...
Energy Technology Data Exchange (ETDEWEB)
Collaboration: ANTARES Collaboration
2015-12-01
The ANTARES telescope is well-suited for detecting astrophysical transient neutrino sources as it can observe a full hemisphere of the sky at all times with a high duty cycle. The background due to atmospheric particles can be drastically reduced, and the point-source sensitivity improved, by selecting a narrow time window around possible neutrino production periods. Blazars, being radio-loud active galactic nuclei with their jets pointing almost directly towards the observer, are particularly attractive potential neutrino point sources, since they are among the most likely sources of the very high-energy cosmic rays. Neutrinos and gamma rays may be produced in hadronic interactions with the surrounding medium. Moreover, blazars generally show high time variability in their light curves at different wavelengths and on various time scales. This paper presents a time-dependent analysis applied to a selection of flaring gamma-ray blazars observed by the FERMI/LAT experiment and by TeV Cherenkov telescopes using five years of ANTARES data taken from 2008 to 2012. The results are compatible with fluctuations of the background. Upper limits on the neutrino fluence have been produced and compared to the measured gamma-ray spectral energy distribution.
48 CFR 652.232-71 - Voucher Submission (Cost-Reimbursement).
2010-10-01
...-Reimbursement). 652.232-71 Section 652.232-71 Federal Acquisition Regulations System DEPARTMENT OF STATE CLAUSES... Voucher Submission (Cost-Reimbursement). As prescribed in 632.908(b), the contracting officer may insert a clause substantially the same as follows: Voucher Submission (Cost-Reimbursement) (AUG 1999) (a) General...
Park, Jiyun; An, Seong Soo A; Giau, Vo Van; Shim, Kyuhwan; Youn, Young Chul; Bagyinszky, Eva; Kim, SangYun
2017-08-01
In the present study, a novel mutation in exon 7 of presenilin 1 (Leu232Pro) was discovered in a Korean patient with early-onset Alzheimer's disease, who represented memory decline at 37 years of age, followed by impairment in spatial activity and concentrations and personality changes. Imaging analyses with magnetic resonance scan showed diffuse atrophy in the frontoparietal regions. Targeted next generation sequencing and Sanger sequencing identified a heterozygous T to C transition at position 695 (c.695T>C) of in presenilin 1 gene (PSEN1), resulting in a novel missense mutation at codon 232 from leucine to proline (L232P). Several family members of the patient developed dementia, suggesting an autosomal dominant inheritance; however, we were unable to perform a segregation analysis to confirm this. Since the proline may play a role as a helix breaker, this mutation could significantly disturb the transmembrane helix domain-V of PSEN1 and perturb its protein functions. This hypothesis was supported by the results from the in silico analyses, predicted a major kink on this helix. Several leucine>proline substitutions in other PSEN1 transmembrane helices revealed aggressive AD phenotypes. Future functional studies would be needed to evaluate the pathogenicity of this mutation in AD. Copyright © 2017 Elsevier Inc. All rights reserved.
Fermi-LAT View of Bright Flaring Gamma-Ray Blazars
Bastieri, D.; Ciprini, S.; Gasparrini, D.
2011-06-01
The Fermi LAT provides a continuous and uniform monitoring of the Universe in the gamma-ray band. During the first year many gamma-ray blazar flares, some unidentified transients and emission by the Sun while in a quiet state were promptly detected. This is mainly due to the design of the mission, featuring a detector, the LAT with a wide field of view, and to the operation of the spacecraft itself, that can cover every region of the sky every 3 hours. Nevertheless, the scientific exploitation of this monitoring is more fruitful when early information about transients reaches a broader community. In this respect, the indefatigable activity of flare advocates, who worked on weekly shifts to validate the results and quickly broadcast information about flares and new detections, was the key to most scientific results.
Collection and evaluation of nuclear data of Th-232
International Nuclear Information System (INIS)
Osawa, Takaaki
1979-01-01
Present status of the requirement to and measurement and evaluation of the nuclear data of Th-232 is presented. The accuracy and energy range of the observed data at present are not enough to the demand from reactor engineering. The data of total cross-section are given in the energy range from 1.5 to 15 MeV from the data by Foster and Fasoli. The data by Uttley for the energy less than 1.5 MeV were accepted. Recently, Whalen and Kobayashi presented new data. Optical potential parameters were deduced. Re-normalization of the capture cross-sections of Th-232 was made on the basis of the evaluated values by Matsunobu and by Kanda. The values are a little smaller than the values in ENDF/B-4. Fission cross-sections were given by Henkel up to 9 MeV, and by Rago and Pankratov for the energy range above 9 MeV. Recently, Behrens presented new data for wide energy range. The accuracy of the measured cross-sections of inelastic scattering is not enough for reactor design. The accurate values of the cross-sections of (n, 2n) reaction of Th-232 have been demanded. Resonance parameters have been measured for wide energy range. In the energy range of thermal neutrons, the capture cross-section is about 7.4 barn. The characteristics of velocity dependence of the capture cross-section in this range should be investigated. (Kato, T.)
49 CFR 232.609 - Handling of defective equipment with ECP brake systems.
2010-10-01
... (ECP) Braking Systems § 232.609 Handling of defective equipment with ECP brake systems. (a) Ninety-five... systems. 232.609 Section 232.609 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION BRAKE SYSTEM SAFETY STANDARDS FOR FREIGHT...
Wortham, B. E.; Banner, J. L.; James, E.; Loewy, S. L.
2013-12-01
Speleothems, calcite deposits in caves, preserve a record of climate in their growth rate, isotope ratios and trace element concentrations. These variables must be tied to precise ages to produce pre-instrumental records of climate. The 238U-234U- 230Th disequilibrium method of dating can yield precise ages if the amount of 230Th from the decay of radiogenic 238U can be constrained. 230Th in a speleothem calcite growth layer has two potential sources - 1) decay of radioactive 238U since the time of growth of the calcite layer; and 2) initial detrital 230Th, incorporated along with detrital 232Th, into the calcite layer at the time it grew. Although the calcite lattice does not typically incorporate Th, samples can contain impurities with relatively high Th contents. Initial 230Th/232Th is commonly estimated by assuming a source with bulk-Earth U/Th values in a state of secular equilibrium in the 238U-decay chain. The uncertainty in this 230Th/232Th estimate is also assumed, typically at +/-100%. Both assumptions contribute to uncertainty in ages determined for young speleothems. If the amount of initial detrital 230Th can be better quantified for samples or sites, then U-series ages will have smaller uncertainties and more precisely define the time series of climate proxies. This study determined the initial 230Th/232Th of modern calcite to provide more precise dates for central Texas speleothems. Calcite was grown on glass-plate substrates placed under active drips in central Texas caves. The 230Th/232Th of this modern calcite was determined using thermal ionization mass spectrometry. Results show that: 1) initial 230Th/232Th ratios can be accurately determined in these young samples and 2) measuring 230Th/232Th reduces the uncertainties in previously-determined ages on stalagmites from under the same drips. For example, measured initial 230Th/232Th in calcite collected on substrates from different locations in the cave at Westcave Preserve are 15.3 × 0.67 ppm
MULTIWAVELENGTH VARIABILITY OF THE BLAZARS Mrk 421 AND 3C 454.3 IN THE HIGH STATE
Energy Technology Data Exchange (ETDEWEB)
Gaur, Haritma; Gupta, Alok C. [Aryabhatta Research Institute of Observational Sciences (ARIES), Manora Peak, Nainital 263129 (India); Wiita, Paul J., E-mail: haritma@aries.res.in [Department of Physics, College of New Jersey, P.O. Box 7718, Ewing, NJ 08628 (United States)
2012-01-15
We report the results of photometric observations of the blazars Mrk 421 and 3C 454.3 designed to search for intraday variability (IDV) and short-term variability (STV). Optical photometric observations were spread over 18 nights for Mrk 421 and 7 nights for 3C 454.3 during our observing run in 2009-2010 at the 1.04 m telescope at Aryabhatta Research Institute of Observational Sciences, India. Genuine IDV is found for the source 3C 454.3 but not for Mrk 421. Genuine STV is found for both sources. Mrk 421 was revealed by the Monitor of All-sky X-ray Image (MAXI) X-ray detector on the International Space Station to be in an exceptionally high flux state in 2010 January-February. We performed a correlation between the X-ray and optical bands to search for time delays and found a weak correlation with higher frequencies leading the lower frequencies by about 10 days. The blazar 3C 454.3 was found to be in a high flux state in 2009 November-December. We performed correlations in optical observations made at three telescopes, along with X-ray data from the MAXI camera and public release {gamma}-ray data from the Fermi space telescope. We found strong correlations between the {gamma}-ray and optical bands at a time lag of about four days, but the X-ray flux is not correlated with either. We briefly discuss the possible reasons for the time delays between these bands within the framework of existing models for X-ray and {gamma}-ray emission mechanisms.
Directory of Open Access Journals (Sweden)
Chale Pauline NF
2011-04-01
Full Text Available Abstract Background Skin diseases are underestimated and overlooked by most clinicians despite being common in clinical practice. Many patients are hospitalized with co-existing dermatological conditions which may not be detected and managed by the attending physicians. The objective of this study was to determine the burden of co-existing and overlooked dermatological disorders among patients admitted to medical wards of Muhimbili National hospital in Dar es Salaam. Study design and settings A hospital-based descriptive cross-sectional study conducted at Muhimbili National hospital in Dar es Salaam, Tanzania. Methods Patients were consecutively recruited from the medical wards. Detailed interview to obtain clinico-demographic characteristics was followed by a complete physical examination. Dermatological diagnoses were made mainly clinically. Appropriate confirmatory laboratory investigations were performed where necessary. Data was analyzed using the 'Statistical Package for Social Sciences' (SPSS program version 10.0. A p-value of Results Three hundred and ninety patients admitted to medical wards were enrolled into the study of whom, 221(56.7% were females. The mean age was 36.7 ± 17.9 (range 7-84 years. Overall, 232/390 patients (59.5% had co-existing dermatological disorders with 49% (191/390 having one, 9% (36/390 two and 5 patients (1% three. A wide range of co-existing skin diseases was encountered, the most diverse being non-infectious conditions which together accounted for 36.4% (142/390 while infectious dermatoses accounted for 31.5% (123/390. The leading infectious skin diseases were superficial fungal infections accounting for 18%. Pruritic papular eruption of HIV/AIDS (PPE and seborrheic eczema were the most common non-infectious conditions, each accounting for 4.3%. Of the 232/390 patients with dermatological disorders, 191/232 (82.3% and 154/232 (66.3% had been overlooked by their referring and admitting doctors respectively
Thorium-232 in human tissues: Metabolic parameters and radiation doses
International Nuclear Information System (INIS)
Stehney, A.F.
1994-01-01
Higher than environmental levels of 232 Th have been found in autopsy samples of lungs and other organs from four former employees of a Th refinery. Working periods of the subjects ranged from 3 to 24 years, and times from end of work to death ranged from 6 to 31 years. Concentrations of 232 Th in these samples and in tissues from two cases of non-occupational exposure were examined for compatibility with dosimetric models in Publication 30 of the International Commission on Radiological Protection (ICPP 1979a). The concentrations of 232 Th in the lungs of the Th workers relative to the concentrations in bone or liver were much higher than calculated from the model for class Y aerosols of Th and the exposure histories of the subjects, and concentrations in the pulmonary lymph nodes were much lower than calculated for three of the Th workers and both non-occupational cases. Least-squares fits to the measured concentrations showed that the biological half-times of Th in liver, spleen, and kidneys are similar to the half-time in bone instead of the factor of 10 less suggested in Publication 30, and the fractions translocated from body fluids were found to be about 0.03, 0.02, and 0.005, respectively, when the fraction to bone was held at the suggested value of 0.7. Fitted values of the respiratory parameters differed significantly between cases and the differences were ascribable to aerosol differences. Average inhalation rates calculated for individual Th workers ranged from 50 to 110 Bq 232 Th y -1 , and dose equivalents as high as 9.3 Sv to the lungs, 2.0 Sv to bone surfaces, and 1.1 Sv effective dose equivalent were calculated from the inhalation rates and fitted values of the metabolic parameters. The radiation doses were about the same when calculated from parameter values fitted with an assumed translocation fraction of 0.2 from body fluids to bone instead of 0.7
The preparation of Th-232 target by molecular plating method
International Nuclear Information System (INIS)
Yang Chunli; Wu Junde; Su Shuxin; Yang Jingling
2010-01-01
In order to measure the reaction cross-section of 232 Th(α,2n) 234 U, the preparation of uniform and adherent Th-232 targets on Al foils of thickness 2-8 μm fixed on target frame by molecular plating technique from isopropanol was described. The substrate of electrolytic cell was reconstructed and the optimum acidity for the deposition of thorium were investigated. Through deposition yield analysis, the target thickness of 100- 200μg/cm 2 was determined. The α-spectrometry for the Th-232 targets shows a good energy resolution. (authors)
48 CFR 232.070 - Responsibilities.
2010-10-01
... DoD contract financing, including DoD contract financing policies and important related procedures... operations. Refer specific cases involving financing policy or important procedural issues to OUSD(AT&L)DPAP... OF DEFENSE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING 232.070 Responsibilities. (a) The...
CERES ERBE-like Instantaneous TOA Estimates (ES-8) in HDF (CER_ES8_TRMM-PFM_Edition2)
Wielicki, Bruce A. (Principal Investigator)
The ES-8 archival data product contains a 24-hour, single-satellite, instantaneous view of scanner fluxes at the top-of-atmosphere (TOA) reduced from spacecraft altitude unfiltered radiances using Earth Radiation Budget Experiment (ERBE) scanner Inversion algorithms and the ERBE shortwave (SW) and longwave (LW) Angular Distribution Models (ADMs). The ES-8 also includes the total (TOT), SW, LW, and window (WN) channel radiometric data; SW, LW, and WN unfiltered radiance values; and the ERBE scene identification for each measurement. These data are organized according to the CERES 3.3-second scan into 6.6-second records. As long as there is one valid scanner measurement within a record, the ES-8 record will be generated. The following CERES ES8 data sets are currently available: CER_ES8_TRMM-PFM_Edition1 CER_ES8_TRMM-PFM_Edition2 CER_ES8_TRMM-PFM_Transient-Ops2 CER_ES8_Terra-FM1_Edition1 CER_ES8_Terra-FM2_Edition1 CER_ES8_Terra-FM1_Edition2 CER_ES8_Terra-FM2_Edition2 CER_ES8_Aqua-FM3_Edition1 CER_ES8_Aqua-FM4_Edition1 CER_ES8_Aqua-FM3_Edition2 CER_ES8_Aqua-FM4_Edition2 CER_ES8_Aqua-FM3_Edition1-CV CER_ES8_Aqua-FM4_Edition1-CV CER_ES8_Terra-FM1_Edition1-CV CER_ES8_Terra-FM1_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1997-12-27; Stop_Date=2000-03-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost_Longitude=180] [Data_Resolution: Temporal_Resolution=1 day; Temporal_Resolution_Range=Daily - < Weekly].
International Nuclear Information System (INIS)
Xie Shengkai; Guo Dongfa; Tan Jing; Zhang Yanhui; Huang Qiuhong; Gao Aiguo
2013-01-01
It is very important for the rapid and reliable determination of 230 Th/ 232 Th in the thorium-230 dating. A method of measuring 230 Th/ 232 Th in natural samples by high resolution inductively coupled plasma mass spectrometer (HR-ICP-MS) was developed on the base of our former work. The precise and accurate of natural 230 Th in geology samples is challenging, as the peak tailing to the high intensity of neighboring peak at 232 Th and the mass discrimination of the instrument. The peak tailing of 238 U to 236 U was used to decrease the peak tailing effect of 232 Th to 230 Th. The mass discrimination factor K between ture and measured isotope ratio was calculated after measuring different 230 Th/ 232 Th ratio solutions. Lab used standard samples was digested in mixed acids of HN0 3 -HF-HCI-HCl0 4 , and separated by the Bio-rad AG 1 × 8 Cl - resin. The measurement method of blank-standard-blank-sample procession was used to determinate the 230 Th/ 232 Th. The measured result of 230 Th/ 232 Th was at (7.29 ± 0.34) × 10 -6 , which agreed with the reference value of (7.33 ± 0.17) × 10 -6 . (authors)
42 CFR 455.232 - Medicaid integrity audit program contractor functions.
2010-10-01
... 42 Public Health 4 2010-10-01 2010-10-01 false Medicaid integrity audit program contractor functions. 455.232 Section 455.232 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL ASSISTANCE PROGRAMS PROGRAM INTEGRITY: MEDICAID Medicaid...
International Nuclear Information System (INIS)
Arruda Neto, J.D.T.; Rigolon, W.; Herdade, S.B.; Riette, H.L.
1983-11-01
The bremsstrahlung-induced fission cross section of 232 Th was measured in the energy region of the Giant Dipole Resonance. The data analysis, performed in terms of the bremsstrahlung spectrum calculated in the Davies-Bethe-Maximon approximation, suggested that the photofission cross section measured at Livermore is correct, and that the (γ,f) data from Saclay are highly questionable. (Author) [pt
International Nuclear Information System (INIS)
Singh, M.; Pradeep Kumar; Singh, Y.; Varshney, A.K.; Gupta, D.K.
2014-01-01
We undertake the present work to treat 232 Th with a soft rotor formula used recently by C. Bihari et. al for γ-band and modified by J.B. Gupta et. al. It describes energy in terms of moment of inertia and softness parameter
CERES ERBE-like Monthly Geographical Averages (ES-4) in HDF (CER_ES4_Aqua-FM4_Edition2)
Wielicki, Bruce A. (Principal Investigator)
The ERBE-like Monthly Geographical Averages (ES-4) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-4 is also produced for combinations of scanner instruments. For each observed 2.5-degree spatial region, the daily average, the hourly average over the month, and the overall monthly average of shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-9 product are spatially nested up from 2.5-degree regions to 5- and 10-degree regions, to 2.5-, 5-, and 10-degree zonal averages, and to global monthly averages. For each nested area, the albedo and net flux are given. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The following CERES ES4 data sets are currently available: CER_ES4_FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition2 CER_ES4_PFM+FM1_Edition1 CER_ES4_PFM+FM2_Edition1 CER_ES4_TRMM-PFM_Edition1 CER_ES4_TRMM-PFM_Edition2 CER_ES4_Terra-FM1_Edition1 CER_ES4_Terra-FM2_Edition1 CER_ES4_FM1+FM2_Edition2 CER_ES4_Terra-FM1_Edition2 CER_ES4_Terra-FM2_Edition2 CER_ES4_Aqua-FM3_Edition1 CER_ES4_Aqua-FM4_Edition1 CER_ES4_FM1+FM2+FM3+FM4_Edition1 CER_ES4_Aqua-FM3_Edition2 CER_ES4_Aqua-FM4_Edition2 CER_ES4_FM1+FM3_Edition2 CER_ES4_FM1+FM4_Edition2 CER_ES4_PFM+FM1_Edition2 CER_ES4_PFM+FM2_Edition2 CER_ES4_Aqua-FM3_Edition1-CV CER_ES4_Aqua-FM4_Edition1-CV CER_ES4_Terra-FM1_Edition1-CV CER_ES4_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2005-03-29] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost_Longitude=180] [Data_Resolution: Latitude_Resolution=2.5 degree; Longitude_Resolution=2.5 degree; Horizontal
CERES ERBE-like Monthly Geographical Averages (ES-4) in HDF (CER_ES4_Aqua-FM3_Edition2)
Wielicki, Bruce A. (Principal Investigator)
The ERBE-like Monthly Geographical Averages (ES-4) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-4 is also produced for combinations of scanner instruments. For each observed 2.5-degree spatial region, the daily average, the hourly average over the month, and the overall monthly average of shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-9 product are spatially nested up from 2.5-degree regions to 5- and 10-degree regions, to 2.5-, 5-, and 10-degree zonal averages, and to global monthly averages. For each nested area, the albedo and net flux are given. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The following CERES ES4 data sets are currently available: CER_ES4_FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition2 CER_ES4_PFM+FM1_Edition1 CER_ES4_PFM+FM2_Edition1 CER_ES4_TRMM-PFM_Edition1 CER_ES4_TRMM-PFM_Edition2 CER_ES4_Terra-FM1_Edition1 CER_ES4_Terra-FM2_Edition1 CER_ES4_FM1+FM2_Edition2 CER_ES4_Terra-FM1_Edition2 CER_ES4_Terra-FM2_Edition2 CER_ES4_Aqua-FM3_Edition1 CER_ES4_Aqua-FM4_Edition1 CER_ES4_FM1+FM2+FM3+FM4_Edition1 CER_ES4_Aqua-FM3_Edition2 CER_ES4_Aqua-FM4_Edition2 CER_ES4_FM1+FM3_Edition2 CER_ES4_FM1+FM4_Edition2 CER_ES4_PFM+FM1_Edition2 CER_ES4_PFM+FM2_Edition2 CER_ES4_Aqua-FM3_Edition1-CV CER_ES4_Aqua-FM4_Edition1-CV CER_ES4_Terra-FM1_Edition1-CV CER_ES4_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2005-12-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost_Longitude=180] [Data_Resolution: Latitude_Resolution=2.5 degree; Longitude_Resolution=2.5 degree; Horizontal
Gamma-spectrometric determination of {sup 232}U in uranium-bearing materials
Energy Technology Data Exchange (ETDEWEB)
Zsigrai, Jozsef [European Commission, Joint Research Centre (JRC), Institute for Transuranium Elements (ITU), 76125 Karlsruhe, P.O. Box 2340 (Germany); Nguyen, Tam Cong [Centre for Energy Research of the Hungarian Academy of Sciences (EK), 1525 Budapest 114, P.O. Box 49 (Hungary); Berlizov, Andrey [European Commission, Joint Research Centre (JRC), Institute for Transuranium Elements (ITU), 76125 Karlsruhe, P.O. Box 2340 (Germany)
2015-09-15
The {sup 232}U content of various uranium-bearing items was measured using low-background gamma spectrometry. The method is independent of the measurement geometry, sample form and chemical composition. Since {sup 232}U is an artificially produced isotope, it carries information about previous irradiation of the material, which is relevant for nuclear forensics, nuclear safeguards and for nuclear reactor operations. A correlation between the {sup 232}U content and {sup 235}U enrichment of the investigated samples has been established, which is consistent with theoretical predictions. It is also shown how the correlation of the mass ratio {sup 232}U/{sup 235}U vs. {sup 235}U content can be used to distinguish materials contaminated with reprocessed uranium from materials made of reprocessed uranium.
Energy Technology Data Exchange (ETDEWEB)
Ahnen, M. L.; Biland, A. [ETH Zurich, CH-8093 Zurich (Switzerland); Ansoldi, S.; Biasuzzi, B. [Università di Udine, and INFN Trieste, I-33100 Udine (Italy); Antonelli, L. A.; Bonnoli, G.; Carosi, A. [INAF National Institute for Astrophysics, I-00136 Rome (Italy); Antoranz, P. [Università di Siena, and INFN Pisa, I-53100 Siena (Italy); Babic, A. [Croatian MAGIC Consortium, Rudjer Boskovic Institute, University of Rijeka, University of Split and University of Zagreb (Croatia); Banerjee, B. [Saha Institute of Nuclear Physics, 1\\AF Bidhannagar, Salt Lake, Sector-1, Kolkata 700064 (India); Bangale, P.; Almeida, U. Barres de; Borracci, F. [Max-Planck-Institut für Physik, D-80805 München (Germany); Barrio, J. A.; Bonnefoy, S. [Universidad Complutense, E-28040 Madrid (Spain); Bednarek, W. [University of Łódź, PL-90236 Lodz (Poland); Bernardini, E. [Deutsches Elektronen-Synchrotron (DESY), D-15738 Zeuthen (Germany); Blanch, O. [IFAE, Campus UAB, E-08193 Bellaterra (Spain); Bretz, T. [Universität Würzburg, D-97074 Würzburg (Germany); Carmona, E., E-mail: fabrizio.tavecchio@brera.inaf.it, E-mail: miguelnievas@ucm.es, E-mail: manganaro@iac.es, E-mail: josefa.becerra@nasa.gov [Centro de Investigaciones Energéticas, Medioambientales y Tecnológicas, E-28040 Madrid (Spain); Collaboration: MAGIC Collaboration; Fermi-LAT Collaboration; and others
2015-12-20
The flat-spectrum radio quasar PKS 1441+25 at a redshift of z = 0.940 is detected between 40 and 250 GeV with a significance of 25.5σ using the MAGIC telescopes. Together with the gravitationally lensed blazar QSO B0218+357 (z = 0.944), PKS 1441+25 is the most distant very high energy (VHE) blazar detected to date. The observations were triggered by an outburst in 2015 April seen at GeV energies with the Large Area Telescope on board Fermi. Multi-wavelength observations suggest a subdivision of the high state into two distinct flux states. In the band covered by MAGIC, the variability timescale is estimated to be 6.4 ± 1.9 days. Modeling the broadband spectral energy distribution with an external Compton model, the location of the emitting region is understood as originating in the jet outside the broad-line region (BLR) during the period of high activity, while being partially within the BLR during the period of low (typical) activity. The observed VHE spectrum during the highest activity is used to probe the extragalactic background light at an unprecedented distance scale for ground-based gamma-ray astronomy.
Mass distributions in monoenergetic-neutron-induced fission of 232Th
International Nuclear Information System (INIS)
Glendenin, L.E.; Gindler, J.E.; Ahmad, I.; Henderson, D.J.; Meadows, J.W.
1980-01-01
Fission product yields for 38 masses were determined for the fission of 232 Th with essentially monoenergetic neutrons of 2.0, 3.0, 4.0, 5.9, 6.4, 6.9, 7.6, and 8.0 MeV. Fission product activities were measured by Ge(Li) γ-ray spectrometry of irradiated 232 Th foils and by chemical separation of the fission product elements followed by β counting. The mass yield data for 232 Th(n,f ) show a sensitive increase of fission yields in the near-symmetric mass region (valley) with increasing incident neutron energy E/sub n/ and a pronounced dip in yield at the onset of second-chance fission just above the neutron binding energy (at approx. 6 MeV) where the excitation energy is lowered by competition with neutron evaporation prior to fission. The effect of second-chance fission is also seen in the yields of asymmetric peak products. A distinct third peak is observed at symmetry in the valley of the mass distribution, and enhanced yields are observed in the asymmetric peaks at masses associated with even Z (proton pairing effect). The fission yeilds of 232 Th(n,f ) are compared with those of 238 U(n,f ) and 232 Th
CERES ERBE-like Monthly Regional Averages (ES-9) in HDF (CER_ES9_Aqua-FM4_Edition2)
Wielicki, Bruce A. (Principal Investigator)
The ERBE-like Monthly Regional Averages (ES-9) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-9 is also produced for combinations of scanner instruments. All instantaneous shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-8 product for a month are sorted by 2.5-degree spatial regions, by day number, and by the local hour of observation. The mean of the instantaneous fluxes for a given region-day-hour bin is determined and recorded on the ES-9 along with other flux statistics and scene information. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The ES-9 also contains hourly average fluxes for the month and an overall monthly average for each region. These average fluxes are given for both clear-sky and total-sky scenes. The following CERES ES9 data sets are currently available: CER_ES9_FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition2 CER_ES9_PFM+FM1_Edition1 CER_ES9_PFM+FM2_Edition1 CER_ES9_PFM+FM1_Edition2 CER_ES9_PFM+FM2_Edition2 CER_ES9_TRMM-PFM_Edition1 CER_ES9_TRMM-PFM_Edition2 CER_ES9_Terra-FM1_Edition1 CER_ES9_Terra-FM2_Edition1 CER_ES9_FM1+FM2_Edition2 CER_ES9_Terra-FM1_Edition2 CER_ES9_Terra-FM2_Edition2 CER_ES9_Aqua-FM3_Edition1 CER_ES9_Aqua-FM4_Edition1 CER_ES9_FM1+FM2+FM3+FM4_Edition1 CER_ES9_Aqua-FM3_Edition2 CER_ES9_Aqua-FM4_Edition2 CER_ES9_FM1+FM3_Edition2 CER_ES9_FM1+FM4_Edition2 CER_ES9_Aqua-FM3_Edition1-CV CER_ES9_Aqua-FM4_Edition1-CV CER_ES9_Terra-FM1_Edition1-CV CER_ES9_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2005-03-29] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost
Optical flare observed in the flaring gamma-ray blazar CGRaBS J0809+5341 (87GB 080551.6+535010)
Pursimo, Tapio; Galindo-Guil, F. J.; Serrano, Pere Blay; Ojha, Roopesh
2017-11-01
We report optical photometry of the blazar CGRaBS J0809+5341 (87GB 080551.6+535010), obtained with the 2.56m Nordic Optical Telescope in La Palma, to look for any enhanced optical activity associated with a recent flare in the daily averaged gamma-ray flux (ATel#10905).
OPTICAL AND INFRARED PHOTOMETRY OF THE BLAZAR PKS 0537-441: LONG AND SHORT TIMESCALE VARIABILITY
International Nuclear Information System (INIS)
Impiombato, D.; Treves, A.; Covino, S.; Foschini, L.; Fugazza, D.; Pian, E.; Tosti, G.; Ciprini, S.; Nicastro, L.
2011-01-01
We present a large collection of photometric data on the blazar PKS 0537-441 in the VRIJHK bands taken in 2004-2009. At least three flare-like episodes with months duration and >3 mag amplitude are apparent. The spectral energy distribution is consistent with a power law, and no indication of a thermal component is found. We searched for short timescale variability, and an interesting event was identified in the J band, with a duration of ∼25 minutes.
Studies on 232Th and 238U levels in marine algae collected from the coast of Niigata Prefecture
International Nuclear Information System (INIS)
Kato, Kenji; Tonouchi, Shigemasa; Maruta, Fumiyuki; Ebata, Hidekazu
2001-01-01
To evaluate the properties of algae to concentrate radioactive elements, 14 species of algae like Sargassum were collected in the Prefecture and analyzed for their 232 Th and 238 U levels with Yokogawa HP4500 ICP-MS apparatus. The places of collection included those near the water discharge of an atomic power station. Mean 232 Th and 238 U levels were found to be 120 and 260 ng/g dry wt, respectively, and Phaeophyta showed more than several times higher 238 U level than Chlorophyta and Rhodophyta. There was no clear difference in 232 Th levels. No difference between places of collection was observed in Sargassum 232 Th or 238 U level. Adsorption of 232 Th particle to and incorporation of soluble 238 U into algae body were suggested. Mean 232 Th and 238 U radioactivities were found 73 and 510 μBq/g wet wt, respectively, and the respective annual committed effective doses, 0.2 and 0.3 μSv, calculated from those values were confirmed to be enough lower than the annual public dose limit, 1 mSv. (K.H.)
Dreiseitel, Jiří
2012-01-01
Práce je věnována problematice konstrukce převodníku Ethernet na RS-232 za pomocí jednočipového mikrokontroléru. Cílem je seznámit čtenáře se síťovou technologií Ethernet a technologií pro sériový přenos založený na protokolu RS-232 a zároveň s technologií vestavěných systémů pro konstrukci zařízení. Součástí práce je kompletní návrh převodníku Ethernet na RS-232 včetně návrhu a implementace firmware v jazyce C za využití LwIP TCP/IP stacku. Převodník je postaven na základě vývojového kitu ST...
CERES ERBE-like Instantaneous TOA Estimates (ES-8) in HDF (CER_ES8_Aqua-FM3_Edition2)
Wielicki, Bruce A. (Principal Investigator)
The ES-8 archival data product contains a 24-hour, single-satellite, instantaneous view of scanner fluxes at the top-of-atmosphere (TOA) reduced from spacecraft altitude unfiltered radiances using Earth Radiation Budget Experiment (ERBE) scanner Inversion algorithms and the ERBE shortwave (SW) and longwave (LW) Angular Distribution Models (ADMs). The ES-8 also includes the total (TOT), SW, LW, and window (WN) channel radiometric data; SW, LW, and WN unfiltered radiance values; and the ERBE scene identification for each measurement. These data are organized according to the CERES 3.3-second scan into 6.6-second records. As long as there is one valid scanner measurement within a record, the ES-8 record will be generated. The following CERES ES8 data sets are currently available: CER_ES8_TRMM-PFM_Edition1 CER_ES8_TRMM-PFM_Edition2 CER_ES8_TRMM-PFM_Transient-Ops2 CER_ES8_Terra-FM1_Edition1 CER_ES8_Terra-FM2_Edition1 CER_ES8_Terra-FM1_Edition2 CER_ES8_Terra-FM2_Edition2 CER_ES8_Aqua-FM3_Edition1 CER_ES8_Aqua-FM4_Edition1 CER_ES8_Aqua-FM3_Edition2 CER_ES8_Aqua-FM4_Edition2 CER_ES8_Aqua-FM3_Edition1-CV CER_ES8_Aqua-FM4_Edition1-CV CER_ES8_Terra-FM1_Edition1-CV CER_ES8_Terra-FM1_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1997-12-27; Stop_Date=2005-12-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost_Longitude=180] [Data_Resolution: Temporal_Resolution=1 day; Temporal_Resolution_Range=Daily - < Weekly].
48 CFR 52.232-26 - Prompt payment for fixed-price architect-engineer contracts.
2010-10-01
...-price architect-engineer contracts. 52.232-26 Section 52.232-26 Federal Acquisition Regulations System... Text of Provisions and Clauses 52.232-26 Prompt payment for fixed-price architect-engineer contracts...-Engineer Contracts (OCT 2008) Notwithstanding any other payment terms in this contract, the Government will...
Clark, Tara R.; Zhao, Jian-xin; Feng, Yue-xing; Done, Terry J.; Jupiter, Stacy; Lough, Janice; Pandolfi, John M.
2012-02-01
The main limiting factor in obtaining precise and accurate uranium-series (U-series) ages of corals that lived during the last few hundred years is the ability to constrain and correct for initial thorium-230 ( 230Th 0), which is proportionally much higher in younger samples. This is becoming particularly important in palaeoecological research where accurate chronologies, based on the 230Th chronometer, are required to pinpoint changes in coral community structure and the timing of mortality events in recent time (e.g. since European settlement of northern Australia in the 1850s). In this study, thermal ionisation mass spectrometry (TIMS) U-series dating of 43 samples of known ages collected from living Porites spp. from the far northern, central and southern inshore regions of the Great Barrier Reef (GBR) was performed to spatially constrain initial 230Th/ 232Th ( 230Th/ 232Th 0) variability. In these living Porites corals, the majority of 230Th/ 232Th 0 values fell within error of the conservative bulk Earth 230Th/ 232Th atomic value of 4.3 ± 4.3 × 10 -6 (2 σ) generally assumed for 230Th 0 corrections where the primary source is terrestrially derived. However, the results of this study demonstrate that the accuracy of 230Th ages can be further improved by using locally determined 230Th/ 232Th 0 values for correction, supporting the conclusion made by Shen et al. (2008) for the Western Pacific. Despite samples being taken from regions adjacent to contrasting levels of land modification, no significant differences were found in 230Th/ 232Th 0 between regions exposed to varying levels of sediment during river runoff events. Overall, 39 of the total 43 230Th/ 232Th 0 atomic values measured in samples from inshore reefs across the entire region show a normal distribution ranging from 3.5 ± 1.1 to 8.1 ± 1.1 × 10 -6, with a weighted mean of 5.76 ± 0.34 × 10 -6 (2 σ, MSWD = 8.1). Considering the scatter of the data, the weighted mean value with a more
MicroRNA modulation induced by AICA ribonucleotide in J1 mouse ES cells.
Directory of Open Access Journals (Sweden)
Xiaoyan Shi
Full Text Available ES cells can propagate indefinitely, maintain self-renewal, and differentiate into almost any cell type of the body. These properties make them valuable in the research of embryonic development, regenerative medicine, and organ transplantation. MicroRNAs (miRNAs are considered to have essential functions in the maintenance and differentiation of embryonic stem cells (ES cells. It was reported that, strong external stimuli, such as a transient low-pH and hypoxia stress, were conducive to the formation of induced pluripotent stem cells (iPS cells. AICA ribonucleotide (AICAR is an AMP-activated protein kinase activator, which can let cells in the state of energy stress. We have demonstrated that AICAR can maintain the pluripotency of J1 mouse ES cells through modulating protein expression in our previous research, but its effects on ES cell miRNA expression remain unknown. In this study, we conducted small RNA high-throughput sequencing to investigate AICAR influence on J1 mouse ES cells by comparing the miRNA expression patterns of the AICAR-treated cells and those without treatment. The result showed that AICAR can significantly modulate the expression of multiple miRNAs, including those have crucial functions in ES cell development. Some differentially expressed miRNAs were selected and confirmed by real-time PCR. For the differently expressed miRNAs identified, further study was conducted regarding the pluripotency and differentiation associated miRNAs with their targets. Moreover, miR-134 was significantly down-regulated after AICAR treatment, and this was suggested to be directly associated with the up-regulated pluripotency markers, Nanog and Sox2. Lastly, Myc was significantly down-regulated after AICAR treatment; therefore, we predicted miRNAs that may target Myc and identified that AICAR induced up-regulation of miR-34a, 34b, and 34c can repress Myc expression in J1 mouse ES cells. Taken together, our study provide a new mechanism for
Lesões do sistema urinário em 1.063 cães
Inkelmann,Maria Andréia; Kommers,Glaucia D.; Trost,Maria Elisa; Barros,Claudio S.L.; Fighera,Rafael A.; Irigoyen,Luiz Francisco; Silveira,Isadora P.
2012-01-01
Com o objetivo de realizar um estudo abrangente das lesões do sistema urinário em cães e determinar a sua prevalência, epidemiologia, importância clínica e possíveis causas associadas, foram revisados os protocolos de necropsias de cães realizadas no período de janeiro de 1999 a dezembro de 2010 no LPV-UFSM. Nesse período foram necropsiados 3.189 cães e destes, cerca de 30% apresentaram lesões no sistema urinário. Na maioria dos cães (79,1%) foram observadas lesões únicas e em aproximadamente...
TIME-DEPENDENT ELECTRON ACCELERATION IN BLAZAR TRANSIENTS: X-RAY TIME LAGS AND SPECTRAL FORMATION
Energy Technology Data Exchange (ETDEWEB)
Lewis, Tiffany R.; Becker, Peter A. [Department of Physics and Astronomy, George Mason University, Fairfax, VA 22030-4444 (United States); Finke, Justin D., E-mail: pbecker@gmu.edu, E-mail: tlewis13@gmu.edu, E-mail: justin.finke@nrl.navy.mil [U.S. Naval Research Laboratory, Code 7653, 4555 Overlook Avenue SW, Washington, DC 20375-5352 (United States)
2016-06-20
Electromagnetic radiation from blazar jets often displays strong variability, extending from radio to γ -ray frequencies. In a few cases, this variability has been characterized using Fourier time lags, such as those detected in the X-rays from Mrk 421 using Beppo SAX. The lack of a theoretical framework to interpret the data has motivated us to develop a new model for the formation of the X-ray spectrum and the time lags in blazar jets based on a transport equation including terms describing stochastic Fermi acceleration, synchrotron losses, shock acceleration, adiabatic expansion, and spatial diffusion. We derive the exact solution for the Fourier transform of the electron distribution and use it to compute the Fourier transform of the synchrotron radiation spectrum and the associated X-ray time lags. The same theoretical framework is also used to compute the peak flare X-ray spectrum, assuming that a steady-state electron distribution is achieved during the peak of the flare. The model parameters are constrained by comparing the theoretical predictions with the observational data for Mrk 421. The resulting integrated model yields, for the first time, a complete first-principles physical explanation for both the formation of the observed time lags and the shape of the peak flare X-ray spectrum. It also yields direct estimates of the strength of the shock and the stochastic magnetohydrodynamical wave acceleration components in the Mrk 421 jet.
Photometric investigation of hot exoplanets: TrES-3b and Qatar-1b
Püsküllü, Ç.; Soydugan, F.; Erdem, A.; Budding, E.
2017-08-01
New photometric follow-up observations of transitting 'hot Jupiters' TrES-3b and Qatar-1b are presented. Weighted mean values of the solutions of light curves in R-filter for both planetary systems are reported and compared with the previous results. The transit light curves were analysed using the WINFITTER code. The physical properties of the planets were estimated. The planet radii are found to be Rp = 1.381 ± 0.033RJ for TrES-3b and Rp = 1.142 ± 0.025RJ for Qatar-1b. Transit times and their uncertainties were also determined and a new linear ephemeris was computed for both systems. Analysis of transit times showed that a significant signal could not be determined for TrES-3b, while weak evidence was found for Qatar-1b, which might be tested using more precise future transit times.
238U, 234U and 232Th in seawater
International Nuclear Information System (INIS)
Chen, J.H.; Edwards, R.L.; Wasserburg, G.J.
1986-01-01
We have developed techniques to determine 238 U, 234 U and 232 Th concentrations in seawater by isotope dilution mass spectrometry. Using these techniques, we have measured 238 U, 234 U and 232 Th in vertical profiles of unfiltered, acidified seawater from the Atlantic and 238 U and 234 U in vertical profiles from the Pacific. Determinations of 234 U/ 238 U at depths ranging from 0 to 4900 m in the Atlantic (7 0 44'N, 40 0 43'W) and the Pacific (14 0 41'N, 160 0 01'W) Oceans are the same within experimental error (±5per mille, 2σ). The average of these 234 U/ 238 U measurements is 144±2per mille (2σ) higher than the equilibrium ratio of 5.472 x 10 -5 . U concentrations, normalized to 35per mille salinity, range from 3.162 to 3.281 ng/g, a range of 3.8%. The average concentration of the Pacific samples (31 0 4'N, 159 0 1'W) is ∝1% higher than that of the Atlantic (7 0 44'N, 40 0 43'W and 31 0 49'N, 64 0 6'W). 232 Th concentrations from an Atlantic profile range from 0.092 to 0.145 pg/g. The observed constancy of the 234 U/ 238 U ratio is consistent with the predicted range of 234 U/ 238 U using a simple two-box model and the residence time of deep water in the ocean determined from 14 C. The variation in salinity-normalized U concentrations suggests that U may be much more reactive in the marine environment than previously thought. (orig./WB)
Calibration of uranium 232 solution
International Nuclear Information System (INIS)
Galan, M.P.; Acena, M.L.
1988-01-01
A method for acertainning the activity by alpha spectroscopy with semiconductor detectors, of a solution of Uranium-232 is presented. It consists of the comparison with a Uranium-233 solution activity previously measured in a gridded ionization chamber of 2 π geometry. The total measurement uncertainty is about +- 0,02. (Author)
International Nuclear Information System (INIS)
Feng, S.; Yang, Y.W.; Lu, X.X.; Liu, R.; Jiang, L.; Zhu, T.H.; Wang, M.; Qin, J.G.
2015-01-01
Highlights: • An integral experiment for 232 Th(n, 2n) reaction was carried out on the newly-established ThO 2 /depleted uranium cylinders. • 232 Th(n, 2n) reaction rate distribution was obtained in the assemblies with an uncertainty of about 7%. • Experiments were analyzed by MCNP code with ENDF/B-VI.8, ENDF/B-VII.0, JENDL-4.0 and CENDL-3.1 libraries. • Experimental results could be used to re-evaluate the cross sections of 232 Th(n, 2n) reaction. - Abstract: In order to verify the evaluated cross sections of 232 Th(n, 2n) reaction for the conceptual design of the thorium based subcritical blanket in the fusion–fission hybrid reactor, an integral experiment on thorium oxide/depleted uranium cylinders was carried out with D-T neutrons using the activation technique. 232 Th(n, 2n) reaction rate distribution was obtained at the central axis direction in the assemblies with an uncertainty of about 7%. Experiments were analyzed by using MCNP code with ENDF/B-VI.8, ENDF/B-VII.0, JENDL-4.0 and CENDL-3.1 libraries to validate the nuclear data libraries of 232 Th(n, 2n) reaction, the calculated results with JENDL-4.0 agree with the measurements the best with discrepancies within the experimental uncertainty. The average values of C/E for the three benchmark assemblies are 1.058, 1.044 and 0.980. Calculations with different evaluated libraries in the benchmark assemblies show a large discrepancy. The experimental results can be used to re-evaluate the cross sections of the 232 Th(n, 2n) reaction
Directory of Open Access Journals (Sweden)
R. Damayanti
2017-05-01
Full Text Available An experimental transmission study was conducted using nine healthy Indonesian indigenous chickens placed together with two 30 days old ducks which were experimentally infected with H5N1 HPAI clade 2.3.2 virus in the Biosafety Laboratory Level 3 (BSL-3 facilities. The aim of the study was to find out the pathogenicity of H5N1 HPAI virus clade 2.3.2 in Indonesian indigenous chickens. The study showed that within twenty four hours rearing, the chickens were exhibited mild clinical signs and by 48 hours, all of the chickens died, whereas the ducks survived but with severe clinical signs. The H5N1 HPAI virus has been successfully isolated from chickens and ducks swabs, confirming that those animals were infected by the virus. Histologically, the infected chicken encountered with severe inflammation reaction namely non suppuratives encephalitis, tracheitis, myocarditis, interstitial pneumonia, hepatitis, proventriculitis, enteritis, pancreatitis, nephritis and bursitis. Necrotizing spleen and pancreas were also prominent. Viral antigen was detected by immunohistochemistry staining in various affected visceral organs. This suggests that Indonesian indigenous chickens were susceptible to H5N1 HPAI virus clade 2.3.2 and it can be transmitted easily to Indonesian indigenous chickens by contact transmission with infected ducks.
Ramli, A Termizi; Hussein, A Wahab M A; Wood, A Khalik
2005-01-01
Concentrations of uranium-238 and thorium-232 in soil, water, grass, moss and oil-palm fruit samples collected from an area of high background radiation were determined using neutron activation analysis (NAA). U-238 concentration in soil ranged from 4.9 mg kg(-1) (58.8 Bq kg(-1)) to 40.4 mg kg(-1) (484.8 Bq kg(-1)), Th-232 concentration ranged from 14.9 mg kg(-1) (59.6 Bq kg(-1)) to 301.0 mg kg(-1) (1204 Bq kg(-1)). The concentration of U-238 in grass samples ranged from below the detection limit to 0.076 mg kg(-1) (912 mBq kg(-1)), and Th-232 ranged from 0.008 mg kg(-1) (32 mBq kg(-1)) to 0.343 mg kg(-1) (1.372 Bq kg(-1)). U-238 content in water samples ranged from 0.33 mg kg(-1) (4.0 Bq L(-1)) to 1.40 mg kg(-1) (16.8 Bq L(-1)), and Th-232 ranged from 0.19 mg kg(-1) (0.76 Bq L(-1)) to 0.66 mg kg(-1) (2.64 Bq L(-1)). It can be said that the concentrations of environmental U-238 and Th-232 in grass and water samples in the study area are insignificant. Mosses were found to be possible bio-radiological indicators due to their high absorption of the heavy radioelements from the environment.
International Nuclear Information System (INIS)
Hess, A.L.
1995-01-01
This Criticality Safety Evaluation Report addendum extends the coverage of the original CSER (90-006) about dismantling the ductwork in 232-Z to include cleanout of the Scrubber Glovebox, with an estimated residual Pu holdup of less than 200 grams. For conservatism and containment considerations, the provisions about waste packaging and water exclusion from the original work are retained, even though it is not credible for the Scrubber Pu content to be made critical with water added (NDA gives about 1/3 a minimum critical mass)
28 CFR 2.32 - Parole to local or immigration detainers.
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Parole to local or immigration detainers... § 2.32 Parole to local or immigration detainers. (a) When a State or local detainer is outstanding... wishes to parole a prisoner subject to a detainer filed by Federal immigration officials, the Commission...
International Nuclear Information System (INIS)
Galan Valera, M. P.; Acena Berrenechea, M. L.
1988-01-01
A method for as certain the activity by alpha spectroscopy with semiconductor detectors, of a solution of 232U is presented. It consists of the comparison with a 233U solution activity previously measured in a gridded ionization chamber of 2π geometry. The total measurement uncertainty is about + - 0,02. (Author) 9 refs
Electrodisintegration of 232Th by neutron emission
International Nuclear Information System (INIS)
Terremoto, L.A.A.
1986-01-01
The one neutron decay of the giant electric quadrupole resonance was studied by means of electrodisintegration and photodisintegration reactions. The separation of the multipole components of the photonuclear cross section σ γ,n (E) in 232 90 Th was also performed. The 232 Th(e,n) 231 Th cross section and the 232 Th(B,n) 231 Th bremsstrahlung yield were measured in the incident electron energy range 8-60 MeV and 25-60 MeV, respectively. These measurements have been performed using the electron beam of the Linear Accelerator of the IFUSP and the experimental technique of activation analysis. The virtual photon spectra corrected for nuclear finite size in the analysis of the experimental data obtained in order to separate the multipole components of the photonuclear cross section, was used. An electric dipole component σ EL γ,n (E) that exhausts (60+-7)% of the El sum rule (integrated uσ to 16,5 MeV) was shown. This result is in agreement with the one Obtained in experiments where monoenergetic photons were used. An electric quadrupole component σ E2 γ,n (E) whose value corresponds to (32+-6)% of the E2 sum rule, was also obtained. (author) [pt
Long-term monitoring of blazars - the DWARF network
Backes, Michael; Biland, Adrian; Boller, Andrea; Braun, Isabel; Bretz, Thomas; Commichau, Sebastian; Commichau, Volker; Dorner, Daniela; von Gunten, Hanspeter; Gendotti, Adamo; Grimm, Oliver; Hildebrand, Dorothée; Horisberger, Urs; Krähenbühl, Thomas; Kranich, Daniel; Lustermann, Werner; Mannheim, Karl; Neise, Dominik; Pauss, Felicitas; Renker, Dieter; Rhode, Wolfgang; Rissi, Michael; Rollke, Sebastian; Röser, Ulf; Stark, Luisa Sabrina; Stucki, Jean-Pierre; Viertel, Gert; Vogler, Patrick; Weitzel, Quirin
The variability of the very high energy (VHE) emission from blazars seems to be connected with the feeding and propagation of relativistic jets and with their origin in supermassive black hole binaries. The key to understanding their properties is measuring well-sampled gamma-ray lightcurves, revealing the typical source behavior unbiased by prior knowledge from other wavebands. Using ground-based gamma-ray observatories with exposures limited by dark-time, a global network of several telescopes is needed to carry out fulltime measurements. Obviously, such observations are time-consuming and, therefore, cannot be carried out with the present state of the art instruments. The DWARF telescope on the Canary Island of La Palma is dedicated to monitoring observations. It is currently being set up, employing a costefï¬cient and robotic design. Part of this project is the future construction of a distributed network of small telescopes. The physical motivation of VHE long-term monitoring will be outlined in detail and the perspective for a network for 24/7 observations will be presented.
24 CFR 232.625 - Discrimination prohibited.
2010-04-01
... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MORTGAGE INSURANCE FOR NURSING HOMES, INTERMEDIATE CARE FACILITIES, BOARD AND CARE HOMES, AND ASSISTED... Fire Safety Equipment Special Requirements § 232.625 Discrimination prohibited. Any contract or...
Chung, HaeWon; Lee, Bum-Kyu; Uprety, Nadima; Shen, Wenwen; Lee, Jiwoon; Kim, Jonghwan
2016-04-01
Yap1 is a transcriptional co-activator of the Hippo pathway. The importance of Yap1 in early cell fate decision during embryogenesis has been well established, though its role in embryonic stem (ES) cells remains elusive. Here, we report that Yap1 plays crucial roles in normal differentiation rather than self-renewal of ES cells. Yap1-depleted ES cells maintain undifferentiated state with a typical colony morphology as well as robust alkaline phosphatase activity. These cells also retain comparable levels of the core pluripotent factors, such as Pou5f1 and Sox2, to the levels in wild-type ES cells without significant alteration of lineage-specific marker genes. Conversely, overexpression of Yap1 in ES cells promotes nuclear translocation of Yap1, resulting in disruption of self-renewal and triggering differentiation by up-regulating lineage-specific genes. Moreover, Yap1-deficient ES cells show impaired induction of lineage markers during differentiation. Collectively, our data demonstrate that Yap1 is a required factor for proper differentiation of mouse ES cells, while remaining dispensable for self-renewal. © 2016 The Authors.
Directory of Open Access Journals (Sweden)
Mohammed Daeih Hassoun محمد ضايع حسون
2014-12-01
Full Text Available This research is an attempt to study the conditions of Hilla administrative since it established year 495 AH / 1101 AD until the end of the Abbasid era in 656 AH / 1258, Since Hilla is one of the Important Iraq cities that contributed to the political, social and economic events and had a big role in weakening the Seljuk power in Iraq, and that the reason of building it was politically and administratively represented in the desire of its founder Prince charity bin Mansour Mazeedi in maintaining its influence and achieve its goal of secession from the Seljuk State, when he saw suitable conditions because of the large number of funds and preoccupation with the sultans of the Seljuks in the ongoing disputes; for that he established Hilla and taken home to the emirate in 495 AH / 1101 AD
Di Mauro, M.; Manconi, S.; Zechlin, H.-S.; Ajello, M.; Charles, E.; Donato, F.
2018-04-01
The Fermi Large Area Telescope (LAT) Collaboration has recently released the Third Catalog of Hard Fermi-LAT Sources (3FHL), which contains 1556 sources detected above 10 GeV with seven years of Pass 8 data. Building upon the 3FHL results, we investigate the flux distribution of sources at high Galactic latitudes (| b| > 20^\\circ ), which are mostly blazars. We use two complementary techniques: (1) a source-detection efficiency correction method and (2) an analysis of pixel photon count statistics with the one-point probability distribution function (1pPDF). With the first method, using realistic Monte Carlo simulations of the γ-ray sky, we calculate the efficiency of the LAT to detect point sources. This enables us to find the intrinsic source-count distribution at photon fluxes down to 7.5 × 10‑12 ph cm‑2 s‑1. With this method, we detect a flux break at (3.5 ± 0.4) × 10‑11 ph cm‑2 s‑1 with a significance of at least 5.4σ. The power-law indexes of the source-count distribution above and below the break are 2.09 ± 0.04 and 1.07 ± 0.27, respectively. This result is confirmed with the 1pPDF method, which has a sensitivity reach of ∼10‑11 ph cm‑2 s‑1. Integrating the derived source-count distribution above the sensitivity of our analysis, we find that (42 ± 8)% of the extragalactic γ-ray background originates from blazars.
International Nuclear Information System (INIS)
Alnour, I.A.
2014-01-01
This work aimed to study the capability of INAA absolute method in determining the elemental concentration of 238 U and 232 Th in the rock samples. The INAA absolute method was implemented in PUSPATI TRIGA Mark II research reactor, Malaysian Nuclear Agency (NM). The accuracy of INAA absolute method was performed by analyzing the IAEA certified reference material (CRM) Soil-7. The analytical results showed the deviations between experimental and certified values were mostly less than 10 % with Z-score in most cases less than 1. In general, the results of analysed CRM Soil-7 show a good agreement between certified and experimental results which mean that the INAA absolute method can be used accurately for elemental analysis of uranium and thorium in various types of samples. The concentration of 238 U and 232 Th ranged from 1.77 to 24.25 and 0.88 to 95.50 ppm respectively. The highest value of 238 U and 232 Th was recorded for granite rock sample G17 of 238 U and sample G9 of 232 Th, whereas the lower value was 1.77 ppm of 238 U recorded in sandstone rock and 0.88 ppm of 232 Th for gabbro. Moreover, a comparison of the 238 U and 232 Th results obtained by the INAA absolute method shows an acceptable level of consistency with those obtained by the INAA relative method. (author)
The polarization dependence of γγ absorption—implications for γ-ray bursts and blazars
International Nuclear Information System (INIS)
Böttcher, M.
2014-01-01
This paper presents an analysis of the dependence of the opacity for high-energy γ-rays to γγ absorption by low-energy photons on the polarization of the γ-ray and target photons. This process has so far only been considered using the polarization-averaged γγ absorption cross section. It is demonstrated that in the case of polarized γ-ray emission, subject to source-intrinsic γγ absorption by polarized target photons, this may lead to a slight overestimation of the γγ opacity by up to ∼10% in the case of a perfectly ordered magnetic field. Thus, for realistic astrophysical scenarios with partially ordered magnetic fields, the use of the polarization-averaged γγ cross section is justified for practical purposes, such as estimates of minimum Doppler factors inferred for γ-ray bursts and blazars, based on γγ transparency arguments; this paper quantifies the small error incurred by the unpolarized-radiation approximation. Furthermore, it is shown that polarization-dependent γγ absorption of initially polarized γ-rays can lead to a slight increase in the polarization beyond the spectral break caused by γγ absorption. This amount is distinctly different from the change in polarization expected if the same spectral break were produced by a break in the underlying electron distribution. This may serve as a diagnostic of whether γγ absorption is relevant in sources such as γ-ray bursts and blazars where the γ-ray emission may be intrinsically highly polarized.
DEFF Research Database (Denmark)
Kalisz, Mark; Winzi, Maria Karin; Bisgaard, Hanne Cathrine
2012-01-01
(EVX1) and GOOSECOID (GSC) regulate cell fate decisions in streak-like progenitors derived from human ES cells exposed to BMP4 and/or activin. We found that EVX1 repressed GSC expression and promoted formation of posterior streak-like progeny in response to BMP4, and conversely that GSC repressed EVX1...... expression and was required for development of anterior streak-like progeny in response to activin. Chromatin immunoprecipitation assays showed that EVX1 bound to the GSC 5'-flanking region in BMP4 treated human ES cells, and band shift assays identified two EVX1 binding sites in the GSC 5'-region......TGFß signaling patterns the primitive streak, yet little is known about transcriptional effectors that mediate the cell fate choices during streak-like development in mammalian embryos and in embryonic stem (ES) cells. Here we demonstrate that cross-antagonistic actions of EVEN-SKIPPED HOMEOBOX 1...
24 CFR 232.605 - Contract requirements.
2010-04-01
... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MORTGAGE INSURANCE FOR NURSING HOMES, INTERMEDIATE CARE FACILITIES, BOARD AND CARE HOMES, AND ASSISTED... Fire Safety Equipment Form of Contract § 232.605 Contract requirements. (a) The contract between the...
Measurement of the 232Th-series activity in gas sockets
International Nuclear Information System (INIS)
Sutarman, I.
1995-01-01
The activity of 232 Th and its daughters in Th-based gas sockets is required for health risk assessment. By absolute measurement of the 228 Ac-and 212 Pb/ 208 Tl-activities, the total activity of the sockets can be assessed. It is governed by 228 Ra and 228 Th and the product age. (author) 1 fig.; 2 tabs
The computer-controlled GPIB-RS232 interface for data transmission
International Nuclear Information System (INIS)
Bai Xiaowei
1993-01-01
A kind of RS232-GPIB interface circuit is introduced, which provides communication between the serial system and the instrument with GPIB. Port P 1 of 8031 is used to select function mode as listener, talker or others. Under the control of a personal computer, the data communication is completed both in serial and the parallel modes
24 CFR 232.865 - Election by lender.
2010-04-01
... FACILITIES Contract Rights and Obligations Rights and Duties of Lender Under the Contract of Insurance § 232.865 Election by lender. Where a real estate mortgage, or other security instrument has been used to...
33 CFR 110.232 - Southeast Alaska.
2010-07-01
... explosives anchorage. (5) A wooden vessel must: (i) Be fitted with a radar reflector screen of metal of sufficient size to permit target indication on the radar screen of commercial type radar; or (ii) Have steel... 110.232 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES...
Energy Technology Data Exchange (ETDEWEB)
Misdaq, M.A.; Elamyn, H.; Erramli, H. [Cadi Ayyad Univ., Nuclear Physics and Techniques Lab., Faculty of Sciences Semlalia, Marrakech (Morocco)
2008-04-15
Uranium ({sup 238}U) and thorium ({sup 232}Th) concentrations were measured in different foods widely consumed in Morocco by using C.R.-39 and L.R.-115 type II solid state nuclear track detectors (S.S.N.T.D.). Data obtained were compared to those obtained by using isotope dilution mass spectrometry (I.D.M.S.). Total daily intakes of {sup 238}U and {sup 232}Th for a typical food basket were estimated to be 1.3 {+-} 0.1 mBq d{sup -1} and 0.98 {+-} 0.08 mBq d{sup -1}, 1.4 {+-} 0.1 mBq d{sup -1} and 1.06 {+-} 0.08 mBq d{sup -1}, 1.7 {+-} 0.1 mBq d{sup -1} and 1.26 {+-} 0.08 mBq d{sup -1} and 2.0 {+-} 0.1 mBq d{sup -1} and 1.5 {+-} 0.1 Bq d{sup -1} for the 2-7 years, 7-12 years, 12-17 years and adult's age groups, respectively. Alpha-activities due to annual {sup 238}U and {sup 232}Th intakes from the ingestion of the studied foodstuffs were determined in different organs and tissues of the human body of members of the public by using the ICRP gastrointestinal tract and systemic part models for these radionuclides. Committed equivalent doses due to annual intakes of {sup 238}U and {sup 232}Th were evaluated in the human body organs and tissues for different age groups of the Moroccan population by exploiting data obtained for alpha-doses deposited by 1 Bq of {sup 238}U and 1 Bq of {sup 232}Th in the considered human organs and tissues. The influence of the mass of the target tissue and activities due to {sup 238}U and {sup 232}Th on the committed equivalent doses due to annual intakes of these radionuclides in the organs and tissues of the human body was studied. (authors)
12 CFR 232.4 - Specific exceptions for obtaining and using medical information.
2010-01-01
... organization works through mortgage lenders and requires mortgage lenders to obtain medical information about... determines that it needs additional information regarding the consumer's circumstances, the creditor may... medical information. 232.4 Section 232.4 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF...
Crosstalk XVI, basic data communication and RS-232C
International Nuclear Information System (INIS)
Hwang, Hui Yung
1988-10-01
This book is divided into three parts, which deals with compatible software of data communication with IBM PC XT/AT. The first part consists of an introduction to crosstalk XVI, getting start for user, crosstalk practice, call with crosstalk, terminal feature, switch of communication parameter, terminal emulation, capturing data, transmission of text file answer mode, file transfer, command file and script file, command summary and examples. The second part deals with basic personal computer communication, RS-232C and explanation of communication control : RS-232C interface, transmission device and interrupt controller 8259.
Torres-González, Pedro; Ortiz-Brizuela, Edgar; Cervera-Hernandez, Miguel Enrique; Bobadilla-Del Valle, Miriam; Martínez-Gamboa, Areli; Sifuentes-Osornio, José; Ponce-de-Leon, Alfredo
2016-10-01
We describe the outcomes and factors associated with OXA-232 producing carbapenem-resistant Enterobacteriaceae infections. A case-control-control study was performed; each case of infection by a carbapenem-resistant/OXA-232 (OXA-232-cases, n=27) was matched by isolation site, species, and date, with 2 cases of infection by carbapenem-susceptible/third-generation cephalosporin-susceptible (TGCS-controls, n=54) and 2 cases by carbapenem-susceptible/ESBL producing Enterobacteriaceae (ESBL-controls, n=54); 66% were urinary tract and 18.5% intra-abdominal infections. In the multivariable analysis with ESBL-controls, previous use β-lactam/β-lactamase antibiotics (OR 6.2; 95% CI 1.6-23.8) and, third-generation cephalosporins (OR 0.2; 95% CI 0.05-0.8) were associated with OXA-232 infection; with TGSC-controls previous use of β-lactam/β-lactamase antibiotics (OR 3.7; 95% 1.1-12.0) was associated. Among the OXA-232-cases, 29% received imipenem/cilastatin or meropenem, 11.1% ceftriaxone, 22.2% a carbapenem-based combination and 33.3% other antimicrobials as treatment. Previous β-lactam/β-lactamase antibiotics are associated with OXA-232 infections, and some may be treated with other active carbapenems or, in the absence of ESBL, third-generation cephalosporins. Copyright © 2016 Elsevier Inc. All rights reserved.
Lesões do sistema urinário em 1.063 cães
Directory of Open Access Journals (Sweden)
Maria Andréia Inkelmann
2012-08-01
Full Text Available Com o objetivo de realizar um estudo abrangente das lesões do sistema urinário em cães e determinar a sua prevalência, epidemiologia, importância clínica e possíveis causas associadas, foram revisados os protocolos de necropsias de cães realizadas no período de janeiro de 1999 a dezembro de 2010 no LPV-UFSM. Nesse período foram necropsiados 3.189 cães e destes, cerca de 30% apresentaram lesões no sistema urinário. Na maioria dos cães (79,1% foram observadas lesões únicas e em aproximadamente 21% havia lesões múltiplas no sistema urinário, totalizando 1.373 lesões. Destas, 1.014 (73,8% foram observadas no rim. No trato urinário inferior (TUI foram diagnosticadas 359 (26,2% lesões. Um terço das lesões no sistema urinário dos cães necropsiados foram causa de morte espontânea ou razão para eutanásia (ME/EUT. As demais foram consideradas como achados incidentais. As principais lesões renais diagnosticadas, em ordem decrescente de prevalência, foram: nefrite túbulo-intersticial, infarto, nefrite granulomatosa (parasitária, glomerulonefrite, neoplasmas metastáticos/multicêntricos, pielonefrite/ pielite e hidronefrose. As principais lesões do TUI diagnosticadas, em ordem decrescente de prevalência, foram: cistite, presença de inclusões virais (morbilivírus, urolitíase, dilatação da bexiga, ruptura de bexiga (com uroperitônio e neoplasmas metastáticos/multicêntricos. As características epidemiológicas como sexo, raça e idade dos cães afetados tiveram variações expressivas de acordo com o tipo de lesão diagnosticada. Uremia foi observada em um número significativo de casos de ME/EUT e foi principalmente secundária a lesões renais.
D ampersand D Characterization of the 232-F Old Tritium Facility at the Savannah River Site
International Nuclear Information System (INIS)
Scallon, K.L.; England, J.L.
1995-01-01
The 232-F ''Old Tritium Facility'' operated in the 1950s as the first tritium production facility at the Savannah River Site (SRS). In 1957, the 232-F operation ceased with tritium production turned over to a larger, technologically improved facility at SRS. The 232-F Facility was abandoned in 1958 and the process areas have remained contaminated with radiological, hazardous and mixed constituents. Decontamination and decommissioning (D ampersand D) of the 232-F Facility is scheduled to occur in the years 1995-1996. This paper presents the D ampersand D characterization efforts for the 232-F Facility
Indian Academy of Sciences (India)
BetiCiciJoan
Nayak, M. Jamil, L. P. Singh & R. Myrzakulov) 97. Gravitational ... (Solution by the Second Perturbation Method) (Lin-Sen Li) 189. FAST Maser .... γ-Ray Emission from the Extreme Blazar 1ES 0229 + 200 (J. Lie, T. Kang & Y. G.. Zheng) 341 .... C. Eiland, T. C. Salzillo, B. H. Hokr, J. L. Highland, W. D. Mayfield & B. M. Wyatt) ...
International Nuclear Information System (INIS)
Aquino, Reginaldo R.; Pecequilo, Brigitte R.S.
2009-01-01
The natural radioactivity in superficial beach sand samples of 7 beaches of Great Vitoria, metropolitan region of the State of Espirito Santo, southeast Brazil, was determined from the 226 Ra, 232 Th and 4 0 K contents. The assessed beaches were Manguinhos, Camburi, Praia do Canto, Curva da Jurema, Itapua, Setibao and Areia Preta. Three samples of each beach were sealed in standard 100 mL polyethylene flasks and stored in order to obtain secular equilibrium in the 238 U and 232 Th series. All samples were measured by high resolution gamma spectrometry and the spectra were analyzed with the WinnerGamma software. The 232 Th concentration was determined from the average concentrations of 228 Ac, 212 Pb and 212 Bi and the 226 Ra concentration was determined from the average concentrations of 214 Pb and 214 Bi. Preliminary results show concentrations varying from 9 Bq.kg -1 to 6035 Bq.kg -1 for 232 Th, from 4 Bq.kg -1 to 575 Bq.kg -1 for 226 Ra and from 13 Bq.kg -1 to 142 Bq.kg -1 for 40 K. Areia Preta beach shows the highest values for 232 Th, while the highest value for 226 Ra was observed for Camburi beach. High values of 40 K were observed for Curva da Jurema beach. (author)
Bulk Comptonization: new hints from the luminous blazar 4C+25.05
Kammoun, E. S.; Nardini, E.; Risaliti, G.; Ghisellini, G.; Behar, E.; Celotti, A.
2018-01-01
Blazars are often characterized by a spectral break at soft X-rays, whose origin is still debated. While most sources show a flattening, some exhibit a blackbody-like soft excess with temperatures of the order of ∼0.1 keV, similar to low-luminosity, non-jetted Seyferts. Here, we present the analysis of the simultaneous XMM-Newton and NuSTAR observations of the luminous flat-spectrum radio quasar 4C+25.05 (z = 2.368). The observed 0.3-30 keV spectrum is best described by the sum of a hard X-ray power law (Γ = 1.38_{-0.03}^{+0.05}) and a soft component, approximated by a blackbody with kT_BB = 0.66_{-0.04}^{+0.05} keV (rest frame). If the spectrum of 4C+25.05 is interpreted in the context of bulk Comptonization by cold electrons of broad-line region photons emitted in the direction of the jet, such an unusual temperature implies a bulk Lorentz factor of the jet of Γbulk ∼ 11.7. Bulk Comptonization is expected to be ubiquitous on physical grounds, yet no clear signature of it has been found so far, possibly due to its transient nature and the lack of high-quality, broad-band X-ray spectra.
34 CFR 75.232 - The cost analysis; basis for grant amount.
2010-07-01
... Secretary sets the amount of a new grant, the Secretary does a cost analysis of the project. The Secretary... objectives of the project with reasonable efficiency and economy under the budget in the application... 34 Education 1 2010-07-01 2010-07-01 false The cost analysis; basis for grant amount. 75.232...
226Ra, 232Th and 40K analysis in water samples from Assiut, Egypt
International Nuclear Information System (INIS)
El-Gamal, H.; Abdel Mageed, A.I.; El-Attar, A.L; Abdel Hamid, M.
2013-01-01
The activity concentrations of 226 Ra, 232 Th and 40 K were determined in water samples, using 2”x 2” NaI(Tl) scintillation detector. Water activity ranges from 0.07 to 0.59 Bq L−1 for 226 Ra, 0.05 to 0.37 Bq L−1 for 232 Th and 3.25 to 8.72 Bq L−1 for 40 K with mean values of 2.64, 2.22 and 119.50 Bq L−1, respectively. As far as the measured gamma radionuclides is concerned, the mean annual effective doses for all analyzed samples of water are in the range of 0.02–0.08, 0.03-0.17 and 0.03-0.10 mSv yr -1 for infants, children and adults, respectively, all being lower than the reference level of the committed effective dose recommended by the WHO.
Energy Technology Data Exchange (ETDEWEB)
Kato, Kenji; Tonouchi, Shigemasa; Maruta, Fumiyuki; Ebata, Hidekazu [Niigata Prefectural Inst. of Public Health and Environmental Sciences (Japan)
2001-12-01
To evaluate the properties of algae to concentrate radioactive elements, 14 species of algae like Sargassum were collected in the Prefecture and analyzed for their {sup 232}Th and {sup 238}U levels with Yokogawa HP4500 ICP-MS apparatus. The places of collection included those near the water discharge of an atomic power station. Mean {sup 232}Th and {sup 238}U levels were found to be 120 and 260 ng/g dry wt, respectively, and Phaeophyta showed more than several times higher {sup 238}U level than Chlorophyta and Rhodophyta. There was no clear difference in {sup 232}Th levels. No difference between places of collection was observed in Sargassum {sup 232}Th or {sup 238}U level. Adsorption of {sup 232}Th particle to and incorporation of soluble {sup 238}U into algae body were suggested. Mean {sup 232}Th and {sup 238}U radioactivities were found 73 and 510 {mu}Bq/g wet wt, respectively, and the respective annual committed effective doses, 0.2 and 0.3 {mu}Sv, calculated from those values were confirmed to be enough lower than the annual public dose limit, 1 mSv. (K.H.)
2010-10-01
... Contractor to the Government under this contract shall bear simple interest from the date due until paid... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Interest. 52.232-17... Interest. As prescribed in 32.611(a) and (b), insert the following clause: INTEREST (OCT 2010) (a) Except...
Directory of Open Access Journals (Sweden)
Bandi Sriram
2008-01-01
Full Text Available Abstract Background Human embryonic stem (hES cells hold considerable promise for cell replacement and gene therapies. Their remarkable properties of pluripotency, self-renewal, and tractability for genetic modification potentially allows for the production of sizeable quantities of therapeutic cells of the hematopoietic lineage. Dendritic cells (DC arise from CD34+ hematopoietic progenitor cells (HPCs and are important in many innate and adaptive immune functions. With respect to HIV-1 infection, DCs play an important role in the efficient capture and transfer of the virus to susceptible cells. With an aim of generating DCs from a renewable source for HIV-1 studies, here we evaluated the capacity of hES cell derived CD34+ cells to give rise to DCs which can support HIV-1 infection. Results Undifferentiated hES cells were cultured on S17 mouse bone marrow stromal cell layers to derive CD34+ HPCs which were subsequently grown in specific cytokine differentiation media to promote the development of DCs. The hES derived DCs (hES-DC were subjected to phenotypic and functional analyses and compared with DCs derived from fetal liver CD34+ HPC (FL-DC. The mature hES-DCs displayed typical DC morphology consisting of veiled stellate cells. The hES-DCs also displayed characteristic phenotypic surface markers CD1a, HLA-DR, B7.1, B7.2, and DC-SIGN. The hES-DCs were found to be capable of antigen uptake and stimulating naïve allogeneic CD4+ T cells in a mixed leukocyte reaction assay. Furthermore, the hES-DCs supported productive HIV-1 viral infection akin to standard DCs. Conclusion Phenotypically normal and functionally competent DCs that support HIV-1 infection can be derived from hES cells. hES-DCs can now be exploited in applied immunology and HIV-1 infection studies. Using gene therapy approaches, it is now possible to generate HIV-1 resistant DCs from anti-HIV gene transduced hES-CD34+ hematopoietic progenitor cells.
SBS 0846+513: a New Gamma-ray Emitting Narrow-line Seyfert 1 Galaxy
D'Ammando, F.; Orienti, M.; Finke, J.; Raiteri, C. M.; Angelakis, E.; Fuhrmann, L.; Giroletti, M.; Hovatta, T.; Max-Moerbeck, W.; Perkins, J. S.;
2012-01-01
We report Fermi-LAT observations of the radio-loud AGN SBS 0846+513 (z=0.5835), optically classified as a Narrow-Line Seyfert 1 galaxy, together with new and archival radio-to-X-ray data. The source was not active at ?-ray energies during the first two years of Fermi operation. A significant increase in activity was observed during 2010 October-2011 August. In particular a strong gamma-ray flare was observed in 2011 June reaching an isotropic ?-ray luminosity (0.1-300 GeV) of 1.0×10(sup 48) erg s(sup -1), comparable to that of the brightest flat spectrum radio quasars, and showing spectral evolution in gamma rays. An apparent superluminal velocity of (8.2+/-1.5)c in the jet was inferred from 2011-2012 VLBA images, suggesting the presence of a highly relativistic jet. Both the power released by this object during the flaring activity and the apparent superluminal velocity are strong indications of the presence of a relativistic jet as powerful as those of blazars. In addition, variability and spectral properties in radio and gamma-ray bands indicate blazar-like behaviour, suggesting that, except for some distinct optical characteristics, SBS 0846+513 could be considered as a young blazar at the low end of the blazar's black hole mass distribution.
Variations of the Blazar AO 0235+164 in 2006-2015
Hagen-Thorn, V. A.; Larionov, V. M.; Morozova, D. A.; Arkharov, A. A.; Hagen-Thorn, E. I.; Shablovinskaya, E. S.; Prokop'eva, M. S.; Yakovleva, V. A.
2018-02-01
The results of optical, radio, and gamma-ray observations of the blazar AO 0235+16 are presented, including photometric ( BV RIJHK) and polarimetric ( R)monitoring carried out at St. Petersburg State University and the Central (Pulkovo) Astronomical Observatory in 2007-2015, 43 GHz Very Long Baseline Interferometry radio observations processed at Boston University, and a gamma-ray light curve based on observationswith the Fermi space observatory are presented. Two strong outbursts were detected. The relative spectral energy distributions of the variable components responsible for the outbursts are determined; these follow power laws, but with different spectral indices. The degree of polarization was high in both outbursts; only an average relationship between the brightness and polarization can be found. There was no time lag between the variations in the optical and gamma-ray, suggesting that the sources of the radiation in the optical and gamma-ray are located in the same region of the jet.
Multiwavelength Picture of the Blazar S5 0716+714 during Its Brightest Outburst
Directory of Open Access Journals (Sweden)
Marina Manganaro
2016-11-01
Full Text Available S5 0716+714 is a well known BL Lac object, and one of the brightest and most active blazars. The discovery in the Very High Energy band (VHE, E > 100 GeV by MAGIC happened in 2008. In January 2015, the source went through the brightest optical state ever observed, triggering MAGIC follow-up and a VHE detection with ∼ 13 σ significance (ATel ♯ 6999 . Rich multiwavelength coverage of the flare allowed us to construct the broad-band spectral energy distribution of S5 0716+714 during its brightest outburst. In this work, we will present the preliminary analysis of MAGIC and Fermi-LAT data of the flaring activity in January and February 2015 for the HE (0.1 < HE < 300 GeV and VHE band, together with radio (Metsähovi, OVRO, VLBA, Effelsberg, sub-millimeter (SMA, optical (Tuorla, Perkins, Steward, AZT-8+ST7, LX-200, Kanata, X-ray and UV (Swift-XRT and UVOT, in the same time-window and discuss the time variability of the multiwavelength light curves during this impressive outburst.
Determination of 232Th, 230Th and 228Th in liquid effluents from uranium mining
International Nuclear Information System (INIS)
Godoy, Jose Marcus de Oliveira
1979-10-01
A liquid scintillator αlpha spectrometer was built for the determination of Th- 228 , Th- 230 and Th- 232 in liquid effluents from Uranium mines and mills. The resolution of the αlpha spectrometer was found to be 200-300 KeV, when the scintillator was 8% T0P0, 0,77% scintimix-4 (91% PP0 and 9% Dimetil-P0P0P) and 10% of naphthalene in toluene. Aliquat-336 in xylene (30% v/v) was used to separate the thorium isotopes from other interfering radionuclides (U- 238 , U- 234 , Ra- 226 , Po- 210 ). Under the extraction experimental conditions, the detection limits were 1,2 pCi/1 for Th- 232 , 1,2 pCi/1 for Th- 230 and 0,9 pCi/1 for Th- 228 , for 1000 minutes of counting time. (author)
24 CFR 232.630 - Assurance of completion.
2010-04-01
... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MORTGAGE INSURANCE FOR NURSING HOMES, INTERMEDIATE CARE FACILITIES, BOARD AND CARE HOMES, AND ASSISTED... Fire Safety Equipment Special Requirements § 232.630 Assurance of completion. If the property upon...
24 CFR 232.565 - Maximum loan amount.
2010-04-01
... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MORTGAGE INSURANCE FOR NURSING HOMES, INTERMEDIATE CARE FACILITIES, BOARD AND CARE HOMES, AND ASSISTED... Fire Safety Equipment Eligible Security Instruments § 232.565 Maximum loan amount. The principal amount...
24 CFR 232.545 - Covenant against liens.
2010-04-01
... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MORTGAGE INSURANCE FOR NURSING HOMES, INTERMEDIATE CARE FACILITIES, BOARD AND CARE HOMES, AND ASSISTED... Fire Safety Equipment Eligible Security Instruments § 232.545 Covenant against liens. (a) The security...
17 CFR 232.313 - Identification of investment company type and series and/or class (or contract).
2010-04-01
... company type and series and/or class (or contract). 232.313 Section 232.313 Commodity and Securities... FILINGS Preparation of Electronic Submissions § 232.313 Identification of investment company type and... must indicate their investment company type, based on whether the registrant's last effective...
Proteogenomic mapping of Mycoplasma hyopneumoniae virulent strain 232.
Pendarvis, Ken; Padula, Matthew P; Tacchi, Jessica L; Petersen, Andrew C; Djordjevic, Steven P; Burgess, Shane C; Minion, F Chris
2014-07-08
Mycoplasma hyopneumoniae causes respiratory disease in swine and contributes to the porcine respiratory disease complex, a major disease problem in the swine industry. The M. hyopneumoniae strain 232 genome is one of the smallest and best annotated microbial genomes, containing only 728 annotated genes and 691 known proteins. Standard protein databases for mass spectrometry only allow for the identification of known and predicted proteins, which if incorrect can limit our understanding of the biological processes at work. Proteogenomic mapping is a methodology which allows the entire 6-frame genome translation of an organism to be used as a mass spectrometry database to help identify unknown proteins as well as correct and confirm existing annotations. This methodology will be employed to perform an in-depth analysis of the M. hyopneumoniae proteome. Proteomic analysis indicates 483 of 691 (70%) known M. hyopneumoniae strain 232 proteins are expressed under the culture conditions given in this study. Furthermore, 171 of 328 (52%) hypothetical proteins have been confirmed. Proteogenomic mapping resulted in the identification of previously unannotated genes gatC and rpmF and 5-prime extensions to genes mhp063, mhp073, and mhp451, all conserved and annotated in other M. hyopneumoniae strains and Mycoplasma species. Gene prediction with Prodigal, a prokaryotic gene predicting program, completely supports the new genomic coordinates calculated using proteogenomic mapping. Proteogenomic mapping showed that the protein coding genes of the M. hyopneumoniae strain 232 identified in this study are well annotated. Only 1.8% of mapped peptides did not correspond to genes defined by the current genome annotation. This study also illustrates how proteogenomic mapping can be an important tool to help confirm, correct and append known gene models when using a genome sequence as search space for peptide mass spectra. Using a gene prediction program which scans for a wide variety of
Nondestructive analysis for 232U and decay progeny in animal tissues
International Nuclear Information System (INIS)
Ballou, J.E.; Wogman, N.A.
1977-01-01
Direct determination of 232 U and its decay products in animal tissues appears to be feasible using an intrinsic Ge(Li) diode detector (for energies of 5-100 keV) and a NaI(Tl) anticoincidence-shielded Ge(Li) diode for higher-energy gamma photons. The detection sensitivity for 232 U and 228 Th is 0.03 and 0.01 nCi, respectively, using a 300-min counting time
Marscher, Alan P.
2011-09-01
Multi-wavelength light curves of bright gamma-ray blazars (e.g., 3C 454.3) are compared with the model proposed by Marscher and Jorstad. In this scenario, much of the optical and high-energy radiation in a blazar is emitted near the 43 GHz core of the jet as seen in VLBA images, parsecs from the central engine. The main physical features are a turbulent ambient jet plasma that passes through a standing recollimation shock in the jet. The model allows for short time-scales of optical and gamma-ray variability by restricting the highest-energy electrons radiating at these frequencies to a small fraction of the turbulent cells, perhaps those with a particular orientation of the magnetic field relative to the shock front. Because of this, the volume filling factor at high frequencies is relatively low, while that of the electrons radiating below about 10 THz is near unity. Such a model is consistent with the (1) red-noise power spectra of flux variations, (2) shorter time-scales of variability at higher frequencies, (3) frequency dependence of polarization and its variability, and (4) breaks in the synchrotron spectrum by more than the radiative loss value of 0.5. Simulated light curves are generated by a numerical code that (as of May 2011) includes synchrotron radiation as well as inverse Compton scattering of seed photons from both a dust torus and a Mach disk at the jet axis. The latter source of seed photons produces more pronounced variability in gamma-ray than in optical light curves, as is often observed. More features are expected to be added to the code by the time of the presentation. This research is supported in part by NASA through Fermi grants NNX08AV65G and NNX10AO59G, and by NSF grant AST-0907893.
24 CFR 232.590 - Eligibility of property.
2010-04-01
... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MORTGAGE INSURANCE FOR NURSING HOMES, INTERMEDIATE CARE FACILITIES, BOARD AND CARE HOMES, AND ASSISTED... Fire Safety Equipment Property Requirements § 232.590 Eligibility of property. (a) A loan to be...
Energy Technology Data Exchange (ETDEWEB)
Lan, Chang-lin; Qiu, Yi-jia; Wang, Qiang; Zhang, Zheng-wei; Zhang, Qian; Tan, Jun-cai; Fang, Kai-hong [Lanzhou University, School of Nuclear Science and Technology, Lanzhou (China); Lai, Cai-feng [China Academy of Engineering Physics, Institute of Nuclear Physics and Chemistry, Mianyang (China)
2017-06-15
The fission cross sections of {sup 232}Th(n,f){sup 131m,g}Sn, {sup 232}Th(n,f){sup 131}Sb, {sup 232}Th(n,f){sup 131m,g}Te, {sup 232}Th(n,f){sup 131}I fission reactions induced by 14 MeV neutrons were measured precisely with the neutron activation technique. The neutron flux was monitored by accompanying α particle in the irradiation and the neutron energies were determined by the cross section ratio of {sup 90}Zr(n,2n){sup 89}Zr to {sup 93}Nb(n,2n){sup 92m}Nb reaction. The values of the cross sections of {sup 232}Th(n,f){sup 131m,g}Sn were analyzed, and the cross sections of {sup 232}Th(n,f){sup 131}Sb were deduced to be 6.5±0.7, 6.3±0.6, 6.1±0.6 mb at 14.1±0.3, 14.5±0.3 and 14.8±0.3 MeV, respectively. The values of the cross sections of {sup 232}Th(n,f){sup 131g}Te were deduced to be 1.8 ± 0.1, 1.5 ± 0.1 and 1.4±0.1 mb at 14.1±0.3, 14.5±0.3 and 14.8±0.3 MeV, respectively. The values of the cross sections of {sup 232}Th(n,f){sup 131}I were given as 1.8±0.2, 1.6±0.2, 1.5±0.1 mb at 14.1±0.3, 14.5±0.3 and 14.8±0.3 MeV, respectively. (orig.)
Probing stochastic inter-galactic magnetic fields using blazar-induced gamma ray halo morphology
Energy Technology Data Exchange (ETDEWEB)
Duplessis, Francis [Physics Department, Arizona State University, Tempe, AZ 85287 (United States); Vachaspati, Tanmay, E-mail: fdupless@asu.edu, E-mail: tvachasp@asu.edu [Maryland Center for Fundamental Physics, University of Maryland, College Park, MD 20742 (United States)
2017-05-01
Inter-galactic magnetic fields can imprint their structure on the morphology of blazar-induced gamma ray halos. We show that the halo morphology arises through the interplay of the source's jet and a two-dimensional surface dictated by the magnetic field. Through extensive numerical simulations, we generate mock halos created by stochastic magnetic fields with and without helicity, and study the dependence of the halo features on the properties of the magnetic field. We propose a sharper version of the Q-statistics and demonstrate its sensitivity to the magnetic field strength, the coherence scale, and the handedness of the helicity. We also identify and explain a new feature of the Q-statistics that can further enhance its power.
2010-10-01
... Government Receipt of Electronic Funds Transfer Information. 52.232-35 Section 52.232-35 Federal Acquisition... of Office for Government Receipt of Electronic Funds Transfer Information (MAY 1999) (a) As provided... CONTRACT CLAUSES Text of Provisions and Clauses 52.232-35 Designation of Office for Government Receipt of...
24 CFR 232.595 - Eligibility of title.
2010-04-01
... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MORTGAGE INSURANCE FOR NURSING HOMES, INTERMEDIATE CARE FACILITIES, BOARD AND CARE HOMES, AND ASSISTED... Fire Safety Equipment Title § 232.595 Eligibility of title. In order for the property which is to be...
2010-10-01
... subcontractor advance payments-DoD pilot mentor-protege program. 252.232-7005 Section 252.232-7005 Federal... subcontractor advance payments—DoD pilot mentor-protege program. As prescribed in 232.412-70(c), use the following clause: Reimbursement of Subcontractor Advance Payments—DoD Pilot Mentor-Protege Program (SEP 2001...
42 CFR 414.232 - Special payment rules for transcutaneous electrical nerve stimulators (TENS).
2010-10-01
... nerve stimulators (TENS). 414.232 Section 414.232 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES... Special payment rules for transcutaneous electrical nerve stimulators (TENS). (a) General payment rule. Except as provided in paragraph (b) of this section, payment for TENS is made on a purchase basis with...
46 CFR 232.3 - Chart of accounts.
2010-10-01
... stated in any revision to generally accepted accounting principles, the meaning of the latter shall... UNIFORM FINANCIAL REPORTING REQUIREMENTS § 232.3 Chart of accounts. (a) Purpose of accounts. A contractor shall use this chart of accounts as a guide for preparing the financial statements and for other...
Energy Technology Data Exchange (ETDEWEB)
Lisowski, P.W.; Ullmann, J.L.; Balestrini, S.J.; Carlson, A.D.; Wasson, O.A.; Hill, N.W.
1988-01-01
Neutron-induced fission cross section ratios for samples of /sup 232/Th, /sup 235,238/U, /sup 237/Np and /sup 239/Pu have been measured from 1 to 400 MeV. The fission reaction rate was determined for all samples simultaneously using a fast parallel plate ionization chamber at a 20-m flight path. A well characterized annular proton recoil telescope was used to measure the neutron fluence up to 30 MeV. These data provided the shape of the /sup 235/U(n,f) cross section relative to the hydrogen scattering cross section. That shape was then normalized to the very accurately known values were determined using the neutron fluence measured with a second proton recoil telescope. Cross section values for /sup 232/Th, /sup 238/U, /sup 237/Np, and /sup 239/Pu were computed from the ratio data using our values for /sup 235/U(n,f). In addition to providing new results at high neutron energies, these data resolve long standing discrepancies among different data sets. 1 ref., 1 fig.
Gastelen, van S.; Visker, M.H.P.W.; Edwards, J.E.; Antunes Fernandes, E.C.; Hettinga, K.A.; Alferink, S.J.J.; Hendriks, W.H.; Bovenhuis, H.; Smidt, H.; Dijkstra, J.
2017-01-01
Complex interactions between rumen microbiota, cow genetics, and diet composition may exist. Therefore, the effect of linseed oil, DGAT1 K232A polymorphism (DGAT1), and the interaction between linseed oil and DGAT1 on CH4 and H2 emission, energy and N metabolism, lactation performance, ruminal
Directory of Open Access Journals (Sweden)
Ulisses Barres de Almeida
2017-11-01
Full Text Available In this work, by making use of the large software and database resources made available through online facilities such as the ASI Science Data Center (ASDC, we present a novel approach to the modelling of blazar emission whereby the multi-epoch SED for Mkn 421 is modelled considering, in a self-consistent way, the temporal lags between bands (both in short and long-timescales. These are obtained via a detailed cross-correlation analysis, spanning data from radio to VHE gamma-rays from 2008 to 2015. In addition to that, long-term optical polarisation data is used to aid and complement our physical interpretation of the state and evolution of the source. Blazar studies constitute a clear example that astrophysics is becoming increasingly dominated by “big data”. Specific questions, such as the interpretation of polarimetric information—namely the evolution of the polarisation degree (PD and specially the polarisation angle (PA of a source—are very sensitive to the density of data coverage. Improving data accessibility and integration, in order to respond to these necessities, is thus extremely important and has a potentially large impact for blazar science. For this reason, we present also the project to create an open-access database for optical polarimetry, aiming to circumvent the issues raised above, by integrating long-term optical polarisation information on a number sources from several observatories and data providers in a consistent way. The platform, to be launched by the end of 2017 is built as part of the Brazilian Science Data Center (BSDC, a project hosted at CBPF, in Rio de Janeiro, and developed with the support of the Italian Space Agency (ASI and ICRANet. The BSDC is Virtual Observatory-compliant and is built in line with “Open Universe”, a global space science open-data initiative to be launched in November under the auspices of the United Nations.
DEFF Research Database (Denmark)
Madejski, G. M.; Nalewajko, K.; Madsen, K. K.
2016-01-01
We report the first hard X-ray observations with NuSTAR of the BL Lac-type blazar PKS 2155-304, augmented with soft X-ray data from XMM-Newton and γ-ray data from the Fermi Large Area Telescope, obtained in 2013 April when the source was in a very low flux state. A joint NuSTAR and XMM spectrum, ...
40 CFR 86.232-94 - Vehicle preconditioning.
2010-07-01
... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Vehicle preconditioning. 86.232-94... (CONTINUED) CONTROL OF EMISSIONS FROM NEW AND IN-USE HIGHWAY VEHICLES AND ENGINES Emission Regulations for 1994 and Later Model Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium...
Emanation of 232U and its radioactive daughter products from respirable size particles
International Nuclear Information System (INIS)
Cuddihy, R.G.; Griffith, W.C.; Hoover, M.D.; Kanapilly, G.M.; Stalnaker, N.D.
1978-01-01
This study is to develop a model for the emanation of 232 U and its radioactive daughter products from particles of Th-U fuel material. The radiation doses to internal organs following inhalation of these particles can only be calculated by knowing the rate of emanation of the daughters from particles in the lung and the subsequent excretion or translocation of the daughters to other organs. The emanation mechanisms are recoil of the daughter nuclei from the particle during alpha decay of the parent, diffusion of inert gas daughters from the particle and dissolution of the particle itself in biological fluids. Experiments to evaluate these mechanisms will involve ThO 2 and UO 2 particles in the size range 0.1 to 1.0 μm MMAD uniformly labeled with 232 U. The influence of the material temperature history on emanation will be investigated by heat treating particles at 600 and 1400 0 C
Rodríguez, Cecilia; Rimaux, Tom; Fornaguera, María José; Vrancken, Gino; de Valdez, Graciela Font; De Vuyst, Luc; Mozzi, Fernanda
2012-03-01
Certain lactic acid bacteria, especially heterofermentative strains, are capable to produce mannitol under adequate culture conditions. In this study, mannitol production by Lactobacillus reuteri CRL 1101 and Lactobacillus fermentum CRL 573 in modified MRS medium containing a mixture of fructose and glucose in a 6.5:1.0 ratio was investigated during batch fermentations with free pH and constant pH 6.0 and 5.0. Mannitol production and yields were higher under constant pH conditions compared with fermentations with free pH, the increase being more pronounced in the case of the L. fermentum strain. Maximum mannitol production and yields from fructose for L. reuteri CRL 1101 (122 mM and 75.7 mol%, respectively) and L. fermentum CRL 573 (312 mM and 93.5 mol%, respectively) were found at pH 5.0. Interestingly, depending on the pH conditions, fructose was used only as an alternative external electron acceptor or as both electron acceptor and energy source in the case of the L. reuteri strain. In contrast, L. fermentum CRL 573 used fructose both as electron acceptor and carbon source simultaneously, independently of the pH value, which strongly affected mannitol production by this strain. Studies on the metabolism of these relevant mannitol-producing lactobacilli provide important knowledge to either produce mannitol to be used as food additive or to produce it in situ during fermented food production.
Mobility of 232Th and 210Po in red mud.
Hegedűs, Miklós; Tóth-Bodrogi, Edit; Jónás, Jácint; Somlai, János; Kovács, Tibor
2018-04-01
The valorization of industrial by-products such as red mud became a tempting opportunity, but the understanding of the risks involved is required for the safe utilization of these products. One of the risks involved are the elevated levels of radionuclides (in the 100-1300 Bq/kg range for both the 238 U and 232 Th decay chains, but usually lower than 1000 Bq/kg, which is the recommended limit for excemption or clearance according to the EU BSS released in 2013) in red mud that can affect human health. There is no satisfactory answer for the utilization of red mud; the main current solution is still almost exclusively disposal into a landfill. For the safe utilization and deposition of red mud, it is important to be able to assess the leaching behaviour of radionuclides. Because there is no commonly accepted measurement protocol for testing the leaching of radionuclides in the EU a combined measurement protocol was made and tested based on heavy metal leaching methods. The leaching features of red mud were studied by methods compliant with the MSZ-21470-50 Hungarian standard, the CEN/TS 14429 standard and the Tessier sequential extraction method for 232 Th and 210 Po. The leached solutions were taken to radiochemical separation followed by spontaneous deposition for Po and electrodeposition for Th. The 332 ± 33 Bq/kg 232 Th content was minimally mobile, 1% became available for distilled water 1% and 6% for Lakanen-Erviö solution; the Tessier extraction showed minimal mobility in the first four steps, while more than 85% remained in the residue. The 210 Po measurements had a severe disturbing effect in many cases, probably due to large amounts of iron present in the red mud, from the 310 ± 12 Bq/kg by aqua regia digestion, distilled water mobilized 23%, while Lakanen-Erviö solution mobilized ∼13%. The proposed protocol is suitable for the analysis of Th and Po leaching behaviour. Copyright © 2018 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Khadijeh Rezaee Ebrahim Saraee; Elias Saion; Naghavi, K.
2009-01-01
The concentrations of 232 Th and 238 U were determined in 30 sediment samples, collected from the South China Sea bed of the east coast peninsular Malaysia. The samples were dried in an oven for 10 days at 65 C and stored in polyethylene bottles for future analysis. INAA used to analyse surficial sediments. The 232 Th and 238 U activities in surficial sediments determined. These activities increased from 14.02 to 30.17 Bq Kg -1 and from 47.49 to 113.69 Bq Kg -1 for 232 Th and 238 U , respectively. Results show diffuse distribution of 232 Th and 238 U actinides in studied area. The Th/Sc and U/Sc ratios of the suricial sediments have same distribution and the highest their values are in station EC12. The radioactive contamination of the investigated sector is compared with the results obtained of other coastal sediments of Malaysia. Results show activity contamination in coastal sediments of the South China Sea is lower than the Straits of Malacca and is the same with the Straits of Johor. (Author)
Defensin-like ZmES4 mediates pollen tube burst in maize via opening of the potassium channel KZM1.
Directory of Open Access Journals (Sweden)
Suseno Amien
2010-06-01
Full Text Available In contrast to animals and lower plant species, sperm cells of flowering plants are non-motile and are transported to the female gametes via the pollen tube, i.e. the male gametophyte. Upon arrival at the female gametophyte two sperm cells are discharged into the receptive synergid cell to execute double fertilization. The first players involved in inter-gametophyte signaling to attract pollen tubes and to arrest their growth have been recently identified. In contrast the physiological mechanisms leading to pollen tube burst and thus sperm discharge remained elusive. Here, we describe the role of polymorphic defensin-like cysteine-rich proteins ZmES1-4 (Zea mays embryo sac from maize, leading to pollen tube growth arrest, burst, and explosive sperm release. ZmES1-4 genes are exclusively expressed in the cells of the female gametophyte. ZmES4-GFP fusion proteins accumulate in vesicles at the secretory zone of mature synergid cells and are released during the fertilization process. Using RNAi knock-down and synthetic ZmES4 proteins, we found that ZmES4 induces pollen tube burst in a species-preferential manner. Pollen tube plasma membrane depolarization, which occurs immediately after ZmES4 application, as well as channel blocker experiments point to a role of K(+-influx in the pollen tube rupture mechanism. Finally, we discovered the intrinsic rectifying K(+ channel KZM1 as a direct target of ZmES4. Following ZmES4 application, KZM1 opens at physiological membrane potentials and closes after wash-out. In conclusion, we suggest that vesicles containing ZmES4 are released from the synergid cells upon male-female gametophyte signaling. Subsequent interaction between ZmES4 and KZM1 results in channel opening and K(+ influx. We further suggest that K(+ influx leads to water uptake and culminates in osmotic tube burst. The species-preferential activity of polymorphic ZmES4 indicates that the mechanism described represents a pre-zygotic hybridization
Defensin-Like ZmES4 Mediates Pollen Tube Burst in Maize via Opening of the Potassium Channel KZM1
Márton, Mihaela L.; Debener, Thomas; Geiger, Dietmar; Becker, Dirk; Dresselhaus, Thomas
2010-01-01
In contrast to animals and lower plant species, sperm cells of flowering plants are non-motile and are transported to the female gametes via the pollen tube, i.e. the male gametophyte. Upon arrival at the female gametophyte two sperm cells are discharged into the receptive synergid cell to execute double fertilization. The first players involved in inter-gametophyte signaling to attract pollen tubes and to arrest their growth have been recently identified. In contrast the physiological mechanisms leading to pollen tube burst and thus sperm discharge remained elusive. Here, we describe the role of polymorphic defensin-like cysteine-rich proteins ZmES1-4 (Zea mays embryo sac) from maize, leading to pollen tube growth arrest, burst, and explosive sperm release. ZmES1-4 genes are exclusively expressed in the cells of the female gametophyte. ZmES4-GFP fusion proteins accumulate in vesicles at the secretory zone of mature synergid cells and are released during the fertilization process. Using RNAi knock-down and synthetic ZmES4 proteins, we found that ZmES4 induces pollen tube burst in a species-preferential manner. Pollen tube plasma membrane depolarization, which occurs immediately after ZmES4 application, as well as channel blocker experiments point to a role of K+-influx in the pollen tube rupture mechanism. Finally, we discovered the intrinsic rectifying K+ channel KZM1 as a direct target of ZmES4. Following ZmES4 application, KZM1 opens at physiological membrane potentials and closes after wash-out. In conclusion, we suggest that vesicles containing ZmES4 are released from the synergid cells upon male-female gametophyte signaling. Subsequent interaction between ZmES4 and KZM1 results in channel opening and K+ influx. We further suggest that K+ influx leads to water uptake and culminates in osmotic tube burst. The species-preferential activity of polymorphic ZmES4 indicates that the mechanism described represents a pre-zygotic hybridization barrier and may be a
Distribution of Th-232 and Th-228 in Santos and Sao Vicente Estuary, Sao Paulo, Brazil
Energy Technology Data Exchange (ETDEWEB)
Silva, P.S.C.; Mazzilli, B.P.; Favaro, D.I.T. [Instituto de Pesquisas Energeticas e Nucleares, Av. Lineu Prestes, 2242, Caixa Postal 05508-000, Cidade Universitaria, Sao Paulo (Brazil)]. e-mail: Pscsilva@ipen.br
2004-07-01
In the last decades considerable attention has been given to technologically enhanced natural occurring radioactive material (TENORM). Within this frame, of particular concern is the phosphate fertilizer industry. Santos Basin, located in Southwest Brazil, Sao Paulo State, comprising Santos and Sao Vicente estuarine system, is considered the most important industrial region of the country. Among the industrial activities present, phosphate fertilizer plants are responsible for the production of 69 millions tons of phosphogypsum waste, which is stockpiled in the surrounding environment. This waste concentrates radionuclides of the natural series originally present in the phosphate rock used as raw material. This study aims to evaluate the environmental impact of such activities in the sediments of the estuarine system. {sup 232} Th and {sup 228} Th concentrations in Santos and San Vicente estuary sediments were determined by Neutron activation analysis and Gamma spectrometry, respectively. {sup 232} Th concentration ranged from 6.5 to 198 Bq kg{sup -1} with mean value of 57 {+-} 39 Bq kg{sup -1}, for 42 samples. {sup 228} Th content varied from 12 to 110 Bq kg{sup -1} with a mean value of 74 {+-} 23 Bq kg{sup -1}, for 18 samples. It can be seen that the amount of {sup 232} Th is higher in the rivers close to the phosphogypsum piles, at least five points were identified as being affected by anthropogenic factor. (Author)
Distribution of Th-232 and Th-228 in Santos and Sao Vicente Estuary, Sao Paulo, Brazil
International Nuclear Information System (INIS)
Silva, P.S.C.; Mazzilli, B.P.; Favaro, D.I.T.
2004-01-01
In the last decades considerable attention has been given to technologically enhanced natural occurring radioactive material (TENORM). Within this frame, of particular concern is the phosphate fertilizer industry. Santos Basin, located in Southwest Brazil, Sao Paulo State, comprising Santos and Sao Vicente estuarine system, is considered the most important industrial region of the country. Among the industrial activities present, phosphate fertilizer plants are responsible for the production of 69 millions tons of phosphogypsum waste, which is stockpiled in the surrounding environment. This waste concentrates radionuclides of the natural series originally present in the phosphate rock used as raw material. This study aims to evaluate the environmental impact of such activities in the sediments of the estuarine system. 232 Th and 228 Th concentrations in Santos and San Vicente estuary sediments were determined by Neutron activation analysis and Gamma spectrometry, respectively. 232 Th concentration ranged from 6.5 to 198 Bq kg -1 with mean value of 57 ± 39 Bq kg -1 , for 42 samples. 228 Th content varied from 12 to 110 Bq kg -1 with a mean value of 74 ± 23 Bq kg -1 , for 18 samples. It can be seen that the amount of 232 Th is higher in the rivers close to the phosphogypsum piles, at least five points were identified as being affected by anthropogenic factor. (Author)
Activity concentrations of 226Ra, 232Th and 40K in brands of fertilisers used in Nigeria
International Nuclear Information System (INIS)
Jibiri, N. N.; Fasae, K. P.
2012-01-01
The activity concentration of naturally occurring radionuclides 40 K, 226 Ra and 232 Th have been measured in different brands of fertiliser samples sold to farmers in retail markets in six commercial cities in southwestern Nigeria. Gamma ray spectroscopy was employed in the measurements of these radionuclides. The results of measurements showed that the average activity concentration of 40 K in the nitrogen, phosphorus and potassium fertilisers across the cities varied from 3972.0 ±416.9 to 5089.3 ±111.3 Bq kg -1 , 9.9 ±7.3 to 450.6 ±14.3 Bq kg -1 for 226 Ra, while for 232 Th it varied from less than lower limit of detection to 15.1 ±2.8 Bq kg -1 . The activity concentrations of 40 K, 226 Ra and 232 Th in single super phosphate (SSP) fertilisers and phosphate rocks were also determined. However, high activity concentrations of 226 Ra were obtained in the SSP fertiliser and phosphate rocks and in particular, two brands of fertilisers from ITL/TAK and F and C companies. The values of the activity concentration of the radionuclides in the brands of fertilisers used in Nigeria are within the range of values reported in several other countries except 40 K. (authors)
27 CFR 24.232 - Gauge of spirits.
2010-04-01
... OF THE TREASURY LIQUORS WINE Spirits § 24.232 Gauge of spirits. (a) If the spirits to be used are in a spirits storage tank on bonded wine premises, or are received immediately prior to use from a distilled spirits plant not adjacent or contiguous to bonded wine premises, the proprietor shall determine...
SUZAKU OBSERVATIONS OF THE EXTREME MeV BLAZAR SWIFT J0746.3+2548
International Nuclear Information System (INIS)
Watanabe, Shin; Sato, Rie; Takahashi, Tadayuki; Edwards, Philip G.; Kataoka, Jun; Madejski, Greg; Romani, Roger; Sikora, Marek; Tavecchio, Fabrizio; Sambruna, Rita; Pursimo, Tapio
2009-01-01
We report the Suzaku observations of the high luminosity blazar SWIFT J0746.3+2548 (J0746) conducted in 2005 November. This object, which, with z = 2.979, is the highest redshift source observed in the Suzaku Guaranteed Time Observer period, is likely to show high gamma-ray flux peaking in the MeV range. As a result of the good photon statistics and high signal-to-noise ratio spectrum, the Suzaku observation clearly confirms that J0746 has an extremely hard spectrum in the energy range of 0.3-24 keV, which is well represented by a single power-law with a photon index of Γ ph ≅ 1.17 and Galactic absorption. The multiwavelength spectral energy distribution of J0746 shows two continuum components, and is well modeled assuming that the high-energy spectral component results from Comptonization of the broad-line region photons. In this paper, we search for the bulk Compton spectral features predicted to be produced in the soft X-ray band by scattering external optical/UV photons by cold electrons in a relativistic jet. We discuss and provide constraints on the pair content resulting from the apparent absence of such features.
Natural(es) remisión de V. ciencias natural(es).
2011-01-01
[ES] Definición del término Natural(es) remisión de V. ciencias natural(es). en el diccionario Dicter. [EN] Definition of the word Natural(es) remisión de V. ciencias natural(es). in the dictionary Dicter.
Energy Technology Data Exchange (ETDEWEB)
Guillot, Ph. [Commissariat a l' Energie Atomique, Fontenay aux Roses (France). Centre d' Etudes Nucleaires
1965-07-01
A bibliography about preparation of uranium 232 is done. This even-even isotope of uranium is suitable for radioactive tracer, neutron source through {alpha},n reaction and heat source applications. The irradiation of protactinium 231, the chemical separation and the purification of uranium are studied. (author) [French] Une etude bibliographique de la preparation d'uranium 232 a ete effectuee. Cet isotope pair-pair de l'uranium peut etre utilise en tant que traceur, source d'energie et source de neutrons, lorsqu'il est melange a un element leger tel le beryllium. Une etude du taux de formation des isotopes produits, lors de l'irradiation du protactinium 231 - une des manieres d'obtenir l'uranium 232 - a ete faite a l'aide d'un programme passe sur ordinateur. Les problemes poses par la separation chimique et la purification de l'uranium ont ete egalement envisages dans ce rapport. (auteur)
International Nuclear Information System (INIS)
Essey, Warren; Kusenko, Alexander; Kalashev, Oleg; Beacom, John F.
2011-01-01
Active galactic nuclei (AGNs) can produce both gamma rays and cosmic rays. The observed high-energy gamma-ray signals from distant blazars may be dominated by secondary gamma rays produced along the line of sight by the interactions of cosmic-ray protons with background photons. This explains the surprisingly low attenuation observed for distant blazars, because the production of secondary gamma rays occurs, on average, much closer to Earth than the distance to the source. Thus, the observed spectrum in the TeV range does not depend on the intrinsic gamma-ray spectrum, while it depends on the output of the source in cosmic rays. We apply this hypothesis to a number of sources and, in every case, we obtain an excellent fit, strengthening the interpretation of the observed spectra as being due to secondary gamma rays. We explore the ramifications of this interpretation for limits on the extragalactic background light and for the production of cosmic rays in AGNs. We also make predictions for the neutrino signals, which can help probe the acceleration of cosmic rays in AGNs.
International Nuclear Information System (INIS)
Maxwell, Omeje; Wagiran, Husin; Ibrahim, Noorddin; Lee, Siak Kuan; Sabri, Soheil
2013-01-01
The study of activity concentration of 232 Th, 238 U and 40 K of rock samples from site one (S1L1–S1L11, 70 m) and site two (S2L1–S2L9, 60 m) boreholes in Dei-Dei and Kubwa was presented and the first time in the region to be compared. Activity concentrations were analysed using a high resolution co-axial HPGe gamma ray spectrometer system. The activity concentration ranges in site one borehole were from 45±1 to 98±6 Bq kg −1 for 232 Th, from 18±2 to 37±4 Bq kg −1 for 238 U and from 254 ±32 Bq kg −1 to 1195 ±151 Bq kg −1 for 40 K. The activity concentration ranges in site two borehole were from 32±3 to 84±7 Bq kg −1 for 232 Th, from 15±2 to 52±5 Bq kg −1 for 238 U and from 119±15 to 705±94 for 40 K Bq kg −1 . Significantly higher concentration of 232 Th and 238 U occurs in samples collected from S1L7, S1L11 and S2L1 layers. These zones experienced granitic intrusions produced by denudation and tectonism. 40 K in rock samples of S1L4 and S2L4 activity concentrations is close; it could be that biotite granitic intrusion that is inferred as the formation in that layer reflects the same activity of potassium in rock's radioactivity measurement. The area requires further investigation of soil geochemistry and activity concentration of radionuclides in groundwater. - Highlights: • Activity concentration of 238 U, 232 Th and 40 K was noted high. • The two boreholes show significant different concentrations of 238 U, 232 Th and 40 K. • The Th/U ratio was high in both, but distinctly higher in first borehole. • 232 Th was increasing with depth in site one almost 100%. • The radiological monitoring on groundwater is recommended
ES-2 Dummy Biomechanical Responses.
Byrnes, Katie; Abramczyk, Joseph; Berliner, Jeff; Irwin, Annette; Jensen, Jack; Kowsika, Murthy; Mertz, Harold J; Rouhana, Stephen W; Scherer, Risa; Shi, Yibing; Sutterfield, Aleta; Xu, Lan; Tylko, Suzanne; Dalmotas, Dainius
2002-11-01
This technical paper presents the results of biomechanical testing conducted on the ES-2 dummy by the Occupant Safety Research Partnership and Transport Canada. The ES-2 is a production dummy, based on the EuroSID-1 dummy, that was modified to further improve testing capabilities as recommended by users of the EuroSID-1 dummy. Biomechanical response data were obtained by completing a series of drop, pendulum, and sled tests that are outlined in the International Organization of Standardization Technical Report 9790 that describes biofidelity requirements for the midsize adult male side impact dummy. A few of the biofidelity tests were conducted on both sides of the dummy to evaluate the symmetry of its responses. Full vehicle crash tests were conducted to verify if the changes in the EuroSID-1, resulting in the ES-2 design, did improve the dummy's testing capability. In addition to the biofidelity testing, the ES-2 dummy repeatability, reproducibility and durability are discussed. Finally, this technical paper will compare the biofidelity ratings of the current adult side impact dummies with the ES-2 dummy, which received an overall dummy biofidelity rating of 4.6.
24 CFR 232.610 - Certification of cost requirements.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Certification of cost requirements... ASSISTED LIVING FACILITIES Eligibility Requirements-Supplemental Loans To Finance Purchase and Installation of Fire Safety Equipment Cost Certification Requirements § 232.610 Certification of cost requirements...
24 CFR 232.850 - Notice of default.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Notice of default. 232.850 Section....850 Notice of default. (a) If the default is not cured within the 30 day grace period, as defined in... default. (b) The lender shall give notice in writing to the Commissioner of the failure of the borrower to...
Implication of the detection of very hard spectra from the TeV blazar Mrk 501
Energy Technology Data Exchange (ETDEWEB)
Shukla, Amit; Hughes, Gareth; Biland, Adrian [ETH Zurich, Institute for Particle Physics (Switzerland); Mannheim, Karl; Dorner, Daniela [Institute for Theoretical Physics and Astrophysics, Universitaet Wuerzburg (Germany); Chitnis, Varsha R. [Department of High Energy Physics, Tata Institute of Fundamental Research, Mumbai (India); Roy, Jayashree; Acharya, Bannanje Sripathi [Center for Excellence in Basic Sciences, UM-DAE Mumbai (India)
2016-07-01
The emission from active galactic nuclei ranges from radio to TeV energies and shows high variability. The origin of the high energy emission is highly debated. The observed emission could be due to a complex superposition of emission from multiple zones. New evidence of the detection of very hard intrinsic gamma-ray spectra obtained from Fermi-LAT observations have challenged the theories about origin of VHE gamma-rays. We have used the 7 years of Fermi-LAT data to search for time intervals with unusually hard spectra from the nearby TeV blazar Mrk 501. In the presentation, we discuss a few possible explanations for the origin of these hard spectra within a leptonic scenario.
Hill, Lauren M; Maman, Suzanne; Kilonzo, Mrema Noel; Kajula, Lusajo Joel
2017-02-01
This study tested the association between mental health scores and sexual risk behaviors among male members of social groups known as "camps" in Dar es Salaam, Tanzania. Anxiety and depression were measured using the HSCL-25 and condom use and sexual partner concurrency were assessed through self-report. A total of 1113 sexually active men with an average age of 27 years were included in the analyses. Higher anxiety and depression scores were significantly associated with both condom use (Anxiety AOR = 0.58, 95% CI: 0.44, 0.77; Depression AOR = 0.60, 95% CI: 0.47, 0.77) and concurrency (Anxiety AOR = 2.32, 95% CI: 1.73, 3.12; Depression AOR = 2.08, 95% CI: 1.60, 2.70). The results of this study provide information salient to the development of effective HIV prevention interventions targeting populations with high burdens of anxiety and depression. The feasibility and effect of integrating mental health promotion activities into HIV prevention interventions should be explored.
Benchmark testing calculations for 232Th
International Nuclear Information System (INIS)
Liu Ping
2003-01-01
The cross sections of 232 Th from CNDC and JENDL-3.3 were processed with NJOY97.45 code in the ACE format for the continuous-energy Monte Carlo Code MCNP4C. The K eff values and central reaction rates based on CENDL-3.0, JENDL-3.3 and ENDF/B-6.2 were calculated using MCNP4C code for benchmark assembly, and the comparisons with experimental results are given. (author)
24 CFR 232.525 - Note and security form.
2010-04-01
... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MORTGAGE INSURANCE FOR NURSING HOMES, INTERMEDIATE CARE FACILITIES, BOARD AND CARE HOMES, AND ASSISTED... Fire Safety Equipment Eligible Security Instruments § 232.525 Note and security form. The lender shall...
Neutron inelastic-scattering cross sections of 232Th, 233U, 235U, 238U, 239Pu and 240Pu
International Nuclear Information System (INIS)
Smith, A.B.; Guenther, P.T.
1982-01-01
Differential-neutron-emission cross sections of 232 Th, 233 U, 235 U, 238 U, 239 Pu and 240 Pu are measured between approx. = 1.0 and 3.5 MeV with the angle and magnitude detail needed to provide angle-integrated emission cross sections to approx. 232 Th, 233 U, 235 U and 238 U inelastic-scattering values, poor agreement is observed for 240 Pu, and a serious discrepancy exists in the case of 239 Pu
International Nuclear Information System (INIS)
Dean, L.N.
1994-02-01
Building 232-Z is an element of the Plutonium Finishing Plant (PFP) located in the 200 West Area of the Hanford Site. From 1961 until 1972, plutonium-bearing combustible materials were incinerated in the building. Between 1972 and 1983, following shutdown of the incinerator, the facility was used for waste segregation activities. The facility was placed in retired inactive status in 1984 and classified as a Limited Control Facility pursuant to DOE Order 5480.5, Safety of Nuclear Facilities, and 6430.1A, General Design Criteria. The current plutonium inventory within the building is estimated to be approximately 848 grams, the majority of which is retained within the process hood ventilation system. As a contaminated retired facility, Building 232-Z is included in the DOE Surplus Facility Management Program. The objective of this Decontamination and Decommissioning (D ampersand D) assessment is to remove Building 232-Z, thereby elmininating the radiological and environmental hazards associated with the plutonium inventory within the structure. The steps to accomplish the plan objectives are: (1) identifying the locations of the most significant amounts of plutonium, (2) removing residual plutonium, (3) removing and decontaminating remaining building equipment, (4) dismantling the remaining structure, and (5) closing out the project
Energy Technology Data Exchange (ETDEWEB)
Dean, L.N. [Advanced Sciences, Inc., (United States)
1994-02-01
Building 232-Z is an element of the Plutonium Finishing Plant (PFP) located in the 200 West Area of the Hanford Site. From 1961 until 1972, plutonium-bearing combustible materials were incinerated in the building. Between 1972 and 1983, following shutdown of the incinerator, the facility was used for waste segregation activities. The facility was placed in retired inactive status in 1984 and classified as a Limited Control Facility pursuant to DOE Order 5480.5, Safety of Nuclear Facilities, and 6430.1A, General Design Criteria. The current plutonium inventory within the building is estimated to be approximately 848 grams, the majority of which is retained within the process hood ventilation system. As a contaminated retired facility, Building 232-Z is included in the DOE Surplus Facility Management Program. The objective of this Decontamination and Decommissioning (D&D) assessment is to remove Building 232-Z, thereby elmininating the radiological and environmental hazards associated with the plutonium inventory within the structure. The steps to accomplish the plan objectives are: (1) identifying the locations of the most significant amounts of plutonium, (2) removing residual plutonium, (3) removing and decontaminating remaining building equipment, (4) dismantling the remaining structure, and (5) closing out the project.
24 CFR 232.510 - Commitment and commitment fee.
2010-04-01
... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MORTGAGE INSURANCE FOR NURSING HOMES, INTERMEDIATE CARE FACILITIES, BOARD AND CARE HOMES, AND... of Fire Safety Equipment Fees and Charges § 232.510 Commitment and commitment fee. (a) Issuance of...
24 CFR 232.570 - Endorsement of credit instrument.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Endorsement of credit instrument... of Fire Safety Equipment Eligible Security Instruments § 232.570 Endorsement of credit instrument. The Commissioner shall indicate his insurance of the loan by endorsing the credit instrument and...
Directory of Open Access Journals (Sweden)
Carolina Casadio
2016-09-01
Full Text Available We present multi-wavelength studies of the radio galaxy 3C 120 and the blazar CTA 102 during unprecedented γ-ray flares for both sources. In both studies the analysis of γ-ray data has been compared with a series of 43 GHz VLBA images from the VLBA-BU-BLAZAR program, providing the necessary spatial resolution to probe the parsec scale jet evolution during the high energy events. To extend the radio dataset for 3C 120 we also used 15 GHz VLBA data from the MOJAVE sample. These two objects which represent very different classes of AGN, have similar properties during the γ-ray events. The γ-ray flares are associated with the passage of a new superluminal component through the mm VLBI core, but not all ejections of new components lead to γ-ray events. In both sources γ-ray events occurred only when the new components are moving in a direction closer to our line of sight. We locate the γ-ray dissipation zone a short distance from the radio core but outside of the broad line region, suggesting synchrotron self-Compton scattering as the probable mechanism for the γ-ray production.
NT-proBNP on Cobas h 232 in point-of-care testing
DEFF Research Database (Denmark)
Gils, Charlotte; Ramanathan, R.; Breindahl, T.
2015-01-01
Background. NT-proBNP may be useful for ruling out heart failure in primary health care. In this study we examined the analytical quality of NT-proBNP in primary health care on the Cobas h 232 point-of-care instrument compared with measurements performed in a hospital laboratory. Materials...... and methods. Blood samples requested for NT-proBNP were collected in primary health care (n = 95) and in a hospital laboratory (n = 107). NT-proBNP was measured on-site on Cobas h 232 instruments both in primary health care centres and at the hospital laboratory and all samples were also analyzed...... with a comparison method at the hospital. Precision, trueness, accuracy, and lot-variation were determined at different concentration levels and evaluated according to acceptance criteria. Furthermore user-friendliness was assessed by questionnaires. Results. For Cobas h 232 repeatability CV was 8...
International Nuclear Information System (INIS)
Fonseca, Leandro M.; Pecequilo, Brigitte R.S.
2015-01-01
The titanium dioxide used as the white pigment in paints is produced from the processing of ilmenite minerals. As monazite, the main ilmenite radioactive contaminant, contains 1 to 20% thorium dioxide and also some uranium traces, so, eventually, wall paints can contain radioactivity. Activity concentrations of the naturally occurring radionuclides 226 Ra, 232 Th and 40 K were determined in 15 Brazilian economic wall paints samples, by high resolution gamma-ray spectrometry. The activities concentrations in the studied samples ranged from 1.3 ± 0.2 Bq/kg to 23.4 ± 0.7 Bq/kg for 226 Ra; from 2.5 ± 0.4 Bq/kg to 45.8 ± 1.5 Bq/kg for 232 Th and from 5.8 ± 2.1 Bq/kg to 157 ± 22 Bq/kg for 40 K. The radium equivalent index, calculated from the 226 Ra, 232 Th and 40 K concentrations, varied from 1.30 Bq/kg up to 95.9 Bq/kg, below the value of 370 Bq/kg recommended by OECD for a safety use in residential building applications. (author)
A Spitzer five-band analysis of the Jupiter-sized planet TrES-1
Energy Technology Data Exchange (ETDEWEB)
Cubillos, Patricio; Harrington, Joseph; Foster, Andrew S. D.; Lust, Nate B.; Hardy, Ryan A.; Bowman, M. Oliver [Planetary Sciences Group, Department of Physics, University of Central Florida, Orlando, FL 32816-2385 (United States); Madhusudhan, Nikku, E-mail: pcubillos@fulbrightmail.org [Department of Physics and Department of Astronomy, Yale University, New Haven, CT 06511 (United States)
2014-12-10
With an equilibrium temperature of 1200 K, TrES-1 is one of the coolest hot Jupiters observed by Spitzer. It was also the first planet discovered by any transit survey and one of the first exoplanets from which thermal emission was directly observed. We analyzed all Spitzer eclipse and transit data for TrES-1 and obtained its eclipse depths and brightness temperatures in the 3.6 μm (0.083% ± 0.024%, 1270 ± 110 K), 4.5 μm (0.094% ± 0.024%, 1126 ± 90 K), 5.8 μm (0.162% ± 0.042%, 1205 ± 130 K), 8.0 μm (0.213% ± 0.042%, 1190 ± 130 K), and 16 μm (0.33% ± 0.12%, 1270 ± 310 K) bands. The eclipse depths can be explained, within 1σ errors, by a standard atmospheric model with solar abundance composition in chemical equilibrium, with or without a thermal inversion. The combined analysis of the transit, eclipse, and radial-velocity ephemerides gives an eccentricity of e=0.033{sub −0.031}{sup +0.015}, consistent with a circular orbit. Since TrES-1's eclipses have low signal-to-noise ratios, we implemented optimal photometry and differential-evolution Markov Chain Monte Carlo (MCMC) algorithms in our Photometry for Orbits, Eclipses, and Transits pipeline. Benefits include higher photometric precision and ∼10 times faster MCMC convergence, with better exploration of the phase space and no manual parameter tuning.
Extension of the Th-232 burnup chain in the WIMSD/4 program library
International Nuclear Information System (INIS)
Caldeira, A.D.
1991-07-01
The Th-232 burnup chain was extended through U-236, in the WIMSD/4 program library. The evolution of the values of k i nf and U-235 number density, as function of time, for the modified TRX1 problem, calculated with the new library, shows an improvement in the results when compared with LEOPARD program. (author)
Potter, William J.
2018-01-01
Blazar jets are renowned for their rapid violent variability and multiwavelength flares, however, the physical processes responsible for these flares are not well understood. In this paper, we develop a time-dependent inhomogeneous fluid jet emission model for blazars. We model optically thick radio flares for the first time and show that they are delayed with respect to the prompt optically thin emission by ∼months to decades, with a lag that increases with the jet power and observed wavelength. This lag is caused by a combination of the travel time of the flaring plasma to the optically thin radio emitting sections of the jet and the slow rise time of the radio flare. We predict two types of flares: symmetric flares - with the same rise and decay time, which occur for flares whose duration is shorter than both the radiative lifetime and the geometric path-length delay time-scale; extended flares - whose luminosity tracks the power of particle acceleration in the flare, which occur for flares with a duration longer than both the radiative lifetime and geometric delay. Our model naturally produces orphan X-ray and γ-ray flares. These are caused by flares that are only observable above the quiescent jet emission in a narrow band of frequencies. Our model is able to successfully fit to the observed multiwavelength flaring spectra and light curves of PKS1502+106 across all wavelengths, using a transient flaring front located within the broad-line region.
K2-232 b: a transiting warm Saturn on an eccentric P = 11.2 d orbit around a V = 9.9 star
Brahm, R.; Espinoza, N.; Jordán, A.; Rojas, F.; Sarkis, P.; Díaz, M. R.; Rabus, M.; Drass, H.; Lachaume, R.; Soto, M. G.; Jenkins, J. S.; Jones, M. I.; Henning, Th; Pantoja, B.; Vučković, M.
2018-06-01
We report the discovery of K2-232 b using photometric data of the Kepler K2 satellite coupled with ground-based spectroscopic observations. K2-232 b has a mass of MP = 0.397 ± 0.037 MJ, a radius of RP = 1.00 ± 0.020 RJ, and a moderately low equilibrium temperature of Teq = 1030 ± 15 K due to its relatively large star-planet separation of a = 0.1036 au. K2-232 b orbits its bright (V = 9.9) late F-type host star in an eccentric orbit (e = 0.258 ± 0.025) every 11.2 d, and is one of only four well-characterized warm Jupiters having host stars brighter than V = 10. We estimate a heavy element content of 20 ± 7 M⊕ for K2-232 b, which is consistent with standard models of giant planet formation. The bright host star of K2-232 b makes this system a well-suited target for detailed follow-up observations that will aid in the study of the atmospheres and orbital evolution of giant planets at moderate separations from their host stars.
(232)Th(d,4n)(230)Pa cross-section measurements at ARRONAX facility for the production of (230)U.
Duchemin, C; Guertin, A; Haddad, F; Michel, N; Métivier, V
2014-05-01
(226)Th (T1/2=31 min) is a promising therapeutic radionuclide since results, published in 2009, showed that it induces leukemia cells death and activates apoptosis pathways with higher efficiencies than (213)Bi. (226)Th can be obtained via the (230)U α decay. This study focuses on the (230)U production using the (232)Th(d,4n)(230)Pa(β-)(230)U reaction. Experimental cross sections for deuteron-induced reactions on (232)Th were measured from 30 down to 19 MeV using the stacked-foil technique with beams provided by the ARRONAX cyclotron. After irradiation, all foils (targets as well as monitors) were measured using a high-purity germanium detector. Our new (230)Pa cross-section values, as well as those of (232)Pa and (233)Pa contaminants created during the irradiation, were compared with previous measurements and with results given by the TALYS code. Experimentally, same trends were observed with slight differences in orders of magnitude mainly due to the nuclear data change. Improvements are ongoing about the TALYS code to better reproduce the data for deuteron-induced reactions on (232)Th. Using our cross-section data points from the (232)Th(d,4n)(230)Pa reaction, we have calculated the thick-target yield of (230)U, in Bq/μA·h. This value allows now to a full comparison between the different production routes, showing that the proton routes must be preferred. Copyright © 2014 Elsevier Inc. All rights reserved.
A New Statistical Approach to the Optical Spectral Variability in Blazars
Directory of Open Access Journals (Sweden)
Jose A. Acosta-Pulido
2016-12-01
Full Text Available We present a spectral variability study of a sample of about 25 bright blazars, based on optical spectroscopy. Observations cover the period from the end of 2008 to mid 2015, with an approximately monthly cadence. Emission lines have been identified and measured in the spectra, which permits us to classify the sources into BL Lac-type or FSRQs, according to the commonly used EW limit. We have obtained synthetic photometry and produced colour-magnitude diagrams which show different trends associated with the object classes: generally, BL Lacs tend to become bluer when brighter and FSRQs become redder when brighter, although several objects exhibit both trends, depending on brightness. We have also applied a pattern recognition algorithm to obtain the minimum number of physical components which can explain the variability of the optical spectrum. We have used NMF (Non-Negative Matrix Factorization instead of PCA (Principal Component Analysis to avoid un-realistic negative components. For most targets we found that 2 or 3 meta-components are enough to explain the observed spectral variability.
Estudo retrospectivo de 1.647 tumores mamários em cães
Directory of Open Access Journals (Sweden)
José C. Oliveira Filho
2010-02-01
Full Text Available Tumores mamários são comuns em cães, e constituem o neoplasma mais frequente em cadelas. Este estudo tem como objetivos principais estabelecer a prevalência dos tumores mamários, e dos diferentes tipos histológicos (neoplásicos e não-neoplásicos, diagnosticados em cães no Laboratório de Patologia Veterinária da Universidade Federal de Santa Maria (LPV-UFSM. Foram avaliados 1.304 protocolos de exames histopatológicos recebidos em 1990-2008 e 132 protocolos de necropsias realizadas em 2000-2008. Deles foram obtidos a raça, o sexo e a idade dos cães, a localização do tumor na cadeia mamária, o diagnóstico morfológico e a ocorrência de metástases. Nos protocolos de exame histopatológico, foram diagnosticados 1.495 tumores, considerando que alguns cães tinham mais de um tipo de tumor, sendo 1.465 neoplásicos e 30 não-neoplásicos. Dos neoplásicos, 390 (26,6% eram benignos e 1.075 (73,3% eram malignos, estabelecendo-se uma relação benigno: maligno de 1:2,75. Das 1.125 necropsias de cães realizadas em 2000-2008, 132 (11,6% protocolos tinham descrições de tumor de mama, perfazendo 152 diagnósticos morfológicos, dos quais 150 eram neoplásicos e dois eram não-neoplásicos. Carcinoma simples foi o tipo histológico mais prevalente tanto em biópsias como em necropsias. Nas necropsias, foram observadas metástases para linfonodos em 39 casos (29,5% e para órgãos distantes em 64 casos (53,3%.Mammary gland tumors are common in dogs and are the most common type of neoplasm of female dogs. The main purposes of this study were to establish the prevalence of the mammary gland tumors, as well as of its different histologic types (neoplastic and non-neoplastic, diagnosed in the Laboratório de Patologia Veterinária of the Universidade Federal de Santa Maria. There were 1,304 biopsy reports of mammary gland tumors during 1990-2008 and 132 necropsy reports of dogs with mammary tumors in 2000-2008. Data about breed, gender, and
Energy Technology Data Exchange (ETDEWEB)
Aquino, Reginaldo Ribeiro de
2010-07-01
In this work the concentrations of natural radionuclides {sup 226}Ra, {sup 232}Th and {sup 40}K were determined in superficial sand samples for 16 locations throughout the coast of the Great Victory, metropolitan region of the state of Espirito Santo, Southeast of Brazil. The assessed beaches were Manguinhos and Jacaraipe in Serra county, Camburi, Praia do Canto and Curva da Jurema in Vitoria county, Praia da Costa and Itapua in Vila Velha county, Setibao, Setibinha, Praia do Morro, Praia das Castanheiras and Areia Preta in Guarapari county and sand of the Paulo Cesar Vinha Reserve also located in Guarapari county. Three sand samples of each beach were sealed in 100 mL high density polyethylene flasks. After approximately 4 weeks in order to reach secular equilibrium in the {sup 238}U and {sup 2}'3{sup 2}Th series, the samples were measured by high resolution gamma spectrometry and the spectra analyzed with the WinnerGamma software. The self absorption correction was performed for all samples. The {sup 226}Ra concentration was determined from the weighted average concentrations of {sup 214}Pb and {sup 21}'4Bi, the {sup 232}Th concentration was determined from the weighted average concentrations of {sup 228}Ac, {sup 2}'1{sup 2}Pb and {sup 212}Bi and the concentration of {sup 40}K is determined by its single gamma transition of 1460 keV. The radium equivalent concentration and the external hazard index where obtained from the concentrations of {sup 226}Ra, {sup 232}Th and {sup 4}'0K. {sup 226}Ra concentrations show values varying from 3 +- 1 Bq.kg-1 to 738 +- 38 Bq.kg{sup -1}, with the highest values for the central locality of the Camburi beach. {sup 232}Th concentrations show values varying from 7 +- 3 Bq.kg{sup -1} to 7422 +- 526 Bq.kg{sup -1}, with the highest values for Areia Preta beach. {sup 40}K concentrations show values varying from 14 +- 6 Bq.kg{sup -1} to 638 +- 232 Bq.kg{sup -1}, with the highest values for Areia Preta beach
Determination of specific concentrations of 40K, 238U and 232Th in mineral fertilizer samples
International Nuclear Information System (INIS)
Garcez, Ricardo W.D.; Lopes, Jose M.; Silva, Ademir X.
2015-01-01
The use of fertilizer is an established practice worldwide to promote agricultural productivity increased without increasing the planted area, resulting in native forests protection and increase of the food availability. Some kinds of fertilizer have in their chemical composition some radionuclides due the origin of its feedstock, such as 238 U, the 232 Th, and their descendants, beyond 40 K. Knowledge of the radioactivity levels in the environment is great importance to know the gamma radiation dose that the human being is exposed. For identification and quantitation of radionuclides, it was used gamma spectrometry where HPGe detector was used to obtain the spectra, and LabSOCS software for calculating the detection efficiency for each energy. The values of 232 Th specific concentrations ranged from 4.1 to 368.1 Bq.Kg -1 , the values of 238 U specific concentrations ranged from 16.0 to 647.7 Bq.Kg -1 and 40 K specific concentrations ranged from 19.1 to 12713 Bq.Kg -1 . Concentrations of values are consistent with those found in literature. (author)
Sugimori, Daisuke; Watanabe, Mika; Utsue, Tomohiro
2013-01-01
The lipids (fats and oils) degradation capabilities of soil microorganisms were investigated for possible application in treatment of lipids-contaminated wastewater. We isolated a strain of the bacterium Raoultella planticola strain 232-2 that is capable of efficiently catabolizing lipids under acidic conditions such as in grease traps in restaurants and food processing plants. The strain 232-2 efficiently catabolized a mixture (mixed lipids) of commercial vegetable oil, lard, and beef tallow (1:1:1, w/w/w) at 20-35 °C, pH 3-9, and 1,000-5,000 ppm lipid content. Highly effective degradation rate was observed at 35 °C and pH 4.0, and the 24-h degradation rate was 62.5 ± 10.5 % for 3,000 ppm mixed lipids. The 24-h degradation rate for 3,000 ppm commercial vegetable oil, lard, beef tallow, mixed lipids, and oleic acid was 71.8 %, 58.7 %, 56.1 %, 55.3 ± 8.5 %, and 91.9 % at pH 4 and 30 °C, respectively. R. planticola NBRC14939 (type strain) was also able to efficiently catabolize the lipids after repeated subculturing. The composition of the culture medium strongly influenced the degradation efficiency, with yeast extract supporting more complete dissimilation than BactoPeptone or beef extract. The acid tolerance of strain 232-2 is proposed to result from neutralization of the culture medium by urease-mediated decomposition of urea to NH(3). The rate of lipids degradation increased with the rates of neutralization and cell growth. Efficient lipids degradation using strain 232-2 has been achieved in the batch treatment of a restaurant wastewater.
Coullin, Ph.; Crooijmans, R.P.M.A.; Groenen, M.A.M.; Heilig, R.; Mollicone, R.; Oriol, R.; Candelier, J.J.
2002-01-01
The human FUT8 gene is implicated in crucial developmental stages and is overexpressed in some tumors and other malignant diseases. Based on three different experiments we have assigned the FUT8 gene to chromosome bands 14q23.2 --> q24.1 and not 14q24.3 as previously shown (Yamaguchi et al.,
Directory of Open Access Journals (Sweden)
M.I.P. Palumbo
2013-06-01
Full Text Available O objetivo deste trabalho foi realizar estudo normativo dos potenciais evocados auditivos obtidos de 34 cães sem raça definida e avaliar a influência da idade nos resultados obtidos. Os animais foram divididos em dois grupos de diferentes faixas etárias e o potencial evocado auditivo foi realizado com um estímulo de 85dB. O grupo 1 incluiu 16 cães com idades entre um e oito anos e o grupo 2, 18 animais com idades acima de oito anos. O comprimento e o diâmetro da cabeça foram mensurados e não houve diferença estatística entre os dois grupos. No grupo 1, as médias das latências das ondas I, III e V foram: 1,13; 2,64 e 3,45ms; e dos intervalos I-III, III-V e I-V foram 1,51; 0,81 e 2,32ms, respectivamente. No grupo 2, as médias das latências das ondas I, III e V foram 1,15; 2,62 e 3,55ms; e dos intervalos I-III, III-V e I-V foram 1,47; 0,93 e 2,40ms, respectivamente. As latências observadas neste estudo foram semelhantes a estudos prévios realizados por outros autores. Nos grupos etários analisados e nas condições preestabelecidas deste estudo, a idade influenciou a latência da onda V e, consequentemente, modificou os intervalos III-V e I-V, portanto deve-se considerar essa variante na interpretação dos resultados do BAEP em cães.
Dicty_cDB: Contig-U12086-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U12086-1 gap included 1101 3 5710254 5711336 PLUS 1 2 U12086 0 0 0 0 0 0 0 1 0 0 0 0 0 0 Show Contig...-U12086-1 Contig ID Contig-U12086-1 Contig update 2002.12.18 Contig sequence >Contig-U12086-1 (Contig-U12086-1Q) /CSM_Contig/Contig-U12086...ATCGGATTA Gap gap included Contig length 1101 Chromosome number (1..6, M) 3 Chromosome length 6358359 Start ...te 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U12086-1 (Contig-U12086-1Q) /CSM_Contig/Contig...Sequences producing significant alignments: (bits) Value Contig-U12086-1 (Contig-U12086-1Q) /CSM_Contig/Conti... 404 e-113 Contig
Directory of Open Access Journals (Sweden)
Abdullah Mesut AĞIR
2012-09-01
Full Text Available Between the years 232-234/847-945 of Abbasids period, the period was called as “Turkish Influence” era since it was the period when Turks possessed the military power and they were successful in military command. Abbassids, came to the power after the Umayyads and stayed away from the mevali policy especially enabled the Turks to show theirselves in the historical area. In this way Islamic world testified emerging of the dignified commanders whom had loyalty to their masters and religon. It is remarkable that some of them among these commanders gained influence as much as preposessing the caliphate during its weak terms and even setting up their seperate states. As notorious begs such as Afşin, Boğa el-Kebîr, Boğa es-Sagîr, Vasîf, Eşnas, İnak et-Türk; Boga es-Sagir was also very important lord like the others. The main sources agree with that Boga, who was also known as es-Sagir et-Turki, eş-Şerabi, was turkish man. He was called by Arabs as es-Sagir to distinguish himself from his big brother Boga el-Kebir. Boga is turkish word and is coincided to its different spelling such as “buka”, “buga”. In this manuscript, the activities that this commander performed will be studied. Abbâsîler döneminin 232-334/847-945 yılları arası, Türklerin askerî gücü elinde bulundurdukları ve askerî komuta görevlerinde başarılı oldukları bir dönem olmasından dolayı “Türk Nüfuzu” dönemi olarak adlandırılmıştır. Emevilerden sonra iktidara gelen ve seleflerinin takip etmiş olduğu mevali politikasından uzak duran Abbâsilerin bu siyaseti özellikle Türklerin tarih sahnesinde kendilerini göstermelerine imkân tanımıştı. Bu sayede İslâm âlemi kabiliyetleri ve cesaretleri ile maiyetleri altında bulundukları efendilerine, mensubu bulundukları dinlerine ve bağlı oldukları topraklarına hizmet edecek çok değerli Türk komutanların ortaya çıkışına tanıklık etmiştir. Bu komutanların
International Nuclear Information System (INIS)
Dusenbery, R.L.
1987-01-01
5 mutagen-sensitive mutants of Drosophila melanogaster, reported to perform normal or only slightly reduced excision repair of UV damage, were examined by an unscheduled DNA synthesis (UDS) assay. 2 mutants, classified as completely or partially proficient for both excision and postreplication repair of UV damage, mus(1)103 and mus(2)205, were found to give positive UDS responses only for UV damage. These mutants exhibit no measurable UDS activity following DNA damage by several different alkylating agents and X-rays. 3 mutants, classified as having no defect in excision repair, but measurable defects in postreplication repair of UV damage, exhibit 3 different response patterns. The mutant mei-41 exhibits a highly positive UDS response following damage by all agents, consistent with its prior classification as excision-repair-proficient, but postreplication-repair-deficient for UV damage. The mutant mus(1)101, however, exhibits a strong positive UDS response following only UV damage and appears to be blocked in the excision repair of damage produced by both alkylating agents and X-irradiation. Finally, mus(3)310 exhibits no UDS response to alkylation, X-ray or UV damage. This is not consistent with its previous classification. Results obtained w0272the qualitative in vitro UDS assay are entirely consistent with the results from two separate in vivo measures of excision repair deficiency followign DNA damage, larval hypersensitivity to killing and hypermutability in the sex-linked recessive lethal test. (Auth.)
International Nuclear Information System (INIS)
Jibiri, N.N.; Ajao, A.O.
2004-01-01
Samples of elephant grass collected at some pasturing farmlands across different locations in Ibadan metropolis were analyzed for their natural radioactivity concentrations due to 40 K, 238 U and 232 Th radionuclides. Radioactivity measurements were carried out using γ-ray spectroscopy. The average radioactivity concentration of 40 K was found to be 64.5±8.1 Bq kg -1 , 25.7±5.5 Bq kg -1 for 238 U and 33.4±3.9 Bq kg -1 for 232 Th. The radiological health implication to the population that may result from these values is found to be very low and almost insignificant. No artificial radionuclide, however, was detected in any of the samples, hence, measurements have been taken as representing baseline values of these radionuclides in the grass in the metropolis
24 CFR 232.620 - Determination of compliance by HHS.
2010-04-01
... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MORTGAGE INSURANCE FOR NURSING HOMES, INTERMEDIATE CARE FACILITIES, BOARD AND CARE HOMES, AND... of Fire Safety Equipment Special Requirements § 232.620 Determination of compliance by HHS. An...
Neutron data evaluation of 232U
International Nuclear Information System (INIS)
Maslov, V.M.; Porodzinskij, Yu.V.; Tetereva, N.A.; Kagalenko, A.B.; Kornilov, N.V.; Baba, M.; Hasegawa, A.
2003-03-01
Consistent evaluation of 232 U measured data base is performed. Hauser-Feshbach- Moldauer theory, coupled channel model and double-humped fission barrier model are employed. Total, differential scattering, fission and (n,xn) data are consistently reproduced as a major constraint for inelastic scattering cross section estimate. The direct excitation of ground state and higher band levels is calculated within rigid rotator and soft (deformable) rotator model, respectively. Prompt fission neutron spectra data are described. Average resonance parameters are provided, which reproduce evaluated cross sections in the range of 10-150 keV. (author)
Zhao, Guo; Zhong, Lei; Lu, Xinlun; Hu, Jiao; Gu, Xiaobing; Kai, Yan; Song, Qingqing; Sun, Qing; Liu, Jinbao; Peng, Daxin; Wang, Xiaoquan; Liu, Xiaowen; Liu, Xiufan
2012-02-01
In spring 2009, one strain of H5N1 clade 2.3.2 virus was isolated from wild swans in Shanghai, indicating the importance of the wild swan in the ecology of this highly pathogenic avian influenza virus (HPAIV) in Eastern China. Pathogenicity experiments conducted in this study indicated that the virus was highly pathogenic for chickens but lowly pathogenic for mammalian hosts, as evidenced by reduced infection of mice. The analysis of complete genome sequences and genetic evolution showed that A/Swan/Shanghai/10/09 (SW/SH/09) may be derived from the strain A/silky chicken/Shantou/475/2004 (CK/ST/04), which is homologous to the influenza viruses isolated from chicken, duck, pika, little egret, swan, mandarin duck and bar-headed goose in China Hunan, China Qinghai, Mongolia, Russia, Japan, Korea, Laos and Hong Kong during 2007-2011, indicating that the virus has retro-infected diverse wild birds from chicken, and significant spread of the virus is still ongoing through overlapping migratory flyways. On the basis of the molecular analysis, we also found that there was a deletion of the glycosylation site (NSS) in amino acid 156 of the hemagglutinin (HA) protein when compared with that of the other Clade 2.3.2 viruses isolated between 2007 and 2011. More importantly, the sequence analysis of SW/SH/09 virus displayed the drug-resistant mutations on the matrix protein (M2) and neuraminidase (NA) genes.
International Nuclear Information System (INIS)
Pessenda, L.C.R.; Nascimento Filho, V.F. do; Nadai, E.A. de; Barros Ferraz, E.S. de; Sao Paulo Univ., Piracicaba
1988-01-01
The natural radioactivity in Ra-226 and Th-232 in samples of natural phosphates, industrial gypsums (phosphogypsums) and surface soils of different regions was measured by γ-ray spectrometry. The majority of phosphates and gypsums examined showed significantly higher values than soils, mainly in relation to Ra-226 activity. The activity ranges found for phosphates, gypsums and soils were: 79.1 - 3180 Bq/kg, 56.3 - 986.6 Bq/kg, 8.8 - 54.3 Bq/kg for Ra-226 and 33.6 - 1450.3 Bq/kg; 17.4 - 130,1 Bq/kg, 9.8 - 108.9 Bq/kg for Th-232, respectively. (author) [pt
17 CFR 232.501 - Modular submissions and segmented filings.
2010-04-01
..., EDGAR will suspend the modular submission and notify the electronic filer by electronic mail. After six... COMMISSION REGULATION S-T-GENERAL RULES AND REGULATIONS FOR ELECTRONIC FILINGS Edgar Functions § 232.501 Modular submissions and segmented filings. An electronic filer may use the following procedures to submit...
P-wave assignment of 232Th neutron resonances
International Nuclear Information System (INIS)
Corvi, F.; Pasquariello, G.; Veen, T. van der
1978-01-01
A method of p-wave assignment which exploits the parity dependence of the primary capture γ-ray spectrum was applied to the 232 Th resonance. The yield of capture γ-rays above 4.4 MeV from a 6 mm thick metallic thorium disk was measured in the neutron energy range 20-2200 eV and compared to a similar run with γ-rays in the range 3.7 - 4.4 MeV. A total of 58 resonances showing an enhancement of the high energy γ-ray yield were assigned as p-waves. Assuming that their reduced neutron widths follow a Porter-Thomas distribution, their average value and then the p-wave strength function S 1 were estimated with a maximum likelihood method. The results are: average neutron width=3.4(+0.8 or -0.6)meV; S 1 = 2.0 (+0.5 or -0.4).10 -4
Identification and characterization of a new member of serpin family- HongrES1 in rat epididymis
Institute of Scientific and Technical Information of China (English)
无
2002-01-01
A full length cDNA named HongrES1 was isolated and cloned by screening rat epididymis cDNA libraryusing a mouse EST as a probe and 5'RACE followed. It contained 1590bp nucleotides and its predictedprotein had 415 amino acid residues including a serpin (serine protease inhibitor) conserved domain. Tissuedistribution pattern showed it was specifically expressed in adult rat epididymis; moreover, in situ hybridyza-tion indicated this gene was expressed in a limited region of the cauda epididymis near vas deference. Suchkind of expression pattern sugested that HongrES1 had potential function in male reproduction.
Compilation of Reprints Number 64.
1987-11-01
Ile~w’Cille Celular com 4k1,101M l o ld ilh t Ni Md S C IC SEAE CURRENT )2 14AA / IAP 166 I00 00 2O 3 0 It’dI ’F2)944POSA 1 ~ ~ 111, 11- 1 1 II ,1 li...and cx clone w\\av es. Tellus, I1: 33 52. Hart. J EK 1479. Barotropic quasi-g~eostrophic flo" over aniNOtropic mountains. J. Atmos. Sci.. 36: 1736
MULTIWAVELENGTH EVIDENCE FOR QUASI-PERIODIC MODULATION IN THE GAMMA-RAY BLAZAR PG 1553+113
Energy Technology Data Exchange (ETDEWEB)
Ackermann, M.; Buehler, R. [Deutsches Elektronen Synchrotron DESY, D-15738 Zeuthen (Germany); Ajello, M. [Department of Physics and Astronomy, Clemson University, Kinard Lab of Physics, Clemson, SC 29634-0978 (United States); Albert, A.; Baldini, L.; Blandford, R. D.; Bloom, E. D.; Bottacini, E.; Caliandro, G. A. [W. W. Hansen Experimental Physics Laboratory, Kavli Institute for Particle Astrophysics and Cosmology, Department of Physics and SLAC National Accelerator Laboratory, Stanford University, Stanford, CA 94305 (United States); Atwood, W. B. [Santa Cruz Institute for Particle Physics, Department of Physics and Department of Astronomy and Astrophysics, University of California at Santa Cruz, Santa Cruz, CA 95064 (United States); Ballet, J. [Laboratoire AIM, CEA-IRFU/CNRS/Université Paris Diderot, Service d’Astrophysique, CEA Saclay, F-91191 Gif sur Yvette (France); Barbiellini, G. [Istituto Nazionale di Fisica Nucleare, Sezione di Trieste, I-34127 Trieste (Italy); Bastieri, D.; Buson, S. [Istituto Nazionale di Fisica Nucleare, Sezione di Padova, I-35131 Padova (Italy); Becerra Gonzalez, J. [NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Bellazzini, R. [Istituto Nazionale di Fisica Nucleare, Sezione di Pisa, I-56127 Pisa (Italy); Bissaldi, E. [Istituto Nazionale di Fisica Nucleare, Sezione di Bari, I-70126 Bari (Italy); Bonino, R. [Istituto Nazionale di Fisica Nucleare, Sezione di Torino, I-10125 Torino (Italy); Bregeon, J. [Laboratoire Univers et Particules de Montpellier, Université Montpellier, CNRS/IN2P3, Montpellier (France); Bruel, P., E-mail: David.J.Thompson@nasa.gov, E-mail: sara.cutini@asdc.asi.it, E-mail: stefano.ciprini@asdc.asi.it, E-mail: stefan@astro.su.se, E-mail: stamerra@oato.inaf.it [Laboratoire Leprince-Ringuet, École polytechnique, CNRS/IN2P3, Palaiseau (France); and others
2015-11-10
We report for the first time a γ-ray and multiwavelength nearly periodic oscillation in an active galactic nucleus. Using the Fermi Large Area Telescope we have discovered an apparent quasi-periodicity in the γ-ray flux (E > 100 MeV) from the GeV/TeV BL Lac object PG 1553+113. The marginal significance of the 2.18 ± 0.08 year period γ-ray cycle is strengthened by correlated oscillations observed in radio and optical fluxes, through data collected in the Owens Valley Radio Observatory, Tuorla, Katzman Automatic Imaging Telescope, and Catalina Sky Survey monitoring programs and Swift-UVOT. The optical cycle appearing in ∼10 years of data has a similar period, while the 15 GHz oscillation is less regular than seen in the other bands. Further long-term multiwavelength monitoring of this blazar may discriminate among the possible explanations for this quasi-periodicity.
MULTIWAVELENGTH EVIDENCE FOR QUASI-PERIODIC MODULATION IN THE GAMMA-RAY BLAZAR PG 1553+113
International Nuclear Information System (INIS)
Ackermann, M.; Buehler, R.; Ajello, M.; Albert, A.; Baldini, L.; Blandford, R. D.; Bloom, E. D.; Bottacini, E.; Caliandro, G. A.; Atwood, W. B.; Ballet, J.; Barbiellini, G.; Bastieri, D.; Buson, S.; Becerra Gonzalez, J.; Bellazzini, R.; Bissaldi, E.; Bonino, R.; Bregeon, J.; Bruel, P.
2015-01-01
We report for the first time a γ-ray and multiwavelength nearly periodic oscillation in an active galactic nucleus. Using the Fermi Large Area Telescope we have discovered an apparent quasi-periodicity in the γ-ray flux (E > 100 MeV) from the GeV/TeV BL Lac object PG 1553+113. The marginal significance of the 2.18 ± 0.08 year period γ-ray cycle is strengthened by correlated oscillations observed in radio and optical fluxes, through data collected in the Owens Valley Radio Observatory, Tuorla, Katzman Automatic Imaging Telescope, and Catalina Sky Survey monitoring programs and Swift-UVOT. The optical cycle appearing in ∼10 years of data has a similar period, while the 15 GHz oscillation is less regular than seen in the other bands. Further long-term multiwavelength monitoring of this blazar may discriminate among the possible explanations for this quasi-periodicity
University of Dar es Salaam Library Journal - Vol 9, No 1 (2007)
African Journals Online (AJOL)
Gender Analysis Of Electronic Information Resource Use: The Case Of The University Of Dar Es Salaam, Tanzania · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL ... A Bibliometric Study Of Research On Dar Es Salaam Region: 1980 To 2003 · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT
International Nuclear Information System (INIS)
Jha, S.K.; Gothankar, S.; Iongwai, P.S.; Kharbuli, B.; War, S.A.; Puranik, V.D.
2012-01-01
The concentration of naturally occurring radionuclides 232 Th, 238 U was determined using Instrumental Neutron Activation Analysis (INAA) in different food groups namely cereals, vegetables, leafy vegetables, roots and tubers cultivated and consumed by tribal population residing around the proposed uranium mine. The study area is a part of rural area K. P. Mawthabah (Domiasiat) in the west Khasi Hills District of Meghalaya, India located in the tropical region of high rainfall that remains steeped in tribal tradition without much outside influence. Agriculture by Jhum (slash and burn) cultivation and animal husbandry are the main occupation of the tribal populations. A total of 89 samples from locally grown food products were analyzed. The concentration of 238 U and 232 Th in the soil of the study area was found to vary 1.6–15.5 and 2.0–5.0 times respectively to the average mean value observed in India. The estimated daily dietary intake of 238 U and 232 Th were 2.0 μg d −1 (25 mBq d −1 ) and 3.4 μg d −1 (14 mBq d −1 ) is comparable with reported range 0.5–5.0 μg d −1 and 0.15–3.5 μg d −1 respectively for the Asian population. - Highlights: ► 232 Th, 238 U were determined using Instrumental Neutron Activation Analysis (INAA). ► Study area located in the tropical region of high rainfall that remains steeped in tribal tradition. ► Agriculture by Jhum (slash and burn) cultivation and animal husbandry are the main occupation of the tribal populations. ► The estimated daily intake of 232 Th and 238 U in high rainfall area was found to be 3.4 and 2.0 μg respectively.
Adrián-Martínez, S.; Albert, A.; André, M.; Anton, G.; Ardid, M.; Aubert, J. -J.; Baret, B.; Barrios-Martí, J.; Basa, S.; Bertin, V.; Biagi, S.; Bogazzi, C.; Bormuth, R.; Bou-Cabo, M.; Bouwhuis, M. C.
2015-01-01
The ANTARES telescope is well-suited for detecting astrophysical transient neutrino sources as it can observe a full hemisphere of the sky at all times with a high duty cycle. The background due to atmospheric particles can be drastically reduced, and the point-source sensitivity improved, by selecting a narrow time window around possible neutrino production periods. Blazars, being radio-loud active galactic nuclei with their jets pointing almost directly towards the observer, ...
International Nuclear Information System (INIS)
Misdaq, M.A.; Mortassim, A.
2009-01-01
238 U and 232 Th concentrations as well as 222 Rn and 220 Rn α-activities per unit volume were measured in various natural honey samples collected from different regions in Morocco using CR-39 and LR-115 type II solid state nuclear track detectors (SSNTDs). These radionuclides were also measured in soils, plant flowers and nectar solutions corresponding to the honey samples studied. In addition, these radionuclides were measured in different imported honey samples. The measured 238 U, 232 Th, 222 Rn and 220 Rn concentrations ranged from (1.5 ± 0.1) mBq kg -1 to (10.6 ± 0.6) mBq kg -1 , (1.1 ± 0.1) mBq kg -1 to (4.2 ± 0.2) mBq kg -1 , (1.5 ± 0.1) Bq kg -1 to (10.6 ± 0.6) Bq kg -1 and (1.1 ± 0.1) Bq kg -1 to (4.2 ± 0.2) Bq kg -1 for the honey samples studied, respectively. Annual 238 U, 232 Th and 222 Rn intakes by Moroccan adults from the consumption of honey were assessed. The influence of the nature of soil and plant on the 238 U and 232 Th contents of the studied honey samples was investigated. These measurements were completed by an investigation of the 238 U and 232 Th transfer between soils and plant flowers and that between plant flowers and honey, and also by the investigation of the influence of pollution due to different material dusts on 238 U, 232 Th and 222 Rn in the honey samples studied. Committed equivalent doses due to the annual intake of 238 U, 232 Th and 222 Rn were evaluated in the organs of adult members of the Moroccan rural population from the ingestion of the honey samples. The maximum total committed effective dose due to 238 U, 232 Th and 222 Rn from the ingestion of natural honey by the Moroccan rural population was found to be equal to 0.64 μSνy -1 . (author)
Energy Technology Data Exchange (ETDEWEB)
DOE/NV Operations Office
1999-05-01
This Corrective Action Investigation Plan (CAIP) has been developed in accordance with the Federal Facility Agreement and Consent Order (FFACO) (1996) that was agreed to by the US Department of Energy, Nevada Operations Office (DOE/NV); the State of Nevada Division of Environmental Protection (NDEP); and the US Department of Defense. The CAIP is a document that provides or references all of the specific information for investigation activities associated with Corrective Action Units (CAUs) or Corrective Action Sites (CASs). According to the FFACO, CASs are sites potentially requiring corrective action(s) and may include solid waste management units or individual disposal or release sites. A CAU consists of one or more CASs grouped together based on geography, technical similarity, or agency responsibility for the purpose of determining corrective actions. This CAIP contains the environmental sample collection objectives and criteria for conducting site investigation activities at CAU 232, Area 25 Sewage Lagoons. Corrective Action Unit 232 consists of CAS 25-03-01, Sewage Lagoon, located in Area 25 of the Nevada Test Site (NTS). The NTS is approximately 65 miles (mi) northwest of Las Vegas, Nevada (Figure 1-1) (DOE/NV, 1996a). The Area 25 Sewage Lagoons (Figure 1-2) (IT, 1999b) are located approximately 0.3 mi south of the Test Cell 'C' (TCC) Facility and were used for the discharge of sanitary effluent from the TCC facility. For purposes of this discussion, this site will be referred to as either CAU 232 or the sewage lagoons.
Directory of Open Access Journals (Sweden)
Emily E I M Mouser
Full Text Available One of the hallmarks of HIV-1 disease is the association of heightened CD4+ T-cell activation with HIV-1 replication. Parasitic helminths including filarial nematodes have evolved numerous and complex mechanisms to skew, dampen and evade human immune responses suggesting that HIV-1 infection may be modulated in co-infected individuals. Here we studied the effects of two filarial nematode products, adult worm antigen from Brugia malayi (BmA and excretory-secretory product 62 (ES-62 from Acanthocheilonema viteae on HIV-1 infection in vitro. Neither BmA nor ES-62 influenced HIV-1 replication in CD4+ enriched T-cells, with either a CCR5- or CXCR4-using virus. BmA, but not ES-62, had the capacity to bind the C-type lectin dendritic cell-specific intercellular adhesion molecule-3-grabbing non-integrin (DC-SIGN thereby inhibiting HIV-1 trans-infection of CD4+ enriched T-cells. As for their effect on DCs, neither BmA nor ES-62 could enhance or inhibit DC maturation as determined by CD83, CD86 and HLA-DR expression, or the production of IL-6, IL-10, IL-12 and TNF-α. As expected, due to the unaltered DC phenotype, no differences were found in CD4+ T helper (Th cell phenotypes induced by DCs treated with either BmA or ES-62. Moreover, the HIV-1 susceptibility of the Th-cell populations induced by BmA or ES-62 exposed DCs was unaffected for both CCR5- and CXCR4-using HIV-1 viruses. In conclusion, although BmA has the potential capacity to interfere with HIV-1 transmission or initial viral dissemination through preventing the virus from interacting with DCs, no differences in the Th-cell polarizing capacity of DCs exposed to BmA or ES-62 were observed. Neither antigenic source demonstrated beneficial or detrimental effects on the HIV-1 susceptibility of CD4+ Th-cells induced by exposed DCs.
Energy Technology Data Exchange (ETDEWEB)
Coombs, M.A.; Cuddihy, R.G. (Lovelace Biomedical and Environmental Research Inst., Albuquerque, NM (USA). Inhalation Toxicology Research Inst.)
1983-01-01
Emanation of /sup 232/U daughter products by nuclear recoil and inert gas diffusion from spherical, submicrometer particles of uranium oxide and thorium dioxide was studied. Monodisperse samples of particles containing 1% /sup 232/U and having physical diameters between 0.1 and 1 ..mu..m were used for the emanation measurements. Thorium-228 ions recoiling from the particles after alpha-decay of /sup 232/U were collected electrostatically on a recoil cathode. Radon-220 diffusing from the particles was swept by an airstream into a 4 l. chamber where the /sup 220/Rn daughters were collected on a second cathode. Mathematical models of radionuclide emanation from spherical particles were used to calculate the recoil range of /sup 228/Th and the diffusion coefficient of /sup 220/Rn in the particle matrix. A /sup 228/Th recoil range of 0.02 ..mu..m and a /sup 220/Rn diffusion coefficient of 3 x 10/sup -14/ cm/sup 2//sec were obtained in both uranium oxide and thorium dioxide particles.
International Nuclear Information System (INIS)
Shiraishi, K.
1995-01-01
Thorium-232 and 238 U contents in four food groups were measured by inductively coupled plasma mass spectrometry (ICP-MS). Daily intakes of 232 Th and 238 U for Japanese were estimated to 2.22 mBq and 15.5 mBq per person, respectively. Furthermore, preliminary estimations were made for the effects of imported foods on internal exposures for Japanese. (author). 16 refs., 1 fig., 3 tabs
Directory of Open Access Journals (Sweden)
Marco Soto-Barba
2009-12-01
Full Text Available Objetivos: Determinar las características epidemiológicas de las defunciones por influenza A(H1N1 en la población asegurada de EsSalud-2009. Diseño: Estudio observacional, descriptivo de corte transversal. Lugar: Seguro Social del Perú - EsSalud. Participantes: Personas muertas por influenza A(H1N1. Intervenciones: La información se recolectó del sistema de vigilancia para Infección Respiratoria Aguda Grave y muertes asociadas de Influenza A(H1N1 de la población asegurada a nivel nacional. Se elaboró una base de datos y se procesó según características epidemiológicas de persona, tiempo y espacio, considerando las características clínicas y comorbilidad asociada. Principales medidas de resultados: Muertes por influenza A(H1N1. Resultados: Se registró un total de 74 muertes por influenza A(H1N1 durante el año 2009, 54% (40 hombres y 46% (34 mujeres. El grupo de edad que presentó mayor afectación fue el de 60 a más años, con 26% (19. La edad promedio de fallecimiento fue 41 años. Todos los pacientes fallecidos fueron hospitalizados y presentaron como síntomas principales fiebre y dificultad respiratoria. El 54% (40 presentó comorbilidad, principalmente enfermedades cardiovasculares, insuficiencia renal y obesidad. Según zona de procedencia, la mayoría de fallecimientos fue de Lima, seguido por Arequipa y el Cusco. Conclusiones: Las muertes presentadas por influenza A(H1N1 2009 en los pacientes asegurados en EsSalud son similares a la tendencia nacional, en cuanto a su distribución por sexo. Donde se muestra una diferencia es en el grupo de edad que más fallecidos presentó: para el nivel nacional fue 50 a 59 años (18,2%, mientras que para EsSalud fue 60 a más años (26%. Asimismo, puede verse que la comorbilidad en los fallecidos en EsSalud (54% fue menor a lo reportado por el Minsa para el nivel nacional (77,6%.
International Nuclear Information System (INIS)
Biteau, J.
2013-01-01
Fifty years after the discovery that quasars are extragalactic sources, their bright cores (AGN) and the jets that some of them exhibit still have plenty of secrets to share, particularly through observations in the gamma-ray band. Above 100 GeV, Cherenkov telescopes such as H.E.S.S. have detected 50 AGN, mostly blazars, objects whose jets are pointed toward the observer. The detection of two faint ones, 1ES 1312-423 and SHBL J001355.9-185406, is described in this thesis. Their multiwavelength spectra are reproduced with a synchrotron self-Compton model. The γ rays emitted by blazars are partly absorbed by the extragalactic background light (EBL), the second most intense cosmological background, which carries the integrated history of star formation. The first detection of this absorption above 100 GeV is performed, enabling the measurement of the EBL peak-amplitude in the optical band at the 20% level. In addition to these spectral studies, the fast flux-variations of blazars are investigated using the outbursts of PKS 2155-304 seen by H.E.S.S.. The observation of a skewed flux distribution and of an R.M.S.-flux correlation are interpreted within a kinematic model, where the emission is a realization of a stochastic process. (author)
Directory of Open Access Journals (Sweden)
Chiba Satoshi
2013-03-01
Full Text Available A dispersive coupled-channel optical model potential (DCCOMP that couples the ground-state rotational and low-lying vibrational bands of 238U and 232Th nuclei is studied. The derived DCCOMP couples almost all excited levels below 1 MeV of excitation energy of the corresponding even-even actinides. The ground state, octupole, beta, gamma, and non-axial bands are coupled. The first two isobar analogue states (IAS populated in the quasi-elastic (p,n reaction are also coupled in the proton induced calculation, making the potential approximately Lane consistent. The coupled-channel potential is based on a soft-rotor description of the target nucleus structure, where dynamic vibrations are considered as perturbations of the rigid rotor underlying structure. Matrix elements required to use the proposed structure model in Tamura coupled-channel scheme are derived. Calculated ratio R(U238/Th232 of the total cross-section difference to the averaged σT for 238U and 232Th nuclei is shown to be in excellent agreement with measured data.
A Search for QPOs in the Blazar OJ287: Preliminary Results from the 2015/2016 Observing Campaign
Directory of Open Access Journals (Sweden)
S. Zola
2016-10-01
Full Text Available We analyse the light curve in the R band of the blazar OJ287, gathered during the 2015/2016 observing season. We did a search for quasi-periodic oscillations (QPOs using several methods over a wide range of timescales. No statistically significant periods were found in the high-frequency domain both in the ground-based data and in Kepler observations. In the longer-period domain, the Lomb–Scargle periodogram revealed several peaks above the 99% significance level. The longest one—about 95 days—corresponds to the innermost stable circular orbit (ISCO period of the more massive black hole. The 43-day period could be an alias, or it can be attributed to accretion in the form of a two-armed spiral wave.
Assessment of natural radioactivity of sands in beaches from Great Vitoria, ES, Brazil
International Nuclear Information System (INIS)
Aquino, Reginaldo Ribeiro de
2010-01-01
In this work the concentrations of natural radionuclides 226 Ra, 232 Th and 40 K were determined in superficial sand samples for 16 locations throughout the coast of the Great Victory, metropolitan region of the state of Espirito Santo, Southeast of Brazil. The assessed beaches were Manguinhos and Jacaraipe in Serra county, Camburi, Praia do Canto and Curva da Jurema in Vitoria county, Praia da Costa and Itapua in Vila Velha county, Setibao, Setibinha, Praia do Morro, Praia das Castanheiras and Areia Preta in Guarapari county and sand of the Paulo Cesar Vinha Reserve also located in Guarapari county. Three sand samples of each beach were sealed in 100 mL high density polyethylene flasks. After approximately 4 weeks in order to reach secular equilibrium in the 238 U and 2 '3 2 Th series, the samples were measured by high resolution gamma spectrometry and the spectra analyzed with the WinnerGamma software. The self absorption correction was performed for all samples. The 226 Ra concentration was determined from the weighted average concentrations of 214 Pb and 21 '4Bi, the 232 Th concentration was determined from the weighted average concentrations of 228 Ac, 2 '1 2 Pb and 212 Bi and the concentration of 40 K is determined by its single gamma transition of 1460 keV. The radium equivalent concentration and the external hazard index where obtained from the concentrations of 226 Ra, 232 Th and 4 '0K. 226 Ra concentrations show values varying from 3 +- 1 Bq.kg-1 to 738 +- 38 Bq.kg -1 , with the highest values for the central locality of the Camburi beach. 232 Th concentrations show values varying from 7 +- 3 Bq.kg -1 to 7422 +- 526 Bq.kg -1 , with the highest values for Areia Preta beach. 40 K concentrations show values varying from 14 +- 6 Bq.kg -1 to 638 +- 232 Bq.kg -1 , with the highest values for Areia Preta beach. Calculation of the radium equivalent and the external hazard index showed two distinct groups. In the first one, for the majority of the beaches, the
24 CFR 232.520 - Maximum fees and charges by lender.
2010-04-01
... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MORTGAGE INSURANCE FOR NURSING HOMES, INTERMEDIATE CARE FACILITIES, BOARD AND CARE HOMES, AND... of Fire Safety Equipment Fees and Charges § 232.520 Maximum fees and charges by lender. The lender...
Design and Construction Documents Associated with N232, Sustainability Base
Zornetzer, Steven F.; Schuler, Raymond F.; Grymes, Rosalind A.
2014-01-01
This request comprehensively covers documents associated with the design and construction of Sustainability Base, N232. The intent of this project specifically envisioned broad dissemination of these materials to others undertaking the design and construction of high-performing energy- and resource-efficient buildings in comparable climate zones.
2013-05-30
... Federal or State minimum wage, whichever is higher.'' The collection is also required by regulations for... legal federal or State minimum wage rate, whichever is highest unless special procedures apply to the... Collection for ETA Form 232, Domestic Agricultural In-Season Wage Report and ETA Form 232-A, Wage Survey...
Directory of Open Access Journals (Sweden)
Yue-zhong Li
2017-04-01
Full Text Available Chaperonin GroEL (Cpn60 requires cofactor GroES (Cpn10 for protein refolding in bacteria that possess single groEL and groES genes in a bicistronic groESL operon. Among 4,861 completely-sequenced prokaryotic genomes, 884 possess duplicate groEL genes and 770 possess groEL genes with no neighboring groES. It is unclear whether stand-alone groEL requires groES in order to function and, if required, how duplicate groEL genes and unequal groES genes balance their expressions. In Myxococcus xanthus DK1622, we determined that, while duplicate groELs were alternatively deletable, the single groES that clusters with groEL1 was essential for cell survival. Either GroEL1 or GroEL2 required interactions with GroES for in vitro and in vivo functions. Deletion of groEL1 or groEL2 resulted in decreased expressions of both groEL and groES; and ectopic complementation of groEL recovered not only the groEL but also groES expressions. The addition of an extra groES gene upstream groEL2 to form a bicistronic operon had almost no influence on groES expression and the cell survival rate, whereas over-expression of groES using a self-replicating plasmid simultaneously increased the groEL expressions. The results indicated that M. xanthus DK1622 cells coordinate expressions of the duplicate groEL and single groES genes for synergistic functions of GroELs and GroES. We proposed a potential regulation mechanism for the expression coordination.