WorldWideScience

Sample records for biospinning spider dragline

  1. Morphology and Microstructure of Spider Dragline Silk from Araneus Ventricosus

    Institute of Scientific and Technical Information of China (English)

    PAN Zhi-juan; MIURA Mikihiko; MORIKAWA Hideaki; IWASA Masayuki; LIU Min

    2005-01-01

    The spider dragline silk has excellent mechanical properties. The stress- strain curves of dragline silk fibers have intraspecific and intraindividual variability because of the spiders active control during spinning process. To investigate the relationship between the morphology of dragline silk fibers and spinning conditions, four samples were made at the reeling rates of 1mm/s, 20mm/s, 43.5mm/s and 110mm/s from the major ampullate glands of Araneus Ventricosus and the other two of dragline silks were prepared from a crawling or dropping spider. The surface microstructure and nanofibril characteristic were analyzed with atomic force microscopy (AFM). AFM images of 2000nm*2000nm and 500nm*500nm of these samples showed that the spinning condition influenced the surface roughness and fibril size, while AFM images of 200nm*200nm clearly displayed that dragline silk of Araneus Ventricosus included sheet macro-conformation structure. These results can facilitate the further investigation of the spinning mechanism of a spider in order to understand mechanical properties and macromolecular structures of dragline silk.

  2. A dragline-forming mobile robot inspired by spiders

    International Nuclear Information System (INIS)

    Mobility of wheeled or legged machines can be significantly increased if they are able to move from a solid surface into a three-dimensional space. Although that may be achieved by addition of flying mechanisms, the payload fraction will be the limiting factor in such hybrid mobile machines for many applications. Inspired by spiders producing draglines to assist locomotion, the paper proposes an alternative mobile technology where a robot achieves locomotion from a solid surface into a free space. The technology resembles the dragline production pathway in spiders to a technically feasible degree and enables robots to move with thermoplastic spinning of draglines. As an implementation, a mobile robot has been prototyped with thermoplastic adhesives as source material of the draglines. Experimental results show that a dragline diameter range of 1.17–5.27 mm was achievable by the 185 g mobile robot in descending locomotion from the solid surface of a hanging structure with a power consumption of 4.8 W and an average speed of 5.13 cm min−1. With an open-loop controller consisting of sequences of discrete events, the robot has demonstrated repeatable dragline formation with a relative deviation within −4% and a length close to the metre scale. (paper)

  3. Molecular architecture and engineering of spider dragline silk protein

    Institute of Scientific and Technical Information of China (English)

    ZHANG Hengmu; LIU Jinyuan

    2005-01-01

    Spider dragline silk, which is produced in spider major ampullate gland, is a composite proteinacious fiber with highly repetitive Ala-Gly-rich domain. The unique combination of both high tensile strength and high elasticity makes spider dragline silk superior to almost any other natural or synthetic fibers. Cloning of the genes reveals that the silk is composed of at least two major proteins. Each protein component contains multiple repeats of modular structures that alternate between Ala-rich domains and Gly-rich domains. Molecular engineering not only opens a door to the production of spidroins but also provides a valuable experimental system to test and further establish the relationship between modular structures and mechanical properties. Here, based on our own studies, we review the latest progress of the modular structure and genetic engineering and outline the future prospects.

  4. High-toughness silk produced by a transgenic silkworm expressing spider (Araneus ventricosus dragline silk protein.

    Directory of Open Access Journals (Sweden)

    Yoshihiko Kuwana

    Full Text Available Spider dragline silk is a natural fiber that has excellent tensile properties; however, it is difficult to produce artificially as a long, strong fiber. Here, the spider (Araneus ventricosus dragline protein gene was cloned and a transgenic silkworm was generated, that expressed the fusion protein of the fibroin heavy chain and spider dragline protein in cocoon silk. The spider silk protein content ranged from 0.37 to 0.61% w/w (1.4-2.4 mol% native silkworm fibroin. Using a good silk-producing strain, C515, as the transgenic silkworm can make the raw silk from its cocoons for the first time. The tensile characteristics (toughness of the raw silk improved by 53% after the introduction of spider dragline silk protein; the improvement depended on the quantity of the expressed spider dragline protein. To demonstrate the commercial feasibility for machine reeling, weaving, and sewing, we used the transgenic spider silk to weave a vest and scarf; this was the first application of spider silk fibers from transgenic silkworms.

  5. Genetic engineering of fibrous proteins: spider dragline silk and collagen.

    Science.gov (United States)

    Wong Po Foo, Cheryl; Kaplan, David L

    2002-10-18

    Various strategies have been employed to genetically engineer fibrous proteins. Two examples, the subject of this review, include spider dragline silk from Nephila clavipes and collagen. These proteins are highlighted because of their unique mechanical and biological properties related to controlled release, biomaterials and tissue engineering. Cloning and expression of native genes and synthetic artificial variants of the consensus sequence repeats from the native genes has been accomplished. Expression of recombinant silk and collagen proteins has been reported in a variety of host systems, including bacteria, yeast, insect cells, plants and mammalian cells. Future utility for these proteins for biomedical materials is expected to increase as needs expand for designer materials with tailored mechanical properties and biological interactions to elicit specific responses in vitro and in vivo.

  6. Construction, cloning, and expression of synthetic genes encoding spider dragline silk.

    Science.gov (United States)

    Prince, J T; McGrath, K P; DiGirolamo, C M; Kaplan, D L

    1995-08-29

    Synthetic genes encoding recombinant spider silk proteins have been constructed, cloned, and expressed. Protein sequences were derived from Nephila clavipes dragline silk proteins and reverse-translated to the corresponding DNA sequences. Codon selection was chosen to maximize expression levels in Escherichia coli. DNA "monomer" sequences were multimerized to encode high molecular weight synthetic spider silks using a "head-to-tail" construction strategy. Multimers were cloned into a prokaryotic expression vector and the encoded silk proteins were expressed in E. coli upon induction with IPTG. Four multimer, ranging in size from 14.7 to 41.3 kDa, were chosen for detailed analysis. These proteins were isolated by immobilized metal affinity chromatography and purified using reverse-phase HPLC. The composition and identity of the purified proteins were confirmed by amino acid composition analysis, N-terminal sequencing, laser desorption mass spectroscopy, and Western analysis using antibodies reactive to native spider dragline silk. Circular dichroism measurements indicate that the synthetic spider silks have substantial beta-sheet structure.

  7. Chromosome mapping of dragline silk genes in the genomes of widow spiders (Araneae, Theridiidae.

    Directory of Open Access Journals (Sweden)

    Yonghui Zhao

    Full Text Available With its incredible strength and toughness, spider dragline silk is widely lauded for its impressive material properties. Dragline silk is composed of two structural proteins, MaSp1 and MaSp2, which are encoded by members of the spidroin gene family. While previous studies have characterized the genes that encode the constituent proteins of spider silks, nothing is known about the physical location of these genes. We determined karyotypes and sex chromosome organization for the widow spiders, Latrodectus hesperus and L. geometricus (Araneae, Theridiidae. We then used fluorescence in situ hybridization to map the genomic locations of the genes for the silk proteins that compose the remarkable spider dragline. These genes included three loci for the MaSp1 protein and the single locus for the MaSp2 protein. In addition, we mapped a MaSp1 pseudogene. All the MaSp1 gene copies and pseudogene localized to a single chromosomal region while MaSp2 was located on a different chromosome of L. hesperus. Using probes derived from L. hesperus, we comparatively mapped all three MaSp1 loci to a single region of a L. geometricus chromosome. As with L. hesperus, MaSp2 was found on a separate L. geometricus chromosome, thus again unlinked to the MaSp1 loci. These results indicate orthology of the corresponding chromosomal regions in the two widow genomes. Moreover, the occurrence of multiple MaSp1 loci in a conserved gene cluster across species suggests that MaSp1 proliferated by tandem duplication in a common ancestor of L. geometricus and L. hesperus. Unequal crossover events during recombination could have given rise to the gene copies and could also maintain sequence similarity among gene copies over time. Further comparative mapping with taxa of increasing divergence from Latrodectus will pinpoint when the MaSp1 duplication events occurred and the phylogenetic distribution of silk gene linkage patterns.

  8. Spider dragline silk proteins in transgenic tobacco leaves: accumulation and field production.

    Science.gov (United States)

    Menassa, Rima; Zhu, Hong; Karatzas, Costas N; Lazaris, Anthoula; Richman, Alex; Brandle, Jim

    2004-09-01

    Spider dragline silk is a unique biomaterial and represents nature's strongest known fibre. As it is almost as strong as many commercial synthetic fibres, it is suitable for use in many industrial and medical applications. The prerequisite for such a widespread use is the cost-effective production in sufficient quantities for commercial fibre manufacturing. Agricultural biotechnology and the production of recombinant dragline silk proteins in transgenic plants offer the potential for low-cost, large-scale production. The purpose of this work was to examine the feasibility of producing the two protein components of dragline silk (MaSp1 and MaSp2) from Nephila clavipes in transgenic tobacco. Two different promoters, the enhanced CaMV 35S promoter (Kay et al., 1987) and a new tobacco cryptic constitutive promoter, tCUP (Foster et al., 1999) were used, in conjunction with a plant secretory signal (PR1b), a translational enhancer (alfalfa mosaic virus, AMV) and an endoplasmic reticulum (ER) retention signal (KDEL), to express the MaSp1 and MaSp2 genes in the leaves of transgenic plants. Both genes expressed successfully and recombinant protein accumulated in transgenic plants grown in both greenhouse and field trials. PMID:17168889

  9. Spider dragline silk proteins in transgenic tobacco leaves: accumulation and field production.

    Science.gov (United States)

    Menassa, Rima; Zhu, Hong; Karatzas, Costas N; Lazaris, Anthoula; Richman, Alex; Brandle, Jim

    2004-09-01

    Spider dragline silk is a unique biomaterial and represents nature's strongest known fibre. As it is almost as strong as many commercial synthetic fibres, it is suitable for use in many industrial and medical applications. The prerequisite for such a widespread use is the cost-effective production in sufficient quantities for commercial fibre manufacturing. Agricultural biotechnology and the production of recombinant dragline silk proteins in transgenic plants offer the potential for low-cost, large-scale production. The purpose of this work was to examine the feasibility of producing the two protein components of dragline silk (MaSp1 and MaSp2) from Nephila clavipes in transgenic tobacco. Two different promoters, the enhanced CaMV 35S promoter (Kay et al., 1987) and a new tobacco cryptic constitutive promoter, tCUP (Foster et al., 1999) were used, in conjunction with a plant secretory signal (PR1b), a translational enhancer (alfalfa mosaic virus, AMV) and an endoplasmic reticulum (ER) retention signal (KDEL), to express the MaSp1 and MaSp2 genes in the leaves of transgenic plants. Both genes expressed successfully and recombinant protein accumulated in transgenic plants grown in both greenhouse and field trials.

  10. Dual Thermosensitive Hydrogels Assembled from the Conserved C-Terminal Domain of Spider Dragline Silk.

    Science.gov (United States)

    Qian, Zhi-Gang; Zhou, Ming-Liang; Song, Wen-Wen; Xia, Xiao-Xia

    2015-11-01

    Stimuli-responsive hydrogels have great potentials in biomedical and biotechnological applications. Due to the advantages of precise control over molecular weight and being biodegradable, protein-based hydrogels and their applications have been extensively studied. However, protein hydrogels with dual thermosensitive properties are rarely reported. Here we present the first report of dual thermosensitive hydrogels assembled from the conserved C-terminal domain of spider dragline silk. First, we found that recombinant C-terminal domain of major ampullate spidroin 1 (MaSp1) of the spider Nephila clavipes formed hydrogels when cooled to approximately 2 °C or heated to 65 °C. The conformational changes and self-assembly of the recombinant protein were studied to understand the mechanism of the gelation processes using multiple methods. It was proposed that the gelation in the low-temperature regime was dominated by hydrogen bonding and hydrophobic interaction between folded protein molecules, whereas the gelation in the high-temperature regime was due to cross-linking of the exposed hydrophobic patches resulting from partial unfolding of the protein upon heating. More interestingly, genetic fusion of the C-terminal domain to a short repetitive region of N. clavipes MaSp1 resulted in a chimeric protein that formed a hydrogel with significantly improved mechanical properties at low temperatures between 2 and 10 °C. Furthermore, the formation of similar hydrogels was observed for the recombinant C-terminal domains of dragline silk of different spider species, thus demonstrating the conserved ability to form dual thermosensitive hydrogels. These findings may be useful in the design and construction of novel protein hydrogels with tunable multiple thermosensitivity for applications in the future.

  11. Comprehensive Proteomic Analysis of Spider Dragline Silk from Black Widows: A Recipe to Build Synthetic Silk Fibers

    Science.gov (United States)

    Larracas, Camille; Hekman, Ryan; Dyrness, Simmone; Arata, Alisa; Williams, Caroline; Crawford, Taylor; Vierra, Craig A.

    2016-01-01

    The outstanding material properties of spider dragline silk fibers have been attributed to two spidroins, major ampullate spidroins 1 and 2 (MaSp1 and MaSp2). Although dragline silk fibers have been treated with different chemical solvents to elucidate the relationship between protein structure and fiber mechanics, there has not been a comprehensive proteomic analysis of the major ampullate (MA) gland, its spinning dope, and dragline silk using a wide range of chaotropic agents, inorganic salts, and fluorinated alcohols to elucidate their complete molecular constituents. In these studies, we perform in-solution tryptic digestions of solubilized MA glands, spinning dope and dragline silk fibers using five different solvents, followed by nano liquid chromatography coupled to tandem mass spectrometry (LC-MS/MS) analysis with an Orbitrap Fusion™ Tribrid™. To improve protein identification, we employed three different tryptic peptide fragmentation modes, which included collision-induced dissociation (CID), electron transfer dissociation (ETD), and high energy collision dissociation (HCD) to discover proteins involved in the silk assembly pathway and silk fiber. In addition to MaSp1 and MaSp2, we confirmed the presence of a third spidroin, aciniform spidroin 1 (AcSp1), widely recognized as the major constituent of wrapping silk, as a product of dragline silk. Our findings also reveal that MA glands, spinning dope, and dragline silk contain at least seven common proteins: three members of the Cysteine-Rich Protein Family (CRP1, CRP2 and CRP4), cysteine-rich secretory protein 3 (CRISP3), fasciclin and two uncharacterized proteins. In summary, this study provides a proteomic blueprint to construct synthetic silk fibers that most closely mimic natural fibers. PMID:27649139

  12. Comprehensive Proteomic Analysis of Spider Dragline Silk from Black Widows: A Recipe to Build Synthetic Silk Fibers

    Directory of Open Access Journals (Sweden)

    Camille Larracas

    2016-09-01

    Full Text Available The outstanding material properties of spider dragline silk fibers have been attributed to two spidroins, major ampullate spidroins 1 and 2 (MaSp1 and MaSp2. Although dragline silk fibers have been treated with different chemical solvents to elucidate the relationship between protein structure and fiber mechanics, there has not been a comprehensive proteomic analysis of the major ampullate (MA gland, its spinning dope, and dragline silk using a wide range of chaotropic agents, inorganic salts, and fluorinated alcohols to elucidate their complete molecular constituents. In these studies, we perform in-solution tryptic digestions of solubilized MA glands, spinning dope and dragline silk fibers using five different solvents, followed by nano liquid chromatography coupled to tandem mass spectrometry (LC-MS/MS analysis with an Orbitrap Fusion™ Tribrid™. To improve protein identification, we employed three different tryptic peptide fragmentation modes, which included collision-induced dissociation (CID, electron transfer dissociation (ETD, and high energy collision dissociation (HCD to discover proteins involved in the silk assembly pathway and silk fiber. In addition to MaSp1 and MaSp2, we confirmed the presence of a third spidroin, aciniform spidroin 1 (AcSp1, widely recognized as the major constituent of wrapping silk, as a product of dragline silk. Our findings also reveal that MA glands, spinning dope, and dragline silk contain at least seven common proteins: three members of the Cysteine-Rich Protein Family (CRP1, CRP2 and CRP4, cysteine-rich secretory protein 3 (CRISP3, fasciclin and two uncharacterized proteins. In summary, this study provides a proteomic blueprint to construct synthetic silk fibers that most closely mimic natural fibers.

  13. Synthetic spider dragline silk proteins and their production in Escherichia coli.

    Science.gov (United States)

    Fahnestock, S R; Irwin, S L

    1997-01-01

    Synthetic genes were designed to encode analogs of the two proteins of Nephila clavipes dragline silk, spidroins 1 and 2. The genes were constructed of tandem repeats of relatively long (more than 300 bp) DNA sequences assembled from synthetic oligonucleotides, and encoded proteins of high molecular mass (65-163 kDa). Both analogs were produced efficiently in Escherichia coli. The yield and homogeneity of the products of longer genes were limited by premature termination of synthesis, probably as a result of processivity errors in protein synthesis. Average termination rates were determined to be 1 in 1100 codons to 1 in 300 codons, depending on the length and synonymous codon choices of the gene. Both analog proteins could be induced to form stable aqueous solutions without denaturants. Circular dichroism spectra of the purified proteins in dilute solution resembled spectra of redissolved natural dragline silk in reflecting a largely disordered structure in water and more ordered structures in mixed solvents with methanol and trifluoroethanol.

  14. Female dragline-mediated species recognition between the wolf spiders Pardosa astrigera and Pardosa pseudoannulata%雌蛛拖丝在星豹蛛和拟环纹豹蛛物种识别中的作用

    Institute of Scientific and Technical Information of China (English)

    曾阳; 梁宏合; 江庆生; 陈建; 刘凤想; 焦晓国

    2015-01-01

    通过比较狼蛛科豹蛛属的星豹蛛和拟环纹豹蛛雄蛛分别在两种雌蛛释放的拖丝上的求偶行为差异,验证两种豹蛛雌蛛拖丝上化学信息物质在物种识别中的作用。研究发现,两种雄性豹蛛在同种雌蛛拖丝上的求偶潜伏时间都显著短于在异种雌蛛拖丝上的求偶潜伏时间,两种雄性豹蛛在同种雌蛛拖丝上的求偶强度都显著强于异种雌蛛拖丝上的求偶强度。可见雄性豹蛛能通过雌蛛拖丝上的化学信息物质进行种内识别。%Chemical signals play important roles on species recognition,mate recognition and mate assessment. Current research in Lycosidae most focuses on the dragline-mediated chemical cues in mate recognition and mate assessment.Depending on the dragline-mediated chemical cues,male wolf spiders are able to discriminate sex,developmental period and female mating status. In the present study,in order to investigate whether male wolf spiders could discriminate conspecific females through female dragline-mediated chemical cues,we compared male courtship behaviour when males were exposed to the draglines from conspecific and heterospecific females between the two closely related species (Pardosa astrigera and P. pseudoannulata). Our results indicated that male courtship latency was significantly delayed and courtship intensity substantially decreased when the male wolf spiders were exposed to the draglines of heterospecifics females compared with those of conspecifics females. Male wolf spiders of P. astrigera and P. pseudoannulata are capable of chemically discriminating between conspecifics and heterospecifics females.

  15. 转KAP6.1-GFP-蜘蛛拖丝蛋白基因核心序列4S绵羊成纤维细胞株的筛选%Filtration of Transgenic Sheep Skin Fibroblasts with KAP6.1-GFP-polymerized Spider Dragline Silk Protein Gene(4S)

    Institute of Scientific and Technical Information of China (English)

    王春生; 原璐; 宁方勇; 吴治昊; 朴善花; 安铁洙

    2011-01-01

    [目的]通过体细胞核移植为获得皮肤特异表达蜘蛛拖丝蛋白的绵羊莫定基础.[方法]将pcDNA3.1和带有角蛋白结合蛋白启动子质粒pGM-T-KAP6.1分别用Bg1 Ⅱ和Hin d Ⅲ双酶切后连接,再与蜘蛛拖丝蛋白基因核心序列4S连接,最后通过酶切与pIRES2-EGFP质粒连接后构建真核表达载体pIRES2-EGFP-4S;将此载体线性化后,采用脂质体法转染绵羊皮肤成纤维细胞,通过G418筛选获得转基因阳性细胞.[结果]筛选得到转pIRES2-EGFP-4S的阳性细胞.对阳性细胞经体外培养后的检测显示:(1)细胞形态(长梭形)、细胞生长曲线(呈S形)、群体倍增时间(随培养时间增加逐渐缩短)和细胞接种率(细胞贴壁率及存活率在24 h内逐渐升高,并达到最高值125%)等均具有正常绵羊成纤维细胞的生物学特征;(2)阳性细胞经冷冻复苏后具有与新鲜阳性细胞相似的生物学特征;(3)PCR检测结果显示,pIRES2-EGFP-4S在阳性细胞的基因组中整合.[结论]获得具有在绵羊皮肤特异表达,且便于检测的转蜘蛛拖丝蛋白4S的绵羊成纤维细胞株.%[Objective] This study aims to establish transgenic sheep fibroblast cell line and lay a foundation for transgenic sheep with expression spider dragline silk protein gene in hair follicle by nuclear transplantation. [Method] pcDNA3.1 and pGM-T-KAP6.1(hair follicle-specific promoter) were digested by 5g/Ⅱand Hind Ⅲ, and linked each other. The recombinant plasmid was linked with spider dragline silk protein gene and then linked with pIRES2-EGFP by a series of molecular methods. The eukaryotic expression vector pIRES2-EGFP-4S was constructed. Sheep fibroblasts were transfected with the plasmid by cationic liposome method and G418 was used to filtrate them. After identified, transgenic cell line with spider dragline silk protein gene was established. [Result] The G418 positive cells were detected in vitro. The results showed that cellular morphology was similar

  16. Dragline operator performance indicator

    Energy Technology Data Exchange (ETDEWEB)

    Dragan Komljenovic; Dragan Bogunovic; Vladislav Kecojevic [University of Quebec, PQ (Canada)

    2010-03-15

    The purpose of this research was to establish an operator performance indicator (OPI) that can be used by mining professionals/management to aid in the evaluation of dragline operators in surface coal mining. The OPI is defined as a ratio of hourly dragline production and hourly energy consumption, which needs to be maximised. A statistical approach based on confidence intervals is proposed as a means of classifying operators' performance. The results of an experiment conducted at a surface mine that is operated by one of the largest North American coal companies are discussed to demonstrate the practical application of developed method. The method applied in this article can also be adjusted and used for various mining equipment.

  17. Spider-Web Inspired Mechanical Metamaterials

    OpenAIRE

    Miniaci, Marco; Krushynska, Anastasiia; Movchan, Alexander B.; Bosia, Federico; Pugno, Nicola M.

    2016-01-01

    Spider silk is a remarkable example of bio-material with superior mechanical characteristics. Its multilevel structural organization of dragline and viscid silk leads to unusual and tunable properties, extensively studied from a quasi-static point of view. In this study, inspired by the Nephila spider orb web architecture, we propose a novel design for mechanical metamaterials based on its periodic repetition. We demonstrate that spider-web metamaterial structure plays an important role in th...

  18. Recombinant Dragline Silk-Like Proteins—Expression and Purification

    Science.gov (United States)

    Gaines, William A.; Marcotte, William R.

    2011-01-01

    Spider dragline silk is a proteinaceous fiber with impressive physical characteristics making it attractive for use in advanced materials. The fiber is composed of two proteins (spidroins MaSp1 and MaSp2), each of which contains a large central repeat array flanked by non-repetitive N- and C-terminal domains. The repeat arrays appear to be largely responsible for the tensile properties of the fiber, suggesting that the N- and C-terminal domains may be involved in self-assembly. We recently isolated the MaSp1 and MaSp2 N-terminal domains from Nephila clavipes and have incorporated these into mini-silk genes for expression in transgenic systems. Current efforts involve the development of expression vectors that will allow purification using a removable affinity tag for scalable protein purification. PMID:23914141

  19. Recombinant Dragline Silk-Like Proteins-Expression and Purification.

    Science.gov (United States)

    Gaines, William A; Marcotte, William R

    2011-03-01

    Spider dragline silk is a proteinaceous fiber with impressive physical characteristics making it attractive for use in advanced materials. The fiber is composed of two proteins (spidroins MaSp1 and MaSp2), each of which contains a large central repeat array flanked by non-repetitive N- and C-terminal domains. The repeat arrays appear to be largely responsible for the tensile properties of the fiber, suggesting that the N- and C-terminal domains may be involved in self-assembly. We recently isolated the MaSp1 and MaSp2 N-terminal domains from Nephila clavipes and have incorporated these into mini-silk genes for expression in transgenic systems. Current efforts involve the development of expression vectors that will allow purification using a removable affinity tag for scalable protein purification.

  20. 30 CFR 77.409 - Shovels, draglines, and tractors.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Shovels, draglines, and tractors. 77.409... COAL MINES Safeguards for Mechanical Equipment § 77.409 Shovels, draglines, and tractors. (a) Shovels, draglines, and tractors shall not be operated in the presence of any person exposed to a hazard from...

  1. NMRbot: Python scripts enable high-throughput data collection on current Bruker BioSpin NMR spectrometers.

    Science.gov (United States)

    Clos, Lawrence J; Jofre, M Fransisca; Ellinger, James J; Westler, William M; Markley, John L

    2013-06-01

    To facilitate the high-throughput acquisition of nuclear magnetic resonance (NMR) experimental data on large sets of samples, we have developed a simple and straightforward automated methodology that capitalizes on recent advances in Bruker BioSpin NMR spectrometer hardware and software. Given the daunting challenge for non-NMR experts to collect quality spectra, our goal was to increase user accessibility, provide customized functionality, and improve the consistency and reliability of resultant data. This methodology, NMRbot, is encoded in a set of scripts written in the Python programming language accessible within the Bruker BioSpin TopSpin™ software. NMRbot improves automated data acquisition and offers novel tools for use in optimizing experimental parameters on the fly. This automated procedure has been successfully implemented for investigations in metabolomics, small-molecule library profiling, and protein-ligand titrations on four Bruker BioSpin NMR spectrometers at the National Magnetic Resonance Facility at Madison. The investigators reported benefits from ease of setup, improved spectral quality, convenient customizations, and overall time savings. PMID:23678341

  2. NMRbot: Python scripts enable high-throughput data collection on current Bruker BioSpin NMR spectrometers.

    Science.gov (United States)

    Clos, Lawrence J; Jofre, M Fransisca; Ellinger, James J; Westler, William M; Markley, John L

    2013-06-01

    To facilitate the high-throughput acquisition of nuclear magnetic resonance (NMR) experimental data on large sets of samples, we have developed a simple and straightforward automated methodology that capitalizes on recent advances in Bruker BioSpin NMR spectrometer hardware and software. Given the daunting challenge for non-NMR experts to collect quality spectra, our goal was to increase user accessibility, provide customized functionality, and improve the consistency and reliability of resultant data. This methodology, NMRbot, is encoded in a set of scripts written in the Python programming language accessible within the Bruker BioSpin TopSpin™ software. NMRbot improves automated data acquisition and offers novel tools for use in optimizing experimental parameters on the fly. This automated procedure has been successfully implemented for investigations in metabolomics, small-molecule library profiling, and protein-ligand titrations on four Bruker BioSpin NMR spectrometers at the National Magnetic Resonance Facility at Madison. The investigators reported benefits from ease of setup, improved spectral quality, convenient customizations, and overall time savings.

  3. Production of spider silk proteins in tobacco and potato.

    Science.gov (United States)

    Scheller, J; Gührs, K H; Grosse, F; Conrad, U

    2001-06-01

    Spider dragline silk is a proteinaceous fiber with remarkable mechanical properties that make it attractive for technical applications. Unfortunately, the material cannot be obtained in large quantities from spiders. We have therefore generated transgenic tobacco and potato plants that express remarkable amounts of recombinant Nephila clavipes dragline proteins. Using a gene synthesis approach, the recombinant proteins exhibit homologies of >90% compared to their native models. Here, we demonstrate the accumulation of recombinant silk proteins, which are encoded by synthetic genes of 420-3,600 base pairs, up to a level of at least 2% of total soluble protein in the endoplasmic reticulum (ER) of tobacco and potato leaves and potato tubers, respectively. Using the present expression system, spider silk proteins up to 100 kDa could be detected in plant tissues. When produced in plants, the recombinant spidroins exhibit extreme heat stability-a property that is used to purify the spidroins by a simple and efficient procedure.

  4. Structural and optical studies on selected web spinning spider silks.

    Science.gov (United States)

    Karthikeyani, R; Divya, A; Mathavan, T; Asath, R Mohamed; Benial, A Milton Franklin; Muthuchelian, K

    2017-01-01

    This study investigates the structural and optical properties in the cribellate silk of the sheet web spider Stegodyphus sarasinorum Karsch (Eresidae) and the combined dragline, viscid silk of the orb-web spiders Argiope pulchella Thorell (Araneidae) and Nephila pilipes Fabricius (Nephilidae). X-ray diffraction (XRD), Fourier transform infra-red (FTIR), Ultraviolet-visible (UV-Vis) and fluorescence spectroscopic techniques were used to study these three spider silk species. X-ray diffraction data are consistent with the amorphous polymer network which is arising from the interaction of larger side chain amino acid contributions due to the poly-glycine rich sequences known to be present in the proteins of cribellate silk. The same amorphous polymer networks have been determined from the combined dragline and viscid silk of orb-web spiders. From FTIR spectra the results demonstrate that, cribellate silk of Stegodyphus sarasinorum, combined dragline viscid silk of Argiope pulchella and Nephila pilipes spider silks are showing protein peaks in the amide I, II and III regions. Further they proved that the functional groups present in the protein moieties are attributed to α-helical and side chain amino acid contributions. The optical properties of the obtained spider silks such as extinction coefficients, refractive index, real and imaginary dielectric constants and optical conductance were studied extensively from UV-Vis analysis. The important fluorescent amino acid tyrosine is present in the protein folding was investigated by using fluorescence spectroscopy. This research would explore the protein moieties present in the spider silks which were found to be associated with α-helix and side chain amino acid contributions than with β-sheet secondary structure and also the optical relationship between the three different spider silks are investigated. Successful spectroscopic knowledge of the internal protein structure and optical properties of the spider silks could

  5. Spiders spinning electrically charged nano-fibres.

    Science.gov (United States)

    Kronenberger, Katrin; Vollrath, Fritz

    2015-01-01

    Most spider threads are on the micrometre and sub-micrometre scale. Yet, there are some spiders that spin true nano-scale fibres such as the cribellate orb spider, Uloborus plumipes. Here, we analyse the highly specialized capture silk-spinning system of this spider and compare it with the silk extrusion systems of the more standard spider dragline threads. The cribellar silk extrusion system consists of tiny, morphologically basic glands each terminating through exceptionally long and narrow ducts in uniquely shaped silk outlets. Depending on spider size, hundreds to thousands of these outlet spigots cover the cribellum, a phylogenetically ancient spinning plate. We present details on the unique functional design of the cribellate gland-duct-spigot system and discuss design requirements for its specialist fibrils. The spinning of fibres on the nano-scale seems to have been facilitated by the evolution of a highly specialist way of direct spinning, which differs from the aqua-melt silk extrusion set-up more typical for other spiders.

  6. Molecular Fundaments of Mechanical Properties of Spider Silk

    Institute of Scientific and Technical Information of China (English)

    潘志娟; 刘敏; 李春萍; 李栋高; 盛家镛

    2003-01-01

    Dragline,framework and cocoon silk fibers of Araneus Ventricosus were used for this study.To investigate the microstructure mechanisms of stress-strain behavior of spider silk,firstly,amino acid compositions were analyzed and molecular conformations and crystallinity were measured with Raman spectra and X-ray diffraction respectively.The results showed that there were more amino acids with large side groups and polar ones in spider silk than those of Bombyx silk,and the amino acid distribution varied with different spider silk.The molecular structures were mainly α-helix and β-sheet,and random coil and β-turn existed as well.The proportions and arrangement of these conformations of dragline silk were different from framework and cocoon silk fibers.Microstructure was one of important factors of excellent mechanical properties of spider silk.Crystallinity of spider silk was very low,which implied that the roles of crystal on spider silk were not as great as other protein fibers.

  7. Preventive Replacement Decisions for Dragline Components Using Reliability Analysis

    Directory of Open Access Journals (Sweden)

    Nuray Demirel

    2016-05-01

    Full Text Available Reliability-based maintenance policies allow qualitative and quantitative evaluation of system downtimes via revealing main causes of breakdowns and discussing required preventive activities against failures. Application of preventive maintenance is especially important for mining machineries since production is highly affected from machinery breakdowns. Overburden stripping operations are one of the integral parts in surface coal mine productions. Draglines are extensively utilized in overburden stripping operations and they achieve earthmoving activities with bucket capacities up to 168 m3. The massive structure and operational severity of these machines increase the importance of performance awareness for individual working components. Research on draglines is rarely observed in the literature and maintenance studies for these earthmovers have been generally ignored. On this basis, this paper offered a comprehensive reliability assessment for two draglines currently operating in the Tunçbilek coal mine and discussed preventive replacement for wear-out components of the draglines considering cost factors.

  8. Spider web-inspired acoustic metamaterials

    Science.gov (United States)

    Miniaci, Marco; Krushynska, Anastasiia; Movchan, Alexander B.; Bosia, Federico; Pugno, Nicola M.

    2016-08-01

    Spider silk is a remarkable example of bio-material with superior mechanical characteristics. Its multilevel structural organization of dragline and viscid silk leads to unusual and tunable properties, extensively studied from a quasi-static point of view. In this study, inspired by the Nephila spider orb web architecture, we propose a design for mechanical metamaterials based on its periodic repetition. We demonstrate that spider-web metamaterial structure plays an important role in the dynamic response and wave attenuation mechanisms. The capability of the resulting structure to inhibit elastic wave propagation in sub-wavelength frequency ranges is assessed, and parametric studies are performed to derive optimal configurations and constituent mechanical properties. The results show promise for the design of innovative lightweight structures for tunable vibration damping and impact protection, or the protection of large scale infrastructure such as suspended bridges.

  9. Molecular spring: from spider silk to silkworm silk

    CERN Document Server

    Wu, Xiang; Du, Ning; Xu, Gang-Qin; Li, Bao-Wen

    2009-01-01

    In this letter, we adopt a new approach combining theoretical modeling with silk stretching measurements to explore the mystery of the structures between silkworm and spider silks, leading to the differences in mechanical response against stretching. Hereby the typical stress-strain profiles are reproduced by implementing the newly discovered and verified "$\\beta$-sheet splitting" mechanism, which primarily varies the secondary structure of protein macromolecules; our modeling and simulation results show good accordance with the experimental measurements. Hence, it can be concluded that the post-yielding mechanical behaviors of both kinds of silks are resulted from the splitting of crystallines while the high extensibility of spider dragline is attributed to the tiny $\\beta$-sheets solely existed in spider silk fibrils. This research reveals for the first time the structural factors leading to the significant difference between spider and silkworm silks in mechanical response to the stretching force. Addition...

  10. Tarantula spider

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/article/002855.htm Tarantula spider bite To use the sharing features on ... JavaScript. This article describes the effects of a tarantula spider bite. This article is for information only. ...

  11. Spider Silk-CBD-Cellulose Nanocrystal Composites: Mechanism of Assembly

    Science.gov (United States)

    Meirovitch, Sigal; Shtein, Zvi; Ben-Shalom, Tal; Lapidot, Shaul; Tamburu, Carmen; Hu, Xiao; Kluge, Jonathan A.; Raviv, Uri; Kaplan, David L.; Shoseyov, Oded

    2016-01-01

    The fabrication of cellulose-spider silk bio-nanocomposites comprised of cellulose nanocrystals (CNCs) and recombinant spider silk protein fused to a cellulose binding domain (CBD) is described. Silk-CBD successfully binds cellulose, and unlike recombinant silk alone, silk-CBD self-assembles into microfibrils even in the absence of CNCs. Silk-CBD-CNC composite sponges and films show changes in internal structure and CNC alignment related to the addition of silk-CBD. The silk-CBD sponges exhibit improved thermal and structural characteristics in comparison to control recombinant spider silk sponges. The glass transition temperature (Tg) of the silk-CBD sponge was higher than the control silk sponge and similar to native dragline spider silk fibers. Gel filtration analysis, dynamic light scattering (DLS), small angle X-ray scattering (SAXS) and cryo-transmission electron microscopy (TEM) indicated that silk-CBD, but not the recombinant silk control, formed a nematic liquid crystalline phase similar to that observed in native spider silk during the silk spinning process. Silk-CBD microfibrils spontaneously formed in solution upon ultrasonication. We suggest a model for silk-CBD assembly that implicates CBD in the central role of driving the dimerization of spider silk monomers, a process essential to the molecular assembly of spider-silk nanofibers and silk-CNC composites. PMID:27649169

  12. Spider Silk-CBD-Cellulose Nanocrystal Composites: Mechanism of Assembly.

    Science.gov (United States)

    Meirovitch, Sigal; Shtein, Zvi; Ben-Shalom, Tal; Lapidot, Shaul; Tamburu, Carmen; Hu, Xiao; Kluge, Jonathan A; Raviv, Uri; Kaplan, David L; Shoseyov, Oded

    2016-01-01

    The fabrication of cellulose-spider silk bio-nanocomposites comprised of cellulose nanocrystals (CNCs) and recombinant spider silk protein fused to a cellulose binding domain (CBD) is described. Silk-CBD successfully binds cellulose, and unlike recombinant silk alone, silk-CBD self-assembles into microfibrils even in the absence of CNCs. Silk-CBD-CNC composite sponges and films show changes in internal structure and CNC alignment related to the addition of silk-CBD. The silk-CBD sponges exhibit improved thermal and structural characteristics in comparison to control recombinant spider silk sponges. The glass transition temperature (Tg) of the silk-CBD sponge was higher than the control silk sponge and similar to native dragline spider silk fibers. Gel filtration analysis, dynamic light scattering (DLS), small angle X-ray scattering (SAXS) and cryo-transmission electron microscopy (TEM) indicated that silk-CBD, but not the recombinant silk control, formed a nematic liquid crystalline phase similar to that observed in native spider silk during the silk spinning process. Silk-CBD microfibrils spontaneously formed in solution upon ultrasonication. We suggest a model for silk-CBD assembly that implicates CBD in the central role of driving the dimerization of spider silk monomers, a process essential to the molecular assembly of spider-silk nanofibers and silk-CNC composites. PMID:27649169

  13. Spider Silk-CBD-Cellulose Nanocrystal Composites: Mechanism of Assembly

    Directory of Open Access Journals (Sweden)

    Sigal Meirovitch

    2016-09-01

    Full Text Available The fabrication of cellulose-spider silk bio-nanocomposites comprised of cellulose nanocrystals (CNCs and recombinant spider silk protein fused to a cellulose binding domain (CBD is described. Silk-CBD successfully binds cellulose, and unlike recombinant silk alone, silk-CBD self-assembles into microfibrils even in the absence of CNCs. Silk-CBD-CNC composite sponges and films show changes in internal structure and CNC alignment related to the addition of silk-CBD. The silk-CBD sponges exhibit improved thermal and structural characteristics in comparison to control recombinant spider silk sponges. The glass transition temperature (Tg of the silk-CBD sponge was higher than the control silk sponge and similar to native dragline spider silk fibers. Gel filtration analysis, dynamic light scattering (DLS, small angle X-ray scattering (SAXS and cryo-transmission electron microscopy (TEM indicated that silk-CBD, but not the recombinant silk control, formed a nematic liquid crystalline phase similar to that observed in native spider silk during the silk spinning process. Silk-CBD microfibrils spontaneously formed in solution upon ultrasonication. We suggest a model for silk-CBD assembly that implicates CBD in the central role of driving the dimerization of spider silk monomers, a process essential to the molecular assembly of spider-silk nanofibers and silk-CNC composites.

  14. Spider Silk-CBD-Cellulose Nanocrystal Composites: Mechanism of Assembly.

    Science.gov (United States)

    Meirovitch, Sigal; Shtein, Zvi; Ben-Shalom, Tal; Lapidot, Shaul; Tamburu, Carmen; Hu, Xiao; Kluge, Jonathan A; Raviv, Uri; Kaplan, David L; Shoseyov, Oded

    2016-09-18

    The fabrication of cellulose-spider silk bio-nanocomposites comprised of cellulose nanocrystals (CNCs) and recombinant spider silk protein fused to a cellulose binding domain (CBD) is described. Silk-CBD successfully binds cellulose, and unlike recombinant silk alone, silk-CBD self-assembles into microfibrils even in the absence of CNCs. Silk-CBD-CNC composite sponges and films show changes in internal structure and CNC alignment related to the addition of silk-CBD. The silk-CBD sponges exhibit improved thermal and structural characteristics in comparison to control recombinant spider silk sponges. The glass transition temperature (Tg) of the silk-CBD sponge was higher than the control silk sponge and similar to native dragline spider silk fibers. Gel filtration analysis, dynamic light scattering (DLS), small angle X-ray scattering (SAXS) and cryo-transmission electron microscopy (TEM) indicated that silk-CBD, but not the recombinant silk control, formed a nematic liquid crystalline phase similar to that observed in native spider silk during the silk spinning process. Silk-CBD microfibrils spontaneously formed in solution upon ultrasonication. We suggest a model for silk-CBD assembly that implicates CBD in the central role of driving the dimerization of spider silk monomers, a process essential to the molecular assembly of spider-silk nanofibers and silk-CNC composites.

  15. Rotational-echo Double-resonance in Complex Biopolymers: a Study of Nephila Clavipes Dragline Silk

    Energy Technology Data Exchange (ETDEWEB)

    Michal, Carl A.; Jelinski, Lynn W. [Cornell University, Center for Advanced Technology (United States)

    1998-08-15

    Rotational-Echo Double-Resonance (REDOR) NMR on strategically 13C and 15N labeled samples is used to study the conformation of the LGXQ (X = S, G, or N) motif in the major ampullate gland dragline silk from the spider Nephila clavipes. A method is described for calculating REDOR dephasing curves suitable for background subtractions, using probability distributions of nitrogen atoms surrounding a given carbon site, which are developed from coordinates in the Brookhaven Protein Data Bank. The validity of the method is established by comparison to dephasings observed from natural abundance 13C peaks for G and A. Straightforward fitting of universal REDOR dephasing curves to the background corrected peaks of interest provide results which are not self-consistent, and a more sophisticated analysis is developed which better accounts for 15N labels which have scrambled from the intended positions. While there is likely some heterogeneity in the structures formed by the LGXQ sequences, the data indicate that they all form compact turn-like structures.

  16. Local tolerance to spider silks and protein polymers in vivo.

    Science.gov (United States)

    Vollrath, F; Barth, P; Basedow, A; Engström, W; List, H

    2002-01-01

    Spider silks were implanted subcutaneously in pigs for a study of the tolerance against this material. Four types of spider silks of high purity and cleanliness were implanted: (i) major ampullate dragline silk reeled from the golden silk spider Nephila clavipes, (ii) native (unsterilised) silk reeled from a Brachypelma spider, (iii) native silk taken from this spider's web and (iv) its web silk thermally treated at 80 degrees C. For comparison we used fibrous silk analogue protein polymers and four already marketed wound dressings (polyurethane film, collagen dressings, gauze pads). All materials were applied epicutaneously to split skin wounds. The implants were examined macroscopically as well as by light microscopy. Superficially, all sites healed rapidly. There were marked inflammatory reactions in all sites with lympho-plasmacellular infiltrations, evidence of phagocytosis and granuloma formation as indicated by the appearance of giant cells. However there was a marked absence of epitheloid cells indicating that the observed reaction was a foreign body granuloma. Furthermore, the histopathological images recorded after 14 days revealed no marked differences between the dressings. Polyurethane films, however, seemed to be superior with respect to the duration of the wound healing process. PMID:12224131

  17. SPIDER SILK

    Directory of Open Access Journals (Sweden)

    PORAV Viorica

    2014-05-01

    Full Text Available The strengthness and toughness of spider fiber and its multifunctional nature is only surpassed in some cases by synthetic high performance fibers. In the world of natural fibers, spider silk has been long time recognized as a wonder fiber for its unique combination of high strength and rupture elongation. Scientists in civil military engineering reveal that the power of biological material (spider silk lies in the geometric configuration of structural protein, and the small cluster of week hydrogen bonds that works together to resist force and dissipate energy. Each spider and each type of silk has a set of mechanical properties optimized for their biological function. Most silks, in particular deagline silk, have exceptional mechanical properties. They exhibit a unique combination of high tensile strength and extensibility (ductility. This enables a silk fiber to absorb a lot of energy before breaking (toughness, the area under a stress- strain curve. A frequent mistake made in the mainstream media is to confuse strength and toughness when comparing silk to other materials. As shown below in detail, weight for weight, silk is stronger than steel, but not as strong as Kevlar. Silk is,however, tougher than both.This paper inform about overview on the today trend in the world of spider silk.

  18. Artificial skin--culturing of different skin cell lines for generating an artificial skin substitute on cross-weaved spider silk fibres.

    Directory of Open Access Journals (Sweden)

    Hanna Wendt

    Full Text Available BACKGROUND: In the field of Plastic Reconstructive Surgery the development of new innovative matrices for skin repair is in urgent need. The ideal biomaterial should promote attachment, proliferation and growth of cells. Additionally, it should degrade in an appropriate time period without releasing harmful substances, but not exert a pathological immune response. Spider dragline silk from Nephila spp meets these demands to a large extent. METHODOLOGY/PRINCIPAL FINDINGS: Native spider dragline silk, harvested directly out of Nephila spp spiders, was woven on steel frames. Constructs were sterilized and seeded with fibroblasts. After two weeks of cultivating single fibroblasts, keratinocytes were added to generate a bilayered skin model, consisting of dermis and epidermis equivalents. For the next three weeks, constructs in co-culture were lifted on an originally designed setup for air/liquid interface cultivation. After the culturing period, constructs were embedded in paraffin with an especially developed program for spidersilk to avoid supercontraction. Paraffin cross-sections were stained in Haematoxylin & Eosin (H&E for microscopic analyses. CONCLUSION/SIGNIFICANCE: Native spider dragline silk woven on steel frames provides a suitable matrix for 3 dimensional skin cell culturing. Both fibroblasts and keratinocytes cell lines adhere to the spider silk fibres and proliferate. Guided by the spider silk fibres, they sprout into the meshes and reach confluence in at most one week. A well-balanced, bilayered cocultivation in two continuously separated strata can be achieved by serum reduction, changing the medium conditions and the cultivation period at the air/liquid interphase. Therefore spider silk appears to be a promising biomaterial for the enhancement of skin regeneration.

  19. Biomaterial evolution parallels behavioral innovation in the origin of orb-like spider webs.

    Science.gov (United States)

    Blackledge, Todd A; Kuntner, Matjaž; Marhabaie, Mohammad; Leeper, Thomas C; Agnarsson, Ingi

    2012-01-01

    Correlated evolution of traits can act synergistically to facilitate organism function. But, what happens when constraints exist on the evolvability of some traits, but not others? The orb web was a key innovation in the origin of >12,000 species of spiders. Orb evolution hinged upon the origin of novel spinning behaviors and innovations in silk material properties. In particular, a new major ampullate spidroin protein (MaSp2) increased silk extensibility and toughness, playing a critical role in how orb webs stop flying insects. Here, we show convergence between pseudo-orb-weaving Fecenia and true orb spiders. As in the origin of true orbs, Fecenia dragline silk improved significantly compared to relatives. But, Fecenia silk lacks the high compliance and extensibility found in true orb spiders, likely due in part to the absence of MaSp2. Our results suggest how constraints limit convergent evolution and provide insight into the evolution of nature's toughest fibers.

  20. The mechanical design of spider silks: from fibroin sequence to mechanical function.

    Science.gov (United States)

    Gosline, J M; Guerette, P A; Ortlepp, C S; Savage, K N

    1999-12-01

    Spiders produce a variety of silks, and the cloning of genes for silk fibroins reveals a clear link between protein sequence and structure-property relationships. The fibroins produced in the spider's major ampullate (MA) gland, which forms the dragline and web frame, contain multiple repeats of motifs that include an 8-10 residue long poly-alanine block and a 24-35 residue long glycine-rich block. When fibroins are spun into fibres, the poly-alanine blocks form (&bgr;)-sheet crystals that crosslink the fibroins into a polymer network with great stiffness, strength and toughness. As illustrated by a comparison of MA silks from Araneus diadematus and Nephila clavipes, variation in fibroin sequence and properties between spider species provides the opportunity to investigate the design of these remarkable biomaterials.

  1. The molecular structures of major ampullate silk proteins of the wasp spider, Argiope bruennichi: a second blueprint for synthesizing de novo silk.

    Science.gov (United States)

    Zhang, Yang; Zhao, Ai-Chun; Sima, Yang-Hu; Lu, Cheng; Xiang, Zhong-Huai; Nakagaki, Masao

    2013-03-01

    The dragline silk of orb-weaving spiders possesses extremely high tensile strength and elasticity. To date, full-length sequences of only two genes encoding major ampullate silk protein (MaSp) in Latrodectus hesperus have been determined. In order to further understand this gene family, we utilized in this study a variety of strategies to isolate full-length MaSp1 and MaSp2 cDNAs in the wasp spider Argiope bruennichi. A. bruennichi MaSp1 and MaSp2 are primarily composed of remarkably homogeneous ensemble repeats containing several complex motifs, and both have highly conserved C-termini and N-termini. Two novel amino acid motifs, GGF and SGR, were found in MaSp1 and MaSp2, respectively. Amino acid composition analysis of silk, luminal contents and predicted sequences indicates that MaSp1 and MaSp2 are two major components of major ampullate glands and that the ratio of MaSp1 to MaSp2 is approximately 3:2 in dragline silk. Furthermore, both the MaSp1:MaSp2 ratio and the conserved termini are closely linked with the production of high quality synthetic fibers. Our results make an important contribution to our understanding of major ampullate silk protein structure and provide a second blueprint for creating new composite silk which mimics natural spider dragline silk. PMID:23262065

  2. Nonlinear control of high-frequency phonons in spider silk

    Science.gov (United States)

    Schneider, Dirk; Gomopoulos, Nikolaos; Koh, Cheong Y.; Papadopoulos, Periklis; Kremer, Friedrich; Thomas, Edwin L.; Fytas, George

    2016-10-01

    Spider dragline silk possesses superior mechanical properties compared with synthetic polymers with similar chemical structure due to its hierarchical structure comprised of partially crystalline oriented nanofibrils. To date, silk’s dynamic mechanical properties have been largely unexplored. Here we report an indirect hypersonic phononic bandgap and an anomalous dispersion of the acoustic-like branch from inelastic (Brillouin) light scattering experiments under varying applied elastic strains. We show the mechanical nonlinearity of the silk structure generates a unique region of negative group velocity, that together with the global (mechanical) anisotropy provides novel symmetry conditions for gap formation. The phononic bandgap and dispersion show strong nonlinear strain-dependent behaviour. Exploiting material nonlinearity along with tailored structural anisotropy could be a new design paradigm to access new types of dynamic behaviour.

  3. Bird-eating Spiders

    Institute of Scientific and Technical Information of China (English)

    梁小明

    2002-01-01

    Many people are frightened by spiders (蜘蛛). They are especially afraid of large, hairyones. The largest and most frightening of all is thebird-eating spider, which lives in the hot, thickrain forests of northern South America.

  4. Dragline bucket improvement survey. Final report, September 30, 1977-September 29, 1979

    Energy Technology Data Exchange (ETDEWEB)

    Stilwell, T.; Kelly, H.; Rumbarger, J.; Dowling, M.

    1979-01-01

    An operating dragline bucket receives a lot of abuse. It logs about a million dig cycles every two or three years, all the while operating through abrasive overburden on a round-the-clock basis. It is to the credit of designers, operators and maintenance men alike that these buckets perform so well under such adverse conditions. Comments made in this report are for the purpose of focusing on areas in which further improvements can be made, and in no way are intended to reflect adversely on the generally high quality of bucket design, use and repair. From December 1977 to September 1978, investigators visited nine surface coal mines to review first-hand the techniques and problems associated with dragline equipment. The contractor also conducted some basic analyses regarding bucket geometry and force patterns. The report concludes that: dragline bucket and rigging designs, while traditionally satisfactory, could be bettered in some areas; the major maintenance problem associated with buckets and associated rigging is abrasive wear; the repair costs for associated rigging (primarily chains) can run in excess of 50% of the repair costs for buckets; there is no established engineering information available regarding stresses, forces, soil flow and soil resistance in relation to dragline buckets; present computer monitoring and analysis equipment could, with appropriate modifications, be utilized to yield useful engineering information.

  5. The Spiders of China

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    @@ Sevaral books about Chinese spider systematics and biology have been published,mostly since the later 1970s and the majority of then are designed as classification guides to the spider fauna of a particular area of China,or focused on a particular group ,for example Fauna of Zhejiang Province ,Araneida and Salticids of China. The newly published book "The Spiders of China",in English,differs from all others by including all 2361 described Chinese spider species and by reviewing literature of over 200 years of work on Chinese spider classification.

  6. Spider silk-like proteins derived from transgenic Nicotiana tabacum.

    Science.gov (United States)

    Peng, Congyue Annie; Russo, Julia; Gravgaard, Charlene; McCartney, Heather; Gaines, William; Marcotte, William R

    2016-08-01

    The high tensile strength and biocompatibility of spider dragline silk makes it a desirable material in many engineering and tissue regeneration applications. Here, we present the feasibility to produce recombinant proteins in transgenic tobacco Nicotiana tabacum with sequences representing spider silk protein building blocks . Recombinant mini-spidroins contain native N- and C-terminal domains of major ampullate spidroin 1 (rMaSp1) or rMaSp2 flanking an abbreviated number (8, 16 or 32) of consensus repeat domains. Two different expression plasmid vectors were tested and a downstream chitin binding domain and self-cleavable intein were included to facilitate protein purification. We confirmed gene insertion and RNA transcription by PCR and reverse-transcriptase PCR, respectively. Mini-spidroin production was detected by N-terminus specific antibodies. Purification of mini-spidroins was performed through chitin affinity chromatography and subsequent intein activation with reducing reagent. Mini-spidroins, when dialyzed and freeze-dried, formed viscous gelatin-like fluids. PMID:27026165

  7. Weld-induced residual stresses in a prototype dragline cluster and comparison with design codes

    Energy Technology Data Exchange (ETDEWEB)

    Joshi, S.; Semetay, C.; Price, J.W.H.; Nied, H.F. [Concordia University, Montreal, PQ (Canada). Dept. of Mechanical & Industrial Engineering

    2010-02-15

    The Australian coal mining industry employs a large fleet of thin-walled Circular Hollow Section (CHS) welded draglines built of several clusters along the length of the main boom, which are often very heavily overlapped with co-eccentric multiple tubular structures. Heat treatment processes for relieving thermally generated weld-induced residual stresses are usually not employed owing to the high costs and potential dragline downtime. However, it is estimated that these weld-induced residual stresses are usually within a tolerable range and are not the major motivating factor in the initiation and propagation of fatigue-induced cracking. This paper presents the simulation of welding-induced residual stresses in a CHS T-Joint, which would form the first of the four lacings welded on to the main chord of a typical mining dragline cluster. The paper compares numerically generated residual stresses during the welding process in a single weld pass with the approach used in two Standards: (I) R6-Revision 4, Assessment of the Integrity of Structures Containing Defects and (ii) American Petroleum Institute API 579-1/ ASME FFS-1 2007. The comparison attests to the observation that while residual stresses in the fused area at some points could be higher than the yield stress, they are generally not capable of inducing cracks in their own right.

  8. Optimization of transport passage with dragline system in thick overburden open pit mine

    Institute of Scientific and Technical Information of China (English)

    Zhang Weishi; Cai Qingxiang; Chen Shuzhao

    2013-01-01

    According to the characteristics of opencast coal resources and dragline technology system application in China, the structure and shifting step of transport passage are optimized in this paper. Typical coal trans-port passage is analyzed in aspects such as the internal dump occupation, dragline operation efficiency, coal transport distance, upper stripping distance and shifting quantities. The middle passage should be given priority in thick overburden open pit mine because the dragline system is only responsible for part stripping task. According to characteristics of middle passage, the transport passage is divided into par-allel climbing, vertical climbing and horizontal transport. In addition, the transport passage structure optimization model and shifting distance optimization model are established in this paper. The case study in Heidaigou open pit mine shows that, the parallel climbing height is accounted for about 60%of the total height, and reasonable shifting distances of the first mining area and the second mining area are 240 and 320 m. Sensitivity analysis shows that, the total passage height has important influence on the shifting step, so it is with the stripping height and passage construction cost to the passage structure.

  9. Spider-man

    Institute of Scientific and Technical Information of China (English)

    路遇

    2002-01-01

    Spider-Man was first introduced in the comic(连环画) Amazing Fantasy #15(August 1962).Peter Parker,a Senior at Midtown High School,receives his powers when bitten by a exhibition(转基因) spider in a science demonstration(展览).This bite endowed(赋予) him with the proportional(相应的) strength and agility(敏捷) of a spider along with a keen “spider sense”.

  10. Disgust and spider phobia

    NARCIS (Netherlands)

    Mulkens, SAN; de Jong, Peter; Merckelbach, H

    1996-01-01

    Twenty-four women with spider phobia and 45 nonphobic women completed the Disgust Questionnaire(DQ; P. Rozin, A. E. Fallen, & R. Mandell, 1984) and the Spider Phobia Questionnaire (SPQ; R. Klorman, T. C. Weerts, J. E. Hastings, B. G. Melamed, gr P. J. Lang, 1974). Participants also underwent behavio

  11. Respiration in spiders (Araneae).

    Science.gov (United States)

    Schmitz, Anke

    2016-05-01

    Spiders (Araneae) are unique regarding their respiratory system: they are the only animal group that breathe simultaneously with lungs and tracheae. Looking at the physiology of respiration the existence of tracheae plays an important role in spiders with a well-developed tracheal system. Other factors as sex, life time, type of prey capture and the high ability to gain energy anaerobically influence the resting and the active metabolic rate intensely. Most spiders have metabolic rates that are much lower than expected from body mass; but especially those with two pairs of lungs. Males normally have higher resting rates than females; spiders that are less evolved and possess a cribellum have lower metabolic rates than higher evolved species. Freely hunting spiders show a higher energy turnover than spiders hunting with a web. Spiders that live longer than 1 year will have lower metabolic rates than those species that die after 1 year in which development and reproduction must be completed. Lower temperatures and starvation, which most spiders can cope with, will decrease the metabolic rate as well. PMID:26820263

  12. Spiders and Silk

    Institute of Scientific and Technical Information of China (English)

    熊世民

    2004-01-01

    Spiders are very small, so it is easy to think that they do not make anything strong. However, a scientist at Oxford University in Britain has discovered this is not true. David Knight says that eight-legged spiders create a material called silk that could be as strong as rope.

  13. Becoming a Spider Scientist

    Science.gov (United States)

    Patrick, Patricia; Getz, Angela

    2008-01-01

    In this integrated unit, third grade students become spider scientists as they observe spiders in their classroom to debunk some common misconceptions about these intimidating creatures. "Charlotte's Web" is used to capture students' interest. In addition to addressing philosophical topics such as growing-up, death, and friendship; E.B. White's…

  14. Spiders in random environment

    CERN Document Server

    Gallesco, Christophe; Popov, Serguei; Vachkovskaia, Marina

    2010-01-01

    A spider consists of several, say $N$, particles. Particles can jump independently according to a random walk if the movement does not violate some given restriction rules. If the movement violates a rule it is not carried out. We consider random walk in random environment (RWRE) on $\\Z$ as underlying random walk. We suppose the environment $\\omega=(\\omega_x)_{x \\in \\Z}$ to be elliptic, with positive drift and nestling, so that there exists a unique positive constant $\\kappa$ such that $\\E[((1-\\omega_0)/\\omega_0)^{\\kappa}]=1$. The restriction rules are kept very general; we only assume transitivity and irreducibility of the spider. The main result is that the speed of a spider is positive if $\\kappa/N>1$ and null if $\\kappa/N<1$. In particular, if $\\kappa/N <1$ a spider has null speed but the speed of a (single) RWRE is positive.

  15. Attentional and behavioural responses of spider fearfuls to virtual spiders

    NARCIS (Netherlands)

    Rinck, M.; Kwakkenbos, C.M.C.; Dotsch, R.; Wigboldus, D.H.J.; Becker, E.S.

    2009-01-01

    This study employed an immersed virtual environment (IVE) in the Nijmegen RIVERlab to study spider fearfuls' attentional and motor reactions to virtual spiders. The participants were exposed to virtual spiders while completing an unrelated task, walking freely through a virtual museum. Compared to n

  16. Regulation of wolf spider populations

    OpenAIRE

    Rickers, Silke

    2005-01-01

    Aim of this study was to identify major regulatory mechanisms for wolf spider populations. Field and laboratory experiments focussed on the importance of prey availability (autochthonous & allochthonous), food quality and habitat heterogeneity on performance of individual wolf spiders or whole populations and on intra- (cannibalism) and interspecific (intraguild predation) relationships in wolf spiders. Wolf spider populations on xeric grasslands near Darmstadt (Germany) are increased on graz...

  17. Bioprospecting finds the toughest biological material: extraordinary silk from a giant riverine orb spider.

    Directory of Open Access Journals (Sweden)

    Ingi Agnarsson

    Full Text Available BACKGROUND: Combining high strength and elasticity, spider silks are exceptionally tough, i.e., able to absorb massive kinetic energy before breaking. Spider silk is therefore a model polymer for development of high performance biomimetic fibers. There are over 41,000 described species of spiders, most spinning multiple types of silk. Thus we have available some 200,000+ unique silks that may cover an amazing breadth of material properties. To date, however, silks from only a few tens of species have been characterized, most chosen haphazardly as model organisms (Nephila or simply from researchers' backyards. Are we limited to 'blindly fishing' in efforts to discover extraordinary silks? Or, could scientists use ecology to predict which species are likely to spin silks exhibiting exceptional performance properties? METHODOLOGY: We examined the biomechanical properties of silk produced by the remarkable Malagasy 'Darwin's bark spider' (Caerostris darwini, which we predicted would produce exceptional silk based upon its amazing web. The spider constructs its giant orb web (up to 2.8 m(2 suspended above streams, rivers, and lakes. It attaches the web to substrates on each riverbank by anchor threads as long as 25 meters. Dragline silk from both Caerostris webs and forcibly pulled silk, exhibits an extraordinary combination of high tensile strength and elasticity previously unknown for spider silk. The toughness of forcibly silked fibers averages 350 MJ/m(3, with some samples reaching 520 MJ/m(3. Thus, C. darwini silk is more than twice tougher than any previously described silk, and over 10 times better than Kevlar®. Caerostris capture spiral silk is similarly exceptionally tough. CONCLUSIONS: Caerostris darwini produces the toughest known biomaterial. We hypothesize that this extraordinary toughness coevolved with the unusual ecology and web architecture of these spiders, decreasing the likelihood of bridgelines breaking and collapsing the web

  18. 智能搜索蜘蛛%Intelligent Search Spiders

    Institute of Scientific and Technical Information of China (English)

    武海燕; 甘利人

    2001-01-01

    The search mechanism and the search process of the intelligent search spiders developed by the University of Arizona, which include Competitive Intelligence (CI) Spider, Meta Spider and Cancer Spider, are introduced. The characteristics of these spiders are summarized.

  19. Spider Bites (For Parents)

    Science.gov (United States)

    ... brown recluse spider bite: red blister in the center with surrounding bluish discoloration around the bite swelling or redness around the bite development of pain around the bite within 2 to 8 hours joint stiffness or pain nausea, vomiting body rash fever and ...

  20. PATHWAYS TO SPIDER PHOBIA

    NARCIS (Netherlands)

    MERCKELBACH, H; ARNTZ, A; ARRINDELL, WA; DEJONG, PJ

    1992-01-01

    Using a revised version of the Phobic Origin Questionnaire (POQ; Ost, L. G. & Hugdahl, K. Behaviour Research and Therapy, 19,439-477; 1981), the present study examined whether conditioning experiences, modeling experiences, and/or informational learning experiences were more often reported by spider

  1. The Spider Files

    Science.gov (United States)

    McDonald, James; Dominguez, Lynn

    2012-01-01

    As children develop misconceptions about animals they believe are dangerous, they also adopt attitudes that are difficult to change. Changing these attitudes is challenging for teachers. One animal that is easy to find but difficult for children to understand is a spider. As with most wild animals, they are difficult to teach about because…

  2. Thermal Analysis, Structural Studies and Morphology of Spider Silk-like Block Copolymers

    Science.gov (United States)

    Huang, Wenwen

    Spider silk is a remarkable natural block copolymer, which offers a unique combination of low density, excellent mechanical properties, and thermal stability over a wide range of temperature, along with biocompatibility and biodegrability. The dragline silk of Nephila clavipes, is one of the most well understood and the best characterized spider silk, in which alanine-rich hydrophobic blocks and glycine-rich hydrophilic blocks are linked together generating a functional block copolymer with potential uses in biomedical applications such as guided tissue repair and drug delivery. To provide further insight into the relationships among peptide amino acid sequence, block length, and physical properties, in this thesis, we studied synthetic proteins inspired by the genetic sequences found in spider dragline silks, and used these bioengineered spider silk block copolymers to study thermal, structural and morphological features. To obtain a fuller understanding of the thermal dynamic properties of these novel materials, we use a model to calculate the heat capacity of spider silk block copolymer in the solid or liquid state, below or above the glass transition temperature, respectively. We characterize the thermal phase transitions by temperature modulated differential scanning calorimetry (TMDSC) and thermogravimetric analysis (TGA). We also determined the crystallinity by TMDSC and compared the result with Fourier transform infrared spectroscopy (FTIR) and wide angle X-ray diffraction (WAXD). To understand the protein-water interactions with respect to the protein amino acid sequence, we also modeled the specific reversing heat capacity of the protein-water system, Cp(T), based on the vibrational, rotational and translational motions of protein amino acid residues and water molecules. Advanced thermal analysis methods using TMDSC and TGA show two glass transitions were observed in all samples during heating. The low temperature glass transition, Tg(1), is related to

  3. Spiders in a hostile world (Arachnoidea, Araneae)

    OpenAIRE

    Helsdingen, Peter J. van

    2012-01-01

    Spiders are powerful predators, but the threats confronting them are numerous. A survey is presented of the many different arthropods which waylay spiders in various ways. Some food-specialists among spiders feed exclusively on spiders. Kleptoparasites are found among spiders as well as among Mecoptera, Diptera, Lepidoptera, and Heteroptera. Predators are found within spiders’ own population (cannibalism), among other spider species (araneophagy), and among different species of Heteroptera, O...

  4. Spider-Ant Associations: An Updated Review of Myrmecomorphy, Myrmecophily, and Myrmecophagy in Spiders

    Directory of Open Access Journals (Sweden)

    Paula E. Cushing

    2012-01-01

    Full Text Available This paper provides a summary of the extensive theoretical and empirical work that has been carried out in recent years testing the adaptational significance of various spider-ant associations. Hundreds of species of spiders have evolved close relationships with ants and can be classified as myrmecomorphs, myrmecophiles, or myrmecophages. Myrmecomorphs are Batesian mimics. Their close morphological and behavioral resemblance to ants confers strong survival advantages against visually hunting predators. Some species of spiders have become integrated into the ant society as myrmecophiles or symbionts. These spider myrmecophiles gain protection against their own predators, live in an environment with a stable climate, and are typically surrounded by abundant food resources. The adaptations by which this integration is made possible are poorly known, although it is hypothesized that most spider myrmecophiles are chemical mimics and some are even phoretic on their hosts. The third type of spider-ant association discussed is myrmecophagy—or predatory specialization on ants. A table of known spider myrmecophages is provided as is information on their biology and hunting strategies. Myrmecophagy provides these predators with an essentially unlimited food supply and may even confer other protections to the spiders.

  5. Molecular spiders on a plane

    Science.gov (United States)

    Antal, Tibor; Krapivsky, P. L.

    2012-06-01

    Synthetic biomolecular spiders with “legs” made of single-stranded segments of DNA can move on a surface covered by single-stranded segments of DNA called substrates when the substrate DNA is complementary to the leg DNA. If the motion of a spider does not affect the substrates, the spider behaves asymptotically as a random walk. We study the diffusion coefficient and the number of visited sites for spiders moving on the square lattice with a substrate in each lattice site. The spider's legs hop to nearest-neighbor sites with the constraint that the distance between any two legs cannot exceed a maximal span. We establish analytic results for bipedal spiders, and investigate multileg spiders numerically. In experimental realizations legs usually convert substrates into products (visited sites). The binding of legs to products is weaker, so the hopping rate from the substrates is smaller. This makes the problem non-Markovian and we investigate it numerically. We demonstrate the emergence of a counterintuitive behavior—the more spiders are slowed down on unvisited sites, the more motile they become.

  6. Recombinant minimalist spider wrapping silk proteins capable of native-like fiber formation.

    Directory of Open Access Journals (Sweden)

    Lingling Xu

    Full Text Available Spider silks are desirable biomaterials characterized by high tensile strength, elasticity, and biocompatibility. Spiders produce different types of silks for different uses, although dragline silks have been the predominant focus of previous studies. Spider wrapping silk, made of the aciniform protein (AcSp1, has high toughness because of its combination of high elasticity and tensile strength. AcSp1 in Argiope trifasciata contains a 200-aa sequence motif that is repeated at least 14 times. Here, we produced in E. coli recombinant proteins consisting of only one to four of the 200-aa AcSp1 repeats, designated W(1 to W(4. We observed that purified W(2, W(3 and W(4 proteins could be induced to form silk-like fibers by shear forces in a physiological buffer. The fibers formed by W(4 were ∼3.4 µm in diameter and up to 10 cm long. They showed an average tensile strength of 115 MPa, elasticity of 37%, and toughness of 34 J cm(-3. The smaller W(2 protein formed fewer fibers and required a higher protein concentration to form fibers, whereas the smallest W(1 protein did not form silk-like fibers, indicating that a minimum of two of the 200-aa repeats was required for fiber formation. Microscopic examinations revealed structural features indicating an assembly of the proteins into spherical structures, fibrils, and silk-like fibers. CD and Raman spectral analysis of protein secondary structures suggested a transition from predominantly α-helical in solution to increasingly β-sheet in fibers.

  7. Novel molecular and mechanical properties of egg case silk from wasp spider, Argiope bruennichi.

    Science.gov (United States)

    Zhao, Ai-Chun; Zhao, Tian-Fu; Nakagaki, Koichi; Zhang, Yuan-Song; Sima, Yang-Hu; Miao, Yun-Gen; Shiomi, Kunihiro; Kajiura, Zenta; Nagata, Yoko; Takadera, Masayuki; Nakagaki, Masao

    2006-03-14

    Araneoid spiders use specialized abdominal glands to produce up to seven different protein-based silks/glues that have various mechanical properties. To date, the fibroin sequences encoding egg case fibers have not been fully determined. To gain further understanding of a recently reported spider silk protein gene family, several novel strategies were utilized in this study to isolate two full-length cDNAs of egg case silk proteins, cylindrical silk protein 1 (CySp1, 9.1 kb) and cylindrical silk protein 2 (CySp2, 9.8 kb), from the wasp spider, Argiope bruennichi. Northern blotting analysis demonstrated that CySp1 and CySp2 are selectively expressed in the cylindrical glands. The amino acid composition of raw egg case silk was closely consistent with the deduced amino acid composition based on the sequences of CySp1 and CySp2, which supports the assertion that CySp1 and CySp2 represent two major components of egg case silk. CySp1 and CySp2 are primarily composed of remarkable homogeneous assemble repeats that are 180 residues in length and consist of several complex subrepeats, and they contain highly homologous C-termini and markedly different N-termini. Our results suggest a possible link between CySp1 and CySp2. In addition, comparisons of stress/strain curves for dragline and egg case silk from Argiope bruennichi showed obvious differences in ultimate strength and extensibility, and similarities in toughness. PMID:16519529

  8. Economic analysis of spider web airline networks

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    The distinct network organization, management, service and operating characteristics of US Southwest Airlines are key elements of its success compared with other airlines. As a network organization type, the spider web airline network has received more attention. In this paper, we analyzed the relation between the spider web airline network and spider web, and the structure of spider web airline network, built the assignment model of the spider web airline network,and investigated the economics concerned.

  9. Cell culture's spider silk road.

    Science.gov (United States)

    Perkel, Jeffrey

    2014-06-01

    A number of synthetic and natural materials have been tried in cell culture and tissue engineering applications in recent years. Now Jeffrey Perkel takes a look at one new culture component that might surprise you-spider silk.

  10. Spider phylogenomics: untangling the Spider Tree of Life.

    Science.gov (United States)

    Garrison, Nicole L; Rodriguez, Juanita; Agnarsson, Ingi; Coddington, Jonathan A; Griswold, Charles E; Hamilton, Christopher A; Hedin, Marshal; Kocot, Kevin M; Ledford, Joel M; Bond, Jason E

    2016-01-01

    Spiders (Order Araneae) are massively abundant generalist arthropod predators that are found in nearly every ecosystem on the planet and have persisted for over 380 million years. Spiders have long served as evolutionary models for studying complex mating and web spinning behaviors, key innovation and adaptive radiation hypotheses, and have been inspiration for important theories like sexual selection by female choice. Unfortunately, past major attempts to reconstruct spider phylogeny typically employing the "usual suspect" genes have been unable to produce a well-supported phylogenetic framework for the entire order. To further resolve spider evolutionary relationships we have assembled a transcriptome-based data set comprising 70 ingroup spider taxa. Using maximum likelihood and shortcut coalescence-based approaches, we analyze eight data sets, the largest of which contains 3,398 gene regions and 696,652 amino acid sites forming the largest phylogenomic analysis of spider relationships produced to date. Contrary to long held beliefs that the orb web is the crowning achievement of spider evolution, ancestral state reconstructions of web type support a phylogenetically ancient origin of the orb web, and diversification analyses show that the mostly ground-dwelling, web-less RTA clade diversified faster than orb weavers. Consistent with molecular dating estimates we report herein, this may reflect a major increase in biomass of non-flying insects during the Cretaceous Terrestrial Revolution 125-90 million years ago favoring diversification of spiders that feed on cursorial rather than flying prey. Our results also have major implications for our understanding of spider systematics. Phylogenomic analyses corroborate several well-accepted high level groupings: Opisthothele, Mygalomorphae, Atypoidina, Avicularoidea, Theraphosoidina, Araneomorphae, Entelegynae, Araneoidea, the RTA clade, Dionycha and the Lycosoidea. Alternatively, our results challenge the monophyly of

  11. Spider phylogenomics: untangling the Spider Tree of Life.

    Science.gov (United States)

    Garrison, Nicole L; Rodriguez, Juanita; Agnarsson, Ingi; Coddington, Jonathan A; Griswold, Charles E; Hamilton, Christopher A; Hedin, Marshal; Kocot, Kevin M; Ledford, Joel M; Bond, Jason E

    2016-01-01

    Spiders (Order Araneae) are massively abundant generalist arthropod predators that are found in nearly every ecosystem on the planet and have persisted for over 380 million years. Spiders have long served as evolutionary models for studying complex mating and web spinning behaviors, key innovation and adaptive radiation hypotheses, and have been inspiration for important theories like sexual selection by female choice. Unfortunately, past major attempts to reconstruct spider phylogeny typically employing the "usual suspect" genes have been unable to produce a well-supported phylogenetic framework for the entire order. To further resolve spider evolutionary relationships we have assembled a transcriptome-based data set comprising 70 ingroup spider taxa. Using maximum likelihood and shortcut coalescence-based approaches, we analyze eight data sets, the largest of which contains 3,398 gene regions and 696,652 amino acid sites forming the largest phylogenomic analysis of spider relationships produced to date. Contrary to long held beliefs that the orb web is the crowning achievement of spider evolution, ancestral state reconstructions of web type support a phylogenetically ancient origin of the orb web, and diversification analyses show that the mostly ground-dwelling, web-less RTA clade diversified faster than orb weavers. Consistent with molecular dating estimates we report herein, this may reflect a major increase in biomass of non-flying insects during the Cretaceous Terrestrial Revolution 125-90 million years ago favoring diversification of spiders that feed on cursorial rather than flying prey. Our results also have major implications for our understanding of spider systematics. Phylogenomic analyses corroborate several well-accepted high level groupings: Opisthothele, Mygalomorphae, Atypoidina, Avicularoidea, Theraphosoidina, Araneomorphae, Entelegynae, Araneoidea, the RTA clade, Dionycha and the Lycosoidea. Alternatively, our results challenge the monophyly of

  12. The evolution of sociality in spiders

    DEFF Research Database (Denmark)

    Lubin, Yael; Bilde, T.

    2007-01-01

    I. Introducing Social Spiders II. Social and Subsocial Species: A Survey of Behavioral Traits III. Inbred Sociality in Spiders A. Cooperation Versus Competition: A Balancing Act B. Do Social Spiders Have Division of Labor? C. Colony Foundation: Propagule Dispersal Versus Fission D. Female...

  13. Evolution of repetitive proteins: spider silks from Nephila clavipes (Tetragnathidae) and Araneus bicentenarius (Araneidae).

    Science.gov (United States)

    Beckwitt, R; Arcidiacono, S; Stote, R

    1998-03-01

    Spider silks are highly repetitive proteins, characterized by regions of polyalanine and glycine-rich repeating units. We have obtained two variants of the Spidroin 1 (NCF-1) silk gene sequence from Nephila clavipes. One sequence (1726 bp) was from a cloned cDNA, and the other (1951 bp) was from PCR of genomic DNA. When these sequences are compared with each other and the previously published Spidroin 1 sequence, there are differences due to sequence rearrangements, as well as single base substitutions. These variations are similar to those that have been reported from other highly repetitive genes, and probably represent the results of unequal cross-overs. We have also obtained 708 bp of sequence from pCR of genomic DNA from Araneus biocentenarius. This sequence shows considerable similarity to a dragline sequence (ADF-3) from A. diadematus, as well as Spidroin 2 (NCF-2) from N. clavipes. Minor but consistent differences in the repeating unit sequence between A. bicentenarius and A. diadematus suggest that concerted evolution or gene conversion processes are acting to maintain similarity among repeat units within a single gene.

  14. Ballooning Spiders: The Case for Electrostatic Flight

    CERN Document Server

    Gorham, Peter W

    2013-01-01

    We consider general aspects of the physics underlying the flight of Gossamer spiders, also known as ballooning spiders. We show that existing observations and the physics of spider silk in the presence of the Earth's static atmospheric electric field indicate a potentially important role for electrostatic forces in the flight of Gossamer spiders. A compelling example is analyzed in detail, motivated by the observed "unaccountable rapidity" in the launching of such spiders from H.M.S. Beagle, recorded by Charles Darwin during his famous voyage.

  15. Vibration Propagation in Spider Webs

    Science.gov (United States)

    Hatton, Ross; Otto, Andrew; Elias, Damian

    Due to their poor eyesight, spiders rely on web vibrations for situational awareness. Web-borne vibrations are used to determine the location of prey, predators, and potential mates. The influence of web geometry and composition on web vibrations is important for understanding spider's behavior and ecology. Past studies on web vibrations have experimentally measured the frequency response of web geometries by removing threads from existing webs. The full influence of web structure and tension distribution on vibration transmission; however, has not been addressed in prior work. We have constructed physical artificial webs and computer models to better understand the effect of web structure on vibration transmission. These models provide insight into the propagation of vibrations through the webs, the frequency response of the bare web, and the influence of the spider's mass and stiffness on the vibration transmission patterns. Funded by NSF-1504428.

  16. The Spider and the Fly

    Science.gov (United States)

    Mellinger, Keith E.; Viglione, Raymond

    2012-01-01

    The Spider and the Fly puzzle, originally attributed to the great puzzler Henry Ernest Dudeney, and now over 100 years old, asks for the shortest path between two points on a particular square prism. We explore a generalization, find that the original solution only holds in certain cases, and suggest how this discovery might be used in the…

  17. Structure and post-translational modifications of the web silk protein spidroin-1 from Nephila spiders.

    Science.gov (United States)

    dos Santos-Pinto, José Roberto Aparecido; Lamprecht, Günther; Chen, Wei-Qiang; Heo, Seok; Hardy, John George; Priewalder, Helga; Scheibel, Thomas Rainer; Palma, Mario Sergio; Lubec, Gert

    2014-06-13

    Spidroin-1 is one of the major ampullate silk proteins produced by spiders for use in the construction of the frame and radii of orb webs, and as a dragline to escape from predators. Only partial sequences of spidroin-1 produced by Nephila clavipes have been reported up to now, and there is no information on post-translational modifications (PTMs). A gel-based mass spectrometry strategy with ETD and CID fragmentation methods were used to sequence and determine the presence/location of any PTMs on the spidroin-1. Sequence coverage of 98.06%, 95.05%, and 98.37% were obtained for N. clavipes, Nephila edulis and for Nephila madagascariensis, respectively. Phosphorylation was the major PTM observed with 8 phosphorylation sites considered reliable on spidroin-1 produced by N. clavipes, 4 in N. madagascariensis and 2 for N. edulis. Dityrosine and 3,4-dihydroxyphenylalanine (formed by oxidation of the spidroin-1) were observed, although the mechanism by which they are formed (i.e. exposure to UV radiation or to peroxidases in the major ampullate silk gland) is uncertain. Herein we present structural information on the spidroin-1 produced by three different Nephila species; these findings may be valuable for understanding the physicochemical properties of the silk proteins and moreover, future designs of recombinantly produced spider silk proteins. Biotechnological significance The present investigation shows for the first time spidroin structure and post-translational modifications observed on the major ampullate silk spidroin-1. The many site specific phosphorylations (localized within the structural motifs) along with the probably photoinduction of hydroxylations may be relevant for scientists in material science, biology, biochemistry and environmental scientists. Up to now all the mechanical properties of the spidroin have been characterized without any consideration about the existence of PTMs in the sequence of spidroins. Thus, these findings for major ampullate silk

  18. Specialised use of working memory by Portia africana, a spider-eating salticid.

    Science.gov (United States)

    Cross, Fiona R; Jackson, Robert R

    2014-03-01

    Using expectancy-violation methods, we investigated the role of working memory in the predatory strategy of Portia africana, a salticid spider from Kenya that preys by preference on other spiders. One of this predator's tactics is to launch opportunistic leaping attacks on to other spiders in their webs. Focussing on this particular tactic, our experiments began with a test spider on a ramp facing a lure (dead prey spider mounted on a cork disc) that could be reached by leaping. After the test spider faced the lure for 30 s, we blocked the test spider's view of the lure by lowering an opaque shutter before the spider leapt. When the shutter was raised 90 s later, either the same lure came into view again (control) or a different lure came into view (experimental: different prey type in same orientation or same prey type in different orientation). We recorded attack frequency (number of test spiders that leapt at the lure) and attack latency (time elapsing between shutter being raised and spiders initiating a leap). Attack latencies in control trials were not significantly different from attack latencies in experimental trials, regardless of whether it was prey type or prey orientation that changed in the experimental trials. However, compared with test spiders in the no-change control trials, significantly fewer test spiders leapt when prey type changed. There was no significant effect on attack frequency when prey orientation changed. These findings suggest that this predator represents prey type independently of prey orientation.

  19. Spider-Venom Peptides as Therapeutics

    OpenAIRE

    Glenn F King; Volker Herzig; Rash, Lachlan D; Jensen, Jonas E.; Sing Yan Er; Sebastian Senff; Saez, Natalie J.

    2010-01-01

    Spiders are the most successful venomous animals and the most abundant terrestrial predators. Their remarkable success is due in large part to their ingenious exploitation of silk and the evolution of pharmacologically complex venoms that ensure rapid subjugation of prey. Most spider venoms are dominated by disulfide-rich peptides that typically have high affinity and specificity for particular subtypes of ion channels and receptors. Spider venoms are conservatively predicted to contain more ...

  20. Carbon nanotubes on a spider silk scaffold

    Science.gov (United States)

    Steven, Eden; Saleh, Wasan R.; Lebedev, Victor; Acquah, Steve F. A.; Laukhin, Vladimir; Alamo, Rufina G.; Brooks, James S.

    2013-09-01

    Understanding the compatibility between spider silk and conducting materials is essential to advance the use of spider silk in electronic applications. Spider silk is tough, but becomes soft when exposed to water. Here we report a strong affinity of amine-functionalised multi-walled carbon nanotubes for spider silk, with coating assisted by a water and mechanical shear method. The nanotubes adhere uniformly and bond to the silk fibre surface to produce tough, custom-shaped, flexible and electrically conducting fibres after drying and contraction. The conductivity of coated silk fibres is reversibly sensitive to strain and humidity, leading to proof-of-concept sensor and actuator demonstrations.

  1. Intelligent spider for Internet searching

    OpenAIRE

    Chung, YM; Ramsey, M; Yang, CC; Ma, PC; Yen, JCH; H Chen

    1997-01-01

    As World Wide Web (WWW) based Internet services become more popular, information overload also becomes a pressing research problem. Difficulties with searching on the Internet get worse as the amount of information that is available increases. A scalable approach to support Internet search is critical to the success of Internet services and other current or future national information infrastructure (NII) applications. A new approach to build an intelligent personal spider (agent), which is b...

  2. Spider management in agroecosystems: Habitat manipulation

    Science.gov (United States)

    Mansour, Fadel; Richman, David B.; Whitcomb, W. H.

    1983-01-01

    Based on the literature and on work conducted in Israel, the management of spider populations through habitat manipulation was found to be very helpful in controlling pest insects in various crops. Spiders were found to be reduced or eliminated by non-selective insecticides, although some resistance has been noted

  3. Insects and Spiders. Environmental Education Curriculum.

    Science.gov (United States)

    Topeka Public Schools, KS.

    This unit is designed to provide information on insects and spiders that special education students are capable of understanding. The activities are aimed at level 2 and level 3 educable mentally retarded classes. There are four topics: (1) Characteristics and Life Cycles of Insects; (2) Characteristics of Spiders; (3) Habitats and Food Sources of…

  4. Spider venomics: implications for drug discovery.

    Science.gov (United States)

    Pineda, Sandy S; Undheim, Eivind A B; Rupasinghe, Darshani B; Ikonomopoulou, Maria P; King, Glenn F

    2014-10-01

    Over a period of more than 300 million years, spiders have evolved complex venoms containing an extraordinary array of toxins for prey capture and defense against predators. The major components of most spider venoms are small disulfide-bridged peptides that are highly stable and resistant to proteolytic degradation. Moreover, many of these peptides have high specificity and potency toward molecular targets of therapeutic importance. This unique combination of bioactivity and stability has made spider-venom peptides valuable both as pharmacological tools and as leads for drug development. This review describes recent advances in spider-venom-based drug discovery pipelines. We discuss spider-venom-derived peptides that are currently under investigation for treatment of a diverse range of pathologies including pain, stroke and cancer.

  5. The ecological consequences of temperament in spiders

    Institute of Scientific and Technical Information of China (English)

    Jonathan N.PRUITT; Susan E.RIECHERT

    2012-01-01

    Ecological and evolutionary studies on spiders have been featured prominently throughout the contemporary behavioral syndromes movement.Here we review the behavioral syndromes literature devoted to spiders,and identify some ways in which behavioral syndromes can impact the function of spiders in ecological communities.We further highlight three general themes within the behavioral syndromes literature for which spiders have served as front running model systems:(1) how trait correlations beget performance trade-offs,(2) the influence that behavioral trait variants have on interspecific interactions and (3)mechanisms that aid in maintaining behavioral variation within- and among-populations.Research on behavioral syndromes continues to grow at an impressive rate,and we feel the success of behavioral syndromes studies in spiders bodes well for their continued prominence.

  6. The ecological consequences of temperament in spiders

    Directory of Open Access Journals (Sweden)

    Jonathan N. PRUITT, Susan E. RIECHERT

    2012-08-01

    Full Text Available Ecological and evolutionary studies on spiders have been featured prominently throughout the contemporary behavio­ral syndromes movement. Here we review the behavioral syndromes literature devoted to spiders, and identify some ways in which behavioral syndromes can impact the function of spiders in ecological communities. We further highlight three general themes within the behavioral syndromes literature for which spiders have served as front running model systems: (1 how trait correlations beget performance trade-offs, (2 the influence that behavioral trait variants have on interspecific interactions and (3 mechanisms that aid in maintaining behavioral variation within- and among-populations. Research on behavioral syndromes continues to grow at an impressive rate, and we feel the success of behavioral syndromes studies in spiders bodes well for their continued prominence [Current Zoology 58 (4: 589–596, 2012].

  7. Verified spider bites in Oregon (USA) with the intent to assess hobo spider venom toxicity.

    Science.gov (United States)

    McKeown, Nathanael; Vetter, Richard S; Hendrickson, Robert G

    2014-06-01

    This study compiled 33 verified spider bites from the state of Oregon (USA). The initial goal was to amass a series of bites by the hobo spider to assess whether it possesses toxic venom, a supposition which is currently in a contested state. None of the 33 bites from several spider species developed significant medical symptoms nor did dermonecrosis occur. The most common biters were the yellow sac spider, Cheiracanthium mildei (N = 10) and orb-weavers of the genus Araneus (N = 6). There were 10 bites from three genera of funnel web spiders of the family Agelenidae including one hobo spider bite and one from the congeneric giant house spider which is readily confused as a hobo spider. The hobo spider bite resulted in pain, redness, twitching in the calf muscle and resolved in 12 h. Also generated from this study were possibly the first records of bites from spiders of the genera Callobius (Amaurobiidae) and Antrodiaetus (Antrodiaetidae), both with minor manifestations.

  8. Wilson, Spider oral history interview

    OpenAIRE

    Interviewee: Wilson, Spider; Interviewer: Walliser, Andrea; Interviewer: La, Michelle; Principal Investigator: Hall, Peter V

    2013-01-01

    Spider Wilson is a tattoo artist who operated a tattoo parlour on Columbia Street for 17 years, and is a New Westminster native. He was born at St. Mary’s Hospital and attended John Robson Elementary and later Lord Kelvin Elementary. He believes his job as a tattoo artist is a mixture of being a social worker and a bartender. He reports feeling a strong connection to the business community on Columbia Street. Having grown up five minutes away from his current shop, he talks about the changes ...

  9. Proteome and peptidome profiling of spider venoms.

    Science.gov (United States)

    Liang, Songping

    2008-10-01

    Spider venoms are an important source of novel molecules with different pharmacological properties. Recent technological developments of proteomics, especially mass spectrometry, have greatly promoted the systematic analysis of spider venom. The enormous diversity of venom components between spider species and the lack of complete genome sequence, and the limited database of protein and peptide sequences make spider venom profiling a challenging task and special considerations for technical strategies are required. This review highlights recently used methods for spider venom profiling. In general, spider venom profiling can be achieved in two parts: proteome profiling of the components with molecular weights above 10 kDa, and peptidome profiling of the components with a molecular weight of 10 kDa or under through the use of different methods. Venom proteomes are rich in various enzymes, hemocyanins, toxin-like proteins and many unknown proteins. Peptidomes are dominated by peptides with a mass of 3-6 kDa with three to five disulfide bonds. Although there are some similarities in peptide superfamily types of venoms from different spider species, the venom profile of each species is unique. The linkage of the peptidomic data with that of the cDNA approach is discussed briefly. Future challenges and perspectives are also highlighted in this review.

  10. Learned predation risk management by spider mites

    Directory of Open Access Journals (Sweden)

    Thomas eHackl

    2014-09-01

    Full Text Available Predation is a prime selective force shaping prey behavior. Investment in anti-predator behavior is traded-off against time and energy for other fitness-enhancing activities such as foraging or reproduction. To optimize this benefit/cost trade-off, prey should be able to innately and/or by experience modulate their behavior to the level of predation risk. Here, we assessed learned predation risk management in the herbivorous two-spotted spider mite Tetranychus urticae. We exposed spider mites coming from benign (naïve or high immediate predation risk (experienced environments to latent and/or no risk and assessed their site choice, activity and oviposition. Benign environments were characterized by the absence of any predator cues, high immediate risk environments by killed spider mites, physical presence of the predatory mite Phytoseiulus persimilis and associated chemosensory traces left on the surface, and latent risk environments by only predator traces. In the no-choice experiment both naïve and experienced spider mites laid their first egg later on leaves with than without predator traces. Irrespective of predator traces presence/absence, experienced mites laid their first egg earlier than naïve ones did. Naïve spider mites were more active, indicating higher restlessness, and laid fewer eggs on leaves with predator traces, whereas experienced mites were less active and laid similar numbers of eggs on leaves with and without predator traces. In the choice experiment both naïve and experienced spider mites preferentially resided and oviposited on leaves without predator traces but experienced mites were less active than naïve ones. Overall, our study suggests that spider mites experienced with high predation risk behave bolder under latent risk than naïve spider mites. Since predator traces alone do not indicate immediate risk, we argue that the attenuated anti-predator response of experienced spider mites represents adaptive learned

  11. Almost a spider: a 305-million-year-old fossil arachnid and spider origins.

    Science.gov (United States)

    Garwood, Russell J; Dunlop, Jason A; Selden, Paul A; Spencer, Alan R T; Atwood, Robert C; Vo, Nghia T; Drakopoulos, Michael

    2016-03-30

    Spiders are an important animal group, with a long history. Details of their origins remain limited, with little knowledge of their stem group, and no insights into the sequence of character acquisition during spider evolution. We describe a new fossil arachnid, Idmonarachne brasierigen. et sp. nov. from the Late Carboniferous (Stephanian,ca 305-299 Ma) of Montceau-les-Mines, France. It is three-dimensionally preserved within a siderite concretion, allowing both laboratory- and synchrotron-based phase-contrast computed tomography reconstruction. The latter is a first for siderite-hosted fossils and has allowed us to investigate fine anatomical details. Although distinctly spider-like in habitus, this remarkable fossil lacks a key diagnostic character of Araneae: spinnerets on the underside of the opisthosoma. It also lacks a flagelliform telson found in the recently recognized, spider-related, Devonian-Permian Uraraneida. Cladistic analysis resolves our new fossil as sister group to the spiders: the spider stem-group comprises the uraraneids and I. brasieri While we are unable to demonstrate the presence of spigots in this fossil, the recovered phylogeny suggests the earliest character to evolve on the spider stem-group is the secretion of silk. This would have been followed by the loss of a flagelliform telson, and then the ability to spin silk using spinnerets. This last innovation defines the true spiders, significantly post-dates the origins of silk, and may be a key to the group's success. The Montceau-les-Mines locality has previously yielded a mesothele spider (with spinnerets). Evidently, Late Palaeozoic spiders lived alongside Palaeozoic arachnid grades which approached the spider condition, but did not express the full suite of crown-group autapomorphies.

  12. Modelling Crop Biocontrol by Wanderer Spiders

    Science.gov (United States)

    Venturino, Ezio; Ghersi, Andrea

    2008-09-01

    We study mathematically the effects some spiders populations have on insects living in and near agroecosystems, where woods and vineyards alternate in the landscape as in the Alta Langa, Piemonte, NW Italy.

  13. Spider behaviors include oral sexual encounters

    Science.gov (United States)

    Gregorič, Matjaž; Šuen, Klavdija; Cheng, Ren-Chung; Kralj-Fišer, Simona; Kuntner, Matjaž

    2016-01-01

    Several clades of spiders whose females evolved giant sizes are known for extreme sexual behaviors such as sexual cannibalism, opportunistic mating, mate-binding, genital mutilation, plugging, and emasculation. However, these behaviors have only been tested in a handful of size dimorphic spiders. Here, we bring another lineage into the picture by reporting on sexual behavior of Darwin’s bark spider, Caerostris darwini. This sexually size dimorphic Madagascan species is known for extreme web gigantism and for producing the world’s toughest biomaterial. Our field and laboratory study uncovers a rich sexual repertoire that predictably involves cannibalism, genital mutilation, male preference for teneral females, and emasculation. Surprisingly, C. darwini males engage in oral sexual encounters, rarely reported outside mammals. Irrespective of female’s age or mating status males salivate onto female genitalia pre-, during, and post-copulation. While its adaptive significance is elusive, oral sexual contact in spiders may signal male quality or reduce sperm competition. PMID:27126507

  14. Spider-Venom Peptides as Therapeutics

    Directory of Open Access Journals (Sweden)

    Glenn F. King

    2010-12-01

    Full Text Available Spiders are the most successful venomous animals and the most abundant terrestrial predators. Their remarkable success is due in large part to their ingenious exploitation of silk and the evolution of pharmacologically complex venoms that ensure rapid subjugation of prey. Most spider venoms are dominated by disulfide-rich peptides that typically have high affinity and specificity for particular subtypes of ion channels and receptors. Spider venoms are conservatively predicted to contain more than 10 million bioactive peptides, making them a valuable resource for drug discovery. Here we review the structure and pharmacology of spider-venom peptides that are being used as leads for the development of therapeutics against a wide range of pathophysiological conditions including cardiovascular disorders, chronic pain, inflammation, and erectile dysfunction.

  15. [Diagnostic use of Internet: google the spider].

    Science.gov (United States)

    Soonawala, Darius; Brienen, Eric A T; Visser, Leo G

    2009-01-01

    A 23-year-old woman was working in a factory unpacking jars of Spanish olives when a spider bit her finger. She presented to the emergency outpatient department carrying the spider in a box. She was worried and wanted to know whether the spider, which may have originated from Spain, was poisonous. After a ten minute Internet search the spider was identified as Segestria florentina. It can inject neurotoxins causing temporary local numbness and pain. The patient was reassured and discharged without further treatment. Later, experts confirmed the species. Internet-based search engines can draw attention to unusual diagnoses which otherwise may easily be overlooked. A general search engine can also provide access to subjects that fall outside the scope of the more usual medical sources. PMID:19785819

  16. Spider behaviors include oral sexual encounters.

    Science.gov (United States)

    Gregorič, Matjaž; Šuen, Klavdija; Cheng, Ren-Chung; Kralj-Fišer, Simona; Kuntner, Matjaž

    2016-01-01

    Several clades of spiders whose females evolved giant sizes are known for extreme sexual behaviors such as sexual cannibalism, opportunistic mating, mate-binding, genital mutilation, plugging, and emasculation. However, these behaviors have only been tested in a handful of size dimorphic spiders. Here, we bring another lineage into the picture by reporting on sexual behavior of Darwin's bark spider, Caerostris darwini. This sexually size dimorphic Madagascan species is known for extreme web gigantism and for producing the world's toughest biomaterial. Our field and laboratory study uncovers a rich sexual repertoire that predictably involves cannibalism, genital mutilation, male preference for teneral females, and emasculation. Surprisingly, C. darwini males engage in oral sexual encounters, rarely reported outside mammals. Irrespective of female's age or mating status males salivate onto female genitalia pre-, during, and post-copulation. While its adaptive significance is elusive, oral sexual contact in spiders may signal male quality or reduce sperm competition. PMID:27126507

  17. Two-step phase-shifting SPIDER

    Science.gov (United States)

    Zheng, Shuiqin; Cai, Yi; Pan, Xinjian; Zeng, Xuanke; Li, Jingzhen; Li, Ying; Zhu, Tianlong; Lin, Qinggang; Xu, Shixiang

    2016-01-01

    Comprehensive characterization of ultrafast optical field is critical for ultrashort pulse generation and its application. This paper combines two-step phase-shifting (TSPS) into the spectral phase interferometry for direct electric-field reconstruction (SPIDER) to improve the reconstruction of ultrafast optical-fields. This novel SPIDER can remove experimentally the dc portion occurring in traditional SPIDER method by recording two spectral interferograms with π phase-shifting. As a result, the reconstructed results are much less disturbed by the time delay between the test pulse replicas and the temporal widths of the filter window, thus more reliable. What is more, this SPIDER can work efficiently even the time delay is so small or the measured bandwidth is so narrow that strong overlap happens between the dc and ac portions, which allows it to be able to characterize the test pulses with complicated temporal/spectral structures or narrow bandwidths. PMID:27666528

  18. First Passage Properties of Molecular Spiders

    CERN Document Server

    Semenov, Oleg; Stefanovic, Darko

    2013-01-01

    Molecular spiders are synthetic catalytic DNA-based nanoscale walkers. We study the mean first passage time for abstract models of spiders moving on a finite two-dimensional lattice with various boundary conditions, and compare it with the mean first passage time of spiders moving on a one-dimensional track. We evaluate by how much the slowdown on newly visited sites, owing to catalysis, can improve the mean first passage time of spiders and show that in one dimension, when both ends of the track are an absorbing boundary, the performance gain is lower than in two dimensions, when the absorbing boundary is a circle; this persists even when the absorbing boundary is a single site.

  19. SPIDER ENVENOMING OF DOG - CASE REPORT

    OpenAIRE

    H. S. FERNANDES; M. SAKATE; A. L. Cherubini; A. F. PADOVANI; A.M.C. Meneses

    2002-01-01

    This report refers to a female Pinscher treated at the Veterinary Hospital of the Botucatu School of Veterinary Medicine and Animal Husbandry (FMVZ)-São Paulo State University (UNESP), Botucatu, 14 hours after a suspected spider envenoming. The animal showed spastic limbs, dyspnea, salivation, hypothermia, muscular fasciculation, non-responsive mydriasis, and claudication of the right hindlimb. The spider was later identified by the Center for the Study of Venoms and Venomous Animals-CEVAP/UN...

  20. Edge effect on weevils and spiders

    OpenAIRE

    Horváth, R; Magura, T.; G. Péter; B. Tóthmérész

    2002-01-01

    The edge effect on weevils and spiders was tested along oak forest – meadow transects using sweep-net samples at the Síkfökút Project in Hungary. For spiders the species richness was significantly higher in the forest edge than either in the meadow or the forest interior. For weevils the species richness of the forest edge was higher than that of the meadow, but the difference was not statistically significant whereas the species richness of the forest...

  1. Spider's web inspires fibres for industry

    Science.gov (United States)

    Dacey, James

    2010-03-01

    Spiders may not be everybody's idea of natural beauty, but nobody can deny the artistry in the webs that they spin, especially when decorated with water baubles in the morning dew. Inspired by this spectacle, a group of researchers in China has mimicked the structural properties of the spider's web to create a fibre for industry that can manipulate water with the same skill and efficiency, writes James Dacey.

  2. Summary statistics for fossil spider species taxonomy

    Directory of Open Access Journals (Sweden)

    David Penney

    2012-05-01

    Full Text Available Spiders (Araneae are one of the most species-rich orders on Earth today, and also have one of the longest geological records of any terrestrial animal groups, as demonstrated by their extensive fossil record. There are currently around 1150 described fossil spider species, representing 2.6% of all described spiders (i.e. extinct and extant. Data for numbers of fossil and living spider taxa described annually (and various other metrics for the fossil taxa were compiled from current taxonomic catalogues. Data for extant taxa showed a steady linear increase of approximately 500 new species per year over the last decade, reflecting a rather constant research activity in this area by a large number of scientists, which can be expected to continue. The results for fossil species were very different, with peaks of new species descriptions followed by long troughs, indicating minimal new published research activity for most years. This pattern is indicative of short bursts of research by a limited number of authors. Given the frequent discovery of new fossil deposits containing spiders, a wealth of new material coming to light from previously worked deposits, and the application of new imaging techniques in palaeoarachnology that allow us to extract additional data from historical specimens, e.g. X-ray computed tomography, it is important not only to ensure a sustained research activity on fossil spiders (and other arachnids through training and enthusing the next generation of palaeoarachnologists, but preferably to promote increased research and expertise in this field.

  3. The Effects of Alcohol on Spiders: What Happens to Web Construction after Spiders Consume Alcohol?

    Science.gov (United States)

    Cross, Victor E.

    2006-01-01

    In the high school experiment reported in this paper, spiders were provided with 40% ethanol (ETOH) in order to determine the effects of alcohol on the web-spinning ability of orb weaver spiders. It was hypothesized that alcohol would have a deleterious effect on the number of radii, number of cells, and area of cells in the webs of orb weaving…

  4. Cognitive bias in spider-phobic children: Comparison of a pictorial and a linguistic spider Stroop.

    NARCIS (Netherlands)

    M. Kindt; J.F. Brosschot

    1999-01-01

    Examined the relation between spider fear in children and cognitive processing bias toward threatening information. It was investigated whether spider fear in children is related to a cognitive bias for threatening pictures and words. Pictorial and linguistic Stroop stimuli were administered to 28 s

  5. Fecundity increase supports adaptive radiation hypothesis in spider web evolution

    OpenAIRE

    Todd A. Blackledge; Coddington, Jonathan A.; Agnarsson, Ingi

    2009-01-01

    Identifying the mechanisms driving adaptive radiations is key to explaining the diversity of life. The extreme reliance of spiders upon silk for survival provides an exceptional system in which to link patterns of diversification to adaptive changes in silk use. Most of the world’s 41,000 species of spiders belong to two apical lineages of spiders that exhibit quite different silk ecologies, distinct from their ancestors. Orb spiders spin highly stereotyped webs that are suspended in air and ...

  6. Flee or fight: ontogenetic changes in the behavior of cobweb spiders in encounters with spider-hunting wasps.

    Science.gov (United States)

    Uma, Divya B; Weiss, Martha R

    2012-12-01

    An animal's body size plays a predominant role in shaping its interspecific interactions, and, in encounters between two predators, often determines which shall be predator and which shall be prey. Spiders are top predators of insects, yet can fall prey to mud-dauber wasps that provision their larval nests with paralyzed spiders. Here we examined predator-prey interactions between Chalybion californicum (Saussure) (Sphecidae), a mud-dauber wasp, and Parasteatoda tepidariorum C. L. Koch (Theridiidae), a cobweb spider. We examined whether a spider's size influences its response to an attacking wasp, and report a size-dependent change in spider behavior: small-sized spiders fled, whereas medium- and large-sized spiders fought in response to wasp attacks. From the wasps' perspective, we examined whether spider size influences a wasp's hunting behavior and capture success. We found that wasps commonly approached small spiders, but were much less likely to approach medium and large spiders. However, wasp capture success did not vary with spider size. We also report a strategy used by Chalybion wasps toward cobweb spiders that is consistent with an interpretation of aggressive mimicry.

  7. Remembering the object you fear: brain potentials during recognition of spiders in spider-fearful individuals.

    Directory of Open Access Journals (Sweden)

    Jaroslaw M Michalowski

    Full Text Available In the present study we investigated long-term memory for unpleasant, neutral and spider pictures in 15 spider-fearful and 15 non-fearful control individuals using behavioral and electrophysiological measures. During the initial (incidental encoding, pictures were passively viewed in three separate blocks and were subsequently rated for valence and arousal. A recognition memory task was performed one week later in which old and new unpleasant, neutral and spider pictures were presented. Replicating previous results, we found enhanced memory performance and higher confidence ratings for unpleasant when compared to neutral materials in both animal fearful individuals and controls. When compared to controls high animal fearful individuals also showed a tendency towards better memory accuracy and significantly higher confidence during recognition of spider pictures, suggesting that memory of objects prompting specific fear is also facilitated in fearful individuals. In line, spider-fearful but not control participants responded with larger ERP positivity for correctly recognized old when compared to correctly rejected new spider pictures, thus showing the same effects in the neural signature of emotional memory for feared objects that were already discovered for other emotional materials. The increased fear memory for phobic materials observed in the present study in spider-fearful individuals might result in an enhanced fear response and reinforce negative beliefs aggravating anxiety symptomatology and hindering recovery.

  8. Remembering the object you fear: brain potentials during recognition of spiders in spider-fearful individuals.

    Science.gov (United States)

    Michalowski, Jaroslaw M; Weymar, Mathias; Hamm, Alfons O

    2014-01-01

    In the present study we investigated long-term memory for unpleasant, neutral and spider pictures in 15 spider-fearful and 15 non-fearful control individuals using behavioral and electrophysiological measures. During the initial (incidental) encoding, pictures were passively viewed in three separate blocks and were subsequently rated for valence and arousal. A recognition memory task was performed one week later in which old and new unpleasant, neutral and spider pictures were presented. Replicating previous results, we found enhanced memory performance and higher confidence ratings for unpleasant when compared to neutral materials in both animal fearful individuals and controls. When compared to controls high animal fearful individuals also showed a tendency towards better memory accuracy and significantly higher confidence during recognition of spider pictures, suggesting that memory of objects prompting specific fear is also facilitated in fearful individuals. In line, spider-fearful but not control participants responded with larger ERP positivity for correctly recognized old when compared to correctly rejected new spider pictures, thus showing the same effects in the neural signature of emotional memory for feared objects that were already discovered for other emotional materials. The increased fear memory for phobic materials observed in the present study in spider-fearful individuals might result in an enhanced fear response and reinforce negative beliefs aggravating anxiety symptomatology and hindering recovery.

  9. Fish predation by semi-aquatic spiders: a global pattern.

    Science.gov (United States)

    Nyffeler, Martin; Pusey, Bradley J

    2014-01-01

    More than 80 incidences of fish predation by semi-aquatic spiders--observed at the fringes of shallow freshwater streams, rivers, lakes, ponds, swamps, and fens--are reviewed. We provide evidence that fish predation by semi-aquatic spiders is geographically widespread, occurring on all continents except Antarctica. Fish predation by spiders appears to be more common in warmer areas between 40° S and 40° N. The fish captured by spiders, usually ranging from 2-6 cm in length, are among the most common fish taxa occurring in their respective geographic area (e.g., mosquitofish [Gambusia spp.] in the southeastern USA, fish of the order Characiformes in the Neotropics, killifish [Aphyosemion spp.] in Central and West Africa, as well as Australian native fish of the genera Galaxias, Melanotaenia, and Pseudomugil). Naturally occurring fish predation has been witnessed in more than a dozen spider species from the superfamily Lycosoidea (families Pisauridae, Trechaleidae, and Lycosidae), in two species of the superfamily Ctenoidea (family Ctenidae), and in one species of the superfamily Corinnoidea (family Liocranidae). The majority of reports on fish predation by spiders referred to pisaurid spiders of the genera Dolomedes and Nilus (>75% of observed incidences). There is laboratory evidence that spiders from several more families (e.g., the water spider Argyroneta aquatica [Cybaeidae], the intertidal spider Desis marina [Desidae], and the 'swimming' huntsman spider Heteropoda natans [Sparassidae]) predate fish as well. Our finding of such a large diversity of spider families being engaged in fish predation is novel. Semi-aquatic spiders captured fish whose body length exceeded the spiders' body length (the captured fish being, on average, 2.2 times as long as the spiders). Evidence suggests that fish prey might be an occasional prey item of substantial nutritional importance. PMID:24940885

  10. Edge effect on weevils and spiders

    Directory of Open Access Journals (Sweden)

    R. Horváth

    2002-05-01

    Full Text Available The edge effect on weevils and spiders was tested along oak forest – meadow transects using sweep-net samples at the Síkfökút Project in Hungary. For spiders the species richness was significantly higher in the forest edge than either in the meadow or the forest interior. For weevils the species richness of the forest edge was higher than that of the meadow, but the difference was not statistically significant whereas the species richness of the forest interior was significantly lower than that of the forest edge and the meadow. The composition of the spider assemblage of the edge was more similar to the forest, while the composition of weevils in the edge was more similar to the meadow. Our results based on two invertebrate groups operating on different trophic levels suggest that there is a significant edge effect for the studied taxa resulting in higher species richness in the edge.

  11. Insights into brown spider and loxoscelism

    Directory of Open Access Journals (Sweden)

    MH Appel

    2005-12-01

    Full Text Available Loxosceles is a genus of cosmopolitan spiders comprising several species, and popularly knownas brown spiders or brown recluses. Brown spider bites can cause dermonecrotic lesions andsystemic reactions known as loxoscelism. Systemic effects are less common but may be severe oreven fatal in some patients. Systemic manifestations include intravascular hemolysis, disseminatedintravascular coagulation and acute renal failure. A rapid diagnosis and an understanding of thevenom’s molecular activity are crucial for satisfactory treatment. Mechanisms by which venoms exerttheir deleterious effects are under investigation, and searches are underway for diagnosticenvenomation assays. Molecular biology is being used to produce quantities of several of the mostimportant venom molecules and has contributed to the study and understanding of their mechanismsof action.

  12. Disentangling the phylogenetic and ecological components of spider phenotypic variation.

    Science.gov (United States)

    Gonçalves-Souza, Thiago; Diniz-Filho, José Alexandre Felizola; Romero, Gustavo Quevedo

    2014-01-01

    An understanding of how the degree of phylogenetic relatedness influences the ecological similarity among species is crucial to inferring the mechanisms governing the assembly of communities. We evaluated the relative importance of spider phylogenetic relationships and ecological niche (plant morphological variables) to the variation in spider body size and shape by comparing spiders at different scales: (i) between bromeliads and dicot plants (i.e., habitat scale) and (ii) among bromeliads with distinct architectural features (i.e., microhabitat scale). We partitioned the interspecific variation in body size and shape into phylogenetic (that express trait values as expected by phylogenetic relationships among species) and ecological components (that express trait values independent of phylogenetic relationships). At the habitat scale, bromeliad spiders were larger and flatter than spiders associated with the surrounding dicots. At this scale, plant morphology sorted out close related spiders. Our results showed that spider flatness is phylogenetically clustered at the habitat scale, whereas it is phylogenetically overdispersed at the microhabitat scale, although phylogenic signal is present in both scales. Taken together, these results suggest that whereas at the habitat scale selective colonization affect spider body size and shape, at fine scales both selective colonization and adaptive evolution determine spider body shape. By partitioning the phylogenetic and ecological components of phenotypic variation, we were able to disentangle the evolutionary history of distinct spider traits and show that plant architecture plays a role in the evolution of spider body size and shape. We also discussed the relevance in considering multiple scales when studying phylogenetic community structure.

  13. Spider Invasion Across the Galaxy

    Science.gov (United States)

    Hui, Chung-Yue

    2014-06-01

    The nature of the exotic stellar corpses which reincarnate by consuming their companion is reviewed. Apart from sucking life from their partners, they are actually eating the doomed companions away by their deadly and powerful particle/radiation beams. Such situation resembles that a female ¡°black widow¡± spider that eats its mate after mating. These celestial zombies are called - Millisecond pulsars (MSPs). In this review article, I will focus on the effort of Fermi Asian Network (FAN) in exploring these intricating objects over the last five years. Two special classes of MSPs are particularly striking. Since Fermi Gamma-ray Space Telescope has started surveying the gamma?ray sky, the population of ¡°black widows¡± has been boosted. Another dramatic class is so-called ¡°redbacks¡± (Australian cousin of ¡°black widows¡±) which has just emerged in the last few years. These MSPs provide us with a long-sought missing link in understanding the transition between accretion-powered and rotation-powered systems. The strategy of hunting MSPs through mulitwavelength observations of the unidentified Fermi objects is also reviewed.

  14. Checklist of spider fauna of FR Peshawar, FATA, Pakistan

    Directory of Open Access Journals (Sweden)

    F. Perveen

    2012-03-01

    Full Text Available The spiders are known as poisonous arthropods, but they also act as the predator or biological pests control agent. Their 23 species belonging to 15 genera and 09 families were reported during 2009-2010 from FR Peshawar, FATA, Pakistan. The reported families Clubionidae, Scytodidae and Sprassidae covered each 4%, Araneidae, Gnaphosidae, Pholicidae and Salticidae each 9%, Thomisidae 13% and Lycosidae 43% biodiversity of spiders of FATA. However, the largest spider collected was huntsman, Isopoda tuhodnigra (Barrion with total body length 15.80+-0.83 mm. Moreover, the smallest spider was wolf spider, Pardosa birmanica (Simon with total body length 4.20+-1.30 mm. Further, the crab spiders, Thomisus pugilis (Stoliczka, T. spectabilis (Doleschall and Diaea evanida (Thorell were the most colorful species belonging to family Thomisidae. A detail study is required for further exploration of spider fauna of FATA.

  15. Cooperative effects enhance the transport properties of molecular spider teams

    CERN Document Server

    Rank, Matthias; Frey, Erwin

    2013-01-01

    Molecular spiders are synthetic molecular motors based on DNA nanotechnology. While natural molecular motors have evolved towards very high efficiency, it remains a major challenge to develop efficient designs for man-made molecular motors. Inspired by biological motor proteins like kinesin and myosin, molecular spiders comprise a body and several legs. The legs walk on a lattice that is coated with substrate which can be cleaved catalytically. We propose a novel molecular spider design in which n spiders form a team. Our theoretical considerations show that coupling several spiders together alters the dynamics of the resulting team significantly. Although spiders operate at a scale where diffusion is dominant, spider teams can be tuned to behave nearly ballistic, which results in fast and predictable motion. Based on the separation of time scales of substrate and product dwell times, we develop a theory which utilises equivalence classes to coarse-grain the micro-state space. In addition, we calculate diffus...

  16. Tangled in a sparse spider web

    DEFF Research Database (Denmark)

    Dimitrov, Dimitar Stefanov; Lopardo, Lara; Giribet, Gonzalo;

    2012-01-01

    In order to study the tempo and the mode of spider orb web evolution and diversification, we conducted a phylogenetic analysis using six genetic markers along with a comprehensive taxon sample. The present analyses are the first to recover the monophyly of orb-weaving spiders based solely on DNA...... orb-weaving families and web designs were already present. The processes that may have given origin to this diversification of lineages and web architectures are discussed. A combination of biotic factors, such as key innovations in web design and silk composition, as well as abiotic environmental...

  17. Assessing and managing spider and scorpion envenomation.

    Science.gov (United States)

    McGhee, Stephen; Weiner, Aaron; Finnegan, Alan; Visovsky, Constance; Clochesy, John M; Graves, Brian

    2015-11-01

    Envenomation by spiders or scorpions is a public health problem in many parts of the world and is not isolated to the tropics and subtropics. Spiders and scorpions can be unintentionally transported globally, and keeping them as pets is becoming more popular, so envenomation can occur anywhere. Emergency nurses should be prepared to assess and treat patients who present with a bite or sting. This article gives an overview of the signs, symptoms and treatment of envenomation by species of arachnids that are clinically significant to humans. PMID:26542925

  18. Programming spiders, bots, and aggregators in Java

    CERN Document Server

    Heaton, Jeff

    2006-01-01

    The content and services available on the web continue to be accessed mostly through direct human control. But this is changing. Increasingly, users rely on automated agents that save them time and effort by programmatically retrieving content, performing complex interactions, and aggregating data from diverse sources. Programming Spiders, Bots, and Aggregators in Java teaches you how to build and deploy a wide variety of these agents-from single-purpose bots to exploratory spiders to aggregators that present a unified view of information from multiple user accounts. You will quickly build on

  19. Assessing and managing spider and scorpion envenomation.

    Science.gov (United States)

    McGhee, Stephen; Weiner, Aaron; Finnegan, Alan; Visovsky, Constance; Clochesy, John M; Graves, Brian

    2015-11-01

    Envenomation by spiders or scorpions is a public health problem in many parts of the world and is not isolated to the tropics and subtropics. Spiders and scorpions can be unintentionally transported globally, and keeping them as pets is becoming more popular, so envenomation can occur anywhere. Emergency nurses should be prepared to assess and treat patients who present with a bite or sting. This article gives an overview of the signs, symptoms and treatment of envenomation by species of arachnids that are clinically significant to humans.

  20. Spider Silk: The Mother Nature's Biological Superlens

    CERN Document Server

    Monks, James N; Wang, Zengbo

    2016-01-01

    This paper demonstrates a possible new microfiber bio near field lens that uses minor ampullate spider silk,spun from the Nephila edulis spider, to create a real time image of a surface using near field optical techniques. The microfiber bio lens is the world's first natural superlens created by exploring biological materials. The resolution of the surface image overcomes the diffraction limit, with the ability to resolve patterns at 100 nm under a standard white light source in reflection mode. This resolution offers further developments in superlens technology and paves the way for new bio optics.

  1. Quantification of the physiochemical constraints on the export of spider silk proteins by Salmonella type III secretion

    Directory of Open Access Journals (Sweden)

    Voigt Christopher A

    2010-10-01

    Full Text Available Abstract Background The type III secretion system (T3SS is a molecular machine in gram negative bacteria that exports proteins through both membranes to the extracellular environment. It has been previously demonstrated that the T3SS encoded in Salmonella Pathogenicity Island 1 (SPI-1 can be harnessed to export recombinant proteins. Here, we demonstrate the secretion of a variety of unfolded spider silk proteins and use these data to quantify the constraints of this system with respect to the export of recombinant protein. Results To test how the timing and level of protein expression affects secretion, we designed a hybrid promoter that combines an IPTG-inducible system with a natural genetic circuit that controls effector expression in Salmonella (psicA. LacO operators are placed in various locations in the psicA promoter and the optimal induction occurs when a single operator is placed at the +5nt (234-fold and a lower basal level of expression is achieved when a second operator is placed at -63nt to take advantage of DNA looping. Using this tool, we find that the secretion efficiency (protein secreted divided by total expressed is constant as a function of total expressed. We also demonstrate that the secretion flux peaks at 8 hours. We then use whole gene DNA synthesis to construct codon optimized spider silk genes for full-length (3129 amino acids Latrodectus hesperus dragline silk, Bombyx mori cocoon silk, and Nephila clavipes flagelliform silk and PCR is used to create eight truncations of these genes. These proteins are all unfolded polypeptides and they encompass a variety of length, charge, and amino acid compositions. We find those proteins fewer than 550 amino acids reliably secrete and the probability declines significantly after ~700 amino acids. There also is a charge optimum at -2.4, and secretion efficiency declines for very positively or negatively charged proteins. There is no significant correlation with hydrophobicity

  2. Silk Spinning in Silkworms and Spiders.

    Science.gov (United States)

    Andersson, Marlene; Johansson, Jan; Rising, Anna

    2016-08-09

    Spiders and silkworms spin silks that outcompete the toughness of all natural and manmade fibers. Herein, we compare and contrast the spinning of silk in silkworms and spiders, with the aim of identifying features that are important for fiber formation. Although spiders and silkworms are very distantly related, some features of spinning silk seem to be universal. Both spiders and silkworms produce large silk proteins that are highly repetitive and extremely soluble at high pH, likely due to the globular terminal domains that flank an intermediate repetitive region. The silk proteins are produced and stored at a very high concentration in glands, and then transported along a narrowing tube in which they change conformation in response primarily to a pH gradient generated by carbonic anhydrase and proton pumps, as well as to ions and shear forces. The silk proteins thereby convert from random coil and alpha helical soluble conformations to beta sheet fibers. We suggest that factors that need to be optimized for successful production of artificial silk proteins capable of forming tough fibers include protein solubility, pH sensitivity, and preservation of natively folded proteins throughout the purification and initial spinning processes.

  3. The aerodynamic signature of running spiders.

    Directory of Open Access Journals (Sweden)

    Jérôme Casas

    Full Text Available Many predators display two foraging modes, an ambush strategy and a cruising mode. These foraging strategies have been classically studied in energetic, biomechanical and ecological terms, without considering the role of signals produced by predators and perceived by prey. Wolf spiders are a typical example; they hunt in leaf litter either using an ambush strategy or by moving at high speed, taking over unwary prey. Air flow upstream of running spiders is a source of information for escaping prey, such as crickets and cockroaches. However, air displacement by running arthropods has not been previously examined. Here we show, using digital particle image velocimetry, that running spiders are highly conspicuous aerodynamically, due to substantial air displacement detectable up to several centimetres in front of them. This study explains the bimodal distribution of spider's foraging modes in terms of sensory ecology and is consistent with the escape distances and speeds of cricket prey. These findings may be relevant to the large and diverse array of arthropod prey-predator interactions in leaf litter.

  4. Spiders (Araneae. Chapter 7.3

    Directory of Open Access Journals (Sweden)

    Wolfgang Nentwig

    2010-07-01

    Full Text Available A total of 47 spider species are alien to Europe; this corresponds to 1.3 % of the native spider fauna. They belong to (in order of decreasing abundance Theridiidae (10 species, Pholcidae (7 species, Sparassidae, Salticidae, Linyphiidae, Oonopidae (4-5 species each and 11 further families. There is a remarkable increase of new records in the last years and the arrival of one new species for Europe per year has been predicted for the next decades. One third of alien spiders have an Asian origin, one fifth comes from North America and Africa each. 45 % of species may originate from temperate habitats and 55 % from tropical habitats. In the past banana or other fruit shipments were an important pathway of introduction; today potted plants and probably container shipments in general are more important. Most alien spiders established in and around human buildings, only few species established in natural sites. No environmental impact of alien species is known so far, but some alien species are theoretically dangerous to humans.

  5. Spiders Tune Glue Viscosity to Maximize Adhesion.

    Science.gov (United States)

    Amarpuri, Gaurav; Zhang, Ci; Diaz, Candido; Opell, Brent D; Blackledge, Todd A; Dhinojwala, Ali

    2015-11-24

    Adhesion in humid conditions is a fundamental challenge to both natural and synthetic adhesives. Yet, glue from most spider species becomes stickier as humidity increases. We find the adhesion of spider glue, from five diverse spider species, maximizes at very different humidities that matches their foraging habitats. By using high-speed imaging and spreading power law, we find that the glue viscosity varies over 5 orders of magnitude with humidity for each species, yet the viscosity at maximal adhesion for each species is nearly identical, 10(5)-10(6) cP. Many natural systems take advantage of viscosity to improve functional response, but spider glue's humidity responsiveness is a novel adaptation that makes the glue stickiest in each species' preferred habitat. This tuning is achieved by a combination of proteins and hygroscopic organic salts that determines water uptake in the glue. We therefore anticipate that manipulation of polymer-salts interaction to control viscosity can provide a simple mechanism to design humidity responsive smart adhesives.

  6. A novel neurotoxin from venom of the spider, Brachypelma albopilosum.

    Science.gov (United States)

    Zhong, Yunhua; Song, Bo; Mo, Guoxiang; Yuan, Mingwei; Li, Hongli; Wang, Ping; Yuan, Minglong; Lu, Qiumin

    2014-01-01

    Spiders have evolved highly selective toxins for insects. There are many insecticidal neurotoxins in spider venoms. Although a large amount of work has been done to focus on neurotoxicity of spider components, little information, which is related with effects of spider toxins on tumor cell proliferation and cytotoxicity, is available for Brachypelma albopilosum venom. In this work, a novel spider neurotoxin (brachyin) was identified and characterized from venoms of the spider, Brachypelma albopilosum. Brachyin is composed of 41 amino acid residues with the sequence of CLGENVPCDKDRPNCCSRYECLEPTGYGWWYASYYCYKKRS. There are six cysteines in this sequence, which form three disulfided bridges. The serine residue at the C-terminus is amidated. Brachyin showed strong lethal effects on American cockroaches (Periplaneta americana) and Tenebrio molitor (common mealbeetle). This neurotoxin also showed significant analgesic effects in mice models including abdominal writhing induced by acetic acid and formalin-induced paw licking tests. It was interesting that brachyin exerted marked inhibition on tumor cell proliferation.

  7. A novel neurotoxin from venom of the spider, Brachypelma albopilosum.

    Directory of Open Access Journals (Sweden)

    Yunhua Zhong

    Full Text Available Spiders have evolved highly selective toxins for insects. There are many insecticidal neurotoxins in spider venoms. Although a large amount of work has been done to focus on neurotoxicity of spider components, little information, which is related with effects of spider toxins on tumor cell proliferation and cytotoxicity, is available for Brachypelma albopilosum venom. In this work, a novel spider neurotoxin (brachyin was identified and characterized from venoms of the spider, Brachypelma albopilosum. Brachyin is composed of 41 amino acid residues with the sequence of CLGENVPCDKDRPNCCSRYECLEPTGYGWWYASYYCYKKRS. There are six cysteines in this sequence, which form three disulfided bridges. The serine residue at the C-terminus is amidated. Brachyin showed strong lethal effects on American cockroaches (Periplaneta americana and Tenebrio molitor (common mealbeetle. This neurotoxin also showed significant analgesic effects in mice models including abdominal writhing induced by acetic acid and formalin-induced paw licking tests. It was interesting that brachyin exerted marked inhibition on tumor cell proliferation.

  8. A novel neurotoxin from venom of the spider, Brachypelma albopilosum.

    Science.gov (United States)

    Zhong, Yunhua; Song, Bo; Mo, Guoxiang; Yuan, Mingwei; Li, Hongli; Wang, Ping; Yuan, Minglong; Lu, Qiumin

    2014-01-01

    Spiders have evolved highly selective toxins for insects. There are many insecticidal neurotoxins in spider venoms. Although a large amount of work has been done to focus on neurotoxicity of spider components, little information, which is related with effects of spider toxins on tumor cell proliferation and cytotoxicity, is available for Brachypelma albopilosum venom. In this work, a novel spider neurotoxin (brachyin) was identified and characterized from venoms of the spider, Brachypelma albopilosum. Brachyin is composed of 41 amino acid residues with the sequence of CLGENVPCDKDRPNCCSRYECLEPTGYGWWYASYYCYKKRS. There are six cysteines in this sequence, which form three disulfided bridges. The serine residue at the C-terminus is amidated. Brachyin showed strong lethal effects on American cockroaches (Periplaneta americana) and Tenebrio molitor (common mealbeetle). This neurotoxin also showed significant analgesic effects in mice models including abdominal writhing induced by acetic acid and formalin-induced paw licking tests. It was interesting that brachyin exerted marked inhibition on tumor cell proliferation. PMID:25329070

  9. Reconstructing web evolution and spider diversification in the molecular era.

    Science.gov (United States)

    Blackledge, Todd A; Scharff, Nikolaj; Coddington, Jonathan A; Szüts, Tamas; Wenzel, John W; Hayashi, Cheryl Y; Agnarsson, Ingi

    2009-03-31

    The evolutionary diversification of spiders is attributed to spectacular innovations in silk. Spiders are unique in synthesizing many different kinds of silk, and using silk for a variety of ecological functions throughout their lives, particularly to make prey-catching webs. Here, we construct a broad higher-level phylogeny of spiders combining molecular data with traditional morphological and behavioral characters. We use this phylogeny to test the hypothesis that the spider orb web evolved only once. We then examine spider diversification in relation to different web architectures and silk use. We find strong support for a single origin of orb webs, implying a major shift in the spinning of capture silk and repeated loss or transformation of orb webs. We show that abandonment of costly cribellate capture silk correlates with the 2 major diversification events in spiders (1). Replacement of cribellate silk by aqueous silk glue may explain the greater diversity of modern orb-weaving spiders (Araneoidea) compared with cribellate orb-weaving spiders (Deinopoidea) (2). Within the "RTA clade," which is the sister group to orb-weaving spiders and contains half of all spider diversity, >90% of species richness is associated with repeated loss of cribellate silk and abandonment of prey capture webs. Accompanying cribellum loss in both groups is a release from substrate-constrained webs, whether by aerially suspended webs, or by abandoning webs altogether. These behavioral shifts in silk and web production by spiders thus likely played a key role in the dramatic evolutionary success and ecological dominance of spiders as predators of insects.

  10. Silk elasticity as a potential constraint on spider body size

    OpenAIRE

    Rodríguez-Gironés, Miguel A; Corcobado, Guadalupe; Moya-Laraño, Jordi

    2010-01-01

    Abstract Silk is known for its strength and extensibility and has played a key role in the radiation of spiders. Individual spiders use different glands to produce silk types with unique sets of proteins. Most research has studied the properties of major ampullate and capture spiral silks and their ecological implications, while little is known about minor ampullate silk, the type used by those spider species studied to date for bridging displacements. A biomechanical model paramet...

  11. Sublethal responses of wolf spiders (Lycosidae) to organophosphorous insecticides.

    Science.gov (United States)

    Van Erp, S; Booth, L; Gooneratne, R; O'Halloran, K

    2002-10-01

    The activities of cholinesterase (ChE) and glutathione S-transferase (GST) enzymes were assessed in the wolf spider (Lycosa hilaris) as biomarkers of organophosphate contamination in agricultural ecosystems. Spiders were exposed to simulated field rates of two commercially available organophosphorous insecticides [Basudin (diazinon) and Lorsban (chlorpyrifos)] under laboratory conditions. In terms of survival, chlorpyrifos and diazinon were more toxic to male than to female wolf spiders, but gender-specific differences in ChE activities were not evident. Cholinesterase activity in male spiders was inhibited to 14% and 61% of control activity by Basudin and Lorsban, respectively. Gluthathione S-transferase activity was not affected by either pesticide. Mortality and biomarker responses in the wolf spider were further investigated following the application of Basudin to pasture. Wolf spiders were deployed into field mesocosms; after 24 h mortality was 40%, and surviving spiders displayed significant inhibition of ChE activity (87%) compared with controls. Cholinesterase activity in spiders exposed for subsequent 24- or 48-h time periods was monitored until it returned to control levels 8 days post-application. Inhibition of ChE activity after a single application of Basudin indicate the potential use of this enzyme in wolf spiders as a biomarker for evaluating organophosphate contamination.

  12. Recent advances in the understanding of brown spider venoms: From the biology of spiders to the molecular mechanisms of toxins.

    Science.gov (United States)

    Gremski, Luiza Helena; Trevisan-Silva, Dilza; Ferrer, Valéria Pereira; Matsubara, Fernando Hitomi; Meissner, Gabriel Otto; Wille, Ana Carolina Martins; Vuitika, Larissa; Dias-Lopes, Camila; Ullah, Anwar; de Moraes, Fábio Rogério; Chávez-Olórtegui, Carlos; Barbaro, Katia Cristina; Murakami, Mario Tyago; Arni, Raghuvir Krishnaswamy; Senff-Ribeiro, Andrea; Chaim, Olga Meiri; Veiga, Silvio Sanches

    2014-06-01

    The Loxosceles genus spiders (the brown spiders) are encountered in all the continents, and the clinical manifestations following spider bites include skin necrosis with gravitational lesion spreading and occasional systemic manifestations, such as intravascular hemolysis, thrombocytopenia and acute renal failure. Brown spider venoms are complex mixtures of toxins especially enriched in three molecular families: the phospholipases D, astacin-like metalloproteases and Inhibitor Cystine Knot (ICK) peptides. Other toxins with low level of expression also present in the venom include the serine proteases, serine protease inhibitors, hyaluronidases, allergen factors and translationally controlled tumor protein (TCTP). The mechanisms by which the Loxosceles venoms act and exert their noxious effects are not fully understood. Except for the brown spider venom phospholipase D, which causes dermonecrosis, hemolysis, thrombocytopenia and renal failure, the pathological activities of the other venom toxins remain unclear. The objective of the present review is to provide insights into the brown spider venoms and loxoscelism based on recent results. These insights include the biology of brown spiders, the clinical features of loxoscelism and the diagnosis and therapy of brown spider bites. Regarding the brown spider venom, this review includes a description of the novel toxins revealed by molecular biology and proteomics techniques, the data regarding three-dimensional toxin structures, and the mechanism of action of these molecules. Finally, the biotechnological applications of the venom components, especially for those toxins reported as recombinant molecules, and the challenges for future study are discussed.

  13. The Jean Gutierrez spider mite collection

    Directory of Open Access Journals (Sweden)

    Alain Migeon

    2015-03-01

    Full Text Available The family Tetranychidae (spider mites currently comprises 1,275 species and represents one of the most important agricultural pest families among the Acari with approximately one hundred pest species, ten of which considered major pests. The dataset presented in this document includes all the identified spider mites composing the Jean Gutierrez Collection hosted at the CBGP (Montferrier-sur-Lez, France, gathered from 1963 to 1999 during his career at the Institut de Recherche pour le Développement (IRD. It consists of 5,262 specimens corresponding to 1,564 occurrences (combination species/host plant/date/location of 175 species. Most specimens were collected in Madagascar and other islands of the Western Indian Ocean, New Caledonia and other islands of the South Pacific and Papuasia. The dataset constitutes today the most important one available on Tetranychidae worldwide.

  14. The Jean Gutierrez spider mite collection.

    Science.gov (United States)

    Migeon, Alain

    2015-01-01

    The family Tetranychidae (spider mites) currently comprises 1,275 species and represents one of the most important agricultural pest families among the Acari with approximately one hundred pest species, ten of which considered major pests. The dataset presented in this document includes all the identified spider mites composing the Jean Gutierrez Collection hosted at the CBGP (Montferrier-sur-Lez, France), gathered from 1963 to 1999 during his career at the Institut de Recherche pour le Développement (IRD). It consists of 5,262 specimens corresponding to 1,564 occurrences (combination species/host plant/date/location) of 175 species. Most specimens were collected in Madagascar and other islands of the Western Indian Ocean, New Caledonia and other islands of the South Pacific and Papuasia. The dataset constitutes today the most important one available on Tetranychidae worldwide.

  15. Araneae Sloveniae: a national spider species checklist

    Directory of Open Access Journals (Sweden)

    Rok Kostanjšek

    2015-01-01

    Full Text Available The research of the spider fauna of Slovenia dates back to the very beginning of binomial nomenclature, and has gone through more and less prolific phases with authors concentrating on taxonomy, faunistics, ecology and zoogeographic reviews. Although the body of published works is remarkable for a small nation, the faunistic data has remained too scattered for a thorough understanding of regional biotic diversity, for comparative and ecological research, and for informed conservation purposes. A national checklist is long overdue. Here, a critical review of all published records in any language is provided. The species list currently comprises 738 species, is published online at http://www.bioportal.si/katalog/araneae.php under the title Araneae Sloveniae, and will be updated in due course. This tool will fill the void in cataloguing regional spider faunas and will facilitate further araneological research in central and southern Europe.

  16. Spider-Venom Peptides as Bioinsecticides

    Directory of Open Access Journals (Sweden)

    Glenn F. King

    2012-03-01

    Full Text Available Over 10,000 arthropod species are currently considered to be pest organisms. They are estimated to contribute to the destruction of ~14% of the world’s annual crop production and transmit many pathogens. Presently, arthropod pests of agricultural and health significance are controlled predominantly through the use of chemical insecticides. Unfortunately, the widespread use of these agrochemicals has resulted in genetic selection pressure that has led to the development of insecticide-resistant arthropods, as well as concerns over human health and the environment. Bioinsecticides represent a new generation of insecticides that utilise organisms or their derivatives (e.g., transgenic plants, recombinant baculoviruses, toxin-fusion proteins and peptidomimetics and show promise as environmentally-friendly alternatives to conventional agrochemicals. Spider-venom peptides are now being investigated as potential sources of bioinsecticides. With an estimated 100,000 species, spiders are one of the most successful arthropod predators. Their venom has proven to be a rich source of hyperstable insecticidal mini-proteins that cause insect paralysis or lethality through the modulation of ion channels, receptors and enzymes. Many newly characterized insecticidal spider toxins target novel sites in insects. Here we review the structure and pharmacology of these toxins and discuss the potential of this vast peptide library for the discovery of novel bioinsecticides.

  17. Structure–Activity Relationship Study of Spider Polyamine Toxins as Inhibitors of Ionotropic Glutamate Receptors

    DEFF Research Database (Denmark)

    Xiong, Xiaofeng; Poulsen, Mette H; Hussein, Rama A;

    2014-01-01

    The spider polyamine toxins Joro spider toxin-3 (JSTX-3) and Nephila polyamine toxins-1 and -8 (NPTX-1 and NPTX-8) are isolated from the venom of the orb-weaver spider Nephila clavata (Joro spider). They share a high degree of structural resemblance, their aromatic head groups being the only...

  18. Evidence for competition between carnivorous plants and spiders.

    Science.gov (United States)

    Jennings, David E; Krupa, James J; Raffel, Thomas R; Rohr, Jason R

    2010-10-01

    Several studies have demonstrated that competition between disparate taxa can be important in determining community structure, yet surprisingly, to our knowledge, no quantitative studies have been conducted on competition between carnivorous plants and animals. To examine potential competition between these taxa, we studied dietary and microhabitat overlap between pink sundews (Drosera capillaris) and wolf spiders (Lycosidae) in the field, and conducted a laboratory experiment examining the effects of wolf spiders on sundew fitness. In the field, we found that sundews and spiders had a high dietary overlap with each other and with the available arthropod prey. Associations between sundews and spiders depended on spatial scale: both sundews and spiders were found more frequently in quadrats with more abundant prey, but within quadrats, spiders constructed larger webs and located them further away from sundews as the total sundew trapping area increased, presumably to reduce competition. Spiders also constructed larger webs when fewer prey were available. In the laboratory, our experiment revealed that spiders can significantly reduce sundew fitness. Our findings suggest that members of the plant and animal kingdoms can and do compete. PMID:20462904

  19. Forest floor spiders of woodlots in an agricultural landscape

    NARCIS (Netherlands)

    Mabelis, A.

    1996-01-01

    An inventory of spiders was made in woodlots, which are situated in an agricultural landscape in the eastern part of the Netherlands. Aim of the study was to test the hypotheses that good dispersers, like spiders, will be distributed randomly over habitat patches and consequently, that there will be

  20. Spider mite control and resistance management: does a genome help?

    NARCIS (Netherlands)

    T. Van Leeuwen; W. Dermauw; M. Grbic; L. Tirry; R. Feyereisen

    2012-01-01

    The complete genome of the two-spotted spider mite, Tetranychus urticae, has been reported. This is the first sequenced genome of a highly polyphagous and resistant agricultural pest. The question as to what the genome offers the community working on spider mite control is addressed.

  1. Splendid coloration of the peacock spider Maratus splendens

    NARCIS (Netherlands)

    Stavenga, Doekele G; Otto, Jürgen C; Wilts, Bodo D

    2016-01-01

    Jumping spiders are well known for their acute vision and often bright colours. The male peacock spider Maratus splendens is richly coloured by scales that cover the body. The colours of the white, cream and red scales, which have an elaborate shape with numerous spines, are pigmentary. Blue scales

  2. Biotechnological Trends in Spider and Scorpion Antivenom Development

    DEFF Research Database (Denmark)

    Laustsen, Andreas Hougaard; Solà, Mireia; Jappe, Emma Christine;

    2016-01-01

    Spiders and scorpions are notorious for their fearful dispositions and their ability to inject venom into prey and predators, causing symptoms such as necrosis, paralysis, and excruciating pain. Information on venom composition and the toxins present in these species is growing due to an interest...... at an increasingly faster pace. In this review, the current knowledge of spider and scorpion venoms is presented, followed by a discussion of all published biotechnological efforts within development of spider and scorpion antitoxins based on small molecules, antibodies and fragments thereof, and next generation...... in using bioactive toxins from spiders and scorpions for drug discovery purposes and for solving crystal structures of membrane-embedded receptors. Additionally, the identification and isolation of a myriad of spider and scorpion toxins has allowed research within next generation antivenoms to progress...

  3. Behavior of an adaptive bio-inspired spider web

    Science.gov (United States)

    Zheng, Lingyue; Behrooz, Majid; Huie, Andrew; Hartman, Alex; Gordaninejad, Faramarz

    2015-03-01

    The goal of this study is to demonstrate the feasibility of an artificial adaptive spider web with comparable behavior to a real spider web. First, the natural frequency and energy absorption ability of a passive web is studied. Next, a control system that consists of stepper motors, load cells and an Arduino, is constructed to mimic a spider's ability to control the tension of radial strings in the web. The energy related characteristics in the artificial spider web is examined while the pre-tension of the radial strings are varied. Various mechanical properties of a damaged spider web are adjusted to study their effect on the behavior of the web. It is demonstrated that the pre-tension and stiffness of the web's radial strings can significantly affect the natural frequency and the total energy of the full and damaged webs.

  4. Vision in the nocturnal wandering spider Leucorchestris arenicola (Araneae: Sparassidae)

    DEFF Research Database (Denmark)

    Nørgaard, Thomas; Nilsson, Dan-Eric; Henschel, Joh R;

    2008-01-01

    At night the Namib Desert spider Leucorchestris arenicola performs long-distance homing across its sand dune habitat. By disabling all or pairs of the spiders' eight eyes we found that homing ability was severely reduced when vision was fully abolished. Vision, therefore, seems to play a key role...... in the nocturnal navigational performances of L. arenicola. After excluding two or three pairs of eyes, the spiders were found to be able to navigate successfully using only their lateral eyes or only their anterior median eyes. Measurement of the eyes' visual fields showed that the secondary eyes combined have...... resolution of the eyes is insufficient for detecting any visual information on structures in the landscape, and bright stars would be the only objects visible to the spiders. However, by summation in space and time, the spiders can rescue enough vision to detect coarse landscape structures. We show that L...

  5. Relatedness facilitates cooperation in the subsocial spider, Stegodyphus tentoriicola

    DEFF Research Database (Denmark)

    Ruch, Jasmin; Heinrich, Lisa; Bilde, T.;

    2009-01-01

    Background Cooperative hunting and foraging in spiders is rare and prone to cheating such that the actions of selfish individuals negatively affect the whole group. The resulting social dilemma may be mitigated by kin selection since related individuals lose indirect fitness benefits by acting...... selfishly. Indeed, cooperation with genetic kin reduces the disadvantages of within-group competition in the subsocial spider Stegodyphus lineatus, supporting the hypothesis that high relatedness is an important pre-adaptation in the transition to sociality in spiders. In this study we examined...... the consequences of group size and relatedness on cooperative feeding in the subsocial spider S. tentoriicola, a species suggested to be at the transition to permanent sociality. Results We formed groups of 3 and 6 spiders that were either siblings or non-siblings. We found that increasing group size negatively...

  6. And along Came a Spider: An Attentional Bias for the Detection of Spiders in Young Children and Adults

    Science.gov (United States)

    LoBue, Vanessa

    2010-01-01

    Spiders are among the most common targets of fears and phobias in the world. In visual search tasks, adults detect their presence more rapidly than other kinds of stimuli. Reported here is an investigation of whether young children share this attentional bias for the detection of spiders. In a series of experiments, preschoolers and adults were…

  7. A two year study of verified spider bites in Switzerland and a review of the European spider bite literature.

    Science.gov (United States)

    Nentwig, Wolfgang; Gnädinger, Markus; Fuchs, Joan; Ceschi, Alessandro

    2013-10-01

    During a two-year study, all spider bites recorded by Swiss primary care physicians were reported to the Swiss Toxicological Information Centre and all collected spiders were identified. A total of 14 verified spider bites were recorded, involving five species from four families: Zoropsis spinimana (five cases), Cheiracanthium punctorium (four cases), Tegenaria atrica (three cases) and one case of Malthonica ferruginea (= Tegenaria ferruginea) (both Agelenidae), and one case of Amaurobius ferox (Amaurobiidae). The bites of all spider species produced relatively mild symptoms. Local symptoms such as moderate to severe pain, circumscribed swelling and redness were the only effects in most cases. Systemic symptoms were rare. There was complete recovery in all cases and all lesions healed completely without further damage or secondary disorders. Following a review of the European spider bite literature, the number of spider species capable of biting humans in Europe is considered to be much larger than could be concluded from this study. Most spider bites are restricted to species living synanthropically, thus promoted by climate and habitat change. The annual frequency of spider bites in Switzerland is estimated at 10-100 bites per million inhabitants, but this is predicted to increase due to the continuous arrival of new alien species, many of which have a high potential to establish in urban areas. PMID:23872119

  8. Morphological evolution of spiders predicted by pendulum mechanics.

    Directory of Open Access Journals (Sweden)

    Jordi Moya-Laraño

    Full Text Available BACKGROUND: Animals have been hypothesized to benefit from pendulum mechanics during suspensory locomotion, in which the potential energy of gravity is converted into kinetic energy according to the energy-conservation principle. However, no convincing evidence has been found so far. Demonstrating that morphological evolution follows pendulum mechanics is important from a biomechanical point of view because during suspensory locomotion some morphological traits could be decoupled from gravity, thus allowing independent adaptive morphological evolution of these two traits when compared to animals that move standing on their legs; i.e., as inverted pendulums. If the evolution of body shape matches simple pendulum mechanics, animals that move suspending their bodies should evolve relatively longer legs which must confer high moving capabilities. METHODOLOGY/PRINCIPAL FINDINGS: We tested this hypothesis in spiders, a group of diverse terrestrial generalist predators in which suspensory locomotion has been lost and gained a few times independently during their evolutionary history. In spiders that hang upside-down from their webs, their legs have evolved disproportionately longer relative to their body sizes when compared to spiders that move standing on their legs. In addition, we show how disproportionately longer legs allow spiders to run faster during suspensory locomotion and how these same spiders run at a slower speed on the ground (i.e., as inverted pendulums. Finally, when suspensory spiders are induced to run on the ground, there is a clear trend in which larger suspensory spiders tend to run much more slowly than similar-size spiders that normally move as inverted pendulums (i.e., wandering spiders. CONCLUSIONS/SIGNIFICANCE: Several lines of evidence support the hypothesis that spiders have evolved according to the predictions of pendulum mechanics. These findings have potentially important ecological and evolutionary implications since

  9. CONSTRUCTION OF SPIDER GENOMIC DNA COSMID LIBRARY AND CLONING OF DRAGLINE SILK GENE%蜘蛛基因组DNA Cosmid文库构建和拖丝蛋白基因的克隆

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    @@ 蜘蛛拖丝是已知性能最好的天然纤维 (Kaplan et al.,1994; Mello et al.,1994).与其它结构蛋白,如胶原蛋白和弹性蛋白相似,丝蛋白具有自装配性质,通过二级结构调节,以提供机械支撑.和其它合成高分子比较,如聚酯,丝的柔韧性和弹性使得它能经得起重压和疲劳.而且,丝膜表现出很好的透明性、生物可降解性和水-空气界面的通透性.研究证实,棒络新妇蛛(Nephila Clavipes)的拖丝是所研究的各种类型的丝中,功能指标最优的(Kerkam et al.,1991; Cunniffet et al.,1995).因拖丝的特殊性质,其作为生物材料应用在医学上表现出极大的潜力,如作为缝合材料、细胞膜以及组织工程所需的临时搭架等.

  10. Time-dependent motor properties of multipedal molecular spiders

    Science.gov (United States)

    Samii, Laleh; Blab, Gerhard A.; Bromley, Elizabeth H. C.; Linke, Heiner; Curmi, Paul M. G.; Zuckermann, Martin J.; Forde, Nancy R.

    2011-09-01

    Molecular spiders are synthetic biomolecular walkers that use the asymmetry resulting from cleavage of their tracks to bias the direction of their stepping motion. Using Monte Carlo simulations that implement the Gillespie algorithm, we investigate the dependence of the biased motion of molecular spiders, along with binding time and processivity, on tunable experimental parameters, such as number of legs, span between the legs, and unbinding rate of a leg from a substrate site. We find that an increase in the number of legs increases the spiders’ processivity and binding time but not their mean velocity. However, we can increase the mean velocity of spiders with simultaneous tuning of the span and the unbinding rate of a spider leg from a substrate site. To study the efficiency of molecular spiders, we introduce a time-dependent expression for the thermodynamic efficiency of a molecular motor, allowing us to account for the behavior of spider populations as a function of time. Based on this definition, we find that spiders exhibit transient motor function over time scales of many hours and have a maximum efficiency on the order of 1%, weak compared to other types of molecular motors.

  11. Mermithid parasitism of Hawaiian Tetragnatha spiders in a fragmented landscape

    Science.gov (United States)

    Vandergast, Amy; Roderick, George K.

    2003-01-01

    Hawaiian Tetragnatha spiders inhabiting small forest fragments on the Big Island of Hawaii are parasitized by mermithid nematodes. This is the first report of mermithid nematodes infecting spiders in Hawaii, and an initial attempt to characterize this host–parasite interaction. Because immature mermithids were not morphologically identifiable, a molecular identification was performed. A phylogenetic analysis based on 18S small ribosomal subunit nuclear gene sequences suggested that Hawaiian spider mermithids are more closely related to a mainland presumptive Aranimemis species that infects spiders, than to an insect-infecting mermithid collected on Oahu, HI, or to Mermis nigrescens, also a parasite of insects. Measured infection prevalence was low (ranging from 0 to 4%) but differed significantly among forest fragments. Infection prevalence was associated significantly with fragment area, but not with spider density nor spider species richness. Results suggest that mermithid populations are sensitive to habitat fragmentation, but that changes in infection prevalence do not appear to affect spider community structure.

  12. Structure-Function-Property-Design Interplay in Biopolymers: Spider Silk

    Science.gov (United States)

    Tokareva, Olena; Jacobsen, Matthew; Buehler, Markus; Wong, Joyce; Kaplan, David L.

    2013-01-01

    Spider silks have been a focus of research for almost two decades due to their outstanding mechanical and biophysical properties. Recent advances in genetic engineering have led to the synthesis of recombinant spider silks, thus helping to unravel a fundamental understanding of structure-function-property relationships. The relationships between molecular composition, secondary structures, and mechanical properties found in different types of spider silks are described, along with a discussion of artificial spinning of these proteins and their bioapplications, including the role of silks in biomineralization and fabrication of biomaterials with controlled properties. PMID:23962644

  13. Recent Results from the 2015 flight of Spider

    Science.gov (United States)

    Jones, William C.

    2016-06-01

    Spider is a balloon borne mm-wave polarimeter designed to provide high fidelity measurements of the large scale polarization of the microwave sky. Spider flew a 17 day mission in January 2015, mapping roughly 10% of the full sky (4500 square degrees) in the southern Galactic hemisphere at each of 94 and 150 GHz. Spider achieved an instrumental sensitivity of 4 μ K_{CMB}√{s}, providing maps that exceed the sensitivity of the Planck data. We discuss these data, the current status of our science analysis, and our understanding of the Galacticforeground emission in this high latitude region.

  14. INTERVENTION PROGRAM FOR NURSING STAFF REGARDING APPROACH TO A PATIENT WITH SPIDER PHOBIA AND/OR BITE.

    Science.gov (United States)

    Al-Agroudi, Mahfouz Ahmad; Ahmed, Salwa Abdalla Mohammad; Morsy, Tosson A

    2016-04-01

    Spider bites are uncommon medical events, since there are limited number of spiders world-wide with fangs strong enough to pierce human skin, and most spiders bite humans only as a final defense when being crushed between skin and another object. Thus, most lesions attributed to spider bites are caused by some other etiology. The spiders that can cause medically significant bites include widow and false widow spiders (worldwide), recluse spiders (mostly North and South America), Australian funnel web spiders (eastern coastal Australia) and Phoneutria spiders (Brazil). Acute spider bites most commonly result in a solitary papule, pustule, or wheal. Systemic symptoms can accompany envenomation of widow; funnel web, and Phoneutria spiders, and less often, those of recluse spiders.

  15. Misdiagnosis of spider bites: bacterial associates, mechanical pathogen transfer, and hemolytic potential of venom from the hobo spider, Tegenaria agrestis (Araneae: Agelenidae).

    Science.gov (United States)

    Gaver-Wainwright, Melissa M; Zack, Richard S; Foradori, Matthew J; Lavine, Laura Corley

    2011-03-01

    The European spider Tegenaria agrestis (Walckenaer) (hobo spider) has been implicated as a spider of medical importance in the Pacific Northwest since its introduction in the late 1980s. Studies have indicated that the hobo spider causes necrotic tissue lesions through hemolytic venom or through the transfer of pathogenic bacteria introduced by its bite. Bacterial infections are often diagnosed as spider bites, in particular the pathogenic bacteria methicillin-resistant Staphylococcus aureus (MRSA). This study examines three aspects of the potential medical importance of hobo spiders in part of its introduced range, Washington State. First, the bacterial diversity of the spider was surveyed using a polymerase chain reaction-based assay to determine whether the spider carries any pathogenic bacteria. Second, an experiment was conducted to determine the ability of the spiders to transfer MRSA. Third, the venom was evaluated to assess the hemolytic activity. We found 10 genera of ubiquitous bacteria on the exterior surface of the spiders. In addition, none of the spiders exposed to MRSA transferred this pathogen. Finally, the hemolytic venom assay corroborates previous studies that found hobo spider venom was not deleterious to vertebrate red blood cells.

  16. Phylogenomics resolves a spider backbone phylogeny and rejects a prevailing paradigm for orb web evolution.

    Science.gov (United States)

    Bond, Jason E; Garrison, Nicole L; Hamilton, Chris A; Godwin, Rebecca L; Hedin, Marshal; Agnarsson, Ingi

    2014-08-01

    Spiders represent an ancient predatory lineage known for their extraordinary biomaterials, including venoms and silks. These adaptations make spiders key arthropod predators in most terrestrial ecosystems. Despite ecological, biomedical, and biomaterial importance, relationships among major spider lineages remain unresolved or poorly supported. Current working hypotheses for a spider "backbone" phylogeny are largely based on morphological evidence, as most molecular markers currently employed are generally inadequate for resolving deeper-level relationships. We present here a phylogenomic analysis of spiders including taxa representing all major spider lineages. Our robust phylogenetic hypothesis recovers some fundamental and uncontroversial spider clades, but rejects the prevailing paradigm of a monophyletic Orbiculariae, the most diverse lineage, containing orb-weaving spiders. Based on our results, the orb web either evolved much earlier than previously hypothesized and is ancestral for a majority of spiders or else it has multiple independent origins, as hypothesized by precladistic authors. Cribellate deinopoid orb weavers that use mechanically adhesive silk are more closely related to a diverse clade of mostly webless spiders than to the araneoid orb-weaving spiders that use adhesive droplet silks. The fundamental shift in our understanding of spider phylogeny proposed here has broad implications for interpreting the evolution of spiders, their remarkable biomaterials, and a key extended phenotype--the spider web.

  17. Sex-specific kleptoparasitic foraging in ant-eating spiders

    DEFF Research Database (Denmark)

    Martisová, Martina; Bilde, T.; Pekar, Stano

    2009-01-01

    Foraging by intraspecific kleptoparasitism is widespread among animal taxa. Most kleptoparasitic interactions are considered facultative, and can be influenced by life history stage and trade-offs with other activities such as mate searching. Trade-offs with mating strategies are often sex specific....... To investigate this hypothesis, we studied the effect of sex and life history stage on the frequency of kleptoparasitism in ant-eating spiders of the genus Zodarion in the field. These spiders use a special capture technique involving a quick attack on an ant that is left unguarded by spiders for several minutes......, providing ample opportunities for kleptoparasitism. We found that adult females consistently hunted actively, while adult males ceased active prey capture and instead engaged in kleptoparasitism. Juvenile spiders were active hunters irrespective of sex. Consistent with an ontogenetic shift in foraging...

  18. Bromeliad-living spiders improve host plant nutrition and growth.

    Science.gov (United States)

    Romero, Gustavo Q; Mazzafera, Paulo; Vasconcellos-Neto, Joao; Trivelin, Paulo C O

    2006-04-01

    Although bromeliads are believed to obtain nutrients from debris deposited by animals in their rosettes, there is little evidence to support this assumption. Using stable isotope methods, we found that the Neotropical jumping spider Psecas chapoda (Salticidae), which lives strictly associated with the terrestrial bromeliad Bromelia balansae, contributed 18% of the total nitrogen of its host plant in a greenhouse experiment. In a one-year field experiment, plants with spiders produced leaves 15% longer than plants from which the spiders were excluded. This is the first study to show nutrient provisioning in a spider-plant system. Because several animal species live strictly associated with bromeliad rosettes, this type of facultative mutualism involving the Bromeliaceae may be more common than previously thought.

  19. Spiders of the Great Dismal Swamp: Lake Drummond 1977

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This report outlines the results of a study of spiders that was conducted along the shores of Lake Drummond, in the Great Dismal Swamp. The purpose of the study was...

  20. Unravelling the biodiversity of nanoscale signatures of spider silk fibres.

    Science.gov (United States)

    Silva, Luciano P; Rech, Elibio L

    2013-01-01

    Living organisms are masters at designing outstanding self-assembled nanostructures through a hierarchical organization of modular proteins. Protein-based biopolymers improved and selected by the driving forces of molecular evolution are among the most impressive archetypes of nanomaterials. One of these biomacromolecules is the myriad of compound fibroins of spider silks, which combine surprisingly high tensile strength with great elasticity. However, no consensus on the nano-organization of spider silk fibres has been reached. Here we explore the biodiversity of spider silk fibres, focusing on nanoscale characterization with high-resolution atomic force microscopy. Our results reveal an evolution of the nanoroughness, nanostiffness, nanoviscoelastic, nanotribological and nanoelectric organization of microfibres, even when they share similar sizes and shapes. These features are related to unique aspects of their molecular structures. The results show that combined nanoscale analyses of spider silks may enable the screening of appropriate motifs for bioengineering synthetic fibres from recombinant proteins. PMID:24345771

  1. Evolution of stenophagy in spiders (Araneae): evidence based on the comparative analysis of spider diets.

    Science.gov (United States)

    Pekár, Stano; Coddington, Jonathan A; Blackledge, Todd A

    2012-03-01

    Stenophagy (narrow diet breadth) represents an extreme of trophic specialization in carnivores, but little is known about the forces driving its evolution. We used spiders, the most diversified group of terrestrial predators, to investigate whether stenophagy (1) promoted diversification; (2) was phylogenetically conserved and evolutionarily derived state; and (3) was determined either by geographical distribution and foraging guild. We used published data on the prey of almost 600 species. Six categories of stenophagy were found: myrmecophagy, araneophagy, lepidopterophagy, termitophagy, dipterophagy, and crustaceophagy. We found that the species diversity of euryphagous genera and families was similar to stenophagous genera and families. At the family level, stenophagy evolved repeatedly and independently. Within families, the basal condition was oligophagy or euryphagy. Most types of stenophagy were clearly derived: myrmecophagy in Zodariidae; lepidopterophagy in Araneidae; dipterophagy in Theridiidae. In contrast, araneophagy was confined to basal and intermediate lineages, suggesting its ancestral condition. The diet breadth of species from the tropics and subtropics was less diverse than species from the temperate zone. Diet breadth was lower in cursorial spiders compared to web-building species. Thus, the evolution of stenophagy in spiders appears to be complex and governed by phylogeny as well as by ecological determinants.

  2. Endosymbiont dominated bacterial communities in a dwarf spider.

    Directory of Open Access Journals (Sweden)

    Bram Vanthournout

    Full Text Available The microbial community of spiders is little known, with previous studies focussing primarily on the medical importance of spiders as vectors of pathogenic bacteria and on the screening of known cytoplasmic endosymbiont bacteria. These screening studies have been performed by means of specific primers that only amplify a selective set of endosymbionts, hampering the detection of unreported species in spiders. In order to have a more complete overview of the bacterial species that can be present in spiders, we applied a combination of a cloning assay, DGGE profiling and high-throughput sequencing on multiple individuals of the dwarf spider Oedothorax gibbosus. This revealed a co-infection of at least three known (Wolbachia, Rickettsia and Cardinium and the detection of a previously unreported endosymbiont bacterium (Rhabdochlamydia in spiders. 16S rRNA gene sequences of Rhabdochlamydia matched closely with those of Candidatus R. porcellionis, which is currently only reported as a pathogen from a woodlouse and with Candidatus R. crassificans reported from a cockroach. Remarkably, this bacterium appears to present in very high proportions in one of the two populations only, with all investigated females being infected. We also recovered Acinetobacter in high abundance in one individual. In total, more than 99% of approximately 4.5M high-throughput sequencing reads were restricted to these five bacterial species. In contrast to previously reported screening studies of terrestrial arthropods, our results suggest that the bacterial communities in this spider species are dominated by, or even restricted to endosymbiont bacteria. Given the high prevalence of endosymbiont species in spiders, this bacterial community pattern could be widespread in the Araneae order.

  3. Recent Advances in Research on Widow Spider Venoms and Toxins

    OpenAIRE

    Shuai Yan; Xianchun Wang

    2015-01-01

    Widow spiders have received much attention due to the frequently reported human and animal injures caused by them. Elucidation of the molecular composition and action mechanism of the venoms and toxins has vast implications in the treatment of latrodectism and in the neurobiology and pharmaceutical research. In recent years, the studies of the widow spider venoms and the venom toxins, particularly the α-latrotoxin, have achieved many new advances; however, the mechanism of action of the venom...

  4. SPIDER Progress Towards High Resolution Correlated Fission Product Data

    Science.gov (United States)

    Shields, Dan; Meierbachtol, Krista; Tovesson, Fredrik; Arnold, Charles; Blackeley, Rick; Bredeweg, Todd; Devlin, Matt; Hecht, Adam; Jandel, Marian; Jorgenson, Justin; Nelson, Ron; White, Morgan; Spider Team

    2014-09-01

    The SPIDER detector (SPectrometer for Ion DEtermination in fission Research) is under development with the goal of obtaining high-resolution, high-efficiency, correlated fission product data needed for many applications including the modeling of next generation nuclear reactors, stockpile stewardship, and the fundamental understanding of the fission process. SPIDER simultaneously measures velocity and energy of both fission products to calculate fission product yields (FPYs), neutron multiplicity (ν), and total kinetic energy (TKE). A detailed description of the prototype SPIDER detector components will be presented. Characterization measurements with alpha and spontaneous fission sources will also be discussed. LA-UR-14-24875. The SPIDER detector (SPectrometer for Ion DEtermination in fission Research) is under development with the goal of obtaining high-resolution, high-efficiency, correlated fission product data needed for many applications including the modeling of next generation nuclear reactors, stockpile stewardship, and the fundamental understanding of the fission process. SPIDER simultaneously measures velocity and energy of both fission products to calculate fission product yields (FPYs), neutron multiplicity (ν), and total kinetic energy (TKE). A detailed description of the prototype SPIDER detector components will be presented. Characterization measurements with alpha and spontaneous fission sources will also be discussed. LA-UR-14-24875. This work is in part supported by LANL Laboratory Directed Research and Development Projects 20110037DR and 20120077DR.

  5. Biodiversity baseline of the French Guiana spider fauna.

    Science.gov (United States)

    Vedel, Vincent; Rheims, Christina; Murienne, Jérôme; Brescovit, Antonio Domingos

    2013-01-01

    The need for an updated list of spiders found in French Guiana rose recently due to many upcoming studies planned. In this paper, we list spiders from French Guiana from existing literature (with corrected nomenclature when necessary) and from 2142 spiders sampled in 12 sites for this baseline study. Three hundred and sixty four validated species names of spider were found in the literature and previous authors' works. Additional sampling, conducted for this study added another 89 identified species and 62 other species with only a genus name for now. The total species of spiders sampled in French Guiana is currently 515. Many other Morphospecies were found but not described as species yet. An accumulation curve was drawn with seven of the sampling sites and shows no plateau yet. Therefore, the number of species inhabiting French Guiana cannot yet be determined. As the very large number of singletons found in the collected materials suggests, the accumulation curve indicates nevertheless that more sampling is necessary to discover the many unknown spider species living in French Guiana, with a focus on specific periods (dry season and wet season) and on specific and poorly studied habitats such as canopy, inselberg and cambrouze (local bamboo monospecific forest).

  6. A clinical and epidemiological study on spider bites in Turkey

    Institute of Scientific and Technical Information of China (English)

    Yildirim Cesaretli; Ozcan Ozkan

    2011-01-01

    Objective:To classify and characterize spider bites among inquiries to the National Poison Information Center (NPIC) between1995 and2004, in terms of the epidemiology and clinical symptomatology.Methods: Clinical and epidemiological data were obtained from theNPIC’s patient records. The following information was recorded for each spider bite: demographics, circumstances of the bite, and local and systemic effects.Results: A total of82 cases were reported. The accidents were mostly seen during August. The gender distribution was59.76%male, 37.20% female, and2.44% unknown and the20-29 age group presented more spider bites. Most of the cases were in the Central Anatolia, Marmara, Mediterranean, and Black Sea regions. Local symptoms were observed in60.87% of the cases, including local pain, edema, redness, itching, debris, burning, and numbness. Systemic symptoms were observed such as nausea, vomiting, abdominal pain, lethargy, anxiety, weakness, somnolence, dyspnea, hypertension, hypotension, and hyperthermia.Conclusions: In conclusion, these findings emphasize the presence of medically important spider species in Turkey. All patients and especially pediatric patients should be admitted to the hospital. Identification of spider species may be considered a useful clinical and epidemiological tool in determining the incidence and risk of spider bites.

  7. Relatedness facilitates cooperation in the subsocial spider, Stegodyphus tentoriicola

    Directory of Open Access Journals (Sweden)

    Bilde Trine

    2009-10-01

    Full Text Available Abstract Background Cooperative hunting and foraging in spiders is rare and prone to cheating such that the actions of selfish individuals negatively affect the whole group. The resulting social dilemma may be mitigated by kin selection since related individuals lose indirect fitness benefits by acting selfishly. Indeed, cooperation with genetic kin reduces the disadvantages of within-group competition in the subsocial spider Stegodyphus lineatus, supporting the hypothesis that high relatedness is an important pre-adaptation in the transition to sociality in spiders. In this study we examined the consequences of group size and relatedness on cooperative feeding in the subsocial spider S. tentoriicola, a species suggested to be at the transition to permanent sociality. Results We formed groups of 3 and 6 spiders that were either siblings or non-siblings. We found that increasing group size negatively affected feeding efficiency but that these negative effects were reduced in sib-groups. Sib groups were more likely to feed cooperatively and all group members grew more homogenously than groups of unrelated spiders. The measured differences did not translate into differential growth or mortality during the experimental period of 8 weeks. Conclusion The combination of our results with those from previous studies indicates that the conflict between individual interests and group interests may be reduced by nepotism and that the latter promote the maintenance of the social community.

  8. Spider-mite problems and control in Taiwan.

    Science.gov (United States)

    Ho, C C

    2000-01-01

    Problems with spider mites first appeared in Taiwan in 1958, eight years after the importation of synthetic pesticides, and the mites evolved into major pests on many crops during the 1980s. Of the 74 spider mite species recorded from Taiwan 10 are major pests, with Tetranychus kanzawai most important, followed by T. urticae, Panonychus citri, T. cinnabarinus, T. truncatus and Oligonychus litchii. Most crops suffer from more than one species. Spider mites reproduce year-round in Taiwan. Diapause occurs only in high-elevation areas. Precipitation is the most important abiotic factor restricting spider-mite populations. Control is usually accomplished by applying chemicals. Fifty acaricides are currently registered for the control of spider mites. Acaricide resistance is a serious problem, with regional variation in resistance levels. Several phytoseiid mites and a chrysopid predator have been studied for control of spider mites with good effect. Efforts to market these predators should be intensified so that biological control can be a real choice for farmers. PMID:11156169

  9. Sperm Dynamics in Spiders (Araneae): Ultrastructural Analysis of the Sperm Activation Process in the Garden Spider Argiope bruennichi (Scopoli, 1772)

    OpenAIRE

    Oliver Vöcking; Gabriele Uhl; Peter Michalik

    2013-01-01

    Storage of sperm inside the female genital tract is an integral phase of reproduction in many animal species. The sperm storage site constitutes the arena for sperm activation, sperm competition and female sperm choice. Consequently, to understand animal mating systems information on the processes that occur from sperm transfer to fertilization is required. Here, we focus on sperm activation in spiders. Male spiders produce sperm whose cell components are coiled within the sperm cell and that...

  10. Early Cretaceous spider web with its prey.

    Science.gov (United States)

    Peñalver, Enrique; Grimaldi, David A; Delclòs, Xavier

    2006-06-23

    The orb web is a spectacular evolutionary innovation that enables spiders to catch flying prey. This elegant, geometric structure is woven with silk fibers that are renowned for their superior mechanical properties. We used silk gland expression libraries to address a long-standing controversy concerning the evolution of the orb-web architecture. Contrary to the view that the orb-web design evolved multiple times, we found that the distribution and phylogeny of silk proteins support a single, ancient origin of the orb web at least 136 million years ago. Furthermore, we substantially expanded the repository of silk sequences that can be used for the synthesis of high-performance biomaterials. PMID:16794072

  11. Function of bright coloration in the wasp spider Argiope bruennichi (Araneae: Araneidae)

    OpenAIRE

    Alex A Bush; Yu, Douglas W; Marie E Herberstein

    2008-01-01

    There are two major competing explanations for the counter-intuitive presence of bright coloration in certain orb-web spiders. Bright coloration could lure insect prey to the web vicinity, increasing the spider's foraging success. Alternatively, the markings could function as disruptive camouflage, making it difficult for the insect prey to distinguish spiders from background colour variation. We measured the prey capture rates of wasp spiders, Argiope bruennichi, that were blacked out, shiel...

  12. Male-directed infanticide in spider monkeys (Ateles spp.).

    Science.gov (United States)

    Alvarez, Sara; Di Fiore, Anthony; Champion, Jane; Pavelka, Mary Susan; Páez, Johanna; Link, Andrés

    2015-04-01

    Infanticide is considered a conspicuous expression of sexual conflict amongst mammals, including at least 35 primate species. Here we describe two suspected and one attempted case of intragroup infanticide in spider monkeys that augment five prior cases of observed or suspected infanticide in this genus. Contrary to the typical pattern of infanticide seen in most primate societies, where infants are killed by conspecifics independent of their sex, all eight cases of observed or suspected infanticide in spider monkeys have been directed toward male infants within their first weeks of life. Moreover, although data are still scant, infanticides seem to be perpetrated exclusively by adult males against infants from their own social groups and are not associated with male takeovers or a sudden rise in male dominance rank. Although the slow reproductive cycles of spider monkeys might favor the presence of infanticide because of the potential to shorten females' interbirth intervals, infanticide is nonetheless uncommon among spider monkeys, and patterns of male-directed infanticide are not yet understood. We suggest that given the potentially close genetic relationships among adult males within spider monkey groups, and the need for males to cooperate with one another in territorial interactions with other groups of related males, infanticide may be expected to occur primarily where the level of intragroup competition among males outweighs that of competition between social groups. Finally, we suggest that infanticide in spider monkeys may be more prevalent than previously thought, given that it may be difficult for observers to witness cases of infanticide or suspected infanticide that occur soon after birth in taxa that are characterized by high levels of fission-fusion dynamics. Early, undetected, male-biased infanticide could influence the composition of spider monkey groups and contribute to the female-biased adult sex ratios often reported for this genus.

  13. Male-directed infanticide in spider monkeys (Ateles spp.).

    Science.gov (United States)

    Alvarez, Sara; Di Fiore, Anthony; Champion, Jane; Pavelka, Mary Susan; Páez, Johanna; Link, Andrés

    2015-04-01

    Infanticide is considered a conspicuous expression of sexual conflict amongst mammals, including at least 35 primate species. Here we describe two suspected and one attempted case of intragroup infanticide in spider monkeys that augment five prior cases of observed or suspected infanticide in this genus. Contrary to the typical pattern of infanticide seen in most primate societies, where infants are killed by conspecifics independent of their sex, all eight cases of observed or suspected infanticide in spider monkeys have been directed toward male infants within their first weeks of life. Moreover, although data are still scant, infanticides seem to be perpetrated exclusively by adult males against infants from their own social groups and are not associated with male takeovers or a sudden rise in male dominance rank. Although the slow reproductive cycles of spider monkeys might favor the presence of infanticide because of the potential to shorten females' interbirth intervals, infanticide is nonetheless uncommon among spider monkeys, and patterns of male-directed infanticide are not yet understood. We suggest that given the potentially close genetic relationships among adult males within spider monkey groups, and the need for males to cooperate with one another in territorial interactions with other groups of related males, infanticide may be expected to occur primarily where the level of intragroup competition among males outweighs that of competition between social groups. Finally, we suggest that infanticide in spider monkeys may be more prevalent than previously thought, given that it may be difficult for observers to witness cases of infanticide or suspected infanticide that occur soon after birth in taxa that are characterized by high levels of fission-fusion dynamics. Early, undetected, male-biased infanticide could influence the composition of spider monkey groups and contribute to the female-biased adult sex ratios often reported for this genus. PMID

  14. Spider phobia - Interaction of disgust and perceived likelihood of involuntary physical contact

    NARCIS (Netherlands)

    de Jong, Peter; Muris, P

    2002-01-01

    After reading vignettes, a group of spider-phobic girls (n = 18) and a group of nonphobic girls (n = 18) rated the subjective probability of spiders entering their private living space, their tendency to approach and make physical contact, and the subjective probability of spiders doing physical har

  15. Biomimetic calcium phosphate coatings on recombinant spider silk fibres

    Energy Technology Data Exchange (ETDEWEB)

    Yang Liang; Habibovic, Pamela; Van Blitterswijk, Clemens A [Department of Tissue Regeneration, University of Twente, PO Box 217, 7500 AE Enschede (Netherlands); Hedhammar, My; Johansson, Jan [Department of Anatomy, Physiology and Biochemistry, Swedish University of Agricultural Sciences, the Biomedical Centre, Box 575, 751 23 Uppsala (Sweden); Blom, Tobias; Leifer, Klaus [Department of Engineering Sciences, Uppsala University, Box 534, S-751 21 Uppsala (Sweden)

    2010-08-01

    Calcium phosphate ceramic coatings, applied on surfaces of metallic and polymeric biomaterials, can improve their performance in bone repair and regeneration. Spider silk is biocompatible, strong and elastic, and hence an attractive biomaterial for applications in connective tissue repair. Recently, artificial spider silk, with mechanical and structural characteristics similar to those of native spider silk, has been produced from recombinant minispidroins. In the present study, supersaturated simulated body fluid was used to deposit calcium phosphate coatings on recombinant spider silk fibres. The mineralization process was followed in time using scanning electron microscopy equipped with an energy dispersive x-ray (EDX) detector and Raman spectroscope. Focused ion beam technology was used to produce a cross section of a coated fibre, which was further analysed by EDX. Preliminary in vitro experiments using a culture of bone marrow-derived human mesenchymal stem cells (hMSCs) on coated fibres were also performed. This study showed that recombinant spider silk fibres were successfully coated with a homogeneous and thick crystalline calcium phosphate layer. In the course of the mineralization process from modified simulated body fluid, sodium chloride crystals were first deposited on the silk surface, followed by the deposition of a calcium phosphate layer. The coated silk fibres supported the attachment and growth of hMSCs.

  16. Radiation Safety System for SPIDER Neutral Beam Accelerator

    Science.gov (United States)

    Sandri, S.; Coniglio, A.; D'Arienzo, M.; Poggi, C.

    2011-12-01

    SPIDER (Source for Production of Ion of Deuterium Extracted from RF Plasma only) and MITICA (Megavolt ITER Injector Concept Advanced) are the ITER neutral beam injector (NBI) testing facilities of the PRIMA (Padova Research Injector Megavolt Accelerated) Center. Both injectors accelerate negative deuterium ions with a maximum energy of 1 MeV for MITICA and 100 keV for SPIDER with a maximum beam current of 40 A for both experiments. The SPIDER facility is classified in Italy as a particle accelerator. At present, the design of the radiation safety system for the facility has been completed and the relevant reports have been presented to the Italian regulatory authorities. Before SPIDER can operate, approval must be obtained from the Italian Regulatory Authority Board (IRAB) following a detailed licensing process. In the present work, the main project information and criteria for the SPIDER injector source are reported together with the analysis of hypothetical accidental situations and safety issues considerations. Neutron and photon nuclear analysis is presented, along with special shielding solutions designed to meet Italian regulatory dose limits. The contribution of activated corrosion products (ACP) to external exposure of workers has also been assessed. Nuclear analysis indicates that the photon contribution to worker external exposure is negligible, and the neutron dose can be considered by far the main radiation protection issue. Our results confirm that the injector has no important radiological impact on the population living around the facility.

  17. Radiation Safety System for SPIDER Neutral Beam Accelerator

    Energy Technology Data Exchange (ETDEWEB)

    Sandri, S.; Poggi, C. [ENEA, Radiation Protection Institute, IRP-FUAC, Frascati (Italy); Coniglio, A. [Medical Physics Department, S. Giovanni Calibita Hospital, Fatebenefratelli, Isola Tiberina, Roma (Italy); D' Arienzo, M. [ENEA, Ionizing Radiation Metrology National Institute, METR, Casaccia, Rome (Italy)

    2011-12-13

    SPIDER (Source for Production of Ion of Deuterium Extracted from RF Plasma only) and MITICA (Megavolt ITER Injector Concept Advanced) are the ITER neutral beam injector (NBI) testing facilities of the PRIMA (Padova Research Injector Megavolt Accelerated) Center. Both injectors accelerate negative deuterium ions with a maximum energy of 1 MeV for MITICA and 100 keV for SPIDER with a maximum beam current of 40 A for both experiments. The SPIDER facility is classified in Italy as a particle accelerator. At present, the design of the radiation safety system for the facility has been completed and the relevant reports have been presented to the Italian regulatory authorities. Before SPIDER can operate, approval must be obtained from the Italian Regulatory Authority Board (IRAB) following a detailed licensing process. In the present work, the main project information and criteria for the SPIDER injector source are reported together with the analysis of hypothetical accidental situations and safety issues considerations. Neutron and photon nuclear analysis is presented, along with special shielding solutions designed to meet Italian regulatory dose limits. The contribution of activated corrosion products (ACP) to external exposure of workers has also been assessed. Nuclear analysis indicates that the photon contribution to worker external exposure is negligible, and the neutron dose can be considered by far the main radiation protection issue. Our results confirm that the injector has no important radiological impact on the population living around the facility.

  18. Biased motion and molecular motor properties of bipedal spiders

    Science.gov (United States)

    Samii, Laleh; Linke, Heiner; Zuckermann, Martin J.; Forde, Nancy R.

    2010-02-01

    Molecular spiders are synthetic molecular motors featuring multiple legs that each can interact with a substrate through binding and cleavage. Experimental studies suggest the motion of the spider in a matrix is biased toward uncleaved substrates and that spider properties such as processivity can be altered by changing the binding strength of the legs to substrate [R. Pei, S. K. Taylor, D. Stefanovic, S. Rudchenko, T. E. Mitchell, and M. N. Stojanovic, J. Am. Chem. Soc. 128, 12693 (2006)]. We investigate the origin of biased motion and molecular motor properties of bipedal spiders using Monte Carlo simulations. Our simulations combine a realistic chemical kinetic model, hand-over-hand or inchworm modes of stepping, and the use of a one-dimensional track. We find that stronger binding to substrate, cleavage and spider detachment from the track are contributing mechanisms to population bias. We investigate the contributions of stepping mechanism to speed, randomness parameter, processivity, coupling, and efficiency, and comment on how these molecular motor properties can be altered by changing experimentally tunable kinetic parameters.

  19. Detection and phylogenetic analysis of bacteriophage WO in spiders (Araneae).

    Science.gov (United States)

    Yan, Qian; Qiao, Huping; Gao, Jin; Yun, Yueli; Liu, Fengxiang; Peng, Yu

    2015-11-01

    Phage WO is a bacteriophage found in Wolbachia. Herein, we represent the first phylogenetic study of WOs that infect spiders (Araneae). Seven species of spiders (Araneus alternidens, Nephila clavata, Hylyphantes graminicola, Prosoponoides sinensis, Pholcus crypticolens, Coleosoma octomaculatum, and Nurscia albofasciata) from six families were infected by Wolbachia and WO, followed by comprehensive sequence analysis. Interestingly, WO could be only detected Wolbachia-infected spiders. The relative infection rates of those seven species of spiders were 75, 100, 88.9, 100, 62.5, 72.7, and 100 %, respectively. Our results indicated that both Wolbachia and WO were found in three different body parts of N. clavata, and WO could be passed to the next generation of H. graminicola by vertical transmission. There were three different sequences for WO infected in A. alternidens and two different WO sequences from C. octomaculatum. Only one sequence of WO was found for the other five species of spiders. The discovered sequence of WO ranged from 239 to 311 bp. Phylogenetic tree was generated using maximum likelihood (ML) based on the orf7 gene sequences. According to the phylogenetic tree, WOs in N. clavata and H. graminicola were clustered in the same group. WOs from A. alternidens (WAlt1) and C. octomaculatum (WOct2) were closely related to another clade, whereas WO in P. sinensis was classified as a sole cluster.

  20. Recent Advances in Research on Widow Spider Venoms and Toxins.

    Science.gov (United States)

    Yan, Shuai; Wang, Xianchun

    2015-12-01

    Widow spiders have received much attention due to the frequently reported human and animal injures caused by them. Elucidation of the molecular composition and action mechanism of the venoms and toxins has vast implications in the treatment of latrodectism and in the neurobiology and pharmaceutical research. In recent years, the studies of the widow spider venoms and the venom toxins, particularly the α-latrotoxin, have achieved many new advances; however, the mechanism of action of the venom toxins has not been completely clear. The widow spider is different from many other venomous animals in that it has toxic components not only in the venom glands but also in other parts of the adult spider body, newborn spiderlings, and even the eggs. More recently, the molecular basis for the toxicity outside the venom glands has been systematically investigated, with four proteinaceous toxic components being purified and preliminarily characterized, which has expanded our understanding of the widow spider toxins. This review presents a glance at the recent advances in the study on the venoms and toxins from the Latrodectus species. PMID:26633495

  1. Recent Advances in Research on Widow Spider Venoms and Toxins

    Directory of Open Access Journals (Sweden)

    Shuai Yan

    2015-11-01

    Full Text Available Widow spiders have received much attention due to the frequently reported human and animal injures caused by them. Elucidation of the molecular composition and action mechanism of the venoms and toxins has vast implications in the treatment of latrodectism and in the neurobiology and pharmaceutical research. In recent years, the studies of the widow spider venoms and the venom toxins, particularly the α-latrotoxin, have achieved many new advances; however, the mechanism of action of the venom toxins has not been completely clear. The widow spider is different from many other venomous animals in that it has toxic components not only in the venom glands but also in other parts of the adult spider body, newborn spiderlings, and even the eggs. More recently, the molecular basis for the toxicity outside the venom glands has been systematically investigated, with four proteinaceous toxic components being purified and preliminarily characterized, which has expanded our understanding of the widow spider toxins. This review presents a glance at the recent advances in the study on the venoms and toxins from the Latrodectus species.

  2. Biotechnological Trends in Spider and Scorpion Antivenom Development

    Science.gov (United States)

    Laustsen, Andreas Hougaard; Solà, Mireia; Jappe, Emma Christine; Oscoz, Saioa; Lauridsen, Line Præst; Engmark, Mikael

    2016-01-01

    Spiders and scorpions are notorious for their fearful dispositions and their ability to inject venom into prey and predators, causing symptoms such as necrosis, paralysis, and excruciating pain. Information on venom composition and the toxins present in these species is growing due to an interest in using bioactive toxins from spiders and scorpions for drug discovery purposes and for solving crystal structures of membrane-embedded receptors. Additionally, the identification and isolation of a myriad of spider and scorpion toxins has allowed research within next generation antivenoms to progress at an increasingly faster pace. In this review, the current knowledge of spider and scorpion venoms is presented, followed by a discussion of all published biotechnological efforts within development of spider and scorpion antitoxins based on small molecules, antibodies and fragments thereof, and next generation immunization strategies. The increasing number of discovery and development efforts within this field may point towards an upcoming transition from serum-based antivenoms towards therapeutic solutions based on modern biotechnology. PMID:27455327

  3. Biotechnological Trends in Spider and Scorpion Antivenom Development

    Directory of Open Access Journals (Sweden)

    Andreas Hougaard Laustsen

    2016-07-01

    Full Text Available Spiders and scorpions are notorious for their fearful dispositions and their ability to inject venom into prey and predators, causing symptoms such as necrosis, paralysis, and excruciating pain. Information on venom composition and the toxins present in these species is growing due to an interest in using bioactive toxins from spiders and scorpions for drug discovery purposes and for solving crystal structures of membrane-embedded receptors. Additionally, the identification and isolation of a myriad of spider and scorpion toxins has allowed research within next generation antivenoms to progress at an increasingly faster pace. In this review, the current knowledge of spider and scorpion venoms is presented, followed by a discussion of all published biotechnological efforts within development of spider and scorpion antitoxins based on small molecules, antibodies and fragments thereof, and next generation immunization strategies. The increasing number of discovery and development efforts within this field may point towards an upcoming transition from serum-based antivenoms towards therapeutic solutions based on modern biotechnology.

  4. Recent Advances in Research on Widow Spider Venoms and Toxins.

    Science.gov (United States)

    Yan, Shuai; Wang, Xianchun

    2015-11-27

    Widow spiders have received much attention due to the frequently reported human and animal injures caused by them. Elucidation of the molecular composition and action mechanism of the venoms and toxins has vast implications in the treatment of latrodectism and in the neurobiology and pharmaceutical research. In recent years, the studies of the widow spider venoms and the venom toxins, particularly the α-latrotoxin, have achieved many new advances; however, the mechanism of action of the venom toxins has not been completely clear. The widow spider is different from many other venomous animals in that it has toxic components not only in the venom glands but also in other parts of the adult spider body, newborn spiderlings, and even the eggs. More recently, the molecular basis for the toxicity outside the venom glands has been systematically investigated, with four proteinaceous toxic components being purified and preliminarily characterized, which has expanded our understanding of the widow spider toxins. This review presents a glance at the recent advances in the study on the venoms and toxins from the Latrodectus species.

  5. Phylogenomic analysis of spiders reveals nonmonophyly of orb weavers.

    Science.gov (United States)

    Fernández, Rosa; Hormiga, Gustavo; Giribet, Gonzalo

    2014-08-01

    Spiders constitute one of the most successful clades of terrestrial predators. Their extraordinary diversity, paralleled only by some insects and mites, is often attributed to the use of silk, and, in one of the largest lineages, to stereotyped behaviors for building foraging webs of remarkable biomechanical properties. However, our understanding of higher-level spider relationships is poor and is largely based on morphology. Prior molecular efforts have focused on a handful of genes but have provided little resolution to key questions such as the origin of the orb weavers. We apply a next-generation sequencing approach to resolve spider phylogeny, examining the relationships among its major lineages. We further explore possible pitfalls in phylogenomic reconstruction, including missing data, unequal rates of evolution, and others. Analyses of multiple data sets all agree on the basic structure of the spider tree and all reject the long-accepted monophyly of Orbiculariae, by placing the cribellate orb weavers (Deinopoidea) with other groups and not with the ecribellate orb weavers (Araneoidea). These results imply independent origins for the two types of orb webs (cribellate and ecribellate) or a much more ancestral origin of the orb web with subsequent loss in the so-called RTA clade. Either alternative demands a major reevaluation of our current understanding of the spider evolutionary chronicle.

  6. Visual odometry in the wolf spider Lycosa tarantula (Araneae: Lycosidae).

    Science.gov (United States)

    Ortega-Escobar, J; Ruiz, M A

    2014-02-01

    The wolf spider Lycosa tarantula homes using path integration. The angular component of the displacement is measured using a polarized-light compass associated with the functioning of the anterior median eyes. However, how L. tarantula estimates the linear component of the displacement was not known prior to this investigation. The ability of L. tarantula to gauge the distance walked after being displaced from its burrow was investigated using experimental channels placed in an indoor setup. Firstly, we manipulated the perception of visual stimuli by covering all the spider's eyes. Secondly, we changed the optic flow supplied by a black-and-white grating (λ=2 cm) perceived either in the lateral or in the ventral field of view. Finally, the period of the lateral or ventral grating was changed from λ=2 cm to λ=1 cm. Our results indicate that visual information contributes to distance estimation because when the spider's eyes were covered, the spiders tended to search for the burrow at very variable distances. This visual information is created by the motion of the image as the spider walks, the motion in the lateral field of view being the most important. The preference of a lateral optic flow over the ventral flow can be explained by the difference in the resolution capacity of the posterior lateral eyes and the anterior lateral eyes. PMID:24477612

  7. Prey interception drives web invasion and spider size determines successful web takeover in nocturnal orb-web spiders

    Directory of Open Access Journals (Sweden)

    Wenjin Gan

    2015-10-01

    Full Text Available A striking feature of web-building spiders is the use of silk to make webs, mainly for prey capture. However, building a web is energetically expensive and increases the risk of predation. To reduce such costs and still have access to abundant prey, some web-building spiders have evolved web invasion behaviour. In general, no consistent patterns of web invasion have emerged and the factors determining web invasion remain largely unexplored. Here we report web invasion among conspecifics in seven nocturnal species of orb-web spiders, and examined the factors determining the probability of webs that could be invaded and taken over by conspecifics. About 36% of webs were invaded by conspecifics, and 25% of invaded webs were taken over by the invaders. A web that was built higher and intercepted more prey was more likely to be invaded. Once a web was invaded, the smaller the size of the resident spider, the more likely its web would be taken over by the invader. This study suggests that web invasion, as a possible way of reducing costs, may be widespread in nocturnal orb-web spiders.

  8. Investigating the efficacy of attention bias modification in reducing high spider fear: The role of individual differences in initial bias

    OpenAIRE

    Fox, E; Zougkou, K; Ashwin, C; Cahill, S

    2015-01-01

    Background and objectives Attention Bias Modification (ABM) targets attention bias (AB) towards threat and is a potential therapeutic intervention for anxiety. The current study investigated whether initial AB (towards or away from spider images) influenced the effectiveness of ABM in spider fear. Methods AB was assessed with an attentional probe task consisting of spider and neutral images presented simultaneously followed by a probe in spider congruent or spider incongruent loca...

  9. Interactions Between the Chilean Recluse Spider (Araneae: Sicariidae) and an Araneophagic Spitting Spider (Araneae: Scytodidae).

    Science.gov (United States)

    Canals, Mauricio; Arriagada, Nicolás; Solís, Rigoberto

    2015-03-01

    In Chile, all necrotic arachnidism is attributed to the Chilean recluse spider, Loxosceles laeta Nicolet, a species that shares the microenvironmental habitats with the spitting spider Scytodes globula Nicolet. The latter species has been proposed as a potential predator of L. laeta. For this research, we studied the interaction between both species during individual encounters to assess the possibility of population regulation of L. laeta cohorts exposed to this potential predator. We found that in most encounters S. globula prevailed. Also, S. globula preys on spiderlings of L. laeta, with a population effect on cohorts of this species. These findings suggest that S. globula may be influencing L. laeta populations in central Chile. The population regulation of L. laeta by predation would be important because this species, in the absence of predators, has a high reproductive rate, and it can maintain populations of large size. However according to our results, although S. globula may aid in the reduction of both spiderling and adult L. laeta populations, and perhaps other Loxosceles species, it is insufficient for biological control of Loxosceles species. Its presence together with other control measures such as hygiene of the rooms can help to decrease loxoscelism incidence. PMID:26336293

  10. Recombinant Spider Silks—Biopolymers with Potential for Future Applications

    Directory of Open Access Journals (Sweden)

    Thomas Scheibel

    2011-03-01

    Full Text Available Nature has evolved a range of materials that compete with man-made materials in physical properties; one of these is spider silk. Silk is a fibrous material that exhibits extremely high strength and toughness with regard to its low density. In this review we discuss the molecular structure of spider silk and how this understanding has allowed the development of recombinant silk proteins that mimic the properties of natural spider silks. Additionally, we will explore the material morphologies and the applications of these proteins. Finally, we will look at attempts to combine the silk structure with chemical polymers and how the structure of silk has inspired the engineering of novel polymers.

  11. Acute generalized exanthematous pustulosis associated with spider bite*

    Science.gov (United States)

    Milman, Laura de Mattos; Müller, Giana Paula; Souza, Paulo Ricardo Martins; Grill, Aline Barcellos; Rhoden, Deise Louise Bohn; Mello-da-Silva, Carlos Augusto; Vettorato, Gerson

    2016-01-01

    Acute generalized exanthematous pustulosis (AGEP) is an acute febrile rash, usually induced by drugs, which recently has been linked to spider bite. We report a case of a male patient, 48 years old, with an erythematous rash accompanied by fever and small non-follicular pustules. He reported previous pain in the buttock with the onset of a necrotic plaque. The lesion was compatible with spider bite of the genus Loxosceles. According to the EuroSCAR group instrument, the patient scored +10 indicating definite diagnosis of AGEP. As the patient had a compatible lesion and had no other triggers of AGEP, in an Loxosceles endemic area, the AGEP would be associated with spider bite, as described in other publications. PMID:27579754

  12. Final design of thermal diagnostic system in SPIDER ion source

    Science.gov (United States)

    Brombin, M.; Dalla Palma, M.; Pasqualotto, R.; Pomaro, N.

    2016-11-01

    The prototype radio frequency source of the ITER heating neutral beams will be first tested in SPIDER test facility to optimize H- production, cesium dynamics, and overall plasma characteristics. Several diagnostics will allow to fully characterise the beam in terms of uniformity and divergence and the source, besides supporting a safe and controlled operation. In particular, thermal measurements will be used for beam monitoring and system protection. SPIDER will be instrumented with mineral insulated cable thermocouples, both on the grids, on other components of the beam source, and on the rear side of the beam dump water cooled elements. This paper deals with the final design and the technical specification of the thermal sensor diagnostic for SPIDER. In particular the layout of the diagnostic, together with the sensors distribution in the different components, the cables routing and the conditioning and acquisition cubicles are described.

  13. Bird predation affects diurnal and nocturnal web-building spiders in a Mediterranean citrus grove

    Science.gov (United States)

    Mestre, L.; Garcia, N.; Barrientos, J. A.; Espadaler, X.; Piñol, J.

    2013-02-01

    Spiders and birds can greatly decrease insect populations, but birds also limit spider densities in some habitats. Bird predation is thought to be one of the causes behind nocturnal activity in spiders, so night-active spiders that hide in retreats during the day should be less affected by bird foraging than day-active spiders. However, this hypothesis has not yet been tested. We investigated the importance of bird predation on the spider community of a Mediterranean organic citrus grove. We excluded birds by placing net cages over the trees and we conducted visual searches in the canopies to sample web-building spiders. As there are many nocturnal species in the family Araneidae, we conducted searches both by day and by night to compare the abundance of active araneids in these two time periods. We sampled the tree trunks with cardboard bands to collect hunting spiders. In bird-excluded canopies there were more spiders of the families Araneidae and Theridiidae. There were higher numbers of active Araneidae at night, but these were just as negatively affected by bird predation as day-active Araneidae, so there was no evidence of nocturnal activity serving as an anti-predator strategy. We did not find any negative impact of birds on hunting spiders. Our results contrast with other studies reporting a negative effect of birds on hunting but not on web-building spiders.

  14. Function of bright coloration in the wasp spider Argiope bruennichi (Araneae: Araneidae).

    Science.gov (United States)

    Bush, Alex A; Yu, Douglas W; Herberstein, Marie E

    2008-06-01

    There are two major competing explanations for the counter-intuitive presence of bright coloration in certain orb-web spiders. Bright coloration could lure insect prey to the web vicinity, increasing the spider's foraging success. Alternatively, the markings could function as disruptive camouflage, making it difficult for the insect prey to distinguish spiders from background colour variation. We measured the prey capture rates of wasp spiders, Argiope bruennichi, that were blacked out, shielded from view using a leaf fragment, or left naturally coloured. Naturally coloured spiders caught over twice the number of prey as did either blacked-out or leaf-shielded spiders, and almost three times as many orthopteran prey. Spectrophotometer measurements suggest that the bright yellow bands on the spider's abdomen are visible to insect prey, but not the banding on the legs, which could disguise the spider's outline. Thus, our results provide strong support for the hypothesis that bright coloration in the wasp spider acts as a visual lure for insect prey and weak support for the hypothesis that the arrangement of the banding pattern across the spider's body disguises the presence of the spider on the web. PMID:18331982

  15. How spiders practice aggressive and Batesian mimicry

    Institute of Scientific and Technical Information of China (English)

    Ximena J.NELSON; Robert R.JACKSON

    2012-01-01

    To understand communication,the interests of the sender and the receiver/s of signals should be considered separately.When our goal is to understand the adaptive significance of specific responses to specific signals by the receiver,questions about signal information are useful.However,when our goal is to understand the adaptive significance to the sender of generating a signal,it may be better to envisage the receiver's response to signals as part of the sender's extended phenotype.By making signals,a sender interfaces with the receiver's model of the world and indirectly manipulates its behaviour.This is especially clear in cases of mimicry,where animals use deceptive signals that indirectly manipulate the behaviour of receivers.Many animals adopt Batesian mimicry to deceive their predators,or aggressive mimicry to deceive their prey.We review examples from the literature on spiders to illustrate how these phenomena,traditionally thought of as distinct,can become entangled in a web of lies.

  16. Thermal architecture for the SPIDER flight cryostat

    CERN Document Server

    Gudmundsson, J E; Amiri, M; Benton, S J; Bihary, R; Bock, J J; Bond, J R; Bonetti, J A; Bryan, S A; Chiang, H C; Contaldi, C R; Crill, B P; O'Dea, D; Farhang, M; Filippini, J P; Fissel, L M; Gandilo, N N; Golwala, S R; Halpern, M; Hasselfield, M; Helson, K R; Hilton, G; Holmes, W; Hristov, V V; Irwin, K D; Jones, W C; Kuo, C L; MacTavish, C J; Mason, P V; Montroy, T E; Morford, T A; Netterfield, C B; Rahlin, A S; Reintsema, C D; Ruhl, J E; Runyan, M C; Schenker, M A; Shariff, J A; Soler, J D; Trangsrud, A; Tucker, C; Tucker, R S; Turner, A D; 10.1117/12.857925

    2011-01-01

    We describe the cryogenic system for SPIDER, a balloon-borne microwave polarimeter that will map 8% of the sky with degree-scale angular resolution. The system consists of a 1284 L liquid helium cryostat and a 16 L capillary-filled superfluid helium tank, which provide base operating temperatures of 4 K and 1.5 K, respectively. Closed-cycle helium-3 adsorption refrigerators supply sub-Kelvin cooling power to multiple focal planes, which are housed in monochromatic telescope inserts. The main helium tank is suspended inside the vacuum vessel with thermally insulating fiberglass flexures, and shielded from thermal radiation by a combination of two vapor cooled shields and multi-layer insulation. This system allows for an extremely low instrumental background and a hold time in excess of 25 days. The total mass of the cryogenic system, including cryogens, is approximately 1000 kg. This enables conventional long duration balloon flights. We will discuss the design, thermal analysis, and qualification of the cryog...

  17. Thermal architecture for the SPIDER flight cryostat

    Science.gov (United States)

    Gudmundsson, J. E.; Ade, P. A. R.; Amiri, M.; Benton, S. J.; Bihary, R.; Bock, J. J.; Bond, J. R.; Bonetti, J. A.; Bryan, S. A.; Burger, B.; Chiang, H. C.; Contaldi, C. R.; Crill, B. P.; Doré, O.; Farhang, M.; Filippini, J.; Fissel, L. M.; Gandilo, N. N.; Golwala, S. R.; Halpern, M.; Hasselfield, M.; Hilton, G.; Holmes, W.; Hristov, V. V.; Irwin, K. D.; Jones, W. C.; Kuo, C. L.; MacTavish, C. J.; Mason, P. V.; Montroy, T. E.; Morford, T. A.; Netterfield, C. B.; O'Dea, D. T.; Rahlin, A. S.; Reintsema, C. D.; Ruhl, J. E.; Runyan, M. C.; Schenker, M. A.; Shariff, J. A.; Soler, J. D.; Trangsrud, A.; Tucker, C.; Tucker, R. S.; Turner, A. D.

    2010-07-01

    We describe the cryogenic system for SPIDER, a balloon-borne microwave polarimeter that will map 8% of the sky with degree-scale angular resolution. The system consists of a 1284 L liquid helium cryostat and a 16 L capillary-filled superfluid helium tank, which provide base operating temperatures of 4 K and 1.5 K, respectively. Closed-cycle 3He adsorption refrigerators supply sub-Kelvin cooling power to multiple focal planes, which are housed in monochromatic telescope inserts. The main helium tank is suspended inside the vacuum vessel with thermally insulating fiberglass flexures, and shielded from thermal radiation by a combination of two vapor cooled shields and multi-layer insulation. This system allows for an extremely low instrumental background and a hold time in excess of 25 days. The total mass of the cryogenic system, including cryogens, is approximately 1000 kg. This enables conventional long duration balloon flights. We will discuss the design, thermal analysis, and qualification of the cryogenic system.

  18. Predator perception of detritus and eggsac decorations spun by orb-web spiders Cyclosa octotuberculata: Do they function to camouflage the spiders?

    OpenAIRE

    Wenjin GAN, Fengxiang LIU, Zengtao ZHANG, Daiqin LI

    2010-01-01

    Camouflage is one of the most widespread and powerful strategies that animals use to make detection/recognition more difficult. Many orb-web spiders of the genus Cyclosa add prey remains, plant debris, moults, and/or eggsacs to their webs called web decorations. Web decorations resembling spider body colour pattern have been considered to camouflage the spider from predators. While this camouflage is obvious from a human’s perspective, it has rarely been investigated from a predator’s perspec...

  19. Prey type, vibrations and handling interactively influence spider silk expression.

    Science.gov (United States)

    Blamires, S J; Chao, I-C; Tso, I-M

    2010-11-15

    The chemical and mechanical properties of spider major ampullate (MA) silks vary in response to different prey, mostly via differential expression of two genes - MaSp1 and MaSp2 - although the spinning process exerts additional influence over the mechanical properties of silk. The prey cues that initiate differential gene expression are unknown. Prey nutrients, vibratory stimuli and handling have been suggested to be influential. We performed experiments to decouple the vibratory stimuli and handling associated with high and low kinetic energy prey (crickets vs flies) from their prey nutrients to test the relative influence of each as inducers of silk protein expression in the orb web spider Nephila pilipes. We found that the MA silks from spiders feeding on live crickets had greater percentages of glutamine, serine, alanine and glycine than those from spiders feeding on live flies. Proline composition of the silks was unaffected by feeding treatment. Increases in alanine and glycine in the MA silks of the live-cricket-feeding spiders indicate a probable increase in MaSp1 gene expression. The amino acid compositions of N. pilipes feeding on crickets with fly stimuli and N. pilipes feeding on flies with cricket stimuli did not differ from each other or from pre-treatment responses, so these feeding treatments did not induce differential MaSp expression. Our results indicate that cricket vibratory stimuli and handling interact with nutrients to induce N. pilipes to adjust their gene expression to produce webs with mechanical properties appropriate for the retention of this prey. This shows that spiders can genetically alter their silk chemical compositions and, presumably, mechanical properties upon exposure to different prey types. The lack of any change in proline composition with feeding treatment in N. pilipes suggests that the MaSp model determined for Nephila clavipes is not universally applicable to all Nephila.

  20. Silk reinforced with graphene or carbon nanotubes spun by spiders

    OpenAIRE

    Lepore, Emiliano; Bonaccorso, Francesco; Bruna, Matteo; Bosia, Federico; Taioli, Simone; Garberoglio, Giovanni; Ferrari, Andrea C.; Pugno, Nicola Maria

    2015-01-01

    Here, we report the production of silk incorporating graphene and carbon nanotubes directly by spider spinning, after spraying spiders with the corresponding aqueous dispersions. We observe a significant increment of the mechanical properties with respect to the pristine silk, in terms of fracture strength, Young's and toughness moduli. We measure a fracture strength up to 5.4 GPa, a Young's modulus up to 47.8 GPa and a toughness modulus up to 2.1 GPa, or 1567 J/g, which, to the best of our k...

  1. Learning from animal sensors: the clever "design" of spider mechanoreceptors

    Science.gov (United States)

    Barth, Friedrich G.

    2012-04-01

    Three types of spider sensors responding to different forms of mechanical energy are chosen to illustrate the power of evolutionary constraints to fine-tune the functional "design" of animal sensors to the particular roles they play in particular behavioral contexts. As demonstrated by the application of computational biomechanics and a fruitful cooperation between biologists and engineers there are remarkable "technical" tricks to be found by which spider tactile sensors, airflow sensors, and strain sensors are adjusted to their biologically relevant stimulus patterns. The application of such "tricks" to technical solutions of measuring problems similar to those animals have to cope with, seems both realistic and very promising.

  2. Volatile compounds from leaves of the African spider plant (Gynandropsis gynandra) with bioactivity against spider mite (Tetranychus urticae)

    DEFF Research Database (Denmark)

    Nyalala, Samuel Odeyo; Petersen, Mikael Agerlin; Grout, Brian William Wilson

    2013-01-01

    Previous studies have demonstrated that Gynandropsis gynandra emits acetonitrile as a foliar volatile from intact plants and isolated leaves, and that this compound is an effective spider mite repellent. This study has used gas chromatography–mass spectrometry to investigate volatile compounds...... emitted from homogenised G. gynandra leaves to evaluate their tissue acetonitrile content and to look for other compounds that might be exploited for the management of spider mites. Acetonitrile was absent from the homogenised tissues of five lines of G. gynandra, studied over two seasons. Thirteen...... volatile compounds were emitted by G. gynandra at significantly higher levels than mite-susceptible pot roses, including isothiocyanates, aldehydes, esters, alcohols and terpenes. Six representative compounds were selected to assess bioactivity. Spider mite populations were completely inactive after a 2¿h...

  3. Spiders do not escape reproductive manipulations by Wolbachia

    Directory of Open Access Journals (Sweden)

    Hendrickx Frederik

    2011-01-01

    Full Text Available Abstract Background Maternally inherited bacteria that reside obligatorily or facultatively in arthropods can increase their prevalence in the population by altering their hosts' reproduction. Such reproductive manipulations have been reported from the major arthropod groups such as insects (in particular hymenopterans, butterflies, dipterans and beetles, crustaceans (isopods and mites. Despite the observation that endosymbiont bacteria are frequently encountered in spiders and that the sex ratio of particular spider species is strongly female biased, a direct relationship between bacterial infection and sex ratio variation has not yet been demonstrated for this arthropod order. Results Females of the dwarf spider Oedothorax gibbosus exhibit considerable variation in the sex ratio of their clutches and were infected with at least three different endosymbiont bacteria capable of altering host reproduction i.e. Wolbachia, Rickettsia and Cardinium. Breeding experiments show that sex ratio variation in this species is primarily maternally inherited and that removal of the bacteria by antibiotics restores an unbiased sex ratio. Moreover, clutches of females infected with Wolbachia were significantly female biased while uninfected females showed an even sex ratio. As female biased clutches were of significantly smaller size compared to non-distorted clutches, killing of male embryos appears to be the most likely manipulative effect. Conclusions This represents to our knowledge the first direct evidence that endosymbiont bacteria, and in particular Wolbachia, might induce sex ratio variation in spiders. These findings are pivotal to further understand the diversity of reproductive phenotypes observed in this arthropod order.

  4. Competition between introduced and native spiders (Araneae: Linyphiidae)

    Science.gov (United States)

    Houser, J.D.; Ginsberg, Howard S.; Jakob, Elizabeth M.

    2014-01-01

    The European sheet-web spider Linyphia triangularis (Araneae: Linyphiidae) has become established in Maine, where it often reaches very high densities. Two lines of evidence from previous work suggest that L. triangularis affects populations of the native linyphiid spider Frontinella communis. First, F. communis individuals are relatively scarce in both forest and coastal habitat where L. triangularis is common, but more common where L. triangularis is at low density. Second, in field experiments, F. communis species are less likely to settle in experimental plots when L. triangularis is present, and F. communis disappears from study plots when L. triangularis is introduced. Here we test two mechanisms that may underlie these patterns. First, we tested whether L. triangularis invades and usurps the webs of F. communis. When spiders were released onto webs of heterospecifics, L. triangularis was more likely to take over or share webs of F. communis than the reverse. We also observed natural takeovers of F. communis webs. Second, we explored the hypothesis that L. triangularis reduces prey availability for native species. We sampled flying prey in areas with L. triangularis and those where it had been removed, and found no effect of spider presence on measured prey density. We also found no effect of prey supplementation on web tenacity in F. communis, suggesting that F. communis movements are not highly dependent on prey availability. We conclude that web takeover is likely more important than prey reduction in driving negative effects of L. triangularis on F. communis.

  5. Spiders (Araneae) as polyphagous natural enemies in orchards

    NARCIS (Netherlands)

    Bogya, S.

    1999-01-01

    Spiders (Araneae) occur in high abundance in all terrestrial ecosystems including agro-ecosystems. They are a very heterogeneous group of animals with different hunting tactics and therefore they play very different ecological roles. At family level these tactics are rather similar thus properties a

  6. Infanticide by a solitary koinobiont ichneumonid ectoparasitoid of spiders

    Science.gov (United States)

    Takasuka, Keizo; Matsumoto, Rikio

    2011-06-01

    When encountering an already parasitized host, a parasitoid's optimal choices (superparasitism, host rejection, host feeding or infanticide) seem to depend on the individual species' life history, because the same choice may have different fitness consequences. We demonstrate infanticide under laboratory conditions by a polysphinctine, Zatypota albicoxa, which is a solitary koinobiont ectoparasitoid of spiders. The female always removed any previously attached egg or larva from the body of the host spider, Parasteatoda tepidariorum, with a rubbing behaviour. She rubbed her ovipositor back and forth toward the undersurface of the attached egg or of the saddle under the attached larva to pry it off and laid an egg after removal. When removing a larva, the infanticidal female engaged exclusively in unfastening the `saddle' which fastens the larva to the body of the spider. All larvae were removed with the `saddle' attached to the ventral surface of the body. The female invested more time to remove the medium second and the large penultimate instar larvae than to remove eggs and first instar larvae because of the labour involved in unfastening the saddle. Oviposition with infanticide of the medium second and the penultimate instar larvae imposed more time upon the female than that on an unparasitized host. Removal of any previous occupant in spite of the associated labour costs suggests that infanticide will always be adaptive, no matter the time costs to Z. albicoxa, because so much is invested in attacking the host and because the parasitoid cannot detect whether the spider is already parasitized until she achieves subjugation.

  7. Preservice Teachers' Conceptions about Animals and Particularly about Spiders

    Science.gov (United States)

    Jambrina, Carmen Urones; Vacas, Jose Manuel; Sanchez-Barbudo, Miguel

    2010-01-01

    Introduction: This article explores the scientific ideas and alternative conceptions that pre-service teachers have regarding animal classification and spiders in particular. Method: The study involved 40 pre-service teachers of elementary education in Spain and the data was collected by means of questionnaires, descriptions and drawings. The…

  8. ArachnoServer: a database of protein toxins from spiders

    Directory of Open Access Journals (Sweden)

    Kaas Quentin

    2009-08-01

    Full Text Available Abstract Background Venomous animals incapacitate their prey using complex venoms that can contain hundreds of unique protein toxins. The realisation that many of these toxins may have pharmaceutical and insecticidal potential due to their remarkable potency and selectivity against target receptors has led to an explosion in the number of new toxins being discovered and characterised. From an evolutionary perspective, spiders are the most successful venomous animals and they maintain by far the largest pool of toxic peptides. However, at present, there are no databases dedicated to spider toxins and hence it is difficult to realise their full potential as drugs, insecticides, and pharmacological probes. Description We have developed ArachnoServer, a manually curated database that provides detailed information about proteinaceous toxins from spiders. Key features of ArachnoServer include a new molecular target ontology designed especially for venom toxins, the most up-to-date taxonomic information available, and a powerful advanced search interface. Toxin information can be browsed through dynamic trees, and each toxin has a dedicated page summarising all available information about its sequence, structure, and biological activity. ArachnoServer currently manages 567 protein sequences, 334 nucleic acid sequences, and 51 protein structures. Conclusion ArachnoServer provides a single source of high-quality information about proteinaceous spider toxins that will be an invaluable resource for pharmacologists, neuroscientists, toxinologists, medicinal chemists, ion channel scientists, clinicians, and structural biologists. ArachnoServer is available online at http://www.arachnoserver.org.

  9. Incidense of spider mites in South Texas cotton fields

    Science.gov (United States)

    The incidence of spider mites was evaluated· in four locations of south Texas between Progreso (Hidalgo Co.) to Bishop (Nueces Co.). This is an area with a south to north transect of 125 miles from south Progreso to north Bishop (respectively).The other two intermediate sampled locations were Harlin...

  10. On the Colours of Spider Orb-Webs

    Science.gov (United States)

    Suhr, Wilfried; Schlichting, H. Joachim

    2011-01-01

    A sticky capture thread from the spiral element of spider orb-webs is formed of almost regularly spaced droplets that surround a supporting axial fibre. From the perspective of physical optics it represents a periodic linear array of scattering elements that acts as a diffraction grating. This is a novel aspect, which is of vital importance for…

  11. Mating duration and sperm precedence in the spider Linyphia triangularis

    DEFF Research Database (Denmark)

    Weldingh, Ditte L.; Toft, Søren; Larsen, Ole Næsbye

    2011-01-01

    , especially the males, are able to influence the outcome of mating for their own benefit. We studied the linyphiid spider Linyphia triangularis in which mating follows a strict sequence during which the male inducts two droplets of sperm and transfers them to the female. We performed sperm competition...

  12. The Spider's Web: Creativity and Survival in Dynamic Balance.

    Science.gov (United States)

    Cohen, Bill

    2001-01-01

    The spider's web is presented as a model for Indigenous education and community transformation, grounded in Okanagan philosophy. Children are at the center and benefit from the influence of extended family and community. The model's relevance for language revitalization, cultural maintenance, and educational planning and assessment is discussed.…

  13. Brown spider (Loxosceles genus) venom toxins: tools for biological purposes.

    Science.gov (United States)

    Chaim, Olga Meiri; Trevisan-Silva, Dilza; Chaves-Moreira, Daniele; Wille, Ana Carolina M; Ferrer, Valéria Pereira; Matsubara, Fernando Hitomi; Mangili, Oldemir Carlos; da Silveira, Rafael Bertoni; Gremski, Luiza Helena; Gremski, Waldemiro; Senff-Ribeiro, Andrea; Veiga, Silvio Sanches

    2011-03-01

    Venomous animals use their venoms as tools for defense or predation. These venoms are complex mixtures, mainly enriched of proteic toxins or peptides with several, and different, biological activities. In general, spider venom is rich in biologically active molecules that are useful in experimental protocols for pharmacology, biochemistry, cell biology and immunology, as well as putative tools for biotechnology and industries. Spider venoms have recently garnered much attention from several research groups worldwide. Brown spider (Loxosceles genus) venom is enriched in low molecular mass proteins (5-40 kDa). Although their venom is produced in minute volumes (a few microliters), and contain only tens of micrograms of protein, the use of techniques based on molecular biology and proteomic analysis has afforded rational projects in the area and permitted the discovery and identification of a great number of novel toxins. The brown spider phospholipase-D family is undoubtedly the most investigated and characterized, although other important toxins, such as low molecular mass insecticidal peptides, metalloproteases and hyaluronidases have also been identified and featured in literature. The molecular pathways of the action of these toxins have been reported and brought new insights in the field of biotechnology. Herein, we shall see how recent reports describing discoveries in the area of brown spider venom have expanded biotechnological uses of molecules identified in these venoms, with special emphasis on the construction of a cDNA library for venom glands, transcriptome analysis, proteomic projects, recombinant expression of different proteic toxins, and finally structural descriptions based on crystallography of toxins.

  14. Brown Spider (Loxosceles genus Venom Toxins: Tools for Biological Purposes

    Directory of Open Access Journals (Sweden)

    Andrea Senff-Ribeiro

    2011-03-01

    Full Text Available Venomous animals use their venoms as tools for defense or predation. These venoms are complex mixtures, mainly enriched of proteic toxins or peptides with several, and different, biological activities. In general, spider venom is rich in biologically active molecules that are useful in experimental protocols for pharmacology, biochemistry, cell biology and immunology, as well as putative tools for biotechnology and industries. Spider venoms have recently garnered much attention from several research groups worldwide. Brown spider (Loxosceles genus venom is enriched in low molecular mass proteins (5–40 kDa. Although their venom is produced in minute volumes (a few microliters, and contain only tens of micrograms of protein, the use of techniques based on molecular biology and proteomic analysis has afforded rational projects in the area and permitted the discovery and identification of a great number of novel toxins. The brown spider phospholipase-D family is undoubtedly the most investigated and characterized, although other important toxins, such as low molecular mass insecticidal peptides, metalloproteases and hyaluronidases have also been identified and featured in literature. The molecular pathways of the action of these toxins have been reported and brought new insights in the field of biotechnology. Herein, we shall see how recent reports describing discoveries in the area of brown spider venom have expanded biotechnological uses of molecules identified in these venoms, with special emphasis on the construction of a cDNA library for venom glands, transcriptome analysis, proteomic projects, recombinant expression of different proteic toxins, and finally structural descriptions based on crystallography of toxins.

  15. Nonlinear material behaviour of spider silk yields robust webs.

    Science.gov (United States)

    Cranford, Steven W; Tarakanova, Anna; Pugno, Nicola M; Buehler, Markus J

    2012-02-01

    Natural materials are renowned for exquisite designs that optimize function, as illustrated by the elasticity of blood vessels, the toughness of bone and the protection offered by nacre. Particularly intriguing are spider silks, with studies having explored properties ranging from their protein sequence to the geometry of a web. This material system, highly adapted to meet a spider's many needs, has superior mechanical properties. In spite of much research into the molecular design underpinning the outstanding performance of silk fibres, and into the mechanical characteristics of web-like structures, it remains unknown how the mechanical characteristics of spider silk contribute to the integrity and performance of a spider web. Here we report web deformation experiments and simulations that identify the nonlinear response of silk threads to stress--involving softening at a yield point and substantial stiffening at large strain until failure--as being crucial to localize load-induced deformation and resulting in mechanically robust spider webs. Control simulations confirmed that a nonlinear stress response results in superior resistance to structural defects in the web compared to linear elastic or elastic-plastic (softening) material behaviour. We also show that under distributed loads, such as those exerted by wind, the stiff behaviour of silk under small deformation, before the yield point, is essential in maintaining the web's structural integrity. The superior performance of silk in webs is therefore not due merely to its exceptional ultimate strength and strain, but arises from the nonlinear response of silk threads to strain and their geometrical arrangement in a web.

  16. Global patterns of guild composition and functional diversity of spiders.

    Directory of Open Access Journals (Sweden)

    Pedro Cardoso

    Full Text Available The objectives of this work are: (1 to define spider guilds for all extant families worldwide; (2 test if guilds defined at family level are good surrogates of species guilds; (3 compare the taxonomic and guild composition of spider assemblages from different parts of the world; (4 compare the taxonomic and functional diversity of spider assemblages and; (5 relate functional diversity with habitat structure. Data on foraging strategy, prey range, vertical stratification and circadian activity was collected for 108 families. Spider guilds were defined by hierarchical clustering. We searched for inconsistencies between family guild placement and the known guild of each species. Richness and abundance per guild before and after correcting guild placement were compared, as were the proportions of each guild and family between all possible pairs of sites. Functional diversity per site was calculated based on hierarchical clustering. Eight guilds were discriminated: (1 sensing, (2 sheet, (3 space, and (4 orb web weavers; (5 specialists; (6 ambush, (7 ground, and (8 other hunters. Sixteen percent of the species richness corresponding to 11% of all captured individuals was incorrectly attributed to a guild by family surrogacy; however, the correlation of uncorrected vs. corrected guilds was invariably high. The correlation of guild richness or abundances was generally higher than the correlation of family richness or abundances. Functional diversity was not always higher in the tropics than in temperate regions. Families may potentially serve as ecological surrogates for species. Different families may present similar roles in the ecosystems, with replacement of some taxa by other within the same guild. Spiders in tropical regions seem to have higher redundancy of functional roles and/or finer resource partitioning than in temperate regions. Although species and family diversity were higher in the tropics, functional diversity seems to be also

  17. Disgust and disgust sensitivity in spider phobia : Facial EMG in response to spider and oral disgust imagery

    NARCIS (Netherlands)

    de Jong, Peter; Peters, Madelon L.; Vanderhallen, [Unknown

    2002-01-01

    Increasing evidence suggests that disgust and fear of contamination is involved in spider phobia. Yet, because the evidence exclusively relies on self-report data it can not be ruled out these findings are produced by mechanisms such as a negative attribution bias, or imprecise emotional labeling. T

  18. Biochemical and pharmacological study of venom of the wolf spider Lycosa singoriensis

    Directory of Open Access Journals (Sweden)

    ZH Liu

    2009-01-01

    Full Text Available The wolf spider Lycosa singoriensis is a large and venomous spider distributed throughout northwestern China. Like other spider venoms, the wolf spider venom is a chemical cocktail. Its protein content is 0.659 mg protein/mg crude venom as determined by the Lowry method. MALDI-TOF analysis revealed that the venom peptides are highly diverse and may be divided into three groups characterized by three independent molecular ranges: 2,000 to 2,500 Da, 4,800 to 5,500 Da and 7,000 to 8,000 Da, respectively. This molecular distribution differs substantially from those of most spider venoms studied so far. This wolf spider venom has low neurotoxic action on mice, but it can induce hemolysis of human erythrocytes. Furthermore, the venom shows antimicrobial activity against prokaryotic and eukaryotic cells.

  19. An insecticidal peptide from the theraposid Brachypelma smithi spider venom reveals common molecular features among spider species from different genera.

    Science.gov (United States)

    Corzo, Gerardo; Diego-García, Elia; Clement, Herlinda; Peigneur, Steve; Odell, George; Tytgat, Jan; Possani, Lourival D; Alagón, Alejandro

    2008-11-01

    The soluble venom of the Mexican theraposid spider Brachypelma smithi was screened for insecticidal peptides based on toxicity to house crickets. An insecticidal peptide, named Bs1 (which stands for Brachypelma smithi toxin 1) was obtained in homogeneous form after the soluble venom was fractionated using reverse-phase and cation-exchange chromatography. It contains 41 amino acids cross-linked by three disulfide bridges. Its sequence is similar to an insecticidal peptide isolated from the theraposid spider Ornithoctonus huwena from China, and another from the hexathelid spider Macrothelegigas from Japan, indicating that they are phylogenetically related. A cDNA library was prepared from the venomous glands of B. smithi and the gene that code for Bs1 was cloned. Sequence analysis of the nucleotides of Bs1 showed similarities to that of the hexathelid spider from Japan proving additional evidence for close genetic relationship between these spider peptides. The mRNAs of these toxins code for signal peptides that are processed at the segment rich in acidic and basic residues. Their C-terminal amino acids are amidated. However, they contain only a glycine residue at the most C-terminal position, without the presence of additional basic amino acid residues, normally required for post-translation processing of other toxins reported in the literature. The possible mechanism of action of Bs1 was investigated using several ion channels as putative receptors. Bs1 had minor, but significant effects on the Para/tipE insect ion channel, which could indirectly correlate with the observed lethal activity to crickets. PMID:18687374

  20. Loss of legs: is it or not a handicap for an orb-weaving spider?

    Science.gov (United States)

    Pasquet, Alain; Anotaux, Mylène; Leborgne, Raymond

    2011-07-01

    Leg loss is a common phenomenon in spiders, and according to the species 5% to 40% of the adults can present at least one missing leg. There is no possibility of regeneration after adult moult and the animal must manage with its missing appendages until its death. With the loss of one or more legs, female orb-weaving spiders can be penalized twice: firstly, because the legs are necessary for web construction and secondly, the legs are essential for the control of the prey after its interception by the web. During development, spiders may be also penalized because regeneration has energetic costs that take away resources for survival, growth and reproduction. All these consequences should influence negatively the development of the spider and thus its fitness. We investigated the impact of leg loss in the orb-weaving spider, Zygiella x-notata by studying its frequency in a natural population and web building and prey capture behaviours in laboratory. In field populations, 9.5% to 13%, of the adult females presented the loss of one or more legs; the majority of individuals had lost only one leg (in 48% of cases, a first one). Leg loss seems to affect all the adult spiders, as there is no difference of mass between intact spiders and those with missing leg. Data obtained with laboratory-reared spiders, showed that the loss of legs due to the moult is rare (less than 1%). Considering changes in web design, spiders with missing legs decreased their silk investment, increased the distance between spiral turns but did not change the capture surface of the web. Under our laboratory experimental conditions, spiders with one or two lost legs did not present any difference in prey capture efficiency. In laboratory conditions, spiders with lost leg(s) did not show any difference in egg sac production or in longevity (adult lifespan) compared to intact spiders.

  1. fMRI neurofeedback facilitates anxiety regulation in females with spider phobia

    OpenAIRE

    Anna eZilverstand; Bettina eSorger; Pegah eSarkheil; Rainer eGoebel

    2015-01-01

    Background: Spider phobics show an exaggerated fear response when encountering spiders. This fear response is aggravated by negative and irrational beliefs about the feared object. Cognitive reappraisal can target these beliefs, and therefore has a fear regulating effect. The presented study investigated if neurofeedback derived from functional magnetic resonance imaging (fMRI) would facilitate anxiety regulation by cognitive reappraisal, using spider phobia as a model of anxiety disorders. F...

  2. High school students' attitudes towards spiders: a cross-cultural comparison

    OpenAIRE

    Prokop, Pavol; Tolarovičová, Andrea; Camerik, Anne M; Peterková, Viera

    2010-01-01

    Abstract Spiders are traditionally considered to be among the least popular of animals. Current evidence suggests that a negative attitude towards spiders could be influenced by both cultural and evolutionary pressures. Some researchers suggest that science education activities could positively influence students? perceptions of spiders. Their evidence is, however, ambivalent. Using a five-point score Likert-type questionnaire in which the items were developed in a similar way to f...

  3. A spider that feeds indirectly on vertebrate blood by choosing female mosquitoes as prey

    OpenAIRE

    Robert R. Jackson; Nelson, Ximena J.; Sune, Godfrey O.

    2005-01-01

    Spiders do not feed directly on vertebrate blood, but a small East African jumping spider (Salticidae), Evarcha culicivora, feeds indirectly on vertebrate blood by choosing as preferred prey female mosquitoes that have had recent blood meals. Experiments show that this spider can identify its preferred prey by sight alone and by odor alone. When presented with two types of size-matched motionless lures, E. culicivora consistently chose blood-fed female mosquitoes in preference to nonmosquito ...

  4. Prediction of abundance of forest spiders according to climate warming in South Korea

    OpenAIRE

    Tae-Sung Kwon; Cheol Min Lee; Tae Woo Kim; Sung-Soo Kim; Joo Han Sung

    2014-01-01

    Distribution of spiders will be changed as climate warms. Abundance of spider species was predicted nationwide in South Korea. Abundance of spiders was projected using temperature species distribution model based on a nationwide data (366 forest sites) according to climate change scenario RCP 4.5 and 8.5. The model predicts that 9 out of 17 species will increase in abundance while 8 species will decrease. Based on this finding, a qualitative prediction (increase or decrease) was conducted on ...

  5. Spiders do not evoke greater early posterior negativity in the event-related potential as snakes.

    Science.gov (United States)

    He, Hongshen; Kubo, Kenta; Kawai, Nobuyuki

    2014-09-10

    It has been long believed that both snakes and spiders are archetypal fear stimuli for humans. Furthermore, snakes have been assumed as stronger threat cues for nonhuman primates. However, it is still unclear whether spiders hold a special status in human perception. The current study explored to what extent spider pictures draw early visual attention [as assessed with early posterior negativity (EPN)] when compared with insects similar to spiders. To measure the EPN, participants watched a random rapid serial presentation of pictures, which consisted of two conditions: spider condition (spider, wasp, bumblebee, beetle) and snake condition (snake, bird). EPN amplitudes revealed no significant difference between spider, wasp, bumblebee, and beetle pictures, whereas EPN amplitudes were significantly larger for snake pictures relative to bird pictures. In addition, EPN amplitudes were significantly larger for snake pictures relative to spider pictures. These results suggest that the early visual attentional capture of animate objects is stronger for snakes, whereas spiders do not appear to hold special early attentional value.

  6. A comparison of spider communities in Bt and non-Bt rice fields.

    Science.gov (United States)

    Lee, Sue Yeon; Kim, Seung Tae; Jung, Jong Kook; Lee, Joon-Ho

    2014-06-01

    To assess the potential adverse effects of a Bt rice line (Japonica rice cultivar, Nakdong) expressing a synthetic cry1Ac1 gene, C7-1-9-1-B, which was highly active against all larval stages of Cnaphalocrocis medinalis (Guenée) (Lepidoptera: Crambidae), we investigated the community structure of spiders in Bt and non-Bt rice fields during the rice-growing season in 2007 and 2008 in Chungcheongnam-do, Korea. Spiders were surveyed with a sweep net and suction device. Suction sampling captured more spiders, measured in terms of species level and abundance, than sweeping. Araneidae and Thomisidae were captured more by sweeping, and certain species were captured only by sweeping. These findings show that both suction and sweep sampling methods should be used because these methods are most likely complementary. In total, 29 species in 23 genera and nine families were identified from the 4,937 spiders collected, and both Bt and non-Bt rice fields showed a typical Korean spider assemblage. The temporal patterns of spider species richness and spider abundance were very similar between Bt and non-Bt rice, although significant differences in species richness were observed on a few occasions. Overall, spider community structure, including diversity, the dominant species, and abundance did not differ between Bt and non-Bt rice. The results of the study indicated that the transgenic Cry1Ac rice lines tested in this study had no adverse effects on the spider community structure of the rice fields.

  7. Polarimetry from the stratosphere with SPIDER and BLASTPol

    Science.gov (United States)

    Shariff, Jamil Aly

    This thesis presents the hardware development and flight performance of two balloon-borne experiments. The SPIDER experiment is a millimetre-wavelength polarimeter designed to measure B-mode polarization in the Cosmic Microwave Background at degree scales. This pattern is the imprint of the primordial gravitational waves predicted to have been produced by inflation. The BLASTPol experiment is a submillimetre-wavelength polarimeter designed to measure the linearly-polarized emission from aligned dust grains in Galactic molecular clouds, inferring the directions of the magnetic fields there. One goal of this measurement is to understand the role of magnetic fields in the earliest stages of star formation. SPIDER had a Long-Duration Balloon flight around Antarctica in January 2015. BLASTPol had two such flights, in December 2010 and 2012. Analysis of SPIDER data is underway. Results of BLASTPol 2012 data analysis are presented herein. The design and performance of the SPIDER pointing control system is presented. A new pivot motor control mode was developed, in which the servo drive controlled motor velocity, not current. This mode enabled sinusoidal azimuth scans at a peak speed of 5 deg/s, with a peak acceleration of 0.5 deg·s-2, in flight. The pointing stability in flight was 1'' to 2'' RMS. A new elevation drive system was designed and built for SPIDER. The SPIDER observing strategy is presented. It enabled observation of a 10% patch of sky, avoiding the sun and Galactic plane, with uniform coverage in declination, and good cross-linking. A model of the BLASTPol 2012 PSF was developed, allowing centroiding, flat-fielding, and map deconvolution. The latter was attempted in Fourier space, and using the Lucy-Richardson method. A net linear polarization of the dust emission in the Carina Nebula was measured by BLASTPol. The mean fractional polarization is 6.75% +/- 0.015%, 6.84% v 0.016% and 7.06% v 0.019%, at 250, 350, and 500 microm respectively. A falling

  8. Spider-mediated flux of PCBs from contaminated sediments to terrestrial ecosystems and potential risks to arachnivorous birds

    Science.gov (United States)

    We investigated aquatic insect utilization and PCB exposure in riparian spiders at the Lake Hartwell superfund site (Clemson, SC , USA). We sampled sediments, adult chironomids, terrestrial insects, riparian spiders (Tetragnathidae, Araneidae, and Mecynogea lemniscata), and upla...

  9. Biotechnological applications of brown spider (Loxosceles genus) venom toxins.

    Science.gov (United States)

    Senff-Ribeiro, Andrea; Henrique da Silva, Paulo; Chaim, Olga Meiri; Gremski, Luiza Helena; Paludo, Kátia Sabrina; Bertoni da Silveira, Rafael; Gremski, Waldemiro; Mangili, Oldemir Carlos; Veiga, Silvio Sanches

    2008-01-01

    Loxoscelism (the term used to define accidents by the bite of brown spiders) has been reported worldwide. Clinical manifestations following brown spider bites are frequently associated with skin degeneration, a massive inflammatory response at the injured region, intravascular hemolysis, platelet aggregation causing thrombocytopenia and renal disturbances. The mechanisms by which the venom exerts its noxious effects are currently under investigation. The whole venom is a complex mixture of toxins enriched with low molecular mass proteins in the range of 5-40 kDa. Toxins including alkaline phosphatase, hyaluronidase, metalloproteases (astacin-like proteases), low molecular mass (5.6-7.9 kDa) insecticidal peptides and phospholipases-D (dermonecrotic toxins) have been identified in the venom. The purpose of the present review is to describe biotechnological applications of whole venom or some toxins, with especial emphasis upon molecular biology findings obtained in the last years.

  10. Structure to function: Spider silk and human collagen

    Science.gov (United States)

    Rabotyagova, Olena S.

    Nature has the ability to assemble a variety of simple molecules into complex functional structures with diverse properties. Collagens, silks and muscles fibers are some examples of fibrous proteins with self-assembling properties. One of the great challenges facing Science is to mimic these designs in Nature to find a way to construct molecules that are capable of organizing into functional supra-structures by self-assembly. In order to do so, a construction kit consisting of molecular building blocks along with a complete understanding on how to form functional materials is required. In this current research, the focus is on spider silk and collagen as fibrous protein-based biopolymers that can shed light on how to generate nanostructures through the complex process of self-assembly. Spider silk in fiber form offers a unique combination of high elasticity, toughness, and mechanical strength, along with biological compatibility and biodegrability. Spider silk is an example of a natural block copolymer, in which hydrophobic and hydrophilic blocks are linked together generating polymers that organize into functional materials with extraordinary properties. Since silks resemble synthetic block copolymer systems, we adopted the principles of block copolymer design from the synthetic polymer literature to build block copolymers based on spider silk sequences. Moreover, we consider spider silk to be an important model with which to study the relationships between structure and properties in our system. Thus, the first part of this work was dedicated to a novel family of spider silk block copolymers, where we generated a new family of functional spider silk-like block copolymers through recombinant DNA technology. To provide fundamental insight into relationships between peptide primary sequence, block composition, and block length and observed morphological and structural features, we used these bioengineered spider silk block copolymers to study secondary structure

  11. Hamiltonian Dynamics of Spider-Type Multirotor Rigid Bodies Systems

    International Nuclear Information System (INIS)

    This paper sets out to develop a spider-type multiple-rotor system which can be used for attitude control of spacecraft. The multirotor system contains a large number of rotor-equipped rays, so it was called a 'Spider-type System', also it can be called 'Rotary Hedgehog'. These systems allow using spinups and captures of conjugate rotors to perform compound attitude motion of spacecraft. The paper describes a new method of spacecraft attitude reorientation and new mathematical model of motion in Hamilton form. Hamiltonian dynamics of the system is investigated with the help of Andoyer-Deprit canonical variables. These variables allow obtaining exact solution for hetero- and homoclinic orbits in phase space of the system motion, which are very important for qualitative analysis.

  12. VIPR III VADR SPIDER Structural Design and Analysis

    Science.gov (United States)

    Li, Wesley; Chen, Tony

    2016-01-01

    In support of the National Aeronautics and Space Administration (NASA) Vehicle Integrated Propulsion Research (VIPR) Phase III team to evaluate the volcanic ash environment effects on the Pratt & Whitney F117-PW-100 turbofan engine, NASA Armstrong Flight Research Center has successfully performed structural design and analysis on the Volcanic Ash Distribution Rig (VADR) and the Structural Particulate Integration Device for Engine Research (SPIDER) for the ash ingestion test. Static and dynamic load analyses were performed to ensure no structural failure would occur during the test. Modal analysis was conducted, and the results were used to develop engine power setting avoidance zones. These engine power setting avoidance zones were defined to minimize the dwell time when the natural frequencies of the VADR/SPIDER system coincided with the excitation frequencies of the engine which was operating at various revolutions per minute. Vortex-induced vibration due to engine suction air flow during the ingestion test was also evaluated, but was not a concern.

  13. A Spider That Lays Its Eggs in Rows

    Directory of Open Access Journals (Sweden)

    Robert L. Edwards

    2000-01-01

    Full Text Available The small (2.5-3.0 mm, colorful metine spider, Homalometa nigritarsis Simon 1897, Family Tetragnathidae, has previously been reported from northern Mexico, Panama and the southern islands of the Lesser Antilles (Levi 1986. In the rain forest of northeastern Puerto Rico it is most frequently found with webbing on the larger outer concave surfaces of pendulous leaves. H. nigritarsis typically makes a circular, relatively flat retreat within which the female deposits two parallel rows of naked eggs. The rows are produced at intervals; as one row hatches another replaces it shortly thereafter. Evidence of up to four generations of rows has been observed. Above the retreat, and closely aligned with it, the spider builds a nearly invisible, delicate orb web, typically from edge to edge of the leaf (Fig. 1a and b. While retaining the traditional orb-web, H. nigritarsis has adopted a unique habitat and set of life history features.

  14. Innate pattern recognition and categorization in a jumping spider.

    Directory of Open Access Journals (Sweden)

    Yinnon Dolev

    Full Text Available The East African jumping spider Evarcha culicivora feeds indirectly on vertebrate blood by preferentially preying upon blood-fed Anopheles mosquitoes, the vectors of human malaria1, using the distinct resting posture and engorged abdomen characteristic of these specific prey as key elements for their recognition. To understand perceptual categorization of objects by these spiders, we investigated their predatory behavior toward different digital stimuli--abstract 'stick figure' representations of Anopheles constructed solely by known key identification elements, disarranged versions of these, as well as non-prey items and detailed images of alternative prey. We hypothesized that the abstract images representing Anopheles would be perceived as potential prey, and would be preferred to those of non-preferred prey. Spiders perceived the abstract stick figures of Anopheles specifically as their preferred prey, attacking them significantly more often than non-preferred prey, even when the comprising elements of the Anopheles stick figures were disarranged and disconnected from each other. However, if the relative angles between the elements of the disconnected stick figures of Anopheles were altered, the otherwise identical set of elements was no longer perceived as prey. These data show that E. culicivora is capable of making discriminations based on abstract concepts, such as the hypothetical angle formed by discontinuous elements. It is this inter-element angle rather than resting posture that is important for correct identification of Anopheles. Our results provide a glimpse of the underlying processes of object recognition in animals with minute brains, and suggest that these spiders use a local processing approach for object recognition, rather than a holistic or global approach. This study provides an excellent basis for a comparative analysis on feature extraction and detection by animals as diverse as bees and mammals.

  15. Spiders (Araneae) as polyphagous natural enemies in orchards

    OpenAIRE

    Bogya, S.

    1999-01-01

    Spiders (Araneae) occur in high abundance in all terrestrial ecosystems including agro-ecosystems. They are a very heterogeneous group of animals with different hunting tactics and therefore they play very different ecological roles. At family level these tactics are rather similar thus properties and behaviour found in different species of one family can be seen as characteristic for the whole family. Especially in orchards little is known about their role and probably it is undervalued. The...

  16. Evidence for competition between carnivorous plants and spiders

    OpenAIRE

    Jennings, David E.; Krupa, James J.; Raffel, Thomas R.; Rohr, Jason R.

    2010-01-01

    Several studies have demonstrated that competition between disparate taxa can be important in determining community structure, yet surprisingly, to our knowledge, no quantitative studies have been conducted on competition between carnivorous plants and animals. To examine potential competition between these taxa, we studied dietary and microhabitat overlap between pink sundews (Drosera capillaris) and wolf spiders (Lycosidae) in the field, and conducted a laboratory experiment examining the e...

  17. ArachnoServer: a database of protein toxins from spiders

    OpenAIRE

    Kaas Quentin; Raven Robert J; Cai Shuzhi; Miljenović Tomas; Wood David LA; Escoubas Pierre; Herzig Volker; Wilson David; King Glenn F

    2009-01-01

    Abstract Background Venomous animals incapacitate their prey using complex venoms that can contain hundreds of unique protein toxins. The realisation that many of these toxins may have pharmaceutical and insecticidal potential due to their remarkable potency and selectivity against target receptors has led to an explosion in the number of new toxins being discovered and characterised. From an evolutionary perspective, spiders are the most successful venomous animals and they maintain by far t...

  18. Climate change and sexual size dimorphism in an Arctic spider

    OpenAIRE

    Høye, Toke Thomas; Hammel, Jörg U; Fuchs, Thomas; Toft, Søren

    2009-01-01

    Climate change is advancing the onset of the growing season and this is happening at a particularly fast rate in the High Arctic. However, in most species the relative fitness implications for males and females remain elusive. Here, we present data on 10 successive cohorts of the wolf spider Pardosa glacialis from Zackenberg in High-Arctic, northeast Greenland. We found marked inter-annual variation in adult body size (carapace width) and this variation was greater in females than in males. E...

  19. Early environmental conditions shape personality types in a jumping spider

    Directory of Open Access Journals (Sweden)

    Jannis eLiedtke

    2015-12-01

    Full Text Available Individuals of many species across the animal kingdom are found to be less plastic than expected, even in behavioral traits. The existence of consistent behavioral differences between individuals, termed personality differences, is puzzling, since plastic behavior is considered ideal to enable animals to adaptively respond to changes in environmental conditions. In order to elucidate which mechanisms are important for the evolution of personality differences, it is crucial to understand which aspects of the environment are important for the development of personality differences. Here, we tested whether physical or social aspects of the environment during development influence individual differentiation (mean level of behavior using the jumping spider Marpissa muscosa. Furthermore, we assessed whether those behaviors were repeatable, i.e. whether personalities existed. We applied a split-brood design and raised spider siblings in three different environments: a deprived environment with no enrichment, a socially and a physically enriched environment. We focused on exploratory behavior and repeatedly assessed individual behavior in a novel environment and a novel object test. Results show that the environment during development influenced spiders’ exploratory tendencies: spiders raised in enriched environments tended to be more exploratory. Most investigated behaviors were repeatable (i.e. personalities existed across all individuals tested, whereas only few behaviors were also repeatable across individuals that had experienced the same environmental condition. Taken together, our results indicate that external stimuli can influence the development of one aspect of personality, the inter-individual variation (mean level of behavior, in a jumping spider. We also found family by environment interactions on behavioral traits potentially suggesting genetic variation in developmental plasticity.

  20. Post-secretion processing influences spider silk performance.

    Science.gov (United States)

    Blamires, Sean J; Wu, Chung-Lin; Blackledge, Todd A; Tso, I-Min

    2012-10-01

    Phenotypic variation facilitates adaptations to novel environments. Silk is an example of a highly variable biomaterial. The two-spidroin (MaSp) model suggests that spider major ampullate (MA) silk is composed of two proteins-MaSp1 predominately contains alanine and glycine and forms strength enhancing β-sheet crystals, while MaSp2 contains proline and forms elastic spirals. Nonetheless, mechanical properties can vary in spider silks without congruent amino acid compositional changes. We predicted that post-secretion processing causes variation in the mechanical performance of wild MA silk independent of protein composition or spinning speed across 10 species of spider. We used supercontraction to remove post-secretion effects and compared the mechanics of silk in this 'ground state' with wild native silks. Native silk mechanics varied less among species compared with 'ground state' silks. Variability in the mechanics of 'ground state' silks was associated with proline composition. However, variability in native silks did not. We attribute interspecific similarities in the mechanical properties of native silks, regardless of amino acid compositions, to glandular processes altering molecular alignment of the proteins prior to extrusion. Such post-secretion processing may enable MA silk to maintain functionality across environments, facilitating its function as a component of an insect-catching web. PMID:22628213

  1. Spider Optimization II: Optical, Magnetic and Foreground Effects

    CERN Document Server

    O'Dea, D T; Amiri, M; Benton, S J; Bock, J J; Bond, J R; Bonetti, J A; Bryan, S; Burger, B; Chiang, H C; Clark, C N; Contaldi, C R; Crill, B P; Davis, G; Dore, O; Farhang, M; Filippini, J P; Fissel, L M; Fraisse, A A; Gandilo, N N; Golwala, S; Gudmundsson, J E; Hasselfield, M; Hilton, G; Holmes, W; Hristov, V V; Irwin, K; Jones, W C; Kuo, C L; MacTavish, C J; Mason, P V; Montroy, T E; Morford, T A; Netterfield, C B; Rahlin, A S; Reintsema, C; Ruhl, J E; Runyan, M C; Schenker, M A; Shariff, J A; Soler, J D; Trangsrud, A; Tucker, C; Tucker, R S; Turner, A D; Wiebe, D

    2011-01-01

    Spider is a balloon-borne instrument designed to map the polarization of the cosmic microwave background (CMB) with degree-scale resolution over a large fraction of the sky. Spider's main goal is to measure the amplitude of primordial gravitational waves through their imprint on the polarization of the CMB if the tensor-to-scalar ratio, r, is greater than 0.03. To achieve this goal, instrumental systematic errors must be controlled with unprecedented accuracy. Here, we build on previous work to use simulations of Spider observations to examine the impact of several systematic effects that have been characterized through testing and modeling of various instrument components. In particular, we investigate the impact of the non-ideal spectral response of the half-wave plates, coupling between focal plane components and the Earth's magnetic field, and beam mismatches and asymmetries. We also present a model of diffuse polarized foreground emission based on a three-dimensional model of the Galactic magnetic field ...

  2. Pointing control for the SPIDER balloon-borne telescope

    CERN Document Server

    Shariff, Jamil A; Amiri, Mandana; Benton, Steven J; Bock, Jamie J; Bond, J Richard; Bryan, Sean A; Chiang, H Cynthia; Contaldi, Carlo R; Crill, Brendan P; Doré, Olivier P; Farhang, Marzieh; Filippini, Jeffrey P; Fissel, Laura M; Fraisse, Aurelien A; Gambrel, Anne E; Gandilo, Natalie N; Golwala, Sunil R; Gudmundsson, Jon E; Halpern, Mark; Hasselfield, Matthew; Hilton, Gene C; Holmes, Warren A; Hristov, Viktor V; Irwin, Kent D; Jones, William C; Kermish, Zigmund D; Kuo, Chao-Lin; MacTavish, Carolyn J; Mason, Peter V; Megerian, Krikor G; Moncelsi, Lorenzo; Morford, Tracy A; Nagy, Johanna M; Netterfield, C Barth; O'Brient, Roger; Rahlin, Alexandra S; Reintsema, Carl D; Ruhl, John E; Runyan, Marcus C; Soler, Juan D; Trangsrud, Amy; Tucker, Carole E; Tucker, Rebecca S; Turner, Anthony D; Weber, Alexis C; Wiebe, Donald V; Young, Edward Y

    2014-01-01

    We present the technology and control methods developed for the pointing system of the SPIDER experiment. SPIDER is a balloon-borne polarimeter designed to detect the imprint of primordial gravitational waves in the polarization of the Cosmic Microwave Background radiation. We describe the two main components of the telescope's azimuth drive: the reaction wheel and the motorized pivot. A 13 kHz PI control loop runs on a digital signal processor, with feedback from fibre optic rate gyroscopes. This system can control azimuthal speed with < 0.02 deg/s RMS error. To control elevation, SPIDER uses stepper-motor-driven linear actuators to rotate the cryostat, which houses the optical instruments, relative to the outer frame. With the velocity in each axis controlled in this way, higher-level control loops on the onboard flight computers can implement the pointing and scanning observation modes required for the experiment. We have accomplished the non-trivial task of scanning a 5000 lb payload sinusoidally in az...

  3. Evidence for antimicrobial activity associated with common house spider silk

    Directory of Open Access Journals (Sweden)

    Wright Simon

    2012-06-01

    Full Text Available Abstract Background Spider silk is one of the most versatile materials in nature with great strength and flexibility. Native and synthetically produced silk has been used in a wide range of applications including the construction of artificial tendons and as substrates for human cell growth. In the literature there are anecdotal reports that suggest that native spider silk may also have antimicrobial properties. Findings In this study we compared the growth of a Gram positive and a Gram negative bacterium in the presence and absence of silk produced by the common house spider Tegenaria domestica. We demonstrate that native web silk of Tegenaria domestica can inhibit the growth of the Gram positive bacterium, Bacillus subtilis. No significant inhibition of growth was detected against the Gram negative bacterium, Escherichia coli. The antimicrobial effect against B. subtilis appears to be short lived thus the active agent potentially acts in a bacteriostatic rather than bactericidal manner. Treatment of the silk with Proteinase K appears to reduce the ability to inhibit bacterial growth. This is consistent with the active agent including a protein element that is denatured or cleaved by treatment. Tegenaria silk does not appear to inhibit the growth of mammalian cells in vitro thus there is the potential for therapeutic applications.

  4. Untangling spider silk evolution with spidroin terminal domains

    Directory of Open Access Journals (Sweden)

    Garb Jessica E

    2010-08-01

    Full Text Available Abstract Background Spidroins are a unique family of large, structural proteins that make up the bulk of spider silk fibers. Due to the highly variable nature of their repetitive sequences, spidroin evolutionary relationships have principally been determined from their non-repetitive carboxy (C-terminal domains, though they offer limited character data. The few known spidroin amino (N-terminal domains have been difficult to obtain, but potentially contain critical phylogenetic information for reconstructing the diversification of spider silks. Here we used silk gland expression data (ESTs from highly divergent species to evaluate the functional significance and phylogenetic utility of spidroin N-terminal domains. Results We report 11 additional spidroin N-termini found by sequencing ~1,900 silk gland cDNAs from nine spider species that shared a common ancestor > 240 million years ago. In contrast to their hyper-variable repetitive regions, spidroin N-terminal domains have retained striking similarities in sequence identity, predicted secondary structure, and hydrophobicity. Through separate and combined phylogenetic analyses of N-terminal domains and their corresponding C-termini, we find that combined analysis produces the most resolved trees and that N-termini contribute more support and less conflict than the C-termini. These analyses show that paralogs largely group by silk gland type, except for the major ampullate spidroins. Moreover, spidroin structural motifs associated with superior tensile strength arose early in the history of this gene family, whereas a motif conferring greater extensibility convergently evolved in two distantly related paralogs. Conclusions A non-repetitive N-terminal domain appears to be a universal attribute of spidroin proteins, likely retained from the origin of spider silk production. Since this time, spidroin N-termini have maintained several features, consistent with this domain playing a key role in silk

  5. Sperm dynamics in spiders (Araneae: ultrastructural analysis of the sperm activation process in the garden spider Argiope bruennichi (Scopoli, 1772.

    Directory of Open Access Journals (Sweden)

    Oliver Vöcking

    Full Text Available Storage of sperm inside the female genital tract is an integral phase of reproduction in many animal species. The sperm storage site constitutes the arena for sperm activation, sperm competition and female sperm choice. Consequently, to understand animal mating systems information on the processes that occur from sperm transfer to fertilization is required. Here, we focus on sperm activation in spiders. Male spiders produce sperm whose cell components are coiled within the sperm cell and that are surrounded by a proteinaceous sheath. These inactive and encapsulated sperm are transferred to the female spermathecae where they are stored for later fertilization. We analyzed the ultrastructural changes of sperm cells during residency time in the female genital system of the orb-web spider Argiope bruennichi. We found three clearly distinguishable sperm conditions: encapsulated sperm (secretion sheath present, decapsulated (secretion sheath absent and uncoiled sperm (cell components uncoiled, presumably activated. After insemination, sperm remain in the encapsulated condition for several days and become decapsulated after variable periods of time. A variable portion of the decapsulated sperm transforms rapidly to the uncoiled condition resulting in a simultaneous occurrence of decapsulated and uncoiled sperm. After oviposition, only decapsulated and uncoiled sperm are left in the spermathecae, strongly suggesting that the activation process is not reversible. Furthermore, we found four different types of secretion in the spermathecae which might play a role in the decapsulation and activation process.

  6. Sperm dynamics in spiders (Araneae): ultrastructural analysis of the sperm activation process in the garden spider Argiope bruennichi (Scopoli, 1772).

    Science.gov (United States)

    Vöcking, Oliver; Uhl, Gabriele; Michalik, Peter

    2013-01-01

    Storage of sperm inside the female genital tract is an integral phase of reproduction in many animal species. The sperm storage site constitutes the arena for sperm activation, sperm competition and female sperm choice. Consequently, to understand animal mating systems information on the processes that occur from sperm transfer to fertilization is required. Here, we focus on sperm activation in spiders. Male spiders produce sperm whose cell components are coiled within the sperm cell and that are surrounded by a proteinaceous sheath. These inactive and encapsulated sperm are transferred to the female spermathecae where they are stored for later fertilization. We analyzed the ultrastructural changes of sperm cells during residency time in the female genital system of the orb-web spider Argiope bruennichi. We found three clearly distinguishable sperm conditions: encapsulated sperm (secretion sheath present), decapsulated (secretion sheath absent) and uncoiled sperm (cell components uncoiled, presumably activated). After insemination, sperm remain in the encapsulated condition for several days and become decapsulated after variable periods of time. A variable portion of the decapsulated sperm transforms rapidly to the uncoiled condition resulting in a simultaneous occurrence of decapsulated and uncoiled sperm. After oviposition, only decapsulated and uncoiled sperm are left in the spermathecae, strongly suggesting that the activation process is not reversible. Furthermore, we found four different types of secretion in the spermathecae which might play a role in the decapsulation and activation process. PMID:24039790

  7. Plant effects on biological control of spider mites in the ornamental crop Gerbera

    NARCIS (Netherlands)

    Krips, O.E.

    2000-01-01

    IntroductionThe spider mite Tetranychus urticae Koch is an important pest in many greenhouse crops. In vegetables it can be successfully controlled with the predatory mite Phytoseiulus persimilis Athias-Henriot, a specialist predator of spider mites (Helle & Sabelis, 1985). However,

  8. Heritability of defence and life-history traits in the two-spotted spider mite

    NARCIS (Netherlands)

    N.S.H. Tien; M.W. Sabelis; M. Egas

    2009-01-01

    Background: Two-spotted spider mites hide against predatory mites in a web of self-produced sticky silk. The proteins invested in this shelter may reduce investment in reproduction. Questions: Do spider mite populations harbor genetic variation for web production, thereby enabling a response to sele

  9. THE ROLE OF EVALUATIVE LEARNING AND DISGUST SENSITIVITY IN THE ETIOLOGY AND TREATMENT OF SPIDER PHOBIA

    NARCIS (Netherlands)

    MERCKELBACH, H; DEJONG, PJ; ARNTZ, A; SCHOUTEN, E

    1993-01-01

    The role of disgust and contamination sensitivity in the development and treatment of spider phobia was examined. It was predicted that spider phobics high in disgust and contamination sensitivity have been more susceptible to evaluative conditioning processes and, as a result, less often report tra

  10. Utility Assessment Report for SPIDERS Phase 2: Ft. Carson (Rev 1.0)

    Energy Technology Data Exchange (ETDEWEB)

    Barr, Jonathan L.; Tuffner, Francis K.; Hadley, Mark D.; Schneider, Kevin P.

    2014-01-01

    This document contains the Utility Assessment Report (UAR) for the Phase 2 operational Demonstration (OD) of the Smart Power Infrastructure Demonstration for Energy Reliability and Security (SPIDERS) Joint Capability Technology Demonstration (JCTD). The UAR for Phase 2 shows that the SPIDERS system was able to meet the requirements of the Implementation Directive at Ft. Carson.

  11. Neural correlation of successful cognitive behaviour therapy for spider phobia: a magnetoencephalography study.

    Science.gov (United States)

    Wright, Barry; Alderson-Day, Ben; Prendergast, Garreth; Kennedy, Juliette; Bennett, Sophie; Docherty, Mary; Whitton, Clare; Manea, Laura; Gouws, Andre; Tomlinson, Heather; Green, Gary

    2013-12-30

    Cognitive behavioural therapy (CBT) can be an effective treatment for spider phobia, but the underlying neural correlates of therapeutic change are yet to be specified. The present study used magnetoencephalography (MEG) to study responses within the first half second, to phobogenic stimuli in a group of individuals with spider phobia prior to treatment (n=12) and then in nine of them following successful CBT (where they could touch and manage live large common house spiders) at least 9 months later. We also compared responses to a group of age-matched healthy control participants (n=11). Participants viewed static photographs of real spiders, other fear-inducing images (e.g. snakes, sharks) and neutral stimuli (e.g. kittens). Beamforming methods were used to localise sources of significant power changes in response to stimuli. Prior to treatment, participants with spider phobia showed a significant maximum response in the right frontal pole when viewing images of real spiders specifically. No significant frontal response was observed for either control participants or participants with spider phobia post-treatment. In addition, participants' subjective ratings of spider stimuli significantly predicted peak responses in right frontal regions. The implications for understanding brain-based effects of cognitive therapies are discussed.

  12. Transcriptome analysis of venom glands from a single fishing spider Dolomedes mizhoanus.

    Science.gov (United States)

    Jiang, Liping; Liu, Changjun; Duan, Zhigui; Deng, Meichun; Tang, Xing; Liang, Songping

    2013-10-01

    The spider venom is a large pharmacological repertoire composed of different types of bioactive peptide toxins. Despite the importance of spider toxins in capturing terrestrial prey and defending themselves against predators, we know little about the venom components from the spider acting on the fish. Here we constructed a cDNA library of a pair of venomous glands from a single fish-hunting spider Dolomedes mizhoanus. A total of 356 high-quality expressed sequence tags (ESTs) were obtained from the venom gland cDNA library and analyzed. These transcripts were further classified into 45 clusters (19 contigs and 26 singletons), most of which encoded cystine knot toxins (CKTs) and non-CKTs. The ESTs coding for 53 novel CKT precursors were abundant transcripts in the venom glands of the spider D. mizhoanus, accounting for 76% of the total ESTs, the precursors of which were grouped into six families based on the sequence identity and the phylogenetic analysis. In addition, the non-CKTs deduced from 21% of the total ESTs were annotated by Gene Ontology terms and eukaryotic orthologous groups. Fifty-five CKT precursors deduced from 273 ESTs are the largest dataset for a single spider specimen to date. The results may contribute to discovering novel potential drug leads from spider venoms and a better understanding of the evolutionary relationship of the spider toxin.

  13. Differences among plant species in acceptance by the spider mite Tetranychus urticae Koch

    NARCIS (Netherlands)

    Boom, van den C.E.M.; Beek, van T.A.; Dicke, M.

    2003-01-01

    The spider mite Tetranychus urticae Koch has a broad range of host plants. However, the spider mite does not accept all plants to the same degree because of differences in nutritive and toxic constituents. Other factors, such as the induction of secondary metabolites, the morphology of a leaf surfac

  14. Spectral response of spider mite infested cotton: Mite density and miticide rate study

    Science.gov (United States)

    Two-spotted spider mites are important pests in many agricultural systems. Spider mites (Acari: Tetranychidae) have been found to cause economic damage in corn, cotton, and sorghum. Adult glass vial bioassays indicate that Temprano™ (abamectin) is the most toxic technical miticide for adult two-spot...

  15. Unidirectional and transitive predatory relationships of spider species in one-on-one encounters (Arachnida; Araneae)

    NARCIS (Netherlands)

    T.M. Brunt; B.A. Heuts

    2008-01-01

    Inter-specific predation (‘inter-specific araneophagy’) among spiders is very common in the field. We investigated the transitivity (defined hereafter) of inter-specific predatory dominance relationships among 60 spider species belonging to 16 families in the laboratory in one-on-one encounters betw

  16. A New Spin on Miscue Analysis: Using Spider Charts to Web Reading Processes

    Science.gov (United States)

    Wohlwend, Karen E.

    2012-01-01

    This article introduces a way of seeing miscue analysis data through a "spider chart", a readily available digital graphing tool that provides an effective way to visually represent readers' complex coordination of interrelated cueing systems. A spider chart is a standard feature in recent spreadsheet software that puts a new spin on miscue…

  17. fMRI neurofeedback facilitates anxiety regulation in females with spider phobia

    NARCIS (Netherlands)

    Zilverstand, Anna; Sorger, Bettina; Sarkheil, Pegah; Goebel, R.

    2015-01-01

    BACKGROUND: Spider phobics show an exaggerated fear response when encountering spiders. This fear response is aggravated by negative and irrational beliefs about the feared object. Cognitive reappraisal can target these beliefs, and therefore has a fear regulating effect. The presented study investi

  18. Biased interpretation and memory in children with varying levels of spider fear

    NARCIS (Netherlands)

    A.M. Klein; G. Titulaer; C. Simons; E. Allart; E. de Gier; S.M. Bögels; E.S. Becker; M. Rinck

    2014-01-01

    This study investigated multiple cognitive biases in children simultaneously, to investigate whether spider-fearful children display an interpretation bias, a recall bias, and source monitoring errors, and whether these biases are specific for spider-related materials. Furthermore, the independent a

  19. Species status and conservation issues of New Zealand's endemic Latrodectus spider species (Araneae: Theridiidae)

    DEFF Research Database (Denmark)

    Vink, Cor J; Sirvid, Phillip J; Malumbres-Olarte, Jagoba;

    2008-01-01

    New Zealand has two endemic widow spiders, Latrodectus katipo Powell, 1871 and L. atritus Urquhart, 1890. Both species face many conservation threats and are actively managed. The species status of the Latrodectus spiders of New Zealand was assessed using molecular (COI, ITS1, ITS2...

  20. Postharvest fumigation of California table grapes with ozone to control Western black widow spider (Araneae: Theridiidae)

    Science.gov (United States)

    Ozone fumigations were evaluated for postharvest control of Western black widow spider (BWS), Latrodectus hesperus (Chamberlin and Ivie), in fresh table grapes destined for export from California USA. Mature adult female black widow spiders were contained in separate gas-permeable cages within a flo...

  1. High School Students' Attitudes Towards Spiders: A cross-cultural comparison

    Science.gov (United States)

    Prokop, Pavol; Tolarovičová, Andrea; Camerik, Anne M.; Peterková, Viera

    2010-08-01

    Spiders are traditionally considered to be among the least popular of animals. Current evidence suggests that a negative attitude towards spiders could be influenced by both cultural and evolutionary pressures. Some researchers suggest that science education activities could positively influence students' perceptions of spiders. Their evidence is, however, ambivalent. Using a five-point score Likert-type questionnaire in which the items were developed in a similar way to four of Kellert's categories of attitude (scientistic, negativistic, naturalistic, and ecologistic) towards invertebrates, we compared the level of knowledge of and attitudes towards spiders of high school students from two countries, Slovakia (n = 354) and South Africa (n = 382). The students represented different cultures and followed dissimilar science education curricula. Only among the Slovakian students there was a statistically significant but low correlation between knowledge and attitude (r = 0.30). The South African students scored higher in the categories of scientistic, naturalistic, and ecologistic attitudes. Comparison of attitude towards spiders of indigenous Africans from coeducational Catholic schools revealed that South African students have greater fear of spiders than Slovakian students, supporting the biological preparedness hypothesis. This hypothesis predicts a greater fear of spiders in South Africa than in Europe since several South African spiders possess venoms that are dangerous to humans. The results of this study are discussed from science education, cultural, and evolutionary perspectives.

  2. Counterconditioning in the treatment of spider phobia : effects on disgust, fear and valence

    NARCIS (Netherlands)

    de Jong, Peter; Vorage, [Unknown; van den Hout, MA

    2000-01-01

    From the perspective that disgust is a core feature of spider phobia, we investigated whether the treatment efficacy could be improved by adding a counterconditioning procedure. Women with a clinically diagnosed spider phobia (N = 34) were randomly assigned to the regular one-session exposure condit

  3. Species richness and composition assessment of spiders in a Mediterranean scrubland

    DEFF Research Database (Denmark)

    Bondoso Cardoso, Pedro Miguel; Henriques, Sérgio S.; Gaspar, Clara;

    2009-01-01

    Intensive fieldwork has been undertaken in Portugal in order to develop a standardized and optimized sampling protocol for Mediterranean spiders. The present study had the objectives of testing the use of semi-quantitative sampling for obtaining an exhaustive species richness assessment of spider...

  4. Factors that influence the beta-diversity of spider communities in northwestern Argentinean Grasslands.

    Science.gov (United States)

    Rodriguez-Artigas, Sandra M; Ballester, Rodrigo; Corronca, Jose A

    2016-01-01

    Beta-diversity, defined as spatial replacement in species composition, is crucial to the understanding of how local communities assemble. These changes can be driven by environmental or geographic factors (such as geographic distance), or a combination of the two. Spiders have been shown to be good indicators of environmental quality. Accordingly, spiders are used in this work as model taxa to establish whether there is a decrease in community similarity that corresponds to geographic distance in the grasslands of the Campos & Malezales ecoregion (Corrientes). Furthermore, the influence of climactic factors and local vegetation heterogeneity (environmental factors) on assemblage composition was evaluated. Finally, this study evaluated whether the differential dispersal capacity of spider families is a factor that influences their community structure at a regional scale. Spiders were collected with a G-Vac from vegetation in six grassland sites in the Campos & Malezales ecoregion that were separated by a minimum of 13 km. With this data, the impact of alpha-diversity and different environmental variables on the beta-diversity of spider communities was analysed. Likewise, the importance of species replacement and nesting on beta-diversity and their contribution to the regional diversity of spider families with different dispersion capacities was evaluated. The regional and site-specific inventories obtained were complete. The similarity between spider communities declined as the geographic distance between sites increased. Environmental variables also influenced community composition; stochastic events and abiotic forces were the principal intervening factors in assembly structure. The differential dispersal capacity of spider groups also influenced community structure at a regional scale. The regional beta-diversity, as well as species replacement, was greater in high and intermediate vagility spiders; while nesting was greater in spiders with low dispersion

  5. Factors that influence the beta-diversity of spider communities in northwestern Argentinean Grasslands.

    Science.gov (United States)

    Rodriguez-Artigas, Sandra M; Ballester, Rodrigo; Corronca, Jose A

    2016-01-01

    Beta-diversity, defined as spatial replacement in species composition, is crucial to the understanding of how local communities assemble. These changes can be driven by environmental or geographic factors (such as geographic distance), or a combination of the two. Spiders have been shown to be good indicators of environmental quality. Accordingly, spiders are used in this work as model taxa to establish whether there is a decrease in community similarity that corresponds to geographic distance in the grasslands of the Campos & Malezales ecoregion (Corrientes). Furthermore, the influence of climactic factors and local vegetation heterogeneity (environmental factors) on assemblage composition was evaluated. Finally, this study evaluated whether the differential dispersal capacity of spider families is a factor that influences their community structure at a regional scale. Spiders were collected with a G-Vac from vegetation in six grassland sites in the Campos & Malezales ecoregion that were separated by a minimum of 13 km. With this data, the impact of alpha-diversity and different environmental variables on the beta-diversity of spider communities was analysed. Likewise, the importance of species replacement and nesting on beta-diversity and their contribution to the regional diversity of spider families with different dispersion capacities was evaluated. The regional and site-specific inventories obtained were complete. The similarity between spider communities declined as the geographic distance between sites increased. Environmental variables also influenced community composition; stochastic events and abiotic forces were the principal intervening factors in assembly structure. The differential dispersal capacity of spider groups also influenced community structure at a regional scale. The regional beta-diversity, as well as species replacement, was greater in high and intermediate vagility spiders; while nesting was greater in spiders with low dispersion

  6. Factors that influence the beta-diversity of spider communities in northwestern Argentinean Grasslands

    Science.gov (United States)

    Rodriguez-Artigas, Sandra M.; Ballester, Rodrigo

    2016-01-01

    Beta-diversity, defined as spatial replacement in species composition, is crucial to the understanding of how local communities assemble. These changes can be driven by environmental or geographic factors (such as geographic distance), or a combination of the two. Spiders have been shown to be good indicators of environmental quality. Accordingly, spiders are used in this work as model taxa to establish whether there is a decrease in community similarity that corresponds to geographic distance in the grasslands of the Campos & Malezales ecoregion (Corrientes). Furthermore, the influence of climactic factors and local vegetation heterogeneity (environmental factors) on assemblage composition was evaluated. Finally, this study evaluated whether the differential dispersal capacity of spider families is a factor that influences their community structure at a regional scale. Spiders were collected with a G-Vac from vegetation in six grassland sites in the Campos & Malezales ecoregion that were separated by a minimum of 13 km. With this data, the impact of alpha-diversity and different environmental variables on the beta-diversity of spider communities was analysed. Likewise, the importance of species replacement and nesting on beta-diversity and their contribution to the regional diversity of spider families with different dispersion capacities was evaluated. The regional and site-specific inventories obtained were complete. The similarity between spider communities declined as the geographic distance between sites increased. Environmental variables also influenced community composition; stochastic events and abiotic forces were the principal intervening factors in assembly structure. The differential dispersal capacity of spider groups also influenced community structure at a regional scale. The regional beta-diversity, as well as species replacement, was greater in high and intermediate vagility spiders; while nesting was greater in spiders with low dispersion

  7. The path to the nest of spiders The path to the nest of spiders

    Directory of Open Access Journals (Sweden)

    Eliane Luz Bayer

    2008-04-01

    Full Text Available Italo Calvino writes in his preface to The Path to the Nest of Spiders that the novel answers to the "ripeness of the time" since ht wrote it after wartime, a period when everyone had a tale to tell. He tells us that this is a story in which iobody is a hero and nobody has the class consciousness necessary to unify them in the struggle. Calvino acknowledges that it was difficult to conciliate his experiences with the postwar literary movement which he calls Neo-expresSionism, a term which, he thinks, describes better Italian Neo-realism. This is a book with a full realistic depictior of the incongruousness of the whole situation, showing rumen beings driven by loneliness, aggressiveness, unfulfilment and failure to meet, their nerves frayed by the War. It reveals human beings in their weaknesses, subjected to deterministic fates changing roles according to circumstance. Partisans shift to the Nazi side and inform on their f rmer allies and vice-versa, being later chased in revenge. The novel has as its setting Italy under Fascism and unde German occupation, the Italian people being divided betw en the fascists of the "Black Brigade" and the "Partisa4s" who belonged to the Resistance. Although this is a pOlitical book, it has universal appeal. At the same time that it livens up historical facts about the period, it moves our feelings. Calvino's book is about World War II as it is viewed and felt by a small outcast, Pin, who makes considerable efforts to be accepted and understood by adults. In his daily life Pinsuffers the consequences Of the war. His aggressive disposition reflects the environment which he has been brought up in: since he was born, his country has been at war. Besides that, his only sister is a whore, whom he hates and despises. Italo Calvino writes in his preface to The Path to the Nest of Spiders that the novel answers to the "ripeness of the time" since ht wrote it after wartime, a period when everyone had a tale to tell

  8. The time course of location-avoidance learning in fear of spiders.

    Science.gov (United States)

    Rinck, Mike; Koene, Marieke; Telli, Sibel; Moerman-van den Brink, Wiltine; Verhoeven, Barbara; Becker, Eni S

    2016-01-01

    Two experiments were designed to study the time course of avoidance learning in spider fearfuls (SFs) under controlled experimental conditions. To achieve this, we employed an immersive virtual environment (IVE): While walking freely through a virtual art museum to search for specific paintings, the participants were exposed to virtual spiders. Unbeknown to the participants, only two of four museum rooms contained spiders, allowing for avoidance learning. Indeed, the more SF the participants were, the faster they learned to avoid the rooms that contained spiders (Experiment. 1), and within the first six trials, high fearfuls already developed a preference for starting their search task in rooms without spiders (Experiment 2). These results illustrate the time course of avoidance learning in SFs, and they speak to the usefulness of IVEs in fundamental anxiety research. PMID:25707541

  9. Microstructure of the water spider (Argyroneta aquatica using the scanning electron microscope

    Directory of Open Access Journals (Sweden)

    Jung-Hoon Kang

    2014-12-01

    Full Text Available This study is aimed to identify the external features of the water spiders (Argyroneta aquatica collected from “The Natural Monument No. 412 Yeoncheon Eundaeri Water Spider Habitat” through observation of their microstructures using a scanning electron microscope. There is no study on the microstructures of the water spiders excluding several studies on protection plans and ecological investigations, thus giving this study considerable academic significance. Based on the scanning electron microscopy analysis, the water spider has eight simple eyes, and both of its lateral simple eyes are stuck together. A lateral bump was confirmed on the upper jaw, and the pedipalps had six joints and the legs had seven joints. The abdomen and sternum of A. aquatica have more hairs compared with those of land spiders, and its structure shows an elongated area of contact with the air bell so that the air bell can become attached to the abdomen better.

  10. Spider genomes provide insight into composition and evolution of venom and silk.

    Science.gov (United States)

    Sanggaard, Kristian W; Bechsgaard, Jesper S; Fang, Xiaodong; Duan, Jinjie; Dyrlund, Thomas F; Gupta, Vikas; Jiang, Xuanting; Cheng, Ling; Fan, Dingding; Feng, Yue; Han, Lijuan; Huang, Zhiyong; Wu, Zongze; Liao, Li; Settepani, Virginia; Thøgersen, Ida B; Vanthournout, Bram; Wang, Tobias; Zhu, Yabing; Funch, Peter; Enghild, Jan J; Schauser, Leif; Andersen, Stig U; Villesen, Palle; Schierup, Mikkel H; Bilde, Trine; Wang, Jun

    2014-05-06

    Spiders are ecologically important predators with complex venom and extraordinarily tough silk that enables capture of large prey. Here we present the assembled genome of the social velvet spider and a draft assembly of the tarantula genome that represent two major taxonomic groups of spiders. The spider genomes are large with short exons and long introns, reminiscent of mammalian genomes. Phylogenetic analyses place spiders and ticks as sister groups supporting polyphyly of the Acari. Complex sets of venom and silk genes/proteins are identified. We find that venom genes evolved by sequential duplication, and that the toxic effect of venom is most likely activated by proteases present in the venom. The set of silk genes reveals a highly dynamic gene evolution, new types of silk genes and proteins, and a novel use of aciniform silk. These insights create new opportunities for pharmacological applications of venom and biomaterial applications of silk.

  11. Association of spiders and lichen on Robben Island, South Africa: a case report

    Directory of Open Access Journals (Sweden)

    A. Mukherjee

    2010-04-01

    Full Text Available The present study is a firstrecord of spider occurrence on Robben Island, South Africa. Some habitats were rich in lichens. As we know, lichens enhance wildlife habitat in less direct ways. The objective of the study was to examine the potential importance of lichens in enriching spider diversity and abundance. A total of 260 spiders (170 from lichens and 90 from bush were collected following the visual search method over one year. Seasonal trends in overall species richness and abundance indicated that the relative density of spiders was greater in lichens than in bushes. The result suggests that habitat structure, such as branch size and epiphytic lichen abundance, can be an explanation for the greater number of spiders in lichen-rich patches of the island.

  12. Species composition and relative seasonal abundance of spiders from the field and tree layers of the Roodeplaat Dam Nature Reserve

    Directory of Open Access Journals (Sweden)

    Anna S. Dippenaar-Schoeman

    1989-10-01

    Full Text Available A survey of spiders was carried out at the Roodeplaat Dam Nature Reserve near Pretoria. Over a 4-year period 10 270 spiders were collected from grasses, herbs and trees. A total of 82 genera of spiders representing 27 families were recorded. Of all the spiders caught, 29,3 percent belonged to the Tetrag-nathidae, 22,7 percent to the Araneidae and 21,4 percent to the Salticidae. The proportion of spiders in each of the remaining 24 families did not exceed 6 percent of the total catch. The species composition and seasonal abundance are discussed.

  13. Structural color and its interaction with other color-producing elements: perspectives from spiders

    Science.gov (United States)

    Hsiung, Bor-Kai; Blackledge, Todd A.; Shawkey, Matthew D.

    2014-09-01

    Structural color is produced when nanostructures called schemochromes alter light reflected from a surface through different optic principles, in contrast with other types of colors that are produced when pigments selectively absorb certain wavelengths of light. Research on biogenic photonic nanostructures has focused primarily on bird feathers, butterfly wings and beetle elytra, ignoring other diverse groups such as spiders. We argue that spiders are a good model system to study the functions and evolution of colors in nature for the following reasons. First, these colors clearly function in spiders such as the tarantulas outside of sexual selection, which is likely the dominant driver of the evolution of structural colors in birds and butterflies. Second, within more than 44,000 currently known spider species, colors are used in every possible way based on the same sets of relatively simple materials. Using spiders, we can study how colors evolve to serve different functions under a variety of combinations of driving forces, and how those colors are produced within a relatively simple system. Here, we first review the different color-producing materials and mechanisms (i.e., light absorbing, reflecting and emitting) in birds, butterflies and beetles, the interactions between these different elements, and the functions of colors in different organisms. We then summarize the current state of knowledge of spider colors and compare it with that of birds and insects. We then raise questions including: 1. Could spiders use fluorescence as a mechanism to protect themselves from UV radiation, if they do not have the biosynthetic pathways to produce melanins? 2. What functions could color serve for nearly blind tarantulas? 3. Why are only multilayer nanostructures (thus far) found in spiders, while birds and butterflies use many diverse nanostructures? And, does this limit the diversity of structural colors found in spiders? Answering any of these questions in the future

  14. Adaptation of the spiders to the environment: the case of some Chilean species

    Directory of Open Access Journals (Sweden)

    Mauricio eCanals

    2015-08-01

    Full Text Available Spiders are small arthropods that have colonized terrestrial environments. These impose three main problems: i terrestrial habitats have large fluctuations in temperature and humidity; ii the internal concentration of water is higher than the external environment in spiders, which exposes them continually to water loss; and iii their small body size determines a large surface / volume ratio, affecting energy exchange and influencing the life strategy. In this review we focus on body design, energetic, thermal selection, and water balance characteristics of some spider species present in Chile and correlate our results with ecological and behavioral information. Preferred temperatures and critical temperatures of Chilean spiders vary among species and individuals and may be adjusted by phenotypic plasticity. For example in the mygalomorph high-altitude spider Paraphysa parvula the preferred temperature is similar to that of the lowland spider Grammostola rosea; but while P. parvula shows phenotypic plasticity, G. rosea does not. The araneomorph spiders Loxosceles laeta and Scytodes globula have greater daily variations in preferred temperatures at twilight and during the night, which are set to the nocturnal activity rhythms of these species. They also present acclimation of the minimum critical temperatures. Dysdera crocata has a low preferred temperature adjusted to its favorite prey, the woodlouse. Spider metabolic rate is low compared to other arthropods, which may be associated with its sit and wait predatory strategy particularly in primitive hunter and weavers. In mygalomorph spiders the respiratory system is highly optimized with high oxygen conductance, for example G. rosea needs only a difference of 0.12 to 0.16 kPa in the oxygen partial pressure across the air-hemolymph barrier to satisfy its resting oxygen consumption demands. Water loss is a significant stress for spiders. Paraphysa parvula shows an evaporative water loss ten times

  15. Climatic control of trophic interaction strength: the effect of lizards on spiders.

    Science.gov (United States)

    Spiller, David A; Schoener, Thomas W

    2008-01-01

    We investigated how temporal variation in rainfall influences the impact of lizards on spiders inhabiting small islands in Abaco, Bahamas. Annual censuses of web spiders were conducted on nine lizard islands and on eight no-lizard islands 1994-2003. Repeated-measures ANOVA showed that annual variation in spider density (time) and in the lizard effect on spider density (lizard x time) were both significant. Correlation coefficients between the lizard effect (ln ratio of no-lizard to lizard spider densities) and number of rainfall days were generally negative, and strengthened with length of the time period during which rainfall was measured prior to annual spider censuses. Spider density was also negatively correlated with rainfall days and strengthened with length of the prior time period. Longer time intervals included the hurricane season, suggesting that the strong negative correlations were linked to high rainfall years during which tropical storms impacted the region and reduced spider and lizard densities. Split-plot ANOVA showed that rainfall during the hurricane season had a significant effect on the lizard effect and on spider density. Results in this study are opposite to those found in our previous 10-year study (1981-1990) conducted in the Exuma Cays, a moderately xeric region of the Bahamas, where the relation between rainfall and the lizard effect on spider density was positive. Combined data from the Exuma and Abaco studies produce a unimodal relation between trophic interaction strength and rainfall; we suggest that the negative effect of storms associated with rainfall was paramount in the present study, whereas the positive bottom-up effect of rainfall prevailed in our previous study. We conclude that climatic variability has a major impact on the trophic interaction and suggest that a substantial change in precipitation in either direction may weaken the interaction significantly. PMID:17972107

  16. Resistance status of the carmine spider mite, Tetranychus cinnabarinus and the twospotted spider mite, Tetranychus urticae to selected acaricides on strawberries.

    Science.gov (United States)

    Bi, Jian-Long; Niu, Zi-Mian; Yu, Lu; Toscano, Nick C

    2016-02-01

    The carmine spider mite, Tetranychus cinnabarinus (Boisduval) and the twospotted spider mite, Tetranychus urticae Koch, are serious pests of strawberries and many other horticultural crops. Control of these pests has been heavily dependent upon chemical acaricides. Objectives of this study were to determine the resistance status of these two pest species to commonly used acaricides on strawberries in a year-round intensive horticultural production region. LC90 of abamectin for adult carmine spider mites was 4% whereas that for adult twospotted spider mites was 24% of the top label rate. LC90s of spiromesifen, etoxazole, hexythiazox and bifenazate were 0.5%, 0.5%, 1.4% and 83% of their respective highest label rates for carmine spider mite eggs, 0.7%, 2.7%, 12.1% and 347% of their respective highest label rates for the nymphs. LC90s of spiromesifen, etoxazole, hexythiazox and bifenazate were 4.6%, 11.1%, 310% and 62% of their respective highest label rates for twospotted spider mite eggs, 3%, 13%, 432,214% and 15% of their respective highest label rates for the nymphs. Our results suggest that T. cinnabarinus have developed resistance to bifenazate and that the T. urticae have developed resistance to hexythiazox. These results strongly emphasize the need to develop resistance management strategies in the region.

  17. Biodistribution studies of bee venom and spider toxin using radiotracers

    Directory of Open Access Journals (Sweden)

    C. M. Yonamine

    2005-03-01

    Full Text Available The use of radiotracers allows the understanding of the bioavailability process, biodistribution, and kinetics of any molecule labelled with an isotope, which does not alter the molecule's biological properties. In this work, technetium-99m and iodine-125 were chosen as radiotracers for biodistribution studies in mice using bee (Apis mellifera venom and a toxin (PnTX2-6 from the Brazilian "armed" spider (Phoneutria nigriventer venom. Incorporated radioactivity was measured in the blood, brain, heart, lung, liver, kidney, adrenal gland, spleen, stomach, testicle, intestine, muscle, and thyroid gland. Results provided the blood kinetic parameter, and different organs distribution rates.

  18. Transient Myocarditis and Cardiomyopathy After Scorpion and Spider Envenomation

    Directory of Open Access Journals (Sweden)

    Mustafa Kır

    2011-08-01

    Full Text Available Introduction: Spider and scorpion stings can cause multiple clinical manifestations such as local skin reactions or multiple organ failure that can cause death. Multi-organ involvement is more frequent in children due to their lower body weight. The most important life threatening event after the sting is cardiac and lung involvement. In this case report, two cases who developed myocarditis and cardiomyopathy following scorpion and spider stings were reported.Case Report: Clinical evaluation of a ten-year-old boy with respiratory distress and tachycardia after being bitten by a spider on his right hand revealed high levels of cardiac enzymes [CK-MB: 16.5 ng/ml (N:0.0-7.2 ng/ml, troponin: 3.06 ng/ml (N:0.0-0.3ng/ml], pathological ST elevations in leads V3 and V4, and T wave negativity in leads V5 and V6. In echocardiography, left ventricular dilatation and moderate systolic dysfunction were found. Antivenom [Serum antiscorpionique (labs 50] was given (5 cc antivenom was administered intravenously following a 1:10 dilution with normal saline. With supportive treatment, all pathological findings resolved in a week. The second case was an eight-year-old boy who had been bitten by a scorpion on his foot and taken to the intensive care unit because of respiratory distress and convulsion. Two doses of antivenom were given to the case who had elevated levels of troponin and CK-MB, pathological ST depressions in ECG, and left ventricular dilatation and systolic dysfunction, as revealed by echocardiography. With dobutamin and supportive treatment, the pathological findings normalized in ten days.Conclusion: Myocarditis developing following spider or scorpion bites can threaten life due to left ventricular systolic dysfunction. This consequence has been attributed to increased catecholaminergic activity or direct effect of toxin to myocardial fibres. ECG must be performed, cardiac enzymes must be monitored and echocardiography must be done to evaluate

  19. Systemic lupus erythematosus flare triggered by a spider bite.

    Science.gov (United States)

    Martín Nares, Eduardo; López Iñiguez, Alvaro; Ontiveros Mercado, Heriberto

    2016-01-01

    Systemic lupus erythematosus is a chronic autoimmune disease with a relapsing and remitting course characterized by disease flares. Flares are a major cause of hospitalization, morbidity and mortality in patients with systemic lupus erythematosus. Some triggers for these exacerbations have been identified, including infections, vaccines, pregnancy, environmental factors such as weather, stress and drugs. We report a patient who presented with a lupus flare with predominantly mucocutaneous, serosal and cardiac involvement after being bitten by a spider and we present the possible mechanisms by which the venom elicited such a reaction. To the best of our knowledge, this is the first such case reported in the literature. PMID:26494589

  20. Mechanical behavior of silk during the evolution of orb-web spinning spiders.

    Science.gov (United States)

    Elices, Manuel; Plaza, Gustavo R; Arnedo, Miquel A; Pérez-Rigueiro, José; Torres, Fernando G; Guinea, Gustavo V

    2009-07-13

    The development of an accurate and reproducible approach to measuring the tensile behavior of spider silk has allowed characterizing and comparing the range of mechanical properties exhibited by different spider species with unprecedented detail. The comparison of silks spun by spiders belonging to different phylogenetic groups has revealed that evolution locked in many of the important properties of spider silks very early in the history of orb-web weaving spiders, despite the fact that the silk gland system is relatively isolated in physiological terms from the rest of the organism and should thus mutate quickly. The variations observed between species may be grouped in at least two patterns that are shown not to be related to phylogeny. Beyond the relevance of these results for the evolutionary biology of spiders and silks, the conservation of the basic traits observed in the mechanical behavior of spider silks is likely to set a limit to the range of properties that can be expected from artificial fibers bioinspired in natural silks.

  1. Dynamics of spider glue adhesion: effect of surface energy and contact area

    Science.gov (United States)

    Amarpuri, Gaurav; Chen, Yizhou; Blackledge, Todd; Dhinojwala, Ali

    Spider glue is a unique biological adhesive which is humidity responsive such that the adhesion continues to increase upto 100% relative humidity (RH) for some species. This is unlike synthetic adhesives that significantly drop in adhesion with an increase in humidity. However, most of adhesion data reported in literature have used clean hydrophilic glass substrate, unlike the hydrophobic, and charged insect cuticle surface that adheres to spider glue in nature. Previously, we have reported that the spider glue viscosity changes over five orders of magnitude with humidity. Here, we vary the surface energy and surface charge of the substrate to test the change in Larnioides cornutus spider glue adhesion with humidity. We find that an increase in both surface energy and surface charge density increases the droplet spreading and there exists an optimum droplet contact area where adhesion is maximized. Moreover, spider glue droplets act as reusable adhesive for low energy hydrophobic surface at the optimum humidity. These results explain why certain prey are caught more efficiently by spiders in their habitat. The mechanism by which spider species tune its glue adhesion for local prey capture can inspire new generation smart adhesives.

  2. Comparative growth and development of spiders reared on live and dead prey.

    Directory of Open Access Journals (Sweden)

    Yu Peng

    Full Text Available Scavenging (feeding on dead prey has been demonstrated across a number of spider families, yet the implications of feeding on dead prey for the growth and development of individuals and population is unknown. In this study we compare the growth, development, and predatory activity of two species of spiders that were fed on live and dead prey. Pardosa astrigera (Lycosidae and Hylyphantes graminicola (Lyniphiidae were fed live or dead fruit flies, Drosophila melanogaster. The survival of P. astrigera and H. graminicola was not affected by prey type. The duration of late instars of P. astrigera fed dead prey were longer and mature spiders had less protein content than those fed live prey, whereas there were no differences in the rate of H. graminicola development, but the mass of mature spiders fed dead prey was greater than those fed live prey. Predation rates by P. astrigera did not differ between the two prey types, but H. graminicola had a higher rate of predation on dead than alive prey, presumably because the dead flies were easier to catch and handle. Overall, the growth, development and reproduction of H. graminicola reared with dead flies was better than those reared on live flies, yet for the larger P. astrigera, dead prey may suit smaller instars but mature spiders may be best maintained with live prey. We have clearly demonstrated that dead prey may be suitable for rearing spiders, although the success of the spiders fed such prey appears size- and species specific.

  3. Climatic Variables Do Not Directly Predict Spider Richness and Abundance in Semiarid Caatinga Vegetation, Brazil.

    Science.gov (United States)

    Carvalho, Leonardo S; Sebastian, Nicholas; Araújo, Helder F P; Dias, Sidclay C; Venticinque, Eduardo; Brescovit, Antonio D; Vasconcellos, Alexandre

    2015-02-01

    Spiders are abundant in tropical ecosystems and exert predatory pressure on a wide variety of invertebrate populations and also serve as prey for many others organisms, being part of complex interrelationships influenced directly and indirectly by a myriad of factors. We examined the influence of biotic (i.e., prey availability) and abiotic (i.e., temperature, precipitation, relative humidity, real evapotranspiration) factors on species richness and abundance during a two-year period in the semiarid Caatinga vegetation in northeastern Brazil. Data were analyzed through partial autocorrelation functions, cross correlations, and a path analysis. A total of 2522 spiders were collected with beating tray, pit-fall traps, and malaise traps, comprising 91 species and 34 families. Spider abundance peaked in the rainy season. Our results suggest that total invertebrate abundance has a direct influence on spider richness and abundance, whereas the effects of precipitation were mainly indirectly related to most spider assemblage parameters. The increase in vegetation cover with the rainy season in the Caatinga provides more breeding and foraging sites for spiders and stimulates their activities. Additionally, rainfall in arid and semiarid ecosystems stimulated the activity and reproduction of many herbivore and detritivore invertebrates dependent on plant biomass and necromass consumption, leading to an increase in spider prey availability. PMID:26308806

  4. A Tank Bromeliad Favors Spider Presence in a Neotropical Inundated Forest.

    Directory of Open Access Journals (Sweden)

    Yann Hénaut

    Full Text Available Tank bromeliads are good models for understanding how climate change may affect biotic associations. We studied the relationships between spiders, the epiphytic tank bromeliad, Aechmea bracteata, and its associated ants in an inundated forest in Quintana Roo, Mexico, during a drought period while, exceptionally, this forest was dry and then during the flooding that followed. We compared spider abundance and diversity between 'Aechmea-areas' and 'control-areas' of the same surface area. We recorded six spider families: the Dipluridae, Ctenidae, Salticidae, Araneidae, Tetragnathidae and Linyphiidae among which the funnel-web tarantula, Ischnothele caudata, the only Dipluridae noted, was the most abundant. During the drought period, the spiders were more numerous in the Aechmea-areas than in the control-areas, but they were not obligatorily associated with the Aechmea. During the subsequent flooding, the spiders were concentrated in the A. bracteata patches, particularly those sheltering an ant colony. Also, a kind of specificity existed between certain spider taxa and ant species, but varied between the drought period and subsequent flooding. We conclude that climatic events modulate the relationship between A. bracteata patches and their associated fauna. Tank bromeliads, previously considered only for their ecological importance in supplying food and water during drought, may also be considered refuges for spiders during flooding. More generally, tank bromeliads have an important role in preserving non-specialized fauna in inundated forests.

  5. The lethal toxin from Australian funnel-web spiders is encoded by an intronless gene.

    Directory of Open Access Journals (Sweden)

    Sandy Steffany Pineda

    Full Text Available Australian funnel-web spiders are generally considered the most dangerous spiders in the world, with envenomations from the Sydney funnel-web spider Atrax robustus resulting in at least 14 human fatalities prior to the introduction of an effective anti-venom in 1980. The clinical envenomation syndrome resulting from bites by Australian funnel-web spiders is due to a single 42-residue peptide known as δ-hexatoxin. This peptide delays the inactivation of voltage-gated sodium channels, which results in spontaneous repetitive firing and prolongation of action potentials, thereby causing massive neurotransmitter release from both somatic and autonomic nerve endings. Here we show that δ-hexatoxin from the Australian funnel-web spider Hadronyche versuta is produced from an intronless gene that encodes a prepropeptide that is post-translationally processed to yield the mature toxin. A limited sampling of genes encoding unrelated venom peptides from this spider indicated that they are all intronless. Thus, in distinct contrast to cone snails and scorpions, whose toxin genes contain introns, spiders may have developed a quite different genetic strategy for evolving their venom peptidome.

  6. Spider mites adaptively learn recognizing mycorrhiza-induced changes in host plant volatiles.

    Science.gov (United States)

    Patiño-Ruiz, J David; Schausberger, Peter

    2014-12-01

    Symbiotic root micro-organisms such as arbuscular mycorrhizal fungi commonly change morphological, physiological and biochemical traits of their host plants and may thus influence the interaction of aboveground plant parts with herbivores and their natural enemies. While quite a few studies tested the effects of mycorrhiza on life history traits, such as growth, development and reproduction, of aboveground herbivores, information on possible effects of mycorrhiza on host plant choice of herbivores via constitutive and/or induced plant volatiles is lacking. Here we assessed whether symbiosis of the mycorrhizal fungus Glomus mosseae with common bean plants Phaseolus vulgaris influences the response of the two-spotted spider mite Tetranychus urticae to volatiles of plants that were clean or infested with spider mites. Mycorrhiza-naïve and -experienced spider mites, reared on mycorrhizal or non-mycorrhizal bean plants for several days before the experiments, were subjected to Y-tube olfactometer choice tests. Experienced but not naïve spider mites distinguished between constitutive volatiles of clean non-mycorrhizal and mycorrhizal plants, preferring the latter. Neither naïve nor experienced spider mites distinguished between spider mite-induced volatiles of mycorrhizal and non-mycorrhizal plants. Learning the odor of clean mycorrhizal plants, resulting in a subsequent preference for these odors, is adaptive because mycorrhizal plants are more favorable host plants for fitness of the spider mites than are non-mycorrhizal plants.

  7. Characterization of the complete mitogenomes of two Neoscona spiders (Araneae: Araneidae) and its phylogenetic implications.

    Science.gov (United States)

    Wang, Zheng-Liang; Li, Chao; Fang, Wen-Yuan; Yu, Xiao-Ping

    2016-09-30

    The complete mitogenomes of two orb-weaving spiders Neoscona doenitzi and Neoscona nautica were determined and a comparative mitogenomic analysis was performed to depict evolutionary trends of spider mitogenomes. The circular mitogenomes are 14,161bp with A+T content of 74.6% in N. doenitzi and 14,049bp with A+T content of 78.8% in N. nautica, respectively. Both mitogenomes contain a standard set of 37 genes typically presented in metazoans. Gene content and orientation are identical to all previously sequenced spider mitogenomes, while gene order is rearranged by tRNAs translocation when compared with the putative ancestral gene arrangement pattern presented by Limulus polyphemus. A comparative mitogenomic analysis reveals that the nucleotide composition bias is obviously divergent between spiders in suborder Opisthothelae and Mesothelae. The loss of D-arm in the trnS(UCN) among all of Opisthothelae spiders highly suggested that this common feature is a synapomorphy for entire suborder Opisthothelae. Moreover, the trnS(AGN) in araneoids preferred to use TCT as an anticodon rather than the typical anticodon GCT. Phylogenetic analysis based on the 13 protein-coding gene sequences consistently yields trees that nest the two Neoscona spiders within Araneidae and recover superfamily Araneoidea as a monophyletic group. The molecular information acquired from the results of this study should be very useful for future research on mitogenomic evolution and genetic diversities in spiders. PMID:27259661

  8. Effects of kaolin particle films on the life span of an orb-weaver spider.

    Science.gov (United States)

    Benhadi-Marín, Jacinto; Pereira, José Alberto; Santos, Sónia A P

    2016-02-01

    Araniella cucurbitina (Araneae: Araneidae) is a widespread orb-weaver spider commonly found in agroecosystems. Mineral particle films such as kaolin, due to their protective or anti-feeding action, can represent an alternative to pesticides, especially in organic farming systems, but little is known about its effects on A. cucurbitina. Therefore, we tested the effect of kaolin sprays on the life span of A. cucurbitina under laboratory conditions. Four treatments were tested encompassing different exposure routes. Thus, kaolin sprays were applied on (i) the surface, (ii) the prey (fly), (iii) the spider and (iv) both spider & prey. A control group was tested with water in each treatment. Results showed that sprays of kaolin significantly affected the survival of A. curcubitina when applications were done on the surface and on both spider & prey registering a reduction of 48% and 56%, respectively. Spiders in control obtained higher probability of reaching alive at the end of the assay than those treated with kaolin. Differences observed can be explained by the feeding behavior of the species and may depend on the consumption of the web by the spider and the ratio spider/fly for body size. PMID:26432533

  9. Effects of kaolin particle films on the life span of an orb-weaver spider.

    Science.gov (United States)

    Benhadi-Marín, Jacinto; Pereira, José Alberto; Santos, Sónia A P

    2016-02-01

    Araniella cucurbitina (Araneae: Araneidae) is a widespread orb-weaver spider commonly found in agroecosystems. Mineral particle films such as kaolin, due to their protective or anti-feeding action, can represent an alternative to pesticides, especially in organic farming systems, but little is known about its effects on A. cucurbitina. Therefore, we tested the effect of kaolin sprays on the life span of A. cucurbitina under laboratory conditions. Four treatments were tested encompassing different exposure routes. Thus, kaolin sprays were applied on (i) the surface, (ii) the prey (fly), (iii) the spider and (iv) both spider & prey. A control group was tested with water in each treatment. Results showed that sprays of kaolin significantly affected the survival of A. curcubitina when applications were done on the surface and on both spider & prey registering a reduction of 48% and 56%, respectively. Spiders in control obtained higher probability of reaching alive at the end of the assay than those treated with kaolin. Differences observed can be explained by the feeding behavior of the species and may depend on the consumption of the web by the spider and the ratio spider/fly for body size.

  10. Exploration behaviour and behavioural flexibility in orb-web spiders: A review

    Institute of Scientific and Technical Information of China (English)

    Thomas HESSELBERG

    2015-01-01

    Orb-web spiders and their webs constitute an ideal model system in which to study behavioural flexibility and spatial cognition in invertebrates due to the easily quantifiable nature of the orb web.A large number of studies demonstrate how spiders are able to modify the geometry of their webs in response to a range of different conditions including the ability to adapt their webs to spatial constraints.However,the mechanisms behind this impressive web-building flexibility in these cognitively limited animals remain poorly explored.One possible mechanism though may be spatial learning during the spiders' exploration of their immediate surroundings.This review discusses the importance of exploration behaviour,the reliance on simple behavioural rules,and the use of already laid threads as guidelines for web-building in orb-web spiders.The focus is on the spiders' ability to detect and adapt their webs to space limitations and other spatial disruptions.I will also review the few published studies on how spatial information is gathered during the exploration phase and discuss the possibility of the use of ‘cognitive map’-like processes in spiders.Finally,the review provides suggestions for designing experimental studies to shed light on whether spiders gather metric information during the site exploration (cognitive map hypothesis) or rely on more simple binary information in combination with previously laid threads to build their webs (stigmergy hypothesis) [Current Zoology 61 (2):313-327,2015].

  11. Molecular characterization and evolutionary study of spider tubuliform (eggcase) silk protein.

    Science.gov (United States)

    Tian, Maozhen; Lewis, Randolph V

    2005-06-01

    As a result of hundreds of millions of years of evolution, orb-web-weaving spiders have developed the use of seven different silks produced by different abdominal glands for various functions. Tubuliform silk (eggcase silk) is unique among these spider silks due to its high serine and very low glycine content. In addition, tubuliform silk is the only silk produced just during a short period of time, the reproductive season, in the spider's life. To understand the molecular characteristics of the proteins composing this silk, we constructed tubuliform-gland-specific cDNA libraries from three different spider families, Nephila clavipes, Argiope aurantia, and Araneus gemmoides. Sequencing of tubuliform silk cDNAs reveals the repetitive architecture of its coding sequence and novel amino acid motifs. The inferred protein, tubuliform spidroin 1 (TuSp1), contains highly homogenized repeats in all three spiders. Amino acid composition comparison of the predicted tubuliform silk protein sequence to tubuliform silk indicates that TuSp1 is the major component of tubuliform silk. Repeat unit alignment of TuSp1 among three spider species shows high sequence conservation among tubuliform silk protein orthologue groups. Sequence comparison among TuSp1 repetitive units within species suggests intragenic concerted evolution, presumably through gene conversion and unequal crossover events. Comparative analysis demonstrates that TuSp1 represents a new orthologue in the spider silk gene family.

  12. A Tank Bromeliad Favors Spider Presence in a Neotropical Inundated Forest.

    Science.gov (United States)

    Hénaut, Yann; Corbara, Bruno; Pélozuelo, Laurent; Azémar, Frédéric; Céréghino, Régis; Herault, Bruno; Dejean, Alain

    2014-01-01

    Tank bromeliads are good models for understanding how climate change may affect biotic associations. We studied the relationships between spiders, the epiphytic tank bromeliad, Aechmea bracteata, and its associated ants in an inundated forest in Quintana Roo, Mexico, during a drought period while, exceptionally, this forest was dry and then during the flooding that followed. We compared spider abundance and diversity between 'Aechmea-areas' and 'control-areas' of the same surface area. We recorded six spider families: the Dipluridae, Ctenidae, Salticidae, Araneidae, Tetragnathidae and Linyphiidae among which the funnel-web tarantula, Ischnothele caudata, the only Dipluridae noted, was the most abundant. During the drought period, the spiders were more numerous in the Aechmea-areas than in the control-areas, but they were not obligatorily associated with the Aechmea. During the subsequent flooding, the spiders were concentrated in the A. bracteata patches, particularly those sheltering an ant colony. Also, a kind of specificity existed between certain spider taxa and ant species, but varied between the drought period and subsequent flooding. We conclude that climatic events modulate the relationship between A. bracteata patches and their associated fauna. Tank bromeliads, previously considered only for their ecological importance in supplying food and water during drought, may also be considered refuges for spiders during flooding. More generally, tank bromeliads have an important role in preserving non-specialized fauna in inundated forests. PMID:25494055

  13. Functional relations between locomotor performance traits in spiders and implications for evolutionary hypotheses

    Directory of Open Access Journals (Sweden)

    Taylor Phillip W

    2010-11-01

    Full Text Available Abstract Background Locomotor performance in ecologically relevant activities is often linked to individual fitness. Recent controversy over evolution of extreme sexual size dimorphism (SSD in spiders centres on the relationship between size and locomotor capacity in males. Advantages for large males running over horizontal surfaces and small males climbing vertically have been proposed. Models have implicitly treated running and climbing as functionally distinct activities and failed to consider the possibility that they reflect common underlying capacities. Findings We examine the relationship between maximum climbing and running performance in males of three spider species. Maximum running and climbing speeds were positively related in two orb-web spiders with high SSD (Argiope keyserlingi and Nephila plumipes, indicating that for these species assays of running and climbing largely reveal the same underlying capacities. Running and climbing speeds were not related in a jumping spider with low SSD (Jacksonoides queenslandica. We found no evidence of a performance trade-off between these activities. Conclusions In the web-spiders A. keyserlingi and N. plumipes good runners were also good climbers. This indicates that climbing and running largely represent a single locomotor performance characteristic in these spiders, but this was not the case for the jumping spider J. queenslandica. There was no evidence of a trade-off between maximum running and climbing speeds in these spiders. We highlight the need to establish the relationship between apparently disparate locomotor activities when testing alternative hypotheses that yield predictions about different locomotor activities. Analysis of slopes suggests greater potential for an evolutionary response on performance in the horizontal compared to vertical context in these spiders.

  14. Deer herbivory reduces web-building spider abundance by simplifying forest vegetation structure

    Science.gov (United States)

    Chips, Michael J.; Carson, Walter P.

    2016-01-01

    Indirect ecological effects are a common feature of ecological systems, arising when one species affects interactions among two or more other species. We examined how browsing by white-tailed deer (Odocoileus virginianus) indirectly affected the abundance and composition of a web-building spider guild through their effects on the structure of the ground and shrub layers of northern hardwood forests. We examined paired plots consisting of deer-free and control plots in the Allegheny Plateau region Pennsylvania and Northern Highlands region of Wisconsin. We recorded the abundance of seven types of webs, each corresponding to a family of web-building spiders. We quantified vegetation structure and habitat suitability for the spiders by computing a web scaffold availability index (WSAI) at 0.5 m and 1.0 m above the ground. At Northern Highlands sites, we recorded prey availability. Spider webs were twice as abundant in deer-free plots compared to control plots, while WSAI was 7–12 times greater in deerfree plots. Prey availability was lower in deer-free plots. With the exception of funnel web-builders, all spider web types were significantly more abundant in deer-free plots. Both deer exclusion and the geographic region of plots were significant predictors of spider community structure. In closed canopy forests with high browsing pressure, the low density of tree saplings and shrubs provides few locations for web-building spiders to anchor webs. Recruitment of these spiders may become coupled with forest disturbance events that increase tree and shrub recruitment. By modifying habitat structure, deer appear to indirectly modify arthropod food web interactions. As deer populations have increased in eastern North America over the past several decades, the effects of deer on web-building spiders may be widespread.

  15. Documented bites by a yellow sac spider (Cheiracanthium punctorium in Italy: a case report

    Directory of Open Access Journals (Sweden)

    R Papini

    2012-01-01

    Full Text Available In Italy reports of human envenomations by yellow sac spiders have been sporadic. Since increasing clinical information would improve understanding of the danger of yellow sac spiders to humans, we report the case of a 7-year-old child and her father bitten by a documented Cheiracanthium punctorium. They developed acute persistent pain with local skin signs and numbness, and required emergency treatment. The father recovered completely within 1 to 2 hours and the child within 3 to 4 days after treatment, probably as a result of spontaneous evolution. Clinicians should be aware of the risks and immediate management of spider bites.

  16. Adaptation of the spiders to the environment: the case of some Chilean species

    Science.gov (United States)

    Canals, Mauricio; Veloso, Claudio; Solís, Rigoberto

    2015-01-01

    Spiders are small arthropods that have colonized terrestrial environments. These impose three main problems: (i) terrestrial habitats have large fluctuations in temperature and humidity; (ii) the internal concentration of water is higher than the external environment in spiders, which exposes them continually to water loss; and (iii) their small body size determines a large surface/volume ratio, affecting energy exchange and influencing the life strategy. In this review we focus on body design, energetic, thermal selection, and water balance characteristics of some spider species present in Chile and correlate our results with ecological and behavioral information. Preferred temperatures and critical temperatures of Chilean spiders vary among species and individuals and may be adjusted by phenotypic plasticity. For example in the mygalomorph high-altitude spider Paraphysa parvula the preferred temperature is similar to that of the lowland spider Grammostola rosea; but while P. parvula shows phenotypic plasticity, G. rosea does not. The araneomorph spiders Loxosceles laeta and Scytodes globula have greater daily variations in preferred temperatures at twilight and during the night, which are set to the nocturnal activity rhythms of these species. They also present acclimation of the minimum critical temperatures. Dysdera crocata has a low preferred temperature adjusted to its favorite prey, the woodlouse. Spider metabolic rate is low compared to other arthropods, which may be associated with its sit and wait predatory strategy particularly in primitive hunter and weavers. In mygalomorph spiders the respiratory system is highly optimized with high oxygen conductance, for example G. rosea needs only a difference of 0.12–0.16 kPa in the oxygen partial pressure across the air-hemolymph barrier to satisfy its resting oxygen consumption demands. Water loss is a significant stress for spiders. Paraphysa parvula shows an evaporative water loss 10 times more than usual

  17. Stability of the volume of air trapped on the abdomen of the water spider Argyroneta aquatica

    OpenAIRE

    Neumann, Dietrich; Woermann, Dietrich

    2013-01-01

    The water spider Argyroneta aquatica lives under water, diving to various depths from time to time. At rest, it breathes air trapped within its diving bell with a hydrophilic surface. Outside their diving bell water spiders trap air on their abdomen under a layer of hydrophobic hair. Is the structure of the layer of hair trapping a volume of air on the abdomen of the water spider Argyroneta aquatica under water related to its observed diving depth (of the order of decimetre)? A positive answe...

  18. Local trophic specialisation in a cosmopolitan spider (Araneae).

    Science.gov (United States)

    Líznarová, Eva; Sentenská, Lenka; García, Luis Fernando; Pekár, Stano; Viera, Carmen

    2013-02-01

    Trophic specialisation can be observed in species with long-term constant exploitation of a certain prey in all populations or in a population of a species with short-term exploitation of a certain prey. While in the former case the species would evolve stereotyped or specialised trophic adaptations, the trophic traits of the latter should be versatile or generalised. Here, we studied the predatory behavioural adaptations of a presumed myrmecophagous spider, Oecobius navus. We chose two distinct populations, one in Portugal and the other in Uruguay. We analysed the actual prey of both populations and found that the Portuguese population feeds mainly on dipterans, while the Uruguayan population feeds mainly on ants. Indeed, dipterans and springtails in Portugal, and ants in Uruguay were the most abundant potential prey. In laboratory trials O. navus spiders recognised and captured a wide variety of prey. The capture efficiency of the Portuguese population measured as components of the handling time was higher for flies than for ants, while that of the Uruguayan population was higher for ants. We found phenotypic plasticity in behavioural traits that lead to increased capture efficiency with respect to the locally abundant prey, but it remains to be determined whether the traits of the two populations are genetically fixed. We conclude that O. navus is a euryphagous generalist predator which shows local specialisation on the locally abundant prey. PMID:23200575

  19. Benefits of cooperation with genetic kin in a subsocial spider.

    Science.gov (United States)

    Schneider, J M; Bilde, T

    2008-08-01

    Interaction within groups exploiting a common resource may be prone to cheating by selfish actions that result in disadvantages for all members of the group, including the selfish individuals. Kin selection is one mechanism by which such dilemmas can be resolved. This is because selfish acts toward relatives include the cost of lowering indirect fitness benefits that could otherwise be achieved through the propagation of shared genes. Kin selection theory has been proved to be of general importance for the origin of cooperative behaviors, but other driving forces, such as direct fitness benefits, can also promote helping behavior in many cooperatively breeding taxa. Investigating transitional systems is therefore particularly suitable for understanding the influence of kin selection on the initial spread of cooperative behaviors. Here we investigated the role of kinship in cooperative feeding. We used a cross-fostering design to control for genetic relatedness and group membership. Our study animal was the periodic social spider Stegodyphus lineatus, a transitional species that belongs to a genus containing both permanent social and periodic social species. In S. lineatus, the young cooperate in prey capture and feed communally. We provide clear experimental evidence for net benefits of cooperating with kin. Genetic relatedness within groups and not association with familiar individuals directly improved feeding efficiency and growth rates, demonstrating a positive effect of kin cooperation. Hence, in communally feeding spiders, nepotism favors group retention and reduces the conflict between selfish interests and the interests of the group. PMID:18658236

  20. Nectar Meals of a Mosquito-Specialist Spider

    Directory of Open Access Journals (Sweden)

    Josiah O. Kuja

    2012-01-01

    Full Text Available Evarcha culicivora, an East African jumping spider, is known for feeding indirectly on vertebrate blood by actively choosing blood-carrying mosquitoes as prey. Using cold-anthrone tests to detect fructose, we demonstrate that E. culicivora also feeds on nectar. Field-collected individuals, found on the plant Lantana camara, tested positive for plant sugar (fructose. In the laboratory, E. culicivora tested positive for fructose after being kept with L. camara or one of another ten plant species (Aloe vera, Clerodendron magnifica, Hamelia patens, Lantana montevideo, Leonotis nepetaefolia, Parthenium hysterophorus, Ricinus communis, Senna didymobotrya, Striga asiatica, and Verbena trivernia. Our findings demonstrate that E. culicivora acquires fructose from its natural diet and can ingest fructose directly from plant nectaries. However, experiments in the laboratory also show that E. culicivora can obtain fructose indirectly by feeding on prey that have fed on fructose, implying a need to consider this possibility when field-collected spiders test positive for fructose. In laboratory tests, 53.5% of 1,215 small juveniles, but only 3.4% of 622 adult E. culicivora, left with plants for 24 hours, were positive for fructose. These findings, along with the field data, suggest that fructose is especially important for early-instar juveniles of E. culicivora.

  1. Extracellular matrix molecules as targets for brown spider venom toxins

    Directory of Open Access Journals (Sweden)

    Veiga S.S.

    2001-01-01

    Full Text Available Loxoscelism, the term used to describe lesions and clinical manifestations induced by brown spider's venom (Loxosceles genus, has attracted much attention over the last years. Brown spider bites have been reported to cause a local and acute inflammatory reaction that may evolve to dermonecrosis (a hallmark of envenomation and hemorrhage at the bite site, besides systemic manifestations such as thrombocytopenia, disseminated intravascular coagulation, hemolysis, and renal failure. The molecular mechanisms by which Loxosceles venoms induce injury are currently under investigation. In this review, we focused on the latest reports describing the biological and physiopathological aspects of loxoscelism, with reference mainly to the proteases recently described as metalloproteases and serine proteases, as well as on the proteolytic effects triggered by L. intermedia venom upon extracellular matrix constituents such as fibronectin, fibrinogen, entactin and heparan sulfate proteoglycan, besides the disruptive activity of the venom on Engelbreth-Holm-Swarm basement membranes. Degradation of these extracellular matrix molecules and the observed disruption of basement membranes could be related to deleterious activities of the venom such as loss of vessel and glomerular integrity and spreading of the venom toxins to underlying tissues.

  2. The SPIDER fission fragment spectrometer for fission product yield measurements

    Energy Technology Data Exchange (ETDEWEB)

    Meierbachtol, K.; Tovesson, F. [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Shields, D. [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Colorado School of Mines, Golden, CO 80401 (United States); Arnold, C. [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Blakeley, R. [University of New Mexico, Albuquerque, NM 87131 (United States); Bredeweg, T.; Devlin, M. [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Hecht, A.A.; Heffern, L.E. [University of New Mexico, Albuquerque, NM 87131 (United States); Jorgenson, J.; Laptev, A. [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Mader, D. [University of New Mexico, Albuquerque, NM 87131 (United States); O' Donnell, J.M.; Sierk, A.; White, M. [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States)

    2015-07-11

    The SPectrometer for Ion DEtermination in fission Research (SPIDER) has been developed for measuring mass yield distributions of fission products from spontaneous and neutron-induced fission. The 2E–2v method of measuring the kinetic energy (E) and velocity (v) of both outgoing fission products has been utilized, with the goal of measuring the mass of the fission products with an average resolution of 1 atomic mass unit (amu). The SPIDER instrument, consisting of detector components for time-of-flight, trajectory, and energy measurements, has been assembled and tested using {sup 229}Th and {sup 252}Cf radioactive decay sources. For commissioning, the fully assembled system measured fission products from spontaneous fission of {sup 252}Cf. Individual measurement resolutions were met for time-of-flight (250 ps FWHM), spacial resolution (2 mm FHWM), and energy (92 keV FWHM for 8.376 MeV). Mass yield results measured from {sup 252}Cf spontaneous fission products are reported from an E–v measurement.

  3. Untangling taxonomy: a DNA barcode reference library for Canadian spiders.

    Science.gov (United States)

    Blagoev, Gergin A; deWaard, Jeremy R; Ratnasingham, Sujeevan; deWaard, Stephanie L; Lu, Liuqiong; Robertson, James; Telfer, Angela C; Hebert, Paul D N

    2016-01-01

    Approximately 1460 species of spiders have been reported from Canada, 3% of the global fauna. This study provides a DNA barcode reference library for 1018 of these species based upon the analysis of more than 30,000 specimens. The sequence results show a clear barcode gap in most cases with a mean intraspecific divergence of 0.78% vs. a minimum nearest-neighbour (NN) distance averaging 7.85%. The sequences were assigned to 1359 Barcode index numbers (BINs) with 1344 of these BINs composed of specimens belonging to a single currently recognized species. There was a perfect correspondence between BIN membership and a known species in 795 cases, while another 197 species were assigned to two or more BINs (556 in total). A few other species (26) were involved in BIN merges or in a combination of merges and splits. There was only a weak relationship between the number of specimens analysed for a species and its BIN count. However, three species were clear outliers with their specimens being placed in 11-22 BINs. Although all BIN splits need further study to clarify the taxonomic status of the entities involved, DNA barcodes discriminated 98% of the 1018 species. The present survey conservatively revealed 16 species new to science, 52 species new to Canada and major range extensions for 426 species. However, if most BIN splits detected in this study reflect cryptic taxa, the true species count for Canadian spiders could be 30-50% higher than currently recognized. PMID:26175299

  4. Coincidental intraguild predation by caterpillars on spider mites.

    Science.gov (United States)

    Shirotsuka, Kanako; Yano, Shuichi

    2012-01-29

    Intraguild predation (IGP) is defined as the killing and eating of prey species by a predator that also can utilize the resources of the prey. It is mainly reported among carnivores that share common herbivorous prey. However, a large chewing herbivore could prey upon sedentary and/or micro herbivores in addition to utilizing a host plant. To investigate such coincidental IGP, we observed the behavioral responses of the polyphagous mite Tetranychus kanzawai Kishida (Acari: Tetranychidae) when its host plant Cayratia japonica (Thunb.) Gagnep. (Vitaceae) was attacked by hornworms, Theretra japonica Boisduval (Sphingidae) and T. oldenlandiae Fabricius (Sphingidae). We also examined an interaction between the oligophagous mite Panonychus citri McGregor (Acari: Tetranychidae) and caterpillars of the swallowtail Papilio xuthus L. (Papilionidae) that share citrus plants as their main food source. Although all T. kanzawai and some active stage P. citri tried to escape from the coincidental IGP, some were consumed together with eggs, quiescent mites, and host plant leaves, suggesting that coincidental IGP occurs on spider mites in the wild. Moreover, neither hornworms nor swallowtail caterpillars distinguished between spider mite-infested and uninfested leaves, suggesting that the mite-infested leaves do not discourage caterpillar feeding. The reasons that the mites have no effective defense against coincidental IGP other than escaping are discussed. PMID:22286142

  5. Damage, Self-Healing, and Hysteresis in Spider Silks

    Science.gov (United States)

    De Tommasi, D.; Puglisi, G.; Saccomandi, G.

    2010-01-01

    Abstract In this article, we propose a microstructure-based continuum model to describe the material behavior of spider silks. We suppose that the material is composed of a soft fraction with entropic elasticity and a hard, damageable fraction. The hard fraction models the presence of stiffer, crystal-rich, oriented regions and accounts for the effect of softening induced by the breaking of hydrogen bonds. To describe the observed presence of crystals with different size, composition, and orientation, this hard fraction is modeled as a distribution of materials with variable properties. The soft fraction describes the remaining regions of amorphous material and is here modeled as a wormlike chain. During stretching, we consider the effect of bond-breaking as a transition from the hard- to the soft-material phase. As we demonstrate, a crucial effect of bond-breaking that accompanies the softening of the material is an increase in contour length associated with chains unraveling. The model describes also the self-healing properties of the material by assuming partial bond reconnection upon unloading. Despite its simplicity, the proposed mechanical system reproduces the main experimental effects observed in cyclic loading of spider silks. Moreover, our approach is amenable to two- or three-dimensional extensions and may prove to be a useful tool in the field of microstructure optimization for bioinspired materials. PMID:20441758

  6. Predator perception of detritus and eggsac decorations spun by orb-web spiders Cyclosa octotuberculata: Do they function to camouflage the spiders?

    Directory of Open Access Journals (Sweden)

    Wenjin GAN, Fengxiang LIU, Zengtao ZHANG, Daiqin LI

    2010-06-01

    Full Text Available Camouflage is one of the most widespread and powerful strategies that animals use to make detection/recognition more difficult. Many orb-web spiders of the genus Cyclosa add prey remains, plant debris, moults, and/or eggsacs to their webs called web decorations. Web decorations resembling spider body colour pattern have been considered to camouflage the spider from predators. While this camouflage is obvious from a human’s perspective, it has rarely been investigated from a predator’s perspective. In this study, we tested the visibility of web decorations by calculating chromatic and achromatic contrasts of detritus and eggsac decorations built by Cyclosa octotuberculata, against four different backgrounds viewed by both bird (e.g., blue tits and hymenopteran (e.g. wasps predators. We showed that both juvenile and adult spiders on webs with detritus or egg-sac decorations were undetectable by both hymenopteran and bird predators over short and long distances. Our results thus suggest that decorating webs with detritus or eggsacs by C. octotuberculata may camouflage the spider from both hymenopteran and bird predators in their common habitats [Current Zoology 56 (3: 379–387, 2010].

  7. The age and evolution of sociality in Stegodyphus spiders: a molecular phylogenetic perspective

    DEFF Research Database (Denmark)

    Johannesen, Jes; Lubin, Yael; Smith, Deborah R.;

    2007-01-01

    Social, cooperative breeding behaviour is rare in spiders and generally characterized by inbreeding, skewed sex ratios and high rates of colony turnover, processes that when combined may reduce genetic variation and lower individual fitness quickly. On these grounds, social spider species have been...... suggested to be unstable in evolutionary time, and hence sociality a rare phenomenon in spiders. Based on a partial molecular phylogeny of the genus Stegodyphus, we address the hypothesis that social spiders in this genus are evolutionary transient. We estimate the age of the three social species, test...... whether they represent an ancestral or derived state and assess diversification relative to subsocial congeners. Intraspecific sequence divergence was high in all of the social species, lending no support for the idea that they are young, transient species. The age of the social lineages, constant lineage...

  8. Spiders (Araneae) of the Moosehorn National Wildlife Refuge, Washington County, Maine

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This report summarizes my identifications of spiders for graduate student Matthew Vander Haegen, College of Forest Resources, Department of Wildlife, University of...

  9. The distribution of spiders and Harvestmen (Chelicerata) in the Dutch National Park "De Hoge Veluwe"

    NARCIS (Netherlands)

    Hammen, van der L.

    1983-01-01

    A preliminary study is made of the distribution of Araneida and Opilionida (Chelicerata) in a National Park in The Netherlands. Special attention is paid to the influence of vegetation structure on the distribution of the spiders.

  10. Prediction of abundance of forest spiders according to climate warming in South Korea

    Directory of Open Access Journals (Sweden)

    Tae-Sung Kwon

    2014-06-01

    Full Text Available Distribution of spiders will be changed as climate warms. Abundance of spider species was predicted nationwide in South Korea. Abundance of spiders was projected using temperature species distribution model based on a nationwide data (366 forest sites according to climate change scenario RCP 4.5 and 8.5. The model predicts that 9 out of 17 species will increase in abundance while 8 species will decrease. Based on this finding, a qualitative prediction (increase or decrease was conducted on the species with more than 1% occurrence: 68 species are expected to decrease, 9 to increase, and 8 to change a little. In pooled estimation, 76 species (75% are expected to decrease, 18 species (18% to increase, and by 8 species (8% to have little change. The projection indicates that majority of spider species will decrease, but minority of species will increase as climate warms, suggesting great increase of remained species in lowlands.

  11. Effects of the Spider Venom on proliferation of Human Lung Adenocarcinoma Cell A549

    Directory of Open Access Journals (Sweden)

    Zengxiang HU

    2010-10-01

    Full Text Available Background and objective The spider venom may inspire new drugs to treat cancer. The aim of this study is to investigate the effects and mechanisms of spider venom on lung adenocarcinoma cell A549. Methods The proliferation of lung adenocarcinoma A549 cells was detected by MTT. The apoptosis rate was observed with MTT assay and flow cytometer. The activity of catalase was detected by colorimetry. The malondialdehyde (MDA content was determined by improved thiobarbituric acid fluorometric method. The expression of P38MAPK protein was analyzed with Western blot. Results Spider venom can remarkably inhibite the proliferation of lung adenocarcinoma A549 cells, increased activity of catalase and MDA content, down-regulated expression of P38MAPK compared with the control group. Conclusion The reduced proliferation of lung adenocarcinoma A549 cells by spider venom is may be associated with the increased of activity of catalase and MDA content and decreased expression of P38MAPK.

  12. Pre-flight integration and characterization of the SPIDER balloon-borne telescope

    CERN Document Server

    Rahlin, A S; Amiri, M; Benton, S J; Bock, J J; Bond, J R; Bryan, S A; Chiang, H C; Contaldi, C R; Crill, B P; Doré, O; Farhang, M; Filippini, J P; Fissel, L M; Fraisse, A A; Gambrel, A E; Gandilo, N N; Golwala, S; Gudmundsson, J E; Halpern, M; Hasselfield, M F; Hilton, G; Holmes, W A; Hristov, V V; Irwin, K D; Jones, W C; Kermish, Z D; Kuo, C L; MacTavish, C J; Mason, P V; Megerian, K; Moncelsi, L; Morford, T A; Nagy, J M; Netterfield, C B; O'Brient, R; Reintsema, C; Ruhl, J E; Runyan, M C; Shariff, J A; Soler, J D; Trangsrud, A; Tucker, C; Tucker, R S; Turner, A D; Weber, A C; Wiebe, D V; Young, E Y

    2014-01-01

    We present the results of integration and characterization of the SPIDER instrument after the 2013 pre-flight campaign. SPIDER is a balloon-borne polarimeter designed to probe the primordial gravitational wave signal in the degree-scale $B$-mode polarization of the cosmic microwave background. With six independent telescopes housing over 2000 detectors in the 94 GHz and 150 GHz frequency bands, SPIDER will map 7.5% of the sky with a depth of 11 to 14 $\\mu$K$\\cdot$arcmin at each frequency, which is a factor of $\\sim$5 improvement over Planck. We discuss the integration of the pointing, cryogenic, electronics, and power sub-systems, as well as pre-flight characterization of the detectors and optical systems. SPIDER is well prepared for a December 2014 flight from Antarctica, and is expected to be limited by astrophysical foreground emission, and not instrumental sensitivity, over the survey region.

  13. [Effect of Segestria florentina spider venom on the mechanism of inactivation of sodium channels].

    Science.gov (United States)

    Usmanov, P B; Kalikulov, D; Nasledov, G A; Tashmukhamedov, B A

    1985-01-01

    It was shown that Segestria florentina spider venom mainly reduces the rate and amount of sodium inactivation. This effect is likely to be responsible for the prolongation of the action potential. PMID:2413900

  14. Envia garciai, a new genus and species of mygalomorph spiders (Araneae, Microstigmatidae from Brazilian Amazonia

    Directory of Open Access Journals (Sweden)

    Ott Ricardo

    2003-01-01

    Full Text Available The genus Envia, comprising only the new species Envia garciai, is proposed. These small mygalomorph spiders were abundantly collected in soil cores and litter samples in primary rain forests near Manaus, Amazonas, Brazil.

  15. Biomimetic Spider Leg Joints: A Review from Biomechanical Research to Compliant Robotic Actuators

    Directory of Open Access Journals (Sweden)

    Stefan Landkammer

    2016-07-01

    Full Text Available Due to their inherent compliance, soft actuated joints are becoming increasingly important for robotic applications, especially when human-robot-interactions are expected. Several of these flexible actuators are inspired by biological models. One perfect showpiece for biomimetic robots is the spider leg, because it combines lightweight design and graceful movements with powerful and dynamic actuation. Building on this motivation, the review article focuses on compliant robotic joints inspired by the function principle of the spider leg. The mechanism is introduced by an overview of existing biological and biomechanical research. Thereupon a classification of robots that are bio-inspired by spider joints is presented. Based on this, the biomimetic robot applications referring to the spider principle are identified and discussed.

  16. SPIDER: Listening for the echoes of inflation from above the clouds

    Science.gov (United States)

    Filippini, Jeffrey; Spider Collaboration

    2016-03-01

    We report on the status of SPIDER, a balloon-borne instrument to map the polarization of the cosmic microwave background at large angular scales. SPIDER targets the B-mode signature of primordial gravitational waves, with a focus on mapping a large sky area at multiple frequencies. SPIDER's six monochromatic refracting telescopes (three each at 95 and 150 GHz) feed a total of more than 2000 antenna-coupled superconducting transition-edge sensors. A sapphire half-wave plate at the aperture of each telescope modulates sky polarization for control of systematics. We discuss SPIDER's first long-duration balloon flight in January 2015, as well as the status of data analysis and development toward a second flight.

  17. Investigating the influence of farm-scape geospatial characteristics on spider diversity

    Science.gov (United States)

    Biodiversity is an important aspect of sustainable crop management and agricultural production. Maintaining biodiversity within agricultural ecosystems, especially in regards to predator species, promotes natural pest control and many other ecosystem services. Spiders (Araneae) often prey upon commo...

  18. To spin or not to spin: spider silk fibers and more.

    Science.gov (United States)

    Doblhofer, Elena; Heidebrecht, Aniela; Scheibel, Thomas

    2015-11-01

    Spider silk fibers have a sophisticated hierarchical structure composed of proteins with highly repetitive sequences. Their extraordinary mechanical properties, defined by a unique combination of strength and extensibility, are superior to most man-made fibers. Therefore, spider silk has fascinated mankind for thousands of years. However, due to their aggressive territorial behavior, farming of spiders is not feasible on a large scale. For this reason, biotechnological approaches were recently developed for the production of recombinant spider silk proteins. These recombinant proteins can be assembled into a variety of morphologies with a great range of properties for technical and medical applications. Here, the different approaches of biotechnological production and the advances in material processing toward various applications will be reviewed.

  19. Task specialization in two social spiders, Stegodyphus sarasinorum (Eresidae) and Anelosimus eximius (Theridiidae)

    DEFF Research Database (Denmark)

    Settepani, Virginia; Grinsted, Lena; Pedersen, Jørgen Granfeldt;

    2013-01-01

    questions: Do individual spiders vary consistently in their propensity to engage in prey attack? Are individual spiders' propensities to engage in web maintenance behaviour influenced by their previous engagement in prey attack? Interestingly, we found that both species showed some degree of task...... no individual specialization, but showed differentiation according to instar, where adult and subadult females were more likely to engage in prey attack than were juveniles. We found no evidence for division of labour between prey attack and web maintenance. Different solutions to achieve task differentiation...... skew is common in other group-living animals. Permanently, social spiders form highly related groups with reproductive skew and communal brood care. We investigated task differentiation in nonreproductive tasks in two permanently and independently derived social spider species asking the following...

  20. Captive spider monkeys (Ateles geoffroyi) arm-raise to solicit allo-grooming.

    Science.gov (United States)

    Scheel, Matthew H; Edwards, Dori

    2012-03-01

    Old World monkeys solicit allo-grooming from conspecifics. However, there are relatively few studies of allo-grooming among spider monkeys, and descriptions of allo-grooming solicitation among spider monkeys are anecdotal. In this study, eighty-one hours of video, shot over eight weeks, captured 271 allo-grooming bouts among small groups of captive spider monkeys. Six of eight monkeys made heretofore unreported arm-raises that solicited higher than normal rates of allo-grooming. Allo-grooming bout durations following arm-raises also tended to be longer than bouts not preceded by arm-raises. The efficacy of the arm-raise at soliciting allo-grooming suggests spider monkeys are capable of intentional communication.

  1. SpiderFab: Architecture for On-Orbit Construction of Kilometer-Scale Apertures Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The SpiderFab effort has investigated the value proposition and technical feasibility of radically changing the way we build and deploy spacecraft in order to...

  2. Spider, bacterial and fungal phospholipase D toxins make cyclic phosphate products.

    Science.gov (United States)

    Lajoie, Daniel M; Cordes, Matthew H J

    2015-12-15

    Phospholipase D (PLD) toxins from sicariid spiders, which cause disease in mammals, were recently found to convert their primary substrates, sphingomyelin and lysophosphatidylcholine, to cyclic phospholipids. Here we show that two PLD toxins from pathogenic actinobacteria and ascomycete fungi, which share distant homology with the spider toxins, also generate cyclic phospholipids. This shared function supports divergent evolution of the PLD toxins from a common ancestor and suggests the importance of cyclic phospholipids in pathogenicity.

  3. Linking Native and Invader Traits Explains Native Spider Population Responses to Plant Invasion.

    Science.gov (United States)

    Smith, Jennifer N; Emlen, Douglas J; Pearson, Dean E

    2016-01-01

    Theoretically, the functional traits of native species should determine how natives respond to invader-driven changes. To explore this idea, we simulated a large-scale plant invasion using dead spotted knapweed (Centaurea stoebe) stems to determine if native spiders' web-building behaviors could explain differences in spider population responses to structural changes arising from C. stoebe invasion. After two years, irregular web-spiders were >30 times more abundant and orb weavers were >23 times more abundant on simulated invasion plots compared to controls. Additionally, irregular web-spiders on simulated invasion plots built webs that were 4.4 times larger and 5.0 times more likely to capture prey, leading to >2-fold increases in recruitment. Orb-weavers showed no differences in web size or prey captures between treatments. Web-spider responses to simulated invasion mimicked patterns following natural invasions, confirming that C. stoebe's architecture is likely the primary attribute driving native spider responses to these invasions. Differences in spider responses were attributable to differences in web construction behaviors relative to historic web substrate constraints. Orb-weavers in this system constructed webs between multiple plants, so they were limited by the overall quantity of native substrates but not by the architecture of individual native plant species. Irregular web-spiders built their webs within individual plants and were greatly constrained by the diminutive architecture of native plant substrates, so they were limited both by quantity and quality of native substrates. Evaluating native species traits in the context of invader-driven change can explain invasion outcomes and help to identify factors limiting native populations. PMID:27082240

  4. Coagulopathy after spider bites in a six-year-old boy

    Directory of Open Access Journals (Sweden)

    Ansari SH.

    2008-06-01

    Full Text Available Background: Spider bites are common in most parts of the world. In some areas, where snake or scorpion bites are common, spider bites may not be considered a significant problem by the general public and those who have been bitten by spiders may not go to a hospital. However, significant problems are observed in the victims of certain species of spiders including: widow spider (of the genus Latrodectus, including the black widow and brown spiders (of the genus Loxosceles, such as the brown recluse. Case: We report a six-year-old boy, admitted to the hospital two weeks after suffering a spider bite. The patient presented with a severe nose bleed, ecchymosis and purpura, as well as anemia, indicating a clotting disorder. Laboratory results revealed abnormal values for prothrombin time (PT >50 sec, partial thromboplastin time (PTT >120 min and fibrinogen = 0 mg/dl, whereas factor VIII was normal according to a mixing study, with a normal platelet count of 350,000/µl. The patient was managed with fresh frozen plasma every 12 h, and was discharged one week after hospital admission. At present, the patient is well with more normal laboratory results one month after treatment: PT=13.4 sec, PTT= 34 sec, fibrinogen=105 mg/dl.         Conclusions: Although spider bites are uncommon in Iran, severe systemic reactions may occur in the pediatric population requiring admission to the pediatric intensive care unit. These systemic reactions may include hemolytic anemia coagulopathy and renal failure.

  5. A Novel Hyaluronidase from Brown Spider (Loxosceles intermedia) Venom (Dietrich's Hyaluronidase): From Cloning to Functional Characterization

    OpenAIRE

    Valéria Pereira Ferrer; Thiago Lopes de Mari; Luiza Helena Gremski; Dilza Trevisan Silva; Rafael Bertoni da Silveira; Waldemiro Gremski; Olga Meiri Chaim; Andrea Senff-Ribeiro; Helena Bonciani Nader; Silvio Sanches Veiga

    2013-01-01

    Loxoscelism is the designation given to clinical symptoms evoked by Loxosceles spider's bites. Clinical manifestations include skin necrosis with gravitational spreading and systemic disturbs. The venom contains several enzymatic toxins. Herein, we describe the cloning, expression, refolding and biological evaluation of a novel brown spider protein characterized as a hyaluronidase. Employing a venom gland cDNA library, we cloned a hyaluronidase (1200 bp cDNA) that encodes for a signal peptide...

  6. Does women’s greater fear of snakes and spiders originate in infancy?

    OpenAIRE

    Rakison, David H.

    2009-01-01

    Previous studies with adult humans and non-human animals revealed more rapid fear learning for spiders and snakes than for mushrooms and flowers. The current experiments tested whether 11-month-olds show a similar effect in learning associative pairings between facial emotions and fear-relevant and fear-irrelevant stimuli. Consistent with the greater incidence of snake and spider phobias in women, results show that female but not male infants learn rapidly to associate negative facial emotion...

  7. Effects of spider Macrothele raven venom on cell proliferation and cytotoxicity in HeLa cells

    Institute of Scientific and Technical Information of China (English)

    Li GAO; Bao-en SHAN; Jing CHEN; Jiang-hui LIU; Da-xiang SONG; Bao-cheng ZHU

    2005-01-01

    Aim: To examine the effect of venom from the spider Macrothele raven on cell proliferation and cytotoxicity in human cervical carcinoma, HeLa cells. Methods:Morphological and biochemical signs of apoptosis appeared using acridine orange-ethidium bromide (AO/EB) staining. Marked morphological changes in HeLa cells after treatment with spider venom were observed using scanning electron microscopy (SEM) and transmission electron microscopy (TEM). Cell proliferation and cytotoxicity were determined by [methyl-3H] thymidine assay ([3H]TdR) and lactate dehydrogenase (LDH) release, respectively. DNA fragmentation and cell cycle distribution were monitored using flow cytometry. In addition, Western blot analysis was used to evaluate the level of caspase-3 expression. In vivo examination of the inhibition of the size of tumors in nude mice treated with spider venom was measured. Results: Marked morphological changes were observed using AO/EB staining, SEM and TEM assay. Spider venom at concentrations of 10-40 mg/L caused dose- and time-dependent inhibition of HeLa cell proliferation.The ratio of apoptosis and necrosis increased. The activity of caspase-3 was upregulated after spider venom treatment. In vivo study of tumor size revealed that tumors significantly decreased in size from controls to tumors treated for 3 weeks with spider venom (P<0.05). Conclusion: The inhibition of HeLa cells by the venom of the spider Macrothele raveni was carried out in three ways: induction of apoptosis, necrosis of toxicity damage and direct lysis. Spider venom is a novel anti-tumor material both in vitro and in vivo.

  8. Milking and partial characterization of venom from the Brazilian spider Vitalius dubius (Theraphosidae).

    Science.gov (United States)

    Rocha-E-Silva, Thomaz A A; Sutti, Rafael; Hyslop, Stephen

    2009-01-01

    The theraphosid spider genus Vitalius contains several species found in southeastern Brazil. In this work, we used electrostimulation to obtain venom from Vitalius dubius and examined its general composition. Male spiders yielded significantly less (p venom (12.5 +/- 0.7 mg of liquid/spider, n = 16; mean +/- S.E.M.) than female spiders (25.5 +/- 2.0 mg of liquid/spider, n = 11). However, when corrected for spider weight, males yielded slightly more venom (2.89 +/- 0.16 mg/g vs. 2.45 +/- 0.76 mg/g for males and females, respectively, p Venom yield correlated linearly with spider weight for spiders weighing up to approximately 12-13 g, but decreased in very heavy females. There was a marked decrease in venom yield after the first milking. The protein concentration of pooled venom was 18.3 +/- 2.4 mg/ml (n = 4) and accounted for 16.6 +/- 4.7% of the dry venom weight. The venom contained high hyaluronidase activity (275 +/- 24 TRU/mg of protein, n = 4), with a molecular mass of approximately 45 kDa estimated by zymography. SDS-PAGE revealed a few proteins with molecular masses >14 kDa but showed two staining bands of peptides venom reacted in ELISA with affinity-purified IgG from commercial arachnidic antivenom. Immunoblotting with this IgG detected proteins of 30-140 kDa only. Fractionation of the venom by reverse-phase chromatography resulted in five major and eight minor peaks.

  9. Development and reproduction of spider mites Tetranychus turkestani (Acari: Tetranychidae) under water deficit condition in soybeans

    OpenAIRE

    Ivelina Nikolova; Natalia Georgieva; Jordanka Naydenova

    2014-01-01

    One of the major pests of soybeans in Bulgaria is the spider mite Tetranychus turkestani Ug et Nik (Acari: Tetranychidae) and different results have been reported about the impact of water stress on its development and reproduction. Soybean plants exposed to natural infestation by spider mites, water deficit and treatment with imidacloprid were examined under greenhouse conditions at the Institute of Forage Crops, Pleven, Bulgaria, over the period 2011-2012...

  10. Osteomyelitis of the Mandibular Symphysis Caused by Brown Recluse Spider Bite

    OpenAIRE

    Naidu, Deepak K.; Ghurani, Rami; Salas, R. Emerick; Mannari, Rudolph J.; Robson, Martin C.; Payne, Wyatt G.

    2008-01-01

    Background: Brown recluse spider bites cause significant trauma via their tissue toxic venom. Diagnosis of these injuries and envenomation is difficult and many times presumptive. Treatment is varied and dependent upon presentation and course of injury. Materials and Methods: We present a case of a previously unreported incidence of osteomyelitis of the mandible as a result of a brown recluse spider bite. A review of the literature and discussion of diagnosis and treatment of brown recluse sp...

  11. Reversible Myocarditis and Pericarditis after Black Widow Spider Bite or Kounis Syndrome?

    OpenAIRE

    Mehmet Yaman; Turkan Mete; Ismail Ozer; Elif Yaman; Osman Beton

    2015-01-01

    Clinical manifestation of black widow spider bite is variable and occasionally leads to death in rural areas. Cases of myocarditis and pericarditis after black widow spider bite are rare and the associated prognostic significance is unknown. Kounis syndrome has been defined as an acute coronary syndrome in the setting of allergic or hypersensitivity and anaphylactic or anaphylactoid insults that manifests as vasospastic angina or acute myocardial infarction or stent thrombosis. Allergic myoca...

  12. Potential lethal and non-lethal effects of predators on dispersal of spider mites.

    OpenAIRE

    Otsuki, Hatsune; Yano, Shuichi

    2014-01-01

    Predators can affect prey dispersal lethally by direct consumption or non-lethally by making prey hesitate to disperse. These lethal and non-lethal effects are detectable only in systems where prey can disperse between multiple patches. However, most studies have drawn their conclusions concerning the ability of predatory mites to suppress spider mites based on observations of their interactions on a single patch or on heavily infested host plants where spider mites could hardly disperse towa...

  13. Linking Native and Invader Traits Explains Native Spider Population Responses to Plant Invasion.

    Science.gov (United States)

    Smith, Jennifer N; Emlen, Douglas J; Pearson, Dean E

    2016-01-01

    Theoretically, the functional traits of native species should determine how natives respond to invader-driven changes. To explore this idea, we simulated a large-scale plant invasion using dead spotted knapweed (Centaurea stoebe) stems to determine if native spiders' web-building behaviors could explain differences in spider population responses to structural changes arising from C. stoebe invasion. After two years, irregular web-spiders were >30 times more abundant and orb weavers were >23 times more abundant on simulated invasion plots compared to controls. Additionally, irregular web-spiders on simulated invasion plots built webs that were 4.4 times larger and 5.0 times more likely to capture prey, leading to >2-fold increases in recruitment. Orb-weavers showed no differences in web size or prey captures between treatments. Web-spider responses to simulated invasion mimicked patterns following natural invasions, confirming that C. stoebe's architecture is likely the primary attribute driving native spider responses to these invasions. Differences in spider responses were attributable to differences in web construction behaviors relative to historic web substrate constraints. Orb-weavers in this system constructed webs between multiple plants, so they were limited by the overall quantity of native substrates but not by the architecture of individual native plant species. Irregular web-spiders built their webs within individual plants and were greatly constrained by the diminutive architecture of native plant substrates, so they were limited both by quantity and quality of native substrates. Evaluating native species traits in the context of invader-driven change can explain invasion outcomes and help to identify factors limiting native populations.

  14. Communities of ground-living spiders in deciduous forests: Does tree species diversity matter?

    OpenAIRE

    Schuldt, Andreas; Fahrenholz, Nadine; Brauns, Mascha; Migge-Kleian, Sonja; Platner, Christian; Schaefer, Matthias

    2008-01-01

    The relationships between species diversity and ecosystem functions are in the focus of recent ecological research. However, until now the influence of species diversity on ecosystem processes such as decomposition or mineral cycling is not well understood. In deciduous forests, spiders are an integral part of the forest floor food web. In the present study, patterns of spider diversity and community structure are related to diversity of deciduous forest stands in the Hainich National Park (T...

  15. A Tank Bromeliad Favors Spider Presence in a Neotropical Inundated Forest

    OpenAIRE

    Yann Hénaut; Bruno Corbara; Laurent Pélozuelo; Frédéric Azémar; Régis Céréghino; Bruno Herault; Alain Dejean

    2014-01-01

    Tank bromeliads are good models for understanding how climate change may affect biotic associations. We studied the relationships between spiders, the epiphytic tank bromeliad, Aechmea bracteata, and its associated ants in an inundated forest in Quintana Roo, Mexico, during a drought period while, exceptionally, this forest was dry and then during the flooding that followed. We compared spider abundance and diversity between 'Aechmea-areas' and 'control-areas' of the same surface area. We rec...

  16. Physical characterization of functionalized spider silk: electronic and sensing properties

    Directory of Open Access Journals (Sweden)

    Eden Steven, Jin Gyu Park, Anant Paravastu, Elsa Branco Lopes, James S Brooks, Ongi Englander, Theo Siegrist, Papatya Kaner and Rufina G Alamo

    2011-01-01

    Full Text Available This work explores functional, fundamental and applied aspects of naturally harvested spider silk fibers. Natural silk is a protein polymer where different amino acids control the physical properties of fibroin bundles, producing, for example, combinations of β-sheet (crystalline and amorphous (helical structural regions. This complexity presents opportunities for functional modification to obtain new types of material properties. Electrical conductivity is the starting point of this investigation, where the insulating nature of neat silk under ambient conditions is described first. Modification of the conductivity by humidity, exposure to polar solvents, iodine doping, pyrolization and deposition of a thin metallic film are explored next. The conductivity increases exponentially with relative humidity and/or solvent, whereas only an incremental increase occurs after iodine doping. In contrast, iodine doping, optimal at 70 °C, has a strong effect on the morphology of silk bundles (increasing their size, on the process of pyrolization (suppressing mass loss rates and on the resulting carbonized fiber structure (that becomes more robust against bending and strain. The effects of iodine doping and other functional parameters (vacuum and thin film coating motivated an investigation with magic angle spinning nuclear magnetic resonance (MAS-NMR to monitor doping-induced changes in the amino acid-protein backbone signature. MAS-NMR revealed a moderate effect of iodine on the helical and β-sheet structures, and a lesser effect of gold sputtering. The effects of iodine doping were further probed by Fourier transform infrared (FTIR spectroscopy, revealing a partial transformation of β-sheet-to-amorphous constituency. A model is proposed, based on the findings from the MAS-NMR and FTIR, which involves iodine-induced changes in the silk fibroin bundle environment that can account for the altered physical properties. Finally, proof

  17. Physical characterization of functionalized spider silk: electronic and sensing properties

    International Nuclear Information System (INIS)

    This work explores functional, fundamental and applied aspects of naturally harvested spider silk fibers. Natural silk is a protein polymer where different amino acids control the physical properties of fibroin bundles, producing, for example, combinations of β-sheet (crystalline) and amorphous (helical) structural regions. This complexity presents opportunities for functional modification to obtain new types of material properties. Electrical conductivity is the starting point of this investigation, where the insulating nature of neat silk under ambient conditions is described first. Modification of the conductivity by humidity, exposure to polar solvents, iodine doping, pyrolization and deposition of a thin metallic film are explored next. The conductivity increases exponentially with relative humidity and/or solvent, whereas only an incremental increase occurs after iodine doping. In contrast, iodine doping, optimal at 70 deg. C, has a strong effect on the morphology of silk bundles (increasing their size), on the process of pyrolization (suppressing mass loss rates) and on the resulting carbonized fiber structure (that becomes more robust against bending and strain). The effects of iodine doping and other functional parameters (vacuum and thin film coating) motivated an investigation with magic angle spinning nuclear magnetic resonance (MAS-NMR) to monitor doping-induced changes in the amino acid-protein backbone signature. MAS-NMR revealed a moderate effect of iodine on the helical and β-sheet structures, and a lesser effect of gold sputtering. The effects of iodine doping were further probed by Fourier transform infrared (FTIR) spectroscopy, revealing a partial transformation of β-sheet-to-amorphous constituency. A model is proposed, based on the findings from the MAS-NMR and FTIR, which involves iodine-induced changes in the silk fibroin bundle environment that can account for the altered physical properties. Finally, proof-of-concept applications of

  18. Association Between Sensitization to Outdoor Spider Mites and Clinical Manifestations of Asthma and Rhinitis in the General Population of Adults

    OpenAIRE

    Kim, Tae-Bum; Kim, Yoon-Keun; Chang, Yoon-Seok; Kim, Sang-Hoon; Hong, Sung-Chul; Jee, Young-Koo; Cho, Sang-Heon; Min, Kyung-Up; Kim, You-Young

    2006-01-01

    It has been demonstrated that spider mites such as the two-spotted spider mite (Tetranychus urticae) are important allergens for fruit farmers. A total of 2,467 adults (795 metropolitan urban, 788 non-metropolitan urban, and 884 rural subjects) were enrolled. They responded to the questionnaire, and underwent methacholine bronchial provocation tests as well as skin prick tests to locally common aeroallergens including the two-spotted spider mite. The prevalences of asthma and rhinitis as repo...

  19. Habitat preferences, diet, feeding strategy and social organisation of the black spider monkey (Ateles panisius paniscus L.) in Surinam

    OpenAIRE

    Roosmalen, van, J.

    1980-01-01

    This study describes habitat choice of the Surinam black spider monkey ( Atelespaniscuspaniscus ) and clarifies complex temporal and spatial effects of food sources on the behaviour of a group of spider monkeys in a 350 ha study area in central Surinam in terms of food category, food plant identity and phenology, and in terms of quantity, density and dispersion of the most important of these food sources. It recognizes the fundamental importance of mature-fruit feeding to spider-monkey foragi...

  20. The effect of ageing on the mechanical properties of the silk of the bridge spider Larinioides cornutus (Clerck, 1757)

    OpenAIRE

    Emiliano Lepore; Marco Isaia; Stefano Mammola; Nicola Pugno

    2016-01-01

    Spider silk is regarded as one of the best natural polymer fibers especially in terms of low density, high tensile strength and high elongation until breaking. Since only a few bio-engineering studies have been focused on spider silk ageing, we conducted nano-tensile tests on the vertical naturally spun silk fibers of the bridge spider Larinioides cornutus (Clerck, 1757) (Arachnida, Araneae) to evaluate changes in the mechanical properties of the silk (ultimate stress and strain, Young’s modu...

  1. SVM-Based Prediction of Propeptide Cleavage Sites in Spider Toxins Identifies Toxin Innovation in an Australian Tarantula

    OpenAIRE

    Wong, Emily S. W.; Hardy, Margaret C.; David Wood; Timothy Bailey; Glenn F. King

    2013-01-01

    Spider neurotoxins are commonly used as pharmacological tools and are a popular source of novel compounds with therapeutic and agrochemical potential. Since venom peptides are inherently toxic, the host spider must employ strategies to avoid adverse effects prior to venom use. It is partly for this reason that most spider toxins encode a protective proregion that upon enzymatic cleavage is excised from the mature peptide. In order to identify the mature toxin sequence directly from toxin tran...

  2. Local and Landscape Correlates of Spider Activity Density and Species Richness in Urban Gardens.

    Science.gov (United States)

    Otoshi, Michelle D; Bichier, Peter; Philpott, Stacy M

    2015-08-01

    Urbanization is a major threat to arthropod biodiversity and abundance due to reduction and loss of suitable natural habitat. Green spaces and small-scale agricultural areas may provide habitat and resources for arthropods within densely developed cities. We studied spider activity density (a measure of both abundance and degree of movement) and diversity in urban gardens in Santa Cruz, Santa Clara, and Monterey counties in central California, USA. We sampled for spiders with pitfall traps and sampled 38 local site characteristics for 5 mo in 19 garden sites to determine the relative importance of individual local factors. We also analyzed 16 landscape variables at 500-m and 1-km buffers surrounding each garden to determine the significance of landscape factors. We identified individuals from the most common families to species and identified individuals from other families to morphospecies. Species from the families Lycosidae and Gnaphosidae composed 81% of total adult spider individuals. Most of the significant factors that correlated with spider activity density and richness were local rather than landscape factors. Spider activity density and richness increased with mulch cover and flowering plant species, and decreased with bare soil. Thus, changes in local garden management have the potential to promote diversity of functionally important spiders in urban environments. PMID:26314049

  3. Evaluation of the efficacy of vacuum cleaners for the integrated control of brown spider Loxosceles intermedia

    Directory of Open Access Journals (Sweden)

    E. N. Ramires

    2007-01-01

    Full Text Available Some venomous spiders of the genus Loxosceles can reach high population densities inside and around houses. In Brazil, most spider accidents are related to Loxosceles intermedia. Control of loxoscelism should utilize integrated pest management tools, such as vacuum cleaners, to eliminate egg sacs, webs and spiders. The present study tested the efficacy of one type of vacuum cleaner (for professional and domestic use in the control of L. intermedia populations. Cockroaches (Pycnoscelus surinamensis were used in some tests for comparison. Vacuuming using standard accessories or a paper tube resulted in the death of all female (n=60, male (n=60, young (n=60 and just-hatched (n=60 L. intermedia, and all egg sacs (n=5 were destroyed. The removal of the plastic plate present at the bottom of the vacuuming tube inside the machine allowed some spiders to survive the vacuuming process. When kept inside a vacuum bag full of dust and debris, adult females (n=10 survived for 10 days; however, significant mortality was observed among male (n=10 and young individuals (n=10. Addition of cornstarch to the vacuum bag did not affect the spiders (n=20. Vacuum cleaners, such as the one used in the present investigation, are promising tools for integrated management of L. intermedia and other spiders in domestic environments.

  4. Stage-based mortality of grassland grasshoppers (Acrididae) from wandering spider (Lycosidae) predation

    Science.gov (United States)

    Oedekoven, Mark A.; Joern, Anthony

    1998-12-01

    Mortality rates in insects, including grasshoppers (Acrididae), are often stage- or size-specific. We estimated stage-specific mortality rates for three common grasshopper species from a Nebraska (USA) sandhills grassland ( Ageneotettix deorum, Melanoplus sanguinipes and Phoetaliotes nebrascensis), and partitioned the impact due to wandering spider predation from remaining sources. Survivorship was estimated for multiple developmental stages (3rd instar through adult) under experimental conditions that either prevented or permitted predation from free-living, wandering spiders (primarily Schizocosa species). Total stage-specific mortality, including spider predation, examined over the period of single stages was greatest for the youngest stages (91% for 3rd instar, 73% for 4th instar, 63.5% for 5th instar and 30.4% for adults). For the developmental stages considered and averaged for all species, the contribution to total mortality from spider predation over the 10-d period (approximately the length of a developmental stage) ranged from 17% for 3rd instar nymphs to 23% for 4th and 5th instars, and an undetectable level for adults. While spiders may depress grasshopper numbers, contributions from spider predation to grasshopper population dynamics are uncertain.

  5. Fecal and Salivary Cortisol Concentrations in Woolly (Lagothrix ssp. and Spider Monkeys (Ateles spp.

    Directory of Open Access Journals (Sweden)

    Kimberly D. Ange-van Heugten

    2009-01-01

    Full Text Available Detrimental physiological effects due to stressors can contribute to the low captive success of primates. The objective of this research was to investigate the potential impact of diet composition on cortisol concentrations in feces and saliva in woolly (n=27 and spider monkeys (n=61. The research was conducted in three studies: the first investigated spider monkeys in the United States, the second investigated spider monkeys within Europe, and the third investigated woolly monkeys within Europe. Fecal cortisol in spider monkeys in US zoos varied (P=.07 from 30 to 66 ng/g. The zoo with the highest fecal cortisol also had the highest salivary cortisol (P≤.05. For European zoos, fecal cortisol differed between zoos for both spider and woolly monkeys (P≤.05. Spider monkeys had higher fecal cortisol than woolly monkeys (P≤.05. Zoos with the highest dietary carbohydrates, sugars, glucose, and fruit had the highest cortisol. Cortisol was highest for zoos that did not meet crude protein requirements and fed the lowest percentage of complete feeds and crude fiber. Differences among zoos in housing and diets may increase animal stress. The lifespan and reproductive success of captive primates could improve if stressors are reduced and dietary nutrients optimized.

  6. ADP is a vasodilator component from Lasiodora sp. mygalomorph spider venom.

    Science.gov (United States)

    Horta, C C; Rezende, B A; Oliveira-Mendes, B B R; Carmo, A O; Capettini, L S A; Silva, J F; Gomes, M T; Chávez-Olórtegui, C; Bravo, C E S; Lemos, V S; Kalapothakis, E

    2013-09-01

    Members of the spider genus Lasiodora are widely distributed in Brazil, where they are commonly known as caranguejeiras. Lasiodora spider venom is slightly harmful to humans. The bite of this spider causes local pain, edema and erythema. However, Lasiodora sp. spider venom may be a source of important pharmacological tools. Our research group has described previously that Lasiodora sp. venom produces bradycardia in the isolated rat heart. In the present work, we sought to evaluate the vascular effect of Lasiodora sp. venom and to isolate the vasoactive compounds from the venom. The results showed that Lasiodora spider venom induced a concentration-dependent vasodilation in rat aortic rings, which was dependent on the presence of a functional endothelium and abolished by the nitric oxide synthase (NOS) inhibitor L-NAME. Western blot experiments revealed that the venom also increased endothelial NOS function by increasing phosphorylation of the Ser¹¹⁷⁷ residue. Assay-directed fractionation isolated a vasoactive fraction from Lasiodora sp. venom. Mass spectrometry (MS) and nuclear magnetic resonance (NMR) assays identified a mixture of two compounds: adenosine diphosphate (ADP, approximately 90%) and adenosine monophosphate (AMP, approximately 10%). The vasodilator effects of Lasiodora sp. whole venom, as well as ADP, were significantly inhibited by suramin, which is a purinergic P2-receptor antagonist. Therefore, the results of the present work indicate that ADP is a main vasodilator component of Lasiodora sp. spider venom.

  7. Potential lethal and non-lethal effects of predators on dispersal of spider mites.

    Science.gov (United States)

    Otsuki, Hatsune; Yano, Shuichi

    2014-11-01

    Predators can affect prey dispersal lethally by direct consumption or non-lethally by making prey hesitate to disperse. These lethal and non-lethal effects are detectable only in systems where prey can disperse between multiple patches. However, most studies have drawn their conclusions concerning the ability of predatory mites to suppress spider mites based on observations of their interactions on a single patch or on heavily infested host plants where spider mites could hardly disperse toward intact patches. In these systems, specialist predatory mites that penetrate protective webs produced by spider mites quickly suppress the spider mites, whereas generalist predators that cannot penetrate the webs were ineffective. By using a connected patch system, we revealed that a generalist ant, Pristomyrmex punctatus Mayr (Hymenoptera: Formicidae), effectively prevented dispersal of spider mites, Tetranychus kanzawai Kishida (Acari: Tetranychidae), by directly consuming dispersing individuals. We also revealed that a generalist predatory mite, Euseius sojaensis Ehara (Acari: Phytoseiidae), prevented between-patch dispersal of T. kanzawai by making them hesitate to disperse. In contrast, a specialist phytoseiid predatory mite, Neoseiulus womersleyi Schicha, allowed spider mites to escape an initial patch, increasing the number of colonized patches within the system. Our results suggest that ants and generalist predatory mites can effectively suppress Tetranychus species under some conditions, and should receive more attention as agents for conservation biological control in agroecosystems.

  8. Parasitism of Trombidium brevimanum larvae on agrobiont linyphiid spiders from Germany.

    Science.gov (United States)

    Tomić, Vladimir; Mąkol, Joanna; Stamenković, Srdjan; Büchs, Wolfgang; Prescher, Sabine; Sivčev, Ivan; Graora, Draga; Sivčev, Lazar; Gotlin-Čuljak, Tatjana; Dudić, Boris

    2015-08-01

    An experiment on three differently-managed agricultural fields in Ahlum, Germany, which aimed at establishing the impact of different management systems on the biodiversity of predators and decomposers, yielded a significant number of spiders parasitized by larvae of Trombidium brevimanum (Actinotrichida, Parasitengona, Trombidiidae). Spider data from the whole sampling period (September 2010-July 2012), indicated that ectoparasitic larvae were recorded only on spiders in pitfall traps in the period of June-July 2011. In this period, only eight species of Linyphiidae--out of 42 species assigned to nine spider families recorded from the study area--were parasitized by mites; considerable levels of parasitism were recorded on Erigone atra, E. dentipalpis, and Oedothorax apicatus. The highest prevalence of parasitism was recorded on the organic field for E. atra (29%), while on the integrated and conventional fields significantly fewer parasitized spiders were observed. The preferred attachment sites on the spider host were regions with softer cuticle, especially regions on the carapace and on the abdomen, adjacent to the pedicel.

  9. Influence of host plant species on the development and reproduction of hawthorn spider mites

    Institute of Scientific and Technical Information of China (English)

    Li Dingxu; Hou Yueli; Shen Zuorui

    2006-01-01

    A leaf disc bioassay was employed to investigate the influence of host species of deciduous fruit trees,like apple,peach,plum,cherry and apricot,on the development and reproduction of the hawthorn spider mite Tetranychus viennensis Zacher in the laboratory under conditions of 25±1℃,60±10% RH and a photoperiod of 16 h: 8 h light:dark.This was done by determining the duration of each life stage of the mites,the intrinsic rate of population increase (Tm),mean generation time (T) and net reproductive rate (R0)of the spider mites on each of the host plant species.Differences in life table parameters of the spider mite among host plants were analyzed with the jack-knife method.The results indicated that plum might be the best suitable plant for the spider mite among the plants tested due to shorter developmental period and higher intrinsic rate of increase,whereas cherry and apricot were least suitable due to their long developmental duration and low intrinsic rates of increase.When the spider mites were transferred from apple to other fruit trees,negative effects on developmental duration, fecundity and life table parameters were found in the first generation,but the effects faded out in succeeding generations.When transferred onto plum and peach,the spider mite adapted to the new hosts in the second generation;however,on cherry and apricot,it adapted in the third generation.

  10. Potential lethal and non-lethal effects of predators on dispersal of spider mites.

    Science.gov (United States)

    Otsuki, Hatsune; Yano, Shuichi

    2014-11-01

    Predators can affect prey dispersal lethally by direct consumption or non-lethally by making prey hesitate to disperse. These lethal and non-lethal effects are detectable only in systems where prey can disperse between multiple patches. However, most studies have drawn their conclusions concerning the ability of predatory mites to suppress spider mites based on observations of their interactions on a single patch or on heavily infested host plants where spider mites could hardly disperse toward intact patches. In these systems, specialist predatory mites that penetrate protective webs produced by spider mites quickly suppress the spider mites, whereas generalist predators that cannot penetrate the webs were ineffective. By using a connected patch system, we revealed that a generalist ant, Pristomyrmex punctatus Mayr (Hymenoptera: Formicidae), effectively prevented dispersal of spider mites, Tetranychus kanzawai Kishida (Acari: Tetranychidae), by directly consuming dispersing individuals. We also revealed that a generalist predatory mite, Euseius sojaensis Ehara (Acari: Phytoseiidae), prevented between-patch dispersal of T. kanzawai by making them hesitate to disperse. In contrast, a specialist phytoseiid predatory mite, Neoseiulus womersleyi Schicha, allowed spider mites to escape an initial patch, increasing the number of colonized patches within the system. Our results suggest that ants and generalist predatory mites can effectively suppress Tetranychus species under some conditions, and should receive more attention as agents for conservation biological control in agroecosystems. PMID:24867061

  11. Geophagy in brown spider monkeys (Ateles hybridus) in a lowland tropical rainforest in Colombia.

    Science.gov (United States)

    Link, Andres; de Luna, Ana Gabriela; Arango, Ricardo; Diaz, Maria Clara

    2011-01-01

    Spider monkeys and howler monkeys are the only Neotropical primates that eat soil from mineral licks. Not all species within these genera visit mineral licks, and geophagy has been restricted to populations of Ateles belzebuth belzebuth,Ateles belzebuth chamek and Alouatta seniculus in western Amazonian rainforests. With the aid of a camera trap we studied the visitation patterns of a group of brown spider monkeys (Ateles hybridus) to a mineral lick at Serrania de Las Quinchas, in Colombia. Spider monkeys visited the lick frequently throughout the year, with a monthly average of 21.7 ± 7.2 visits per 100 days of camera trapping (n = 14 months). Spider monkeys visited the mineral lick almost always on days with no rain, or very little (<3 mm) rain, suggesting that proximate environmental variables might determine spider monkeys' decisions to come to the ground at the licks. This study expands the geographical occurrence of mineral lick use by spider monkeys providing additional data for future assessments on the biogeographical correlates of mineral lick use by platyrrhines. PMID:21494049

  12. Composition and Function of Spider Glues Maintained During the Evolution of Cobwebs.

    Science.gov (United States)

    Jain, Dharamdeep; Zhang, Ci; Cool, Lydia Rose; Blackledge, Todd A; Wesdemiotis, Chrys; Miyoshi, Toshikazu; Dhinojwala, Ali

    2015-10-12

    Capture silks are an interesting class of biological glues that help spiders subdue their prey. Viscid capture silk produced by the orb web spiders is a combination of hygroscopic salts that aid in water uptake and interact with adhesive glycoproteins to make them soft and sticky. The orb was a stepping stone to the evolution of new web types, but little is known about the adhesives in these webs. For instance, cobweb spiders evolved from orb-weaving ancestors and utilize glue in specialized sticky gumfoot threads rather than an elastic spiral. Early investigation suggests that gumfoot adhesives are quite different viscid glues because they lack a visible glycoprotein core, act as viscoelastic fluids rather than solids, and are largely invariant to humidity. Here, we use spectroscopic and staining methods to show that the gumfoot silk produced by Latrodectus hesperus (western black widow) is composed of hygroscopic organic salts and water insoluble glycoproteins, similar to viscid silk, in addition to a low concentration of spider coating peptides reported before. Our adhesion studies reveal that the organic salts play an important role in adhesion, similar to that seen in orb web spiders, but modulating function at much lower humidity. Our work shows more similarities in the viscid silk produced by orb web and cobweb spiders than previously anticipated and provide guidelines for developing synthetic adhesives that can work in dry to humid environments.

  13. Tactile learning by a whip spider, Phrynus marginemaculatus C.L. Koch (Arachnida, Amblypygi).

    Science.gov (United States)

    Santer, Roger D; Hebets, Eileen A

    2009-04-01

    The ability of animals to learn and remember underpins many behavioural actions and can be crucial for survival in certain contexts, for example in finding and recognising a habitual refuge. The sensory cues that an animal learns in such situations are to an extent determined by its own sensory specialisations. Whip spiders (Arachnida, Amblypygi) are nocturnal and possess uniquely specialised sensory systems that include elongated 'antenniform' forelegs specialised for use as chemo- and mechanosensory feelers. We tested the tactile learning abilities of the whip spider Phrynus marginemaculatus in a maze learning task with two tactile cues of different texture--one associated with an accessible refuge, and the other with an inaccessible refuge. Over ten training trials, whip spiders got faster and more accurate at finding the accessible refuge. During a subsequent test trial where both refuges were inaccessible, whip spiders searched for significantly longer at the tactile cue previously associated with the accessible refuge. Using high-speed cinematography, we describe three distinct antenniform leg movements used by whip spiders during tactile examination. We discuss the potential importance of tactile learning in whip spider behaviour and a possible role for their unique giant sensory neurons in accessing tactile information. PMID:19198849

  14. Dangerous mating systems: signal complexity, signal content and neural capacity in spiders.

    Science.gov (United States)

    Herberstein, M E; Wignall, A E; Hebets, E A; Schneider, J M

    2014-10-01

    Spiders are highly efficient predators in possession of exquisite sensory capacities for ambushing prey, combined with machinery for launching rapid and determined attacks. As a consequence, any sexually motivated approach carries a risk of ending up as prey rather than as a mate. Sexual selection has shaped courtship to effectively communicate the presence, identity, motivation and/or quality of potential mates, which help ameliorate these risks. Spiders communicate this information via several sensory channels, including mechanical (e.g. vibrational), visual and/or chemical, with examples of multimodal signalling beginning to emerge in the literature. The diverse environments that spiders inhabit have further shaped courtship content and form. While our understanding of spider neurobiology remains in its infancy, recent studies are highlighting the unique and considerable capacities of spiders to process and respond to complex sexual signals. As a result, the dangerous mating systems of spiders are providing important insights into how ecology shapes the evolution of communication systems, with future work offering the potential to link this complex communication with its neural processes. PMID:25088579

  15. Spider web glue: two proteins expressed from opposite strands of the same DNA sequence.

    Science.gov (United States)

    Choresh, Omer; Bayarmagnai, Battuya; Lewis, Randolph V

    2009-10-12

    The various silks that make up the web of the orb web spiders have been studied extensively. However, success in prey capture depends as much on the web glue as on the fibers. Spider silk glue, which is considered one of the strongest and most effective biological glues, is an aqueous solution secreted from the orb weaving spider's aggregate glands and coats the spiral prey capturing threads of their webs. Studies identified the major component of the glue as microscopic nodules made of a glycoprotein. This study describes two newly discovered proteins that form the glue-glycoprotein of the golden orb weaving spider Nephila clavipes . Our results demonstrate that both proteins contain unique 110 amino acid repetitive domains that are encoded by opposite strands of the same DNA sequence. Thus, the genome of the spider encodes two distinct yet functionally related genes by using both strands of an identical DNA sequence. Moreover, the closest match for the nonrepetitive region of one of the proteins is chitin binding proteins. The web glue appears to have evolved a substantial level of sophistication matching that of the spider silk fibers.

  16. A verified spider bite and a review of the literature confirm Indian ornamental tree spiders (Poecilotheria species) as underestimated theraphosids of medical importance.

    Science.gov (United States)

    Fuchs, Joan; von Dechend, Margot; Mordasini, Raffaella; Ceschi, Alessandro; Nentwig, Wolfgang

    2014-01-01

    Literature on bird spider or tarantula bites (Theraphosidae) is rare. This is astonishing as they are coveted pets and interaction with their keepers (feeding, cleaning the terrarium or taking them out to hold) might increase the possibility for bites. Yet, this seems to be a rare event and might be why most theraphosids are considered to be harmless, even though the urticating hairs of many American species can cause disagreeable allergic reactions. We are describing a case of a verified bite by an Indian ornamental tree spider (Poecilotheria regalis), where the patient developed severe, long lasting muscle cramps several hours after the bite. We present a comprehensive review of the literature on bites of these beautiful spiders and conclude that a delayed onset of severe muscle cramps, lasting for days, is characteristic for Poecilotheria bites. We discuss Poecilotheria species as an exception from the general assumption that theraphosid bites are harmless to humans.

  17. Structure and Fibrous Composition of the Egg Case of Spider Argiolpe bruennichi%横纹金蛛卵袋结构与纤维组成

    Institute of Scientific and Technical Information of China (English)

    蒋平; 吕太勇; 肖永红; 江丽琴; 熊超群; 郭聪

    2011-01-01

    The structures and fibrous composition of egg case of the spider (Argiope bruennichi) were examined using SEM as well as amino acid analysis. The egg case is composed of multiple layers of silk, including the frame, outer cover, cover cap, inner cover, egg cover cap and egg wrapping cover, and formed by different colored silk with diameters between hundreds of nanometers and several micrometers. The amino acid composition was similar in the frame silk and typical dragline silk, glycine ( about 37% ) and alanine ( about 25% ) are the most abundant amino acids present, and glutamic acid (about 10% ) , prone (about 7% ) and serine ( about 5% ) as the next most abundant. The amino acid composition of cover silk was similar with typical cylindrical gland silk. In contrast to the frame silk, all cover silk of egg case contained a significant proportion of the serine ( about 22% ) and less glycine ( about 7% ) and prone ( about 2% ), and contained more polar amino and large side acids. The original gland that produce silk fibers with different diameters was analyzed based on the results of SEM and amino acid composition studies.%采用SEM和氨基酸自动分析仪对横纹金蛛(Argiope bruennichi)卵袋的超微结构与氨基酸组成进行了观察研究.结果表明,横纹金蛛卵袋呈封闭的葫形,是由多种丝腺纺出的微米与纳米级的丝纤维形成的多个覆盖层构成,具有多层复杂结构,从外向内分别为:框架、卵袋覆盖帽、外覆盖层和内覆盖层、卵块覆盖帽、卵块包裹层,其中外覆盖层与卵袋覆盖帽内侧面的丝较外侧面的丝排列规则均匀.卵袋框丝与典型的拖牵丝(大壶状腺丝)氨基酸组成相似,甘氨酸和丙氨酸的含量最丰富,分别约占37%和25%,其次是谷氨酸、脯氨酸和丝氨酸,分别约占10%、7%和5%;其余卵袋丝纤维的氨基酸组成与典型的柱状腺丝相似.与卵袋框丝相比,卵袋覆盖层的丝氨酸含量显

  18. David and Goliath: potent venom of an ant-eating spider (Araneae) enables capture of a giant prey

    Science.gov (United States)

    Pekár, Stano; Šedo, Onřej; Líznarová, Eva; Korenko, Stanislav; Zdráhal, Zdeněk

    2014-07-01

    It is rare to find a true predator that repeatedly and routinely kills prey larger than itself. A solitary specialised ant-eating spider of the genus Zodarion can capture a relatively giant prey. We studied the trophic niche of this spider species and investigated its adaptations (behavioural and venomic) that are used to capture ants. We found that the spider captures mainly polymorphic Messor arenarius ants. Adult female spiders captured large morphs while tiny juveniles captured smaller morphs, yet in both cases ants were giant in comparison with spider size. All specimens used an effective prey capture strategy that protected them from ant retaliation. Juvenile and adult spiders were able to paralyse their prey using a single bite. The venom glands of adults were more than 50 times larger than those of juvenile spiders, but the paralysis latency of juveniles was 1.5 times longer. This suggests that this spider species possesses very potent venom already at the juvenile stage. Comparison of the venom composition between juvenile and adult spiders did not reveal significant differences. We discovered here that specialised capture combined with very effective venom enables the capture of giant prey.

  19. EFFECT OF THE SPIDER PEUCETIA VIRIDANS (OXYOPIDAE) ON FLORAL VISITORS AND SEED SET OF CNIDOSCOLUS MULTILOBUS (EUPHORBIACEAE)

    OpenAIRE

    Angélica M. Arango; Jorge López-Portillo; Victor Parra-Tabla; Laura T. Hernández-Salazar; Jorge E. Morales-Mávil; Victor Rico-Gray

    2012-01-01

    We studied the interaction between the plant Cnidoscolus multilobus, its floral visitors and the predator spider Peucetia viridans. The diet of P. viridans was composed exclusively of arthropods (spiders 32%, insects 68%). Body length of prey was 5.9 ± 1.0 mm, and prey size range was 11.0 ± 0.4 mm (i.e. 0.14-1.3 times larger than the spider). Based on feeding frequency and time available for prey capture and feeding, one spider may capture up to 3.9 prey items per day, depending on the time o...

  20. Mapping Learning Outcomes and Assignment Tasks for SPIDER Activities

    Directory of Open Access Journals (Sweden)

    Lyn Brodie

    2011-05-01

    Full Text Available Modern engineering programs have to address rapidly changing technical content and have to enable students to develop transferable skills such as critical evaluation, communication skills and lifelong learning. This paper introduces a combined learning and assessment activity that provides students with opportunities to develop and practice their soft skills, but also extends their theoretical knowledge base. Key tasks included self directed inquiry, oral and written communication as well as peer assessment. To facilitate the SPIDER activities (Select, Prepare and Investigate, Discuss, Evaluate, Reflect, a software tool has been implemented in the learning management system Moodle. Evidence shows increased student engagement and better learning outcomes for both transferable as well as technical skills. The study focuses on generalising the relationship between learning outcomes and assignment tasks as well as activities that drive these tasks. Trail results inform the approach. Staff evaluations and their views of assignments and intended learning outcomes also supported this analysis.

  1. Remote sensing of spider mite damage in California peach orchards

    Science.gov (United States)

    Luedeling, Eike; Hale, Adam; Zhang, Minghua; Bentley, Walter J.; Dharmasri, L. Cecil

    2009-08-01

    Remote sensing techniques can decrease pest monitoring costs in orchards. To evaluate the feasibility of detecting spider mite damage in orchards, we measured visible and near infrared reflectance of 1153 leaves and 392 canopies in 11 peach orchards in California. Pairs of significant wavelengths, identified by Partial Least Squares regression, were combined into normalized difference indices. These and 9 previously published indices were evaluated for correlation with mite damage. Eight spectral regions for leaves and two regions for canopies (at blue and red wavelengths) were significantly correlated with mite damage. These findings were tested by calculating normalized difference indices from the Red and Blue bands of six multispectral aerial images. Index values were linearly correlated with mite damage ( R2 = 0.47), allowing identification of mite hotspots in orchards. However, better standardization of aerial imagery and accounting for perturbing environmental factors will be necessary for making this technique applicable for early mite detection.

  2. Evolutionary Aspects of Acaricide-Resistance Development in Spider Mites

    Directory of Open Access Journals (Sweden)

    Masahiro (Mh. Osakabe

    2009-01-01

    Full Text Available Although the development of acaricide resistance in spider mites is a long-standing issue in agricultural fields, recent problems with acaricide resistance may be characterized by the development of complex- and/or multiresistance to acaricides in distinct classes. Such complexity of resistance is not likely to be a single mechanism. Pesticide resistance involves the microevolution of arthropod pests, and population genetics underlies the evolution. In this review, we address the genetic mechanisms of acaricide resistance evolution. We discuss genetic diversity and linkage of resistance genes, relationships between mite habitat and dispersal, and the effect of dispersal on population genetic structure and the dynamics of resistance genes. Finally, we attempt to present a comprehensive view of acaricide resistance evolution and suggest risks under globalization as well as possible approaches to managing acaricide resistance evolution or emergence.

  3. No discrimination against previous mates in a sexually cannibalistic spider

    Science.gov (United States)

    Fromhage, Lutz; Schneider, Jutta M.

    2005-09-01

    In several animal species, females discriminate against previous mates in subsequent mating decisions, increasing the potential for multiple paternity. In spiders, female choice may take the form of selective sexual cannibalism, which has been shown to bias paternity in favor of particular males. If cannibalistic attacks function to restrict a male's paternity, females may have little interest to remate with males having survived such an attack. We therefore studied the possibility of female discrimination against previous mates in sexually cannibalistic Argiope bruennichi, where females almost always attack their mate at the onset of copulation. We compared mating latency and copulation duration of males having experienced a previous copulation either with the same or with a different female, but found no evidence for discrimination against previous mates. However, males copulated significantly shorter when inserting into a used, compared to a previously unused, genital pore of the female.

  4. Ecology and multilevel selection explain aggression in spider colonies.

    Science.gov (United States)

    Biernaskie, Jay M; Foster, Kevin R

    2016-08-01

    Progress in sociobiology continues to be hindered by abstract debates over methodology and the relative importance of within-group vs. between-group selection. We need concrete biological examples to ground discussions in empirical data. Recent work argued that the levels of aggression in social spider colonies are explained by group-level adaptation. Here, we examine this conclusion using models that incorporate ecological detail while remaining consistent with kin- and multilevel selection frameworks. We show that although levels of aggression are driven, in part, by between-group selection, incorporating universal within-group competition provides a striking fit to the data that is inconsistent with pure group-level adaptation. Instead, our analyses suggest that aggression is favoured primarily as a selfish strategy to compete for resources, despite causing lower group foraging efficiency or higher risk of group extinction. We argue that sociobiology will benefit from a pluralistic approach and stronger links between ecologically informed models and data.

  5. Benefits of cooperation with genetic kin in a subsocial spider

    DEFF Research Database (Denmark)

    Schneider, J.M.; Bilde, T.

    2008-01-01

    relatives include the cost of lowering indirect fitness benefits that could otherwise be achieved through the propagation of shared genes. Kin selection theory has been proved to be of general importance for the origin of cooperative behaviors, but other driving forces, such as direct fitness benefits, can...... also promote helping behavior in many cooperatively breeding taxa. Investigating transitional systems is therefore particularly suitable for understanding the influence of kin selection on the initial spread of cooperative behaviors. Here we investigated the role of kinship in cooperative feeding. We...... used a cross-fostering design to control for genetic relatedness and group membership. Our study animal was the periodic social spider Stegodyphus lineatus, a transitional species that belongs to a genus containing both permanent social and periodic social species. In S. lineatus, the young cooperate...

  6. Climate change and sexual size dimorphism in an Arctic spider.

    Science.gov (United States)

    Høye, Toke Thomas; Hammel, Jörg U; Fuchs, Thomas; Toft, Søren

    2009-08-23

    Climate change is advancing the onset of the growing season and this is happening at a particularly fast rate in the High Arctic. However, in most species the relative fitness implications for males and females remain elusive. Here, we present data on 10 successive cohorts of the wolf spider Pardosa glacialis from Zackenberg in High-Arctic, northeast Greenland. We found marked inter-annual variation in adult body size (carapace width) and this variation was greater in females than in males. Earlier snowmelt during both years of its biennial maturation resulted in larger adult body sizes and a skew towards positive sexual size dimorphism (females bigger than males). These results illustrate the pervasive influence of climate on key life-history traits and indicate that male and female responses to climate should be investigated separately whenever possible. PMID:19435831

  7. Ecology and multilevel selection explain aggression in spider colonies.

    Science.gov (United States)

    Biernaskie, Jay M; Foster, Kevin R

    2016-08-01

    Progress in sociobiology continues to be hindered by abstract debates over methodology and the relative importance of within-group vs. between-group selection. We need concrete biological examples to ground discussions in empirical data. Recent work argued that the levels of aggression in social spider colonies are explained by group-level adaptation. Here, we examine this conclusion using models that incorporate ecological detail while remaining consistent with kin- and multilevel selection frameworks. We show that although levels of aggression are driven, in part, by between-group selection, incorporating universal within-group competition provides a striking fit to the data that is inconsistent with pure group-level adaptation. Instead, our analyses suggest that aggression is favoured primarily as a selfish strategy to compete for resources, despite causing lower group foraging efficiency or higher risk of group extinction. We argue that sociobiology will benefit from a pluralistic approach and stronger links between ecologically informed models and data. PMID:27264438

  8. Traditions in spider monkeys are biased towards the social domain.

    Directory of Open Access Journals (Sweden)

    Claire J Santorelli

    Full Text Available Cross-site comparison studies of behavioral variation can provide evidence for traditions in wild species once ecological and genetic factors are excluded as causes for cross-site differences. These studies ensure behavior variants are considered within the context of a species' ecology and evolutionary adaptations. We examined wide-scale geographic variation in the behavior of spider monkeys (Ateles geoffroyi across five long-term field sites in Central America using a well established ethnographic cross-site survey method. Spider monkeys possess a relatively rare social system with a high degree of fission-fusion dynamics, also typical of chimpanzees (Pan troglodytes and humans (Homo sapiens. From the initial 62 behaviors surveyed 65% failed to meet the necessary criteria for traditions. The remaining 22 behaviors showed cross-site variation in occurrence ranging from absent through to customary, representing to our knowledge, the first documented cases of traditions in this taxon and only the second case of multiple traditions in a New World monkey species. Of the 22 behavioral variants recorded across all sites, on average 57% occurred in the social domain, 19% in food-related domains and 24% in other domains. This social bias contrasts with the food-related bias reported in great ape cross-site comparison studies and has implications for the evolution of human culture. No pattern of geographical radiation was found in relation to distance across sites. Our findings promote A. geoffroyi as a model species to investigate traditions with field and captive based experiments and emphasize the importance of the social domain for the study of animal traditions.

  9. Spatial variation in the strength of mutualism between a jumping spider and a terrestrial bromeliad: Evidence from the stable isotope 15N

    Science.gov (United States)

    Romero, Gustavo Q.; Vasconcellos-Neto, João; Trivelin, Paulo C. O.

    2008-05-01

    Psecas chapoda, a neotropical jumping spider strictly associated with the terrestrial bromeliad Bromelia balansae in cerrados and semi-deciduous forests in South America, effectively contributes to plant nutrition and growth. In this study, our goal was to investigate if spider density caused spatial variations in the strength of this spider-plant mutualism. We found a positive significant relationship between spider density and δ15N values for bromeliad leaves in different forest fragments. Open grassland Bromeliads were associated with spiders and had higher δ15N values compared to forest bromeliads. Although forest bromeliads had no association with spiders their total N concentrations were higher. These results suggest that bromeliad nutrition is likely more litter-based in forests and more spider-based in open grasslands. This study is one of the few to show nutrient provisioning and conditionality in a spider-plant system.

  10. The eunuch phenomenon: adaptive evolution of genital emasculation in sexually dimorphic spiders.

    Science.gov (United States)

    Kuntner, Matjaž; Agnarsson, Ingi; Li, Daiqin

    2015-02-01

    Under natural and sexual selection traits often evolve that secure paternity or maternity through self-sacrifice to predators, rivals, offspring, or partners. Emasculation-males removing their genitals-is an unusual example of such behaviours. Known only in insects and spiders, the phenomenon's adaptiveness is difficult to explain, yet its repeated origins and association with sexual size dimorphism (SSD) and sexual cannibalism suggest an adaptive significance. In spiders, emasculation of paired male sperm-transferring organs - secondary genitals - (hereafter, palps), results in 'eunuchs'. This behaviour has been hypothesized to be adaptive because (i) males plug female genitals with their severed palps (plugging hypothesis), (ii) males remove their palps to become better fighters in male-male contests (better-fighter hypothesis), perhaps reaching higher agility due to reduced total body mass (gloves-off hypothesis), and (iii) males achieve prolonged sperm transfer through severed genitals (remote-copulation hypothesis). Prior research has provided evidence in support of these hypotheses in some orb-weaving spiders but these explanations are far from general. Seeking broad macroevolutionary patterns of spider emasculation, we review the known occurrences, weigh the evidence in support of the hypotheses in each known case, and redefine more precisely the particular cases of emasculation depending on its timing in relation to maturation and mating: 'pre-maturation', 'mating', and 'post-mating'. We use a genus-level spider phylogeny to explore emasculation evolution and to investigate potential evolutionary linkage between emasculation, SSD, lesser genital damage (embolic breakage), and sexual cannibalism (females consuming their mates). We find a complex pattern of spider emasculation evolution, all cases confined to Araneoidea: emasculation evolved at least five and up to 11 times, was lost at least four times, and became further modified at least once. We also find

  11. Responses of ground-dwelling spiders to four hedgerow species on sloped agricultural fields in Southwest

    Institute of Scientific and Technical Information of China (English)

    Yuhong Wu; Qingnian Cai; Chaowen Lin; Yibing Chen; Yuying Li; Xu Cheng

    2009-01-01

    Spiders are important predators in aeroecosystems and contribute to the control of agricultural nect nnnulatinns.Hahitat manage-ment such as the creation of new semi-natural habitats around or within fields enhances spider abundance and species diversity.Using pitfall traps,we investigated the effects of four hedgerow plant svecies.which serve as undisturhed and permanent semi-narimal habitats,on ground-dwelling spider activity density(a parameter of nonulation density and relative activitv)and species richness.Samples were ollected over two winter wheat and two summer maize growing seasons druing 2005-2007 in trial field 1(slope gradient of 20%)and field 2(slope gradient of 12%)at the Ziyane Experimental Site in Sichuan Province,China.The hedgerow species evaluated were Amorpha fruticosa(field 1).Vetiveria zizanioides(field 1),EulahODsis binata (field 2),and Afediraon sativa(field 2).CnmnareA to rnntrnl plots,hedgerow plots had significantly higher activity density and species richness of ground-dwelling spiders within strips in both fields 1 and 2 during the wheat growing season.The presence of hedgerow strins did not augment the activity density and species richness of ground-dwelling spiders within the crop fields during the wheat or maize growing seasons.The ground-dwelling spider activity density within hedgerow strips was significantly higher in the Vetiveria than in the AmorDha nlots and in the Medicago than in the Eulaliopsis plots,and the species richness was significantly higher in the Vetiveria than in the Amornha plots during the wheat season. Our results suggest that hedgerows may serve as important overwinterine sites for ground-dwelling spiders durinjthe wheat growing season.In addition,the diversification of agroecosystems by using hedgerow strips may be a viable strategy for maintaining ground-dwelling spider populations in agricultural areas.However,ground-dwelling spiders did not move into adiacent crop fields;therefore,future work should

  12. Gamma irradiation as a quarantine treatment for spider mites (Acarina: tetranychidae) in horticultural products

    International Nuclear Information System (INIS)

    The carmine spider mite, Tetranychus cinnabarinus (Boisd.), and the two-spotted spider mite, Tetranychus urticae Koch, are closely related species of tetranychid mites (Acarina, Tetranychidae) that respond to gamma irradiation in a similar way. Eggs of both species exposed to gamma radiation early in embryonic development were considerably more susceptible to irradiation than older eggs. The tolerance of eggs to gamma radiation increased in 3-4-day-old eggs, when eye-spots were formed. Nymphs were more resistant to gamma radiation than eggs and larvae. Deteriorative effects of irradiation treatment were reflected in the immatures by their mortality in subsequent developmental stages. A positive relationship between dosage and the percent egg mortality or the mortality of subsequent stages was usually found when the immature stages were irradiated. The sex ratio of adults developed from irradiated eggs, larvae, and nymphs was affected by the irradiation treatment; the ratio was usually skewed towards males. Irradiation of females resulted in increased mortality, lowered fecundity, reduced egg viability, and sex ratio distortion in their progeny. Two-day-old females of the carmine spider mite and the two-spotted spider mite irradiated with 200 or 300 Gy lived as long as the controls. Mortality occurred after 3 weeks. The number of eggs laid by irradiated females of spider mites was considerably lower than in the control, and it decreased as the absorbed dose increased. The higher the dose of gamma radiation applied to adults of the spider mites (the parental generation, P), the higher the mortality of the F1 mites during their embryonic development. Viability of eggs laid by irradiated females of spider mites mated with irradiated males was significantly reduced. Young females treated with a dose of 0.2 kGy produced 40-50% nonviable eggs, while control mites produced only 6.0-6.6% nonviable eggs. A dose of 0.3 kGy caused high mortality of eggs; 88% and 97% nonviable

  13. 'Natural experiment' demonstrates top-down control of spiders by birds on a landscape level.

    Directory of Open Access Journals (Sweden)

    Haldre Rogers

    Full Text Available The combination of small-scale manipulative experiments and large-scale natural experiments provides a powerful approach for demonstrating the importance of top-down trophic control on the ecosystem scale. The most compelling natural experiments have come from studies examining the landscape-scale loss of apex predators like sea otters, wolves, fish and land crabs. Birds are dominant apex predators in terrestrial systems around the world, yet all studies on their role as predators have come from small-scale experiments; the top-down impact of bird loss on their arthropod prey has yet to be examined at a landscape scale. Here, we use a unique natural experiment, the extirpation of insectivorous birds from nearly all forests on the island of Guam by the invasive brown tree snake, to produce the first assessment of the impacts of bird loss on their prey. We focused on spiders because experimental studies showed a consistent top-down effect of birds on spiders. We conducted spider web surveys in native forest on Guam and three nearby islands with healthy bird populations. Spider web densities on the island of Guam were 40 times greater than densities on islands with birds during the wet season, and 2.3 times greater during the dry season. These results confirm the general trend from manipulative experiments conducted in other systems however, the effect size was much greater in this natural experiment than in most manipulative experiments. In addition, bird loss appears to have removed the seasonality of spider webs and led to larger webs in at least one spider species in the forests of Guam than on nearby islands with birds. We discuss several possible mechanisms for the observed changes. Overall, our results suggest that effect sizes from smaller-scale experimental studies may significantly underestimate the impact of bird loss on spider density as demonstrated by this large-scale natural experiment.

  14. A comparative analysis of the morphology and evolution of permanent sperm depletion in spiders.

    Directory of Open Access Journals (Sweden)

    Peter Michalik

    Full Text Available Once thought to be energetically cheap and easy to produce, empirical work has shown that sperm is a costly and limited resource for males. In some spider species, there is behavioral evidence that sperm are permanently depleted after a single mating. This extreme degree of mating investment appears to co-occur with other reproductive strategies common to spiders, e.g. genital mutilation and sexual cannibalism. Here we corroborate that sperm depletion in the golden orb-web spider Nephila clavipes is permanent by uncovering its mechanistic basis using light and electron microscopy. In addition, we use a phylogeny-based statistical analysis to test the evolutionary relationships between permanent sperm depletion (PSD and other reproductive strategies in spiders. Male testes do not produce sperm during adulthood, which is unusual in spiders. Instead, spermatogenesis is nearly synchronous and ends before the maturation molt. Testis size decreases as males approach their maturation molt and reaches its lowest point after sperm is transferred into the male copulatory organs (pedipalps. As a consequence, the amount of sperm available to males for mating is limited to the sperm contained in the pedipalps, and once it is used, males lose their ability to fertilize eggs. Our data suggest that PSD has evolved independently at least three times within web-building spiders and is significantly correlated with the evolution of other mating strategies that limit males to monogamy, including genital mutilation and sexual cannibalism. We conclude that PSD may be an energy-saving adaptation in species where males are limited to monogamy. This could be particularly important in web-building spiders where extreme sexual size dimorphism results in large, sedentary females and small, searching males who rarely feed as adults and are vulnerable to starvation. Future work will explore possible energetic benefits and the evolutionary lability of PSD relative to other

  15. Lyriform slit sense organs on the pedipalps and spinnerets of spiders

    Indian Academy of Sciences (India)

    Bhavani Patil; Suphala Prabhu; K P Rajashekhar

    2006-03-01

    Lyriform slits sense organs (LSSO) are a precise assembly of stress detecting cuticular slit sensilla found on the appendages of arachnids. While these structures on the legs of the wandering spider Cupennius salei are well studied in terms of morphology, function and contribution to behaviour, their distribution on pedipalps and spinnerets of spiders is not well explored. A study was therefore carried out to observe the distribution of LSSO on pedipalps and spinnerets of some spider species. Haplogyne spiders belonging to family Pholcidae have a simple complement of LSSOs represented by one or two LSSOs on their femur. The entelegyne spiders possess a complex assembly of LSSOs on the distal segments of their pedipalps. Various types of LSSOs are found on the pedipalps indicating a capacity for analysis of complex cuticular stress. It is suggested that the complexity of LSSOs on pedipalps of entelegyne spiders relates to courtship and spermatophore transfer and may help in reproductive isolation. Lack of LSSOs on the distal segments of pedipalps leads us to infer that unlike legs, pedipalps are less likely to receive vibratory input through their distal segments. Spinnerets have a relatively simple complement of LSSOs. One LSSO is found only on anterior spinnerets and it is a common feature observed among spiders, irrespective of the variations in web building behaviour. The orb-weaving araneid Argiope pulchella, however, has two LSSOs on the anterior spinneret. As non-web builders and orb weavers do not differ markedly in terms of LSSOs on the spinnerets and LSSOs are simple in nature (type A), it is likely that spinning and weaving are not largely regulated by sensory input from LSSOs on the spinnerets.

  16. [Spider diversity in cultures of Citrus sinensis (Rutaceae) in Corrientes province, Argentina].

    Science.gov (United States)

    Avalos, Gilberto; Bar, Maria Esther; Oscherov, Elena Beatriz; González, Alda

    2013-09-01

    Spiders are predators that reduce insect pest populations in agroecosystems. In spite that the presence of spider assemblages has been described in different crop plants, no reports have been done for Citrus species in Argentina. We studied the spider community associated with cultures of Citrus sinensis in the province of Corrientes, Argentina, in two plots (AM1 irrigated and AM2 unirrigated) of 0.82 hectares each. Spiders were collected monthly by using pitfall traps, hand capture, agitation of foliage and sieving of soil litter. A total of 7174 specimens were collected (33 families, 44 genera and 200 species/morphospecies). The AM1 recorded 3811 individuals (33 families, 179 species/morphospecies) and AM2 3363 individuals (31 families, 174 species/morphospecies). November, December and January showed the highest abundance in both plots. A total of 70% of collected spiders were juveniles. Eight families were the most abundant and represented 75% of spiders collected in both plots, the largest being Lycosidae. We identified eight guilds in both plots, for which the ground runners resulted the most abundant (AM1 n = 1341, s=39, n=999 AM2, s = 33), followed by orb weavers (AM1 n = 637, s = 36; AM2 n = 552, s = 33), the stalkers (AM1 n = 471, s = 43, AM2 n = 453, s = 47) and the space web-builders (AM1 n = 446, s = 23; AM2 n = 342, s = 25). The analysis of alpha diversity in both plots (AM1H' = 4.161, J' = 0.802; AM2 H' = 4.184, J' = 0.811) showed no significant differences (t = 1.083 p = 0.279). The linear dependences model was the one with the best fit results, where the species observed were more than estimated. Clench model estimated 90.9% of the spiders observed in the unit with irrigation and 90.6% in the unit without irrigation. PMID:24027921

  17. Oxyopinins, large amphipathic peptides isolated from the venom of the wolf spider Oxyopes kitabensis with cytolytic properties and positive insecticidal cooperativity with spider neurotoxins.

    Science.gov (United States)

    Corzo, Gerardo; Villegas, Elba; Gómez-Lagunas, Froylan; Possani, Lourival D; Belokoneva, Olga S; Nakajima, Terumi

    2002-06-28

    Five amphipathic peptides with antimicrobial, hemolytic, and insecticidal activity were isolated from the crude venom of the wolf spider Oxyopes kitabensis. The peptides, named oxyopinins, are the largest linear cationic amphipathic peptides from the venom of a spider that have been chemically characterized at present. According to their primary structure Oxyopinin 1 is composed of 48 amino acid residues showing extended sequence similarity to the ant insecticidal peptide ponericinL2 and to the frog antimicrobial peptide dermaseptin. Oxyopinins 2a, 2b, 2c, and 2d have highly similar sequences. At least 27 out of 37 amino acid residues are conserved. They also show a segment of sequence similar to ponericinL2. Circular dichroism analyses showed that the secondary structure of the five peptides is essentially alpha-helical. Oxyopinins showed disrupting activities toward both biological membranes and artificial vesicles, particularly to those rich in phosphatidylcholine. Electrophysiological recordings performed on insect cells (Sf9) showed that the oxyopinins produce a drastic reduction of cell membrane resistance by opening non-selective ion channels. Additionally, a new paralytic neurotoxin named Oxytoxin 1 was purified from the same spider venom. It contains 69 amino acid residue cross-linked by five disulfide bridges. Application of mixtures containing oxyopinins and Oxytoxin 1 to insect larvae showed a potentiation phenomenon, by which an increase lethality effect is observed. These results suggest that the linear amphipathic peptides in spider venoms and neuropeptides cooperate to capture insects efficiently.

  18. Habitat preferences, diet, feeding strategy and social organisation of the black spider monkey (Ateles panisius paniscus L.) in Surinam

    NARCIS (Netherlands)

    Roosmalen, van M.G.M.

    1980-01-01

    This study describes habitat choice of the Surinam black spider monkey ( Atelespaniscuspaniscus ) and clarifies complex temporal and spatial effects of food sources on the behaviour of a group of spider monkeys in a 350 ha study area in central Surinam in terms of food category,

  19. Japanese monkeys (Macaca fuscata) quickly detect snakes but not spiders: Evolutionary origins of fear-relevant animals.

    Science.gov (United States)

    Kawai, Nobuyuki; Koda, Hiroki

    2016-08-01

    Humans quickly detect the presence of evolutionary threats through visual perception. Many theorists have considered humans to be predisposed to respond to both snakes and spiders as evolutionarily fear-relevant stimuli. Evidence supports that human adults, children, and snake-naive monkeys all detect pictures of snakes among pictures of flowers more quickly than vice versa, but recent neurophysiological and behavioral studies suggest that spiders may, in fact, be processed similarly to nonthreat animals. The evidence of quick detection and rapid fear learning by primates is limited to snakes, and no such evidence exists for spiders, suggesting qualitative differences between fear of snakes and fear of spiders. Here, we show that snake-naive Japanese monkeys detect a single snake picture among 8 nonthreat animal pictures (koala) more quickly than vice versa; however, no such difference in detection was observed between spiders and pleasant animals. These robust differences between snakes and spiders are the most convincing evidence that the primate visual system is predisposed to pay attention to snakes but not spiders. These findings suggest that attentional bias toward snakes has an evolutionary basis but that bias toward spiders is more due to top-down, conceptually driven effects of emotion on attention capture. (PsycINFO Database Record PMID:27078076

  20. Japanese monkeys (Macaca fuscata) quickly detect snakes but not spiders: Evolutionary origins of fear-relevant animals.

    Science.gov (United States)

    Kawai, Nobuyuki; Koda, Hiroki

    2016-08-01

    Humans quickly detect the presence of evolutionary threats through visual perception. Many theorists have considered humans to be predisposed to respond to both snakes and spiders as evolutionarily fear-relevant stimuli. Evidence supports that human adults, children, and snake-naive monkeys all detect pictures of snakes among pictures of flowers more quickly than vice versa, but recent neurophysiological and behavioral studies suggest that spiders may, in fact, be processed similarly to nonthreat animals. The evidence of quick detection and rapid fear learning by primates is limited to snakes, and no such evidence exists for spiders, suggesting qualitative differences between fear of snakes and fear of spiders. Here, we show that snake-naive Japanese monkeys detect a single snake picture among 8 nonthreat animal pictures (koala) more quickly than vice versa; however, no such difference in detection was observed between spiders and pleasant animals. These robust differences between snakes and spiders are the most convincing evidence that the primate visual system is predisposed to pay attention to snakes but not spiders. These findings suggest that attentional bias toward snakes has an evolutionary basis but that bias toward spiders is more due to top-down, conceptually driven effects of emotion on attention capture. (PsycINFO Database Record

  1. Analysis of transcriptomes of three orb-web spider species reveals gene profiles involved in silk and toxin.

    Science.gov (United States)

    Zhao, Ying-Jun; Zeng, Yan; Chen, Lei; Dong, Yang; Wang, Wen

    2014-12-01

    As an ancient arthropod with a history of 390 million years, spiders evolved numerous morphological forms resulting from adaptation to different environments. The venom and silk of spiders, which have promising commercial applications in agriculture, medicine and engineering fields, are of special interests to researchers. However, little is known about their genomic components, which hinders not only understanding spider biology but also utilizing their valuable genes. Here we report on deep sequenced and de novo assembled transcriptomes of three orb-web spider species, Gasteracantha arcuata, Nasoonaria sinensis and Gasteracantha hasselti which are distributed in tropical forests of south China. With Illumina paired-end RNA-seq technology, 54 871, 101 855 and 75 455 unigenes for the three spider species were obtained, respectively, among which 9 300, 10 001 and 10 494 unique genes are annotated, respectively. From these annotated unigenes, we comprehensively analyzed silk and toxin gene components and structures for the three spider species. Our study provides valuable transcriptome data for three spider species which previously lacked any genetic/genomic data. The results have laid the first fundamental genomic basis for exploiting gene resources from these spiders.

  2. Convergent evolution of behavior in an adaptive radiation of Hawaiian web-building spiders.

    Science.gov (United States)

    Blackledge, Todd A; Gillespie, Rosemary G

    2004-11-16

    Species in ecologically similar habitats often display patterns of divergence that are strikingly comparable, suggesting that natural selection can lead to predictable evolutionary change in communities. However, the relative importance of selection as an agent mediating in situ diversification, versus dispersal between habitats, cannot be addressed without knowledge of phylogenetic history. We used an adaptive radiation of spiders within the Hawaiian Islands to test the prediction that species of spiders on different islands would independently evolve webs with similar architectures. Tetragnatha spiders are the only nocturnal orb-weaving spiders endemic to the Hawaiian archipelago, and multiple species of orb-weaving Tetragnatha co-occur within mesic and wet forest habitats on each of the main islands. Therefore, comparison of web architectures spun by spiders on different islands allowed study of replicated evolutionary events of past behavioral diversification. We found that species within each island construct webs with architectures that differ from one another. However, pairs of species on different islands, "ethotypes," share remarkable similarities in web architectures. Phylogenetic analysis demonstrated that the species comprising these ethotypes evolved independent of one another. Our study illustrates the high degree of predictability that can be exhibited by the evolutionary diversification of complex behaviors. However, not all web architectures were shared between islands, demonstrating that unique effects also have played an important role in the historical diversification of behavior.

  3. Multiple endosymbiont infections and reproductive manipulations in a linyphiid spider population.

    Science.gov (United States)

    Curry, M M; Paliulis, L V; Welch, K D; Harwood, J D; White, J A

    2015-08-01

    In many arthropods, maternally inherited endosymbiotic bacteria can increase infection frequency by manipulating host reproduction. Multiple infections of different bacteria in a single host population are common, yet few studies have documented concurrent endosymbiont phenotypes or explored their potential interactions. We hypothesized that spiders might be a particularly useful taxon for investigating endosymbiont interactions, because they are host to a plethora of endosymbiotic bacteria and frequently exhibit multiple infections. We established two matrilines from the same population of the linyphiid spider Mermessus fradeorum and then used antibiotic curing and controlled mating assays to demonstrate that each matriline was subject to a distinct endosymbiotic reproductive manipulation. One matriline was co-infected with Rickettsia and Wolbachia and produced offspring with a radical female bias. Antibiotic treatment eliminated both endosymbionts and restored an even sex ratio to subsequent generations. Chromosomal and fecundity observations suggest a feminization mechanism. In the other matriline, a separate factorial mating assay of cured and infected spiders demonstrated strong cytoplasmic incompatibility (CI) induced by a different strain of Wolbachia. However, males with this Wolbachia induced only mild CI when mated with the Rickettsia-Wolbachia females. In a subsequent survey of a field population of M. fradeorum, we detected these same three endosymbionts infecting 55% of the spiders in almost all possible combinations, with nearly half of the infected spiders exhibiting multiple infection. Our results suggest that a dynamic network of endosymbionts may interact both within multiply infected hosts and within a population subject to multiple strong reproductive manipulations. PMID:25899011

  4. Abundance and Fluctuation in Spider Diversity in Citrus Fruits from Located in Vicinity of Faisalabad Pakistan

    Institute of Scientific and Technical Information of China (English)

    Maqsood I; Mohsin S B; Li Yi-jing; Tang Li-jie; Saleem K M; Khalil U R; Shahla A; Aoun Bukhari; S S Jamal

    2016-01-01

    Spiders for the present study were collected from different fruit gardens (i.e. citrus) located at various localities (i.e., Tehsil Samundri, Jaranwala, Tandlianwala and Faisalabad) of District Faisalabad, Pakistan. Spiders belonging to six families and 33 species were captured from the two fruit gardens during the one year of this study. The citrus fruits garden was found to be best populated habitat as compared to other fruit garden. These sites were sampled by using pitfall traps; each month for five consecutive days from September 2010 to March 2011. As a result, 1 054 specimens were captured representing six families viz: lycosidae, thomosidae, gnaphosidae, saltisidae, araneidae and clubionidae. Lycosidae was more abundant, while clubionidae was less diverse during the study. Maximum population fluctuation among the spider specimens showed during the months from September and October, while the least abundance of spider specimens was reordered during June, November and December. Maximum taxonomic diversity was recorded from September to November, with the peak in September. It was concluded during these three months, when the citrus and guava gardens were attacked by the most of the pest insects. During the months of July and November diversity was moderate and mutually comparable, while in June and December, it was the least. This study contributed to the identification of spider diversity in the agro-ecosystem which could be used in the biological pest control.

  5. Variations in Loxosceles spider venom composition and toxicity contribute to the severity of envenomation.

    Science.gov (United States)

    de Oliveira, Kátia C; Gonçalves de Andrade, Rute M; Piazza, Roxane M F; Ferreira, Jorge M C; van den Berg, C W; Tambourgi, Denise V

    2005-03-15

    Envenomation by Loxosceles spiders causes two main clinical manifestations: cutaneous and systemic loxoscelism. The factors contributing to the severity of loxoscelism are not fully understood. We have analysed biochemical and toxicity variations in venom of L. laeta and L. intermedia, with the aim to find a correlation with the seriousness of loxoscelism. Differences in expression of proteins, glycoproteins and sphingomyelinase activity were observed between venom from male and female spiders and between venom from the two species. These differences were reflected in the toxicity of the venoms including the capacity to induce complement-dependent haemolysis, dermonecrosis and lethality. Comparative analysis of gender and species, showed that these biological activities were more prominent in venom from female spiders, especially from L. laeta. Antiserum raised against venom from females L. laeta spiders had the highest efficacy in neutralizing venoms of males and females of both species. These results indicate that the severity of loxoscelism depends, at least partially, on the species and sex of the spider and suggest that for accidents involving L. laeta an specific serum therapy is necessary. Furthermore, it emphasizes the efficacy of the antiserum produced against L. laeta female venom in neutralizing Loxosceles venoms from different species and gender.

  6. Recruitment and diversification of an ecdysozoan family of neuropeptide hormones for black widow spider venom expression.

    Science.gov (United States)

    McCowan, Caryn; Garb, Jessica E

    2014-02-25

    Venoms have attracted enormous attention because of their potent physiological effects and dynamic evolution, including the convergent recruitment of homologous genes for venom expression. Here we provide novel evidence for the recruitment of genes from the Crustacean Hyperglycemic Hormone (CHH) and arthropod Ion Transport Peptide (ITP) superfamily for venom expression in black widow spiders. We characterized latrodectin peptides from venom gland cDNAs from the Western black widow spider (Latrodectus hesperus), the brown widow (Latrodectus geometricus) and cupboard spider (Steatoda grossa). Phylogenetic analyses of these sequences with homologs from other spider, scorpion and wasp venom cDNAs, as well as CHH/ITP neuropeptides, show latrodectins as derived members of the CHH/ITP superfamily. These analyses suggest that CHH/ITP homologs are more widespread in spider venoms, and were recruited for venom expression in two additional arthropod lineages. We also found that the latrodectin 2 gene and nearly all CHH/ITP genes include a phase 2 intron in the same position, supporting latrodectin's placement within the CHH/ITP superfamily. Evolutionary analyses of latrodectins suggest episodes of positive selection along some sequence lineages, and positive and purifying selection on specific codons, supporting its functional importance in widow venom. We consider how this improved understanding of latrodectin evolution informs functional hypotheses regarding its role in black widow venom as well as its potential convergent recruitment for venom expression across arthropods.

  7. Tracking a medically important spider: climate change, ecological niche modeling, and the brown recluse (Loxosceles reclusa.

    Directory of Open Access Journals (Sweden)

    Erin E Saupe

    Full Text Available Most spiders use venom to paralyze their prey and are commonly feared for their potential to cause injury to humans. In North America, one species in particular, Loxosceles reclusa (brown recluse spider, Sicariidae, causes the majority of necrotic wounds induced by the Araneae. However, its distributional limitations are poorly understood and, as a result, medical professionals routinely misdiagnose brown recluse bites outside endemic areas, confusing putative spider bites for other serious conditions. To address the issue of brown recluse distribution, we employ ecological niche modeling to investigate the present and future distributional potential of this species. We delineate range boundaries and demonstrate that under future climate change scenarios, the spider's distribution may expand northward, invading previously unaffected regions of the USA. At present, the spider's range is centered in the USA, from Kansas east to Kentucky and from southern Iowa south to Louisiana. Newly influenced areas may include parts of Nebraska, Minnesota, Wisconsin, Michigan, South Dakota, Ohio, and Pennsylvania. These results illustrate a potential negative consequence of climate change on humans and will aid medical professionals in proper bite identification/treatment, potentially reducing bite misdiagnoses.

  8. Antipredator behaviours of a spider mite in response to cues of dangerous and harmless predators.

    Science.gov (United States)

    Dias, Cleide Rosa; Bernardo, Ana Maria Guimarães; Mencalha, Jussara; Freitas, Caelum Woods Carvalho; Sarmento, Renato Almeida; Pallini, Angelo; Janssen, Arne

    2016-07-01

    Prey are known to invest in costly antipredator behaviour when perceiving cues of dangerous, but not of relatively harmless predators. Whereas most studies investigate one type of antipredator behaviour, we studied several types (changes in oviposition, in escape and avoidance behaviour) in the spider mite Tetranychus evansi in response to cues from two predatory mites. The predator Phytoseiulus longipes is considered a dangerous predator for T. evansi, whereas Phytoseiulus macropilis has a low predation rate on this prey, thus is a much less dangerous predator. Spider mite females oviposited less on leaf disc halves with predator cues than on clean disc halves, independent of the predator species. On entire leaf discs, they laid fewer eggs in the presence of cues of the dangerous predator than on clean discs, but not in the presence of cues of the harmless predator. Furthermore, the spider mites escaped more often from discs with cues of the dangerous predator than from discs without predator cues, but they did not escape more from discs with cues of the harmless predator. The spider mites did not avoid plants with conspecifics and predators. We conclude that the spider mites displayed several different antipredator responses to the same predator species, and that some of these antipredator responses were stronger with cues of dangerous predators than with cues of harmless predators.

  9. Immobilizing and lethal effects of spider venoms on the cockroach and the common mealbeetle.

    Science.gov (United States)

    Friedel, T; Nentwig, W

    1989-01-01

    Immobilizing and lethal effects of the venoms obtained from six spider species (Brachypelma albopilosum, Atrax robustus, Cupiennius salei, Selenops mexicanus, Tegenaria atrica, Argiope bruennichi) were tested on Blatta orientalis (cockroach) and Tenebrio molitor (common mealbeetle). The immobilizing effects were quantified by measuring insect locomotor activity in circle arenas observed over 72 hr after venom injection. Both insect species showed cramps, quivering and jerking of the limbs as well as flaccid paralysis after venom injection. Through relative toxicity of the venoms tested is the same in T. molitor and B. orientalis, T. molitor is absolutely less sensitive to spider venoms. The effects on locomotor activity show time characteristics specific for each venom. A dependence of the venom paralyzing effects on insect locomotor activity, low intensity of the initial excitatory phase of the venom effects and partial recovery of the insects was found with A. bruennichi and T. atrica venom. The maximal venom yields of A. bruennichi and S. mexicanus are not lethal to B. orientalis, indicating that the mere immobilizing effects of spider venoms are far more crucial to prey capture than their lethal effects. The contribution of a variety of differently acting neurotoxic components in spider venoms to the observed venom effects on insects and the significance of the venoms in spider nutrition, hunting behaviour and ecology are discussed. PMID:2728023

  10. Reversible Myocarditis and Pericarditis after Black Widow Spider Bite or Kounis Syndrome?

    Science.gov (United States)

    Yaman, Mehmet; Mete, Turkan; Ozer, Ismail; Yaman, Elif; Beton, Osman

    2015-01-01

    Clinical manifestation of black widow spider bite is variable and occasionally leads to death in rural areas. Cases of myocarditis and pericarditis after black widow spider bite are rare and the associated prognostic significance is unknown. Kounis syndrome has been defined as an acute coronary syndrome in the setting of allergic or hypersensitivity and anaphylactic or anaphylactoid insults that manifests as vasospastic angina or acute myocardial infarction or stent thrombosis. Allergic myocarditis is caused by myocardial inflammation triggered by infectious pathogens, toxic, ischemic, or mechanical injuries, such as drug-related inflammation and other immune reactions. A 15-year-old child was admitted to the emergency department with pulmonary edema after spider bite. ST segment depression on ECG, elevated cardiac enzymes and global left ventricular hypokinesia (with ejection fraction of 22%), and local pericardial effusion findings confirmed the diagnosis of myopericarditis. After heart failure and pulmonary edema oriented medical therapy, clinical status improved. Patient showed a progressive improvement and LV functions returned to normal on the sixth day. Myopericarditis complicating spider bite is rare and sometimes fatal. The mechanism is not clearly known. Alpha-latrotoxin of the black widow spider is mostly convicted in these cases. But allergy or hypersensitivity may play a role in myocardial damage. PMID:26509087

  11. Reversible Myocarditis and Pericarditis after Black Widow Spider Bite or Kounis Syndrome?

    Science.gov (United States)

    Yaman, Mehmet; Mete, Turkan; Ozer, Ismail; Yaman, Elif; Beton, Osman

    2015-01-01

    Clinical manifestation of black widow spider bite is variable and occasionally leads to death in rural areas. Cases of myocarditis and pericarditis after black widow spider bite are rare and the associated prognostic significance is unknown. Kounis syndrome has been defined as an acute coronary syndrome in the setting of allergic or hypersensitivity and anaphylactic or anaphylactoid insults that manifests as vasospastic angina or acute myocardial infarction or stent thrombosis. Allergic myocarditis is caused by myocardial inflammation triggered by infectious pathogens, toxic, ischemic, or mechanical injuries, such as drug-related inflammation and other immune reactions. A 15-year-old child was admitted to the emergency department with pulmonary edema after spider bite. ST segment depression on ECG, elevated cardiac enzymes and global left ventricular hypokinesia (with ejection fraction of 22%), and local pericardial effusion findings confirmed the diagnosis of myopericarditis. After heart failure and pulmonary edema oriented medical therapy, clinical status improved. Patient showed a progressive improvement and LV functions returned to normal on the sixth day. Myopericarditis complicating spider bite is rare and sometimes fatal. The mechanism is not clearly known. Alpha-latrotoxin of the black widow spider is mostly convicted in these cases. But allergy or hypersensitivity may play a role in myocardial damage.

  12. Reversible Myocarditis and Pericarditis after Black Widow Spider Bite or Kounis Syndrome?

    Directory of Open Access Journals (Sweden)

    Mehmet Yaman

    2015-01-01

    Full Text Available Clinical manifestation of black widow spider bite is variable and occasionally leads to death in rural areas. Cases of myocarditis and pericarditis after black widow spider bite are rare and the associated prognostic significance is unknown. Kounis syndrome has been defined as an acute coronary syndrome in the setting of allergic or hypersensitivity and anaphylactic or anaphylactoid insults that manifests as vasospastic angina or acute myocardial infarction or stent thrombosis. Allergic myocarditis is caused by myocardial inflammation triggered by infectious pathogens, toxic, ischemic, or mechanical injuries, such as drug-related inflammation and other immune reactions. A 15-year-old child was admitted to the emergency department with pulmonary edema after spider bite. ST segment depression on ECG, elevated cardiac enzymes and global left ventricular hypokinesia (with ejection fraction of 22%, and local pericardial effusion findings confirmed the diagnosis of myopericarditis. After heart failure and pulmonary edema oriented medical therapy, clinical status improved. Patient showed a progressive improvement and LV functions returned to normal on the sixth day. Myopericarditis complicating spider bite is rare and sometimes fatal. The mechanism is not clearly known. Alpha-latrotoxin of the black widow spider is mostly convicted in these cases. But allergy or hypersensitivity may play a role in myocardial damage.

  13. Inhibition of Return in Fear of Spiders: Discrepant Eye Movement and Reaction Time Data

    Directory of Open Access Journals (Sweden)

    Elisa Berdica

    2014-01-01

    Full Text Available Inhibition of return (IOR refers to a bias against returning the attention to a previously attended location. As a foraging facilitator it is thought to facilitate systematic visual search. With respect to neutral stimuli, this is generally thought to be adaptive, but when threatening stimuli appear in our environment, such a bias may be maladaptive. This experiment investigated the influence of phobia-related stimuli on the IOR effect using a discrimination task. A sample of 50 students (25 high, 25 low in spider fear completed an IOR task including schematic representations of spiders or butterflies as targets. Eye movements were recorded and to assess discrimination among targets, participants indicated with button presses if targets were spiders or butterflies. Reaction time data did not reveal a significant IOR effect but a significant interaction of group and target; spider fearful participants were faster to respond to spider targets than to butterflies. Furthermore, eye-tracking data showed a robust IOR effect independent of stimulus category. These results offer a more comprehensive assessment of the motor and oculomotor factors involved in the IOR effect.

  14. fMRI neurofeedback facilitates anxiety regulation in females with spider phobia

    Directory of Open Access Journals (Sweden)

    Anna eZilverstand

    2015-06-01

    Full Text Available Background: Spider phobics show an exaggerated fear response when encountering spiders. This fear response is aggravated by negative and irrational beliefs about the feared object. Cognitive reappraisal can target these beliefs, and therefore has a fear regulating effect. The presented study investigated if neurofeedback derived from functional magnetic resonance imaging (fMRI would facilitate anxiety regulation by cognitive reappraisal, using spider phobia as a model of anxiety disorders. Feedback was provided based on activation in left dorsolateral prefrontal cortex and right insula, as indicators of engagement and regulation success, respectively.Methods: Eighteen female spider phobics participated in a randomized, controlled, single-blinded study. All participants completed a training session in the MRI scanner. Participants assigned to the neurofeedback condition were instructed to shape their regulatory strategy based on the provided feedback. Participants assigned to the control condition were asked to adapt their strategy intuitively.Results: Neurofeedback participants exhibited lower anxiety levels than the control group at the end of the training. In addition, only neurofeedback participants achieved down-regulation of insula activation levels by cognitive reappraisal. Group differences became more pronounced over time, supporting learning as a mechanism behind this effect. Importantly, within the neurofeedback group, achieved changes in insula activation levels during training predicted long-term anxiety reduction.Conclusions: The conducted study provides first evidence that fMRI neurofeedback has a facilitating effect on anxiety regulation in spider phobia.

  15. Diversity and distribution of spiders from Gibbon Wildlife Sanctuary, Assam, India

    Directory of Open Access Journals (Sweden)

    Dilip Kumar Kalita

    2012-07-01

    Full Text Available The study describes the identification of the spider assemblages with respect to their diversity and distribution in the semi evergreen forest, Gibbon Wildlife Sanctuary, Assam, India. The paper aims to introduce this neglected Order- Araneae which is primarily unknown to Science particularly in Northeast India. A total of 95 species of spiders belonging to 56 genera and 18 families were recorded during the study from June-August and October-December, 2011. The species were identified using keys for Indian spiders from (Tikader, 1987; Platnick , 2011. Methodology included active searching at all layers from ground level to tree canopy layer accessible easily for hand collecting and visual surveys. This is the first attempt to report the spider assemblages and their microhabitat preferences from Assam, India. Such surveys are vital for conservation of these creatures and building a biodiversity database of this mega diverse group from a fragmented semi-evergreen forest ecosystem in Assam, India. This study is focused on the neglected diversity of spider fauna representing this semi evergreen forest.

  16. Tracking a medically important spider: climate change, ecological niche modeling, and the brown recluse (Loxosceles reclusa).

    Science.gov (United States)

    Saupe, Erin E; Papes, Monica; Selden, Paul A; Vetter, Richard S

    2011-01-01

    Most spiders use venom to paralyze their prey and are commonly feared for their potential to cause injury to humans. In North America, one species in particular, Loxosceles reclusa (brown recluse spider, Sicariidae), causes the majority of necrotic wounds induced by the Araneae. However, its distributional limitations are poorly understood and, as a result, medical professionals routinely misdiagnose brown recluse bites outside endemic areas, confusing putative spider bites for other serious conditions. To address the issue of brown recluse distribution, we employ ecological niche modeling to investigate the present and future distributional potential of this species. We delineate range boundaries and demonstrate that under future climate change scenarios, the spider's distribution may expand northward, invading previously unaffected regions of the USA. At present, the spider's range is centered in the USA, from Kansas east to Kentucky and from southern Iowa south to Louisiana. Newly influenced areas may include parts of Nebraska, Minnesota, Wisconsin, Michigan, South Dakota, Ohio, and Pennsylvania. These results illustrate a potential negative consequence of climate change on humans and will aid medical professionals in proper bite identification/treatment, potentially reducing bite misdiagnoses. PMID:21464985

  17. Ecotoxicological effects of buprofezin on fecundity, growth, development, and predation of the wolf spider Pirata piratoides (Schenkel).

    Science.gov (United States)

    Deng, Lingling; Xu, Muqi; Cao, Hong; Dai, Jiayin

    2008-11-01

    The toxicological effects of buprofezin, an insect growth regulator, on the fecundity, development, and pest control potential of the wolf spider Pirata piratoides (Schenkel) (Araneae: Lycosidae) were investigated in the laboratory. It was shown that buprofezin had low toxicity to P. piratoides and that the median lethal dosage (LD(50)) 48 h and 10% lethal dosage (LD(10)) after topical application for female spiders were 653 and 316 mg buprofezin/mg fresh weight of spider, respectively. Buprofezin significantly reduced the percent hatching of spiders' eggs but had only a slight effect on egg production. No negative effects on the development and growth were observed. However, spider predation rates were strongly affected: Insecticide-treated females predated on fewer prey than the controls, and their predation rate did not recover even 5 days after insecticide application. This indicated that their pest control potential might be influenced by buprofezin, and the use of buprofezin in biological control of insects is discussed.

  18. SVM-based prediction of propeptide cleavage sites in spider toxins identifies toxin innovation in an Australian tarantula.

    Directory of Open Access Journals (Sweden)

    Emily S W Wong

    Full Text Available Spider neurotoxins are commonly used as pharmacological tools and are a popular source of novel compounds with therapeutic and agrochemical potential. Since venom peptides are inherently toxic, the host spider must employ strategies to avoid adverse effects prior to venom use. It is partly for this reason that most spider toxins encode a protective proregion that upon enzymatic cleavage is excised from the mature peptide. In order to identify the mature toxin sequence directly from toxin transcripts, without resorting to protein sequencing, the propeptide cleavage site in the toxin precursor must be predicted bioinformatically. We evaluated different machine learning strategies (support vector machines, hidden Markov model and decision tree and developed an algorithm (SpiderP for prediction of propeptide cleavage sites in spider toxins. Our strategy uses a support vector machine (SVM framework that combines both local and global sequence information. Our method is superior or comparable to current tools for prediction of propeptide sequences in spider toxins. Evaluation of the SVM method on an independent test set of known toxin sequences yielded 96% sensitivity and 100% specificity. Furthermore, we sequenced five novel peptides (not used to train the final predictor from the venom of the Australian tarantula Selenotypus plumipes to test the accuracy of the predictor and found 80% sensitivity and 99.6% 8-mer specificity. Finally, we used the predictor together with homology information to predict and characterize seven groups of novel toxins from the deeply sequenced venom gland transcriptome of S. plumipes, which revealed structural complexity and innovations in the evolution of the toxins. The precursor prediction tool (SpiderP is freely available on ArachnoServer (http://www.arachnoserver.org/spiderP.html, a web portal to a comprehensive relational database of spider toxins. All training data, test data, and scripts used are available from

  19. Trichobothrial mediation of an aquatic escape response: Directional jumps by the fishing spider, Dolomedes triton, foil frog attacks

    Directory of Open Access Journals (Sweden)

    Robert B. Suter

    2003-07-01

    Full Text Available Fishing spiders (Pisauridae frequent the surfaces of ponds and streams and thereby expose themselves to predation by a variety of aquatic and semi-aquatic vertebrates. To assess the possibility that the impressive jumps of fishing spiders from the water surface function in evading attacks by frogs, attacks by bullfrogs (Rana catesbiana and green frogs (R. clamitans on Dolomedes triton were studied. Both the attack dynamics of the frogs and the evasive behaviors of the spiders were recorded at 250 frames per second. A freeze-dried bullfrog, propelled toward spiders with acceleration, posture, and position that approximated the natural attack posture and dynamics, was used to assess the spiders' behavior. Qualitatively, the spiders responded to these mock-attacks just as they had to attacks by live frogs: jumping (N=29 jumps, 56.9% of instances, rearing the legs nearest the attacking frog (N=15, 29.4%, or showing no visible response (N=7, 13.7%. Spiders that jumped always did so away (in the vertical plane from the attack (mean =137° vs. vertical at 90° or horizontally toward the frog at 0°. The involvement of the trichobothria (leg hairs sensitive to air movements, and the eyes as sensory mediators of the evasion response was assessed. Spiders with deactivated trichobothria were significantly impaired relative to intact and sham-deactivated spiders, and relative to spiders in total darkness. Thus, functional trichobothria, unlike the eyes, are both necessary and sufficient mediators of the evasion response. Measurements of air flow during frog attacks suggest that an exponential rise in flow velocity is the airborne signature of an attack.

  20. SVM-based prediction of propeptide cleavage sites in spider toxins identifies toxin innovation in an Australian tarantula.

    Science.gov (United States)

    Wong, Emily S W; Hardy, Margaret C; Wood, David; Bailey, Timothy; King, Glenn F

    2013-01-01

    Spider neurotoxins are commonly used as pharmacological tools and are a popular source of novel compounds with therapeutic and agrochemical potential. Since venom peptides are inherently toxic, the host spider must employ strategies to avoid adverse effects prior to venom use. It is partly for this reason that most spider toxins encode a protective proregion that upon enzymatic cleavage is excised from the mature peptide. In order to identify the mature toxin sequence directly from toxin transcripts, without resorting to protein sequencing, the propeptide cleavage site in the toxin precursor must be predicted bioinformatically. We evaluated different machine learning strategies (support vector machines, hidden Markov model and decision tree) and developed an algorithm (SpiderP) for prediction of propeptide cleavage sites in spider toxins. Our strategy uses a support vector machine (SVM) framework that combines both local and global sequence information. Our method is superior or comparable to current tools for prediction of propeptide sequences in spider toxins. Evaluation of the SVM method on an independent test set of known toxin sequences yielded 96% sensitivity and 100% specificity. Furthermore, we sequenced five novel peptides (not used to train the final predictor) from the venom of the Australian tarantula Selenotypus plumipes to test the accuracy of the predictor and found 80% sensitivity and 99.6% 8-mer specificity. Finally, we used the predictor together with homology information to predict and characterize seven groups of novel toxins from the deeply sequenced venom gland transcriptome of S. plumipes, which revealed structural complexity and innovations in the evolution of the toxins. The precursor prediction tool (SpiderP) is freely available on ArachnoServer (http://www.arachnoserver.org/spiderP.html), a web portal to a comprehensive relational database of spider toxins. All training data, test data, and scripts used are available from the Spider

  1. Improved SpiderMine Algorithm Based on Cloud Computing in Big Graph Mining%大图挖掘中一种基于云计算的改进SpiderMine算法

    Institute of Scientific and Technical Information of China (English)

    刘莹; 杜奕智; 邹乐

    2016-01-01

    现有的图挖掘算法在云环境下难以有效地进行大规模图形的高频模式挖掘。为此,对SpiderMine算法做了改进,提出一种基于云的SpiderMine算法(c-SpiderMine)。首先,利用最小切割算法将大规模图形数据分为多个子图,使分区/融合成本最小,然后,利用 SpiderMine 进行模式挖掘,显著降低了大型模式生成时的组合复杂度。最后,采用一种模式键函数来保存模式,以保证所有模式可被成功恢复和融合。基于3种真实数据集的仿真实验结果表明,c-SpiderMine可高效挖掘云环境下的前K个大型模式,在不同数据规模和最小支持设置条件下,c-SpiderMine在内存使用和运行时间方面的性能均优于SpiderMine。%The existing graph mining algorithms in a cloud environment are difficult to carry out mining the high frequent patterns of a massive graph .To solve this problem, this paper has made the improvement to the SpiderMine algorithm, and an improved SpiderMine algorithm is proposed based on the cloud(c-SpiderMine). Firstly, one big graph data is divided into several sub graphs by minimum cut algorithm to minimize partition/merge costs. And then it exploits SpiderMine to mine the patterns, which generates large patterns with much lower combinational complexity. Finally, a pattern key (PK) function is proposed to preserve the patterns, which guarantees that all patterns can be successfully recovered and merged. The experiments are conducted with three real data sets, and the experimental results demonstrate that c-SpiderMine can efficiently mine top-k large patternsin the cloud, and performs well in memory usage and execution time with different data sizes and minimum supports than the SpiderMine.

  2. INSECTICIDE RESISTANCE IN THE GROUND SPIDER, Pardosa sumatrana (THORELL, 1890; ARANEAE: LYCOSIDAE).

    Science.gov (United States)

    Tahir, Hafiz Muhammad; Khizar, Farva; Naseem, Sajida; Yaqoob, Rabia; Samiullah, Khizar

    2016-09-01

    Elevated levels of insecticides detoxifying enzymes, such as esterases, glutathione S-transferases (GSTs), and cytochrome P-450 monooxygenases, act in the resistance mechanisms in insects. In the present study, levels of these enzymes in the insecticide-resistant ground spider Pardosa sumatrana (Thorell, 1890) were compared with a susceptible population (control) of the same species. Standard protocols were used for biochemical estimation of enzymes. The results showed significantly higher levels of nonspecific esterases and monooxygenases in resistant spiders compared to controls. The activity of GSTs was lower in the resistant spiders. Elevated levels of nonspecific esterases and monooxygenases suggest their role in metabolic resistance in P. sumatrana. The reduced levels of total protein contents revealed its possible consumption to meet energy demands. PMID:27312591

  3. High-Resolution Correlated Fission Product Measurements of 235U (nth , f) with SPIDER

    Science.gov (United States)

    Shields, Dan; Spider Team

    2015-10-01

    The SPIDER detector (SPectrometer for Ion DEtermination in fission Research) has obtained high-resolution, moderate-efficiency, correlated fission product data needed for many applications including the modeling of next generation nuclear reactors, stockpile stewardship, and the fundamental understanding of the fission process. SPIDER simultaneously measures velocity and energy of both fission products to calculate fission product yields (FPYs), neutron multiplicity (ν), and total kinetic energy (TKE). These data will be some of the first of their kind available to nuclear data evaluations. An overview of the SPIDER detector, analytical method, and preliminary results for 235U (nth , f) will be presented. LA-UR-15-20130 This work benefited from the use of the LANSCE accelerator facility and was performed under the auspices of the US Department of Energy by Los Alamos Security, LLC under Contract DE-AC52-06NA25396.

  4. Intersexual Trophic Niche Partitioning in an Ant-Eating spider (Araneae: Zodariidae)

    DEFF Research Database (Denmark)

    Pekár, Stanislav; Martisová, Martina; Bilde, T.

    2011-01-01

    Background Divergence in trophic niche between the sexes may function to reduce competition between the sexes (“intersexual niche partitioning hypothesis”), or may be result from differential selection among the sexes on maximizing reproductive output (“sexual selection hypothesis”). The latter may...... lead to higher energy demands in females driven by fecundity selection, while males invest in mate searching. We tested predictions of the two hypotheses underlying intersexual trophic niche partitioning in a natural population of spiders. Zodarion jozefienae spiders specialize on Messor barbarus ants...... demonstrated highly female biased SSD (Sexual Size Dimorphism) in body size, body weight, and in the size of chelicerae, the latter arising from sex-specific growth patterns in trophic morphology. In the field, female spiders actively selected ant sub-castes that were larger than the average prey size...

  5. Psychophysiological effects of an iTBS modulated virtual reality challenge including participants with spider phobia.

    Science.gov (United States)

    Notzon, S; Deppermann, S; Fallgatter, A; Diemer, J; Kroczek, A; Domschke, K; Zwanzger, P; Ehlis, A-C

    2015-12-01

    Preliminary evidence suggests beneficial effects of transcranial magnetic stimulation (TMS) on anxiety. The objective of this study was to investigate the effects of intermittent theta burst stimulation (iTBS) as a form of TMS on acute anxiety provoked by a virtual reality (VR) scenario. Participants with spider phobia (n=41) and healthy controls (n=42) were exposed to a spider scenario in VR after one session of iTBS over the prefrontal cortex or sham treatment. Participants with spider phobia reacted with more anxiety compared to healthy controls. Their heart rate and skin conductance increased compared to baseline. Contrary to expectations, iTBS did not influence these reactions, but modulated heart rate variability (HRV). Sympathetic influence on HRV showed an increase in the active iTBS group only. This study does not support the idea of beneficial effects of a single session of iTBS on anxiety, although other protocols or repeated sessions might be effective. PMID:26476332

  6. Nutrient regulation in a predator, the wolf spider Pardosa prativaga

    DEFF Research Database (Denmark)

    Jensen, Kim; Mayntz, David; Toft, Søren;

    2011-01-01

    Nutrient balancing is well known in herbivores and omnivores, but has only recently been demonstrated in predators. To test how a predator might regulate nutrients when the prey varies in nutrient composition, we restricted juvenile Pardosa prativaga wolf spiders to diets of one of six fruit fly......, Drosophila melanogaster, prey types varying in lipid:protein composition during their second instar. We collected all fly remnants to estimate food and nutrient intake over each meal. The spiders adjusted their capture rate and nutrient extraction in response to prey mass and nutrient composition...... amounts of protein to gain more lipids and energy. The spiders also regulated protein after ingestion, and ingested protein was incorporated less efficiently into body tissue when the prey was protein rich. Despite both pre- and postingestive nutrient regulation, the body lipid:protein compositions...

  7. Modelling spider monkeys Ateles spp. Gray, 1825: ecological responses and conservation implications to increased elevation

    Directory of Open Access Journals (Sweden)

    S. Shanee

    2009-09-01

    Full Text Available Spider monkeys (Ateles spp. are among the most widely-distributed and endangered neotropical primate genera. Throughout their distribution expanding human populations and associated demands for land are causing widespread deforestation, especially in low-lying areas where many populations of spider monkeys are being pushed to high elevation sites with sub-optimal conditions. In this paper ecological data from a wide range of sources has been collected and examined to try to better understand and predict spider monkey ecological responses to high elevation areas with lower environmental carrying capacities. Results show a significant reduction in group and foraging party sizes with increased elevation. A general reduction in density is also noted with increasing elevation, while home range sizes remain static. It is recommended that these observations be taken into account when planning conservation actions and new protected areas, and further implications are also discussed.

  8. Compositional changes in spider (Araneae) assemblages along an urbanisation gradient near a Danish town

    DEFF Research Database (Denmark)

    Horváth, R.; Elek, Zoltán; Lövei, Gabor L

    2014-01-01

    species, with money spiders (Linyphiidae) and wolf spiders (Lycosidae) being most numerous. One species, Ero aphana, was new to the Danish fauna. In 2004, 45-47 species were captured in the habitats in various stages of urbanisation, while in 2005 (with a smaller collection effort), 28 (urban) - 37 (rural......Spider (Araneae) assemblages were studied over two years by pitfall trapping along an urbanisation gradient of forested habitats (rural forest - suburban forest fragment - urban forest fragment) in a Danish town, using the Globenet protocol. During the two years, we collected 4340 individuals of 90......) species were captured. Twenty-five percent of the collected species occurred in all habitats, but about half of them were only collected in one of the urbanisation stages. The number of shared species was the highest between the suburban and urban habitats. The highest similarities between assemblages...

  9. Spider-venom peptides: structure, pharmacology, and potential for control of insect pests.

    Science.gov (United States)

    King, Glenn F; Hardy, Margaret C

    2013-01-01

    Spider venoms are an incredibly rich source of disulfide-rich insecticidal peptides that have been tuned over millions of years to target a wide range of receptors and ion channels in the insect nervous system. These peptides can act individually, or as part of larger toxin cabals, to rapidly immobilize envenomated prey owing to their debilitating effects on nervous system function. Most of these peptides contain a unique arrangement of disulfide bonds that provides them with extreme resistance to proteases. As a result, these peptides are highly stable in the insect gut and hemolymph and many of them are orally active. Thus, spider-venom peptides can be used as stand-alone bioinsecticides, or transgenes encoding these peptides can be used to engineer insect-resistant crops or enhanced entomopathogens. We critically review the potential of spider-venom peptides to control insect pests and highlight their advantages and disadvantages compared with conventional chemical insecticides.

  10. Integrated Assessment Plan Template and Operational Demonstration for SPIDERS Phase 2: Fort Carson

    Energy Technology Data Exchange (ETDEWEB)

    Barr, Jonathan L.; Tuffner, Francis K.; Hadley, Mark D.; Kreyling, Sean J.; Schneider, Kevin P.

    2013-09-01

    This document contains the Integrated Assessment Plan (IAP) for the Phase 2 Operational Demonstration (OD) of the Smart Power Infrastructure Demonstration for Energy Reliability (SPIDERS) Joint Capability Technology Demonstration (JCTD) project. SPIDERS will be conducted over a three year period with Phase 2 being conducted at Fort Carson, Colorado. This document includes the Operational Demonstration Execution Plan (ODEP) and the Operational Assessment Execution Plan (OAEP), as approved by the Operational Manager (OM) and the Integrated Management Team (IMT). The ODEP describes the process by which the OD is conducted and the OAEP describes the process by which the data collected from the OD is processed. The execution of the OD, in accordance with the ODEP and the subsequent execution of the OAEP, will generate the necessary data for the Quick Look Report (QLR) and the Utility Assessment Report (UAR). These reports will assess the ability of the SPIDERS JCTD to meet the four critical requirements listed in the Implementation Directive (ID).

  11. ANALYSIS ON THE DYNAMICS OF SPATIAL DISTRIBUTION PATTERN OF MIXED SPIDER POPULATION IN RICE FIELD

    Institute of Scientific and Technical Information of China (English)

    ZhiWang; Zhe-mingYuan; Da-xiangSong; Ming-shengZhu

    2004-01-01

    The results make it clear that there are total 11 families, 29 genera and 43 species of spiders in the rice field of Dong Fang Hong Farm. Among them, there are 8 families, 19 genera and 28 species in the early rice field, and 10 families, 27 genera and 36 species in the late rice field. The spatial distribution pattern of mixed spider populations in rice fields was different during different development stages of rice plant. During the prophase, metaphase and anaphase of early rice plant development, the spatial distribution pattern of mixed spider populations was aggregative, random and aggregative respectively. During the prophase, metaphase and anaphase of late rice plant development, the spatial distribution pattern was uniform, aggregative and uniform respectively.

  12. Design and construction of a carbon fiber gondola for the SPIDER balloon-borne telescope

    CERN Document Server

    Soler, J D; Amiri, M; Benton, S J; Bock, J J; Bond, J R; Bryan, S A; Chiang, C; Contaldi, C C; Crill, B P; Doré, O P; Farhang, M; Filippini, J P; Fissel, L M; Fraisse, A A; Gambrel, A E; Gandilo, N N; Golwala, S; Gudmundsson, J E; Halpern, M; Hasselfield, M; Hilton, G C; Holmes, W A; Hristov, V V; Irwin, K D; Jones, W C; Kermish, Z D; Kuo, C L; MacTavish, C J; Mason, P V; Megerian, K G; Moncelsi, L; Nagy, J M; Netterfield, C B; O'Brient, R; Rahlin, A S; Reintsema, C D; Ruhl, J E; Runyan, M C; Shariff, J A; Trangsrud, A; Tucker, C; Tucker, R S; Turner, A D; Weber, A C; Wiebe, D V; Young, E Y

    2014-01-01

    We introduce the light-weight carbon fiber and aluminum gondola designed for the SPIDER balloon-borne telescope. SPIDER is designed to measure the polarization of the Cosmic Microwave Background radiation with unprecedented sensitivity and control of systematics in search of the imprint of inflation: a period of exponential expansion in the early Universe. The requirements of this balloon-borne instrument put tight constrains on the mass budget of the payload. The SPIDER gondola is designed to house the experiment and guarantee its operational and structural integrity during its balloon-borne flight, while using less than 10% of the total mass of the payload. We present a construction method for the gondola based on carbon fiber reinforced polymer tubes with aluminum inserts and aluminum multi-tube joints. We describe the validation of the model through Finite Element Analysis and mechanical tests.

  13. Silkomics: Insight into the Silk Spinning Process of Spiders.

    Science.gov (United States)

    Dos Santos-Pinto, José Roberto Aparecido; Garcia, Ana Maria Caviquioli; Arcuri, Helen Andrade; Esteves, Franciele Grego; Salles, Heliana Clara; Lubec, Gert; Palma, Mario Sergio

    2016-04-01

    The proteins from the silk-producing glands were identified using both a bottom-up gel-based proteomic approach as well as from a shotgun proteomic approach. Additionally, the relationship between the functions of identified proteins and the spinning process was studied. A total of 125 proteins were identified in the major ampullate, 101 in the flagelliform, 77 in the aggregate, 75 in the tubuliform, 68 in the minor ampullate, and 23 in aciniform glands. On the basis of the functional classification using Gene Ontology, these proteins were organized into seven different groups according to their general function: (i) web silk proteins-spidroins, (ii) proteins related to the folding/conformation of spidroins, (iii) proteins that protect silk proteins from oxidative stress, (iv) proteins involved in fibrillar preservation of silks in the web, (v) proteins related to ion transport into and out of the glands during silk fiber spinning, (vi) proteins involved in prey capture and pre-digestion, and (vii) housekeeping proteins from all of the glands. Thus, a general mechanism of action for the identified proteins in the silk-producing glands from the Nephila clavipes spider was proposed; the current results also indicate that the webs play an active role in prey capture.

  14. Universal behaviors as candidate traditions in wild spider monkeys.

    Directory of Open Access Journals (Sweden)

    Claire J Santorelli

    Full Text Available Candidate traditions were documented across three communities of wild spider monkeys (Ateles geoffroyi using an a priori approach to identify behavioral variants and a statistical approach to examine differences in their proportional use. This methodology differs from previous studies of animal traditions, which used retrospective data and relied on the 'exclusion method' to identify candidate traditions. Our a priori approach increased the likelihood that behavior variants with equivalent functions were considered and our statistical approach enabled the proportional use of 'universal' behaviors, i.e., used across all communities, to be examined for the first time in any animal species as candidate traditions. Among universal behaviors we found 14 'community preferred' variants. After considering the extent to which community preferred variants were due to ecological and, to a lesser degree, genetic differences, we concluded that at least six were likely maintained through social learning. Our findings have two main implications: (i tradition repertoires could be larger than assumed from previous studies using the exclusion method; (ii the relative use of universal behavior variants can reinforce community membership.

  15. Analysis of cases caused by acute spider bite

    Directory of Open Access Journals (Sweden)

    Zihni Sulaj

    2015-08-01

    Full Text Available We performed a retrospective study of 176 patients in the University Hospital Center of Tirana (Albania, during the period 2001–2011, admitted with the diagnosis of a suspected spider bite. Three fatalities were registered during this decade covered from our study, with a clinical picture of marked hypertension, tachycardia and acute cardiac failure leading to death within a minimum of 25 h and a maximum of 42 h from the occurrence. Out of the total of 176 patients, we had 59% (104 cases females, and 41% males. The overwhelming majority of the patients lived in rural areas (155 of the cases; extremities were mostly affected from the bites. A summary of clinical signs and a brief review of the available literature are made in the results and discussion section of this paper. Authors advocate that special precautions should be taken especially in severe forms of interesting autonomous nerve system, with aggressive fluid resuscitation, supportive therapy and close monitoring of vital signs.

  16. Sublethal effect of agronomical surfactants on the spider Pardosa agrestis.

    Science.gov (United States)

    Niedobová, Jana; Hula, Vladimír; Michalko, Radek

    2016-06-01

    In addition to their active ingredients, pesticides contain also additives - surfactants. Use of surfactants has been increasing over the past decade, but their effects on non-target organisms, especially natural enemies of pests, have been studied only very rarely. The effect of three common agrochemical surfactants on the foraging behavior of the wolf spider Pardosa agrestis was studied in the laboratory. Differences in short-term, long-term, and overall cumulative predatory activities were investigated. We found that surfactant treatment significantly affected short-term predatory activity but had no effect on long-term predatory activity. The surfactants also significantly influenced the cumulative number of killed prey. We also found the sex-specific increase in cumulative kills after surfactants treatment. This is the first study showing that pesticide additives have a sublethal effect that can weaken the predatory activity of a potential biological control agent. More studies on the effects of surfactants are needed to understand how they affect beneficial organisms in agroecosystems. PMID:26878602

  17. Extraordinarily high spider densities on islands: flow of energy from the marine to terrestrial food webs and the absence of predation.

    Science.gov (United States)

    Polis, G A; Hurd, S D

    1995-01-01

    Some islands in the Gulf of California support very high densities of spiders. Spider density is negatively correlated with island size; many small islands support 50-200 spiders per m3 of cactus. Energy for these spiders comes primarily from the ocean and not from in situ productivity by land plants. We explicitly connect the marine and terrestrial systems to show that insular food webs represent one endpoint of the marine web. We describe two conduits for marine energy entering these islands: shore drift and seabird colonies. Both conduits are related to island area, having a much stronger effect on smaller islands. This asymmetric effect helps to explain the exceptionally high spider densities on small islands. Although productivity sets the maximal potential densities, predation (by scorpions) limits realized spider abundance. Thus, prey availability and predation act in concert to set insular spider abundance. PMID:7753815

  18. Repellency and oviposition deterrence of wild tomato leaf extracts to spider mites, Tetranychus urticae Koch.

    Science.gov (United States)

    Antonious, George F; Snyder, John C

    2015-01-01

    Glandular trichomes on the leaves of wild tomato, Lycopersicon hirsutum f. hirsutum Mull, also known as Solanum habrochaites (Solanaceae) synthesize and accumulate high levels of methyl ketones (MKs). The potential of using MKs as alternatives to synthetic acaricides for controlling the twospotted spider mite, Tetranychus urticae Koch, is explored in this study. Plants of L. hirsutum accession LA 407 having high concentrations of MKs were grown from seeds under greenhouse conditions. The main objective of this investigation was to conduct bioassays that are quick and easy to implement, consistent over time (repeatable) with the ability to utilize small amounts of test material for testing repellency and fecundity (number of eggs laid by a female mite) of MKs in pure forms and in LA 407 crude extracts. Four MKs (2-tridecanone, 2-undecanone, 2-dodecanone, 2-pentadecanone) and their mixture were screened for their repellency and ability to alter fecundity of spider mites. All MKs repelled spider mites at the two periods tested. Following spraying of tomato leaf extracts prepared in ethanol (ethanol extracts), average number of eggs laid per female mite on bean leaf discs dropped from 0.8 to 0.3 and from 0.9 to 0.3 at 4 and 24 h after exposure representing 65 and 68% reduction, respectively. However, spraying of tomato leaf extracts prepared in water (water extracts) reduced number of eggs laid per female mite from 1.7 to 0.7 and from 2.6 to 0.9 at 4 and 24 h after exposure representing 60 and 67% reduction, respectively. We concluded that all MKs have repellent and egg laying deterrence activities against spider mites. This investigation suggests that ethanol and water extracts of LA 407 have a potential for repelling female spider mites and reducing their laid eggs which might be explored under field conditions for managing populations of spider mites, which could reduce reliance on synthetic acaricides.

  19. Enhanced discriminative fear learning of phobia-irrelevant stimuli in spider-fearful individuals

    Directory of Open Access Journals (Sweden)

    Carina eMosig

    2014-10-01

    Full Text Available Avoidance is considered as a central hallmark of all anxiety disorders. The acquisition and expression of avoidance which leads to the maintenance and exacerbation of pathological fear is closely linked to Pavlovian and operant conditioning processes. Changes in conditionability might represent a key feature of all anxiety disorders but the exact nature of these alterations might vary across different disorders. To date, no information is available on specific changes in conditionability for disorder-irrelevant stimuli in specific phobia (SP. The first aim of this study was to investigate changes in fear acquisition and extinction in spider-fearful individuals as compared to non-fearful participants by using the de novo fear conditioning paradigm. Secondly, we aimed to determine whether differences in the magnitude of context-dependent fear retrieval exist between spider-fearful and non-fearful individuals. Our findings point to an enhanced fear discrimination in spider-fearful individuals as compared to non-fearful individuals at both the physiological and subjective level. The enhanced fear discrimination in spider-fearful individuals was neither mediated by increased state anxiety, depression, nor stress tension. Spider-fearful individuals displayed no changes in extinction learning and/or fear retrieval. Surprisingly, we found no evidence for context-dependent modulation of fear retrieval in either group. Here we provide first evidence that spider-fearful individuals show an enhanced discriminative fear learning of phobia-irrelevant (de novo stimuli. Our findings provide novel insights into the role of fear acquisition and expression for the development and maintenance of maladaptive responses in the course of SP.

  20. Toxicity and repellency of hot pepper extracts to spider mite, Tetranychus urticae Koch.

    Science.gov (United States)

    Antonious, George F; Meyer, Janet E; Snyder, John C

    2006-01-01

    Increasing concern about persistence and environmental impact of synthetic pesticide residues require development of biodegradable and environmentally safe alternatives. The potential of using fruit extracts of hot pepper as alternatives to synthetic acaricides for controlling the two-spotted spider mite, Tetranychus urticae Koch, is explored in this study. Twenty-four Capsicum accessions (Solanaceae) were screened for their toxicity and repellency to the spider mites. Crude extracts from fruits of C. chinense, C. frutescens, C. baccatum, C. annuum, and C. pubescens were prepared in methanol and tested for their acaricidal properties. Spider mite mortality was greatest (45%) when fruit extract of accession Grif-9169 (C. annuum) was used. Results from diving board bioassays indicated that mites avoided filter paper strips treated with hot pepper extracts from accessions PI-596057 (C. baccatum), PI-195299 (C. annuum), and Grif- 9270 (C. annuum). This investigation suggests that methanolic extracts of these three accessions may have a great potential for repelling spider mites and should be field-tested on a large-scale to assess their value in managing populations of spider mites, which could reduce reliance on synthetic acaricides. An attempt was made to correlate repellency with chemical constituents of fruit extracts of the most repellent accessions to identify chemical sources of repellency. Capsaicin and dihydrocapsaicin, the pungent components of pepper fruit, were not correlated with toxicity or repellency, indicating that these are not likely related to the toxicity or repellency of the pepper fruit extracts. Other, unidentified chemicals are likely responsible for toxicity and repellency to the two-spotted spider mite. PMID:17090499

  1. Studies of the necrotic actions of the venoms of several Australian spiders.

    Science.gov (United States)

    Atkinson, R K; Wright, L G

    1991-01-01

    1. Raw venoms from a number of Australian Araneomorph spiders were found to cause epidermal disruption in cultured skin from both mice and humans. 2. The more potent ones also caused loss of epidermal cell-cell adhesion of mouse skin in vivo. 3. Raw venoms from three Mygalomorph species did not have these actions. 4. Venom gland extracts from the Araneomorph species were also ineffective. 5. It was concluded that where spider venoms appear to possess necrogenic activity the most likely reason for this is contamination of the venoms with digestive tract secretions. PMID:1676958

  2. Numerical simulations of the first operational conditions of the negative ion test facility SPIDER

    Energy Technology Data Exchange (ETDEWEB)

    Serianni, G., E-mail: gianluigi.serianni@igi.cnr.it; Agostinetti, P.; Antoni, V.; Baltador, C.; Chitarin, G.; Marconato, N.; Pasqualotto, R.; Sartori, E.; Toigo, V.; Veltri, P. [Consorzio RFX (CNR, ENEA, INFN, UNIPD, Acciaierie Venete SpA), Corso Stati Uniti 4, 35127 Padova (Italy); Cavenago, M. [INFN-LNL, Viale dell’Università n. 2, 35020 Legnaro (Italy)

    2016-02-15

    In view of the realization of the negative ion beam injectors for ITER, a test facility, named SPIDER, is under construction in Padova (Italy) to study and optimize production and extraction of negative ions. The present paper is devoted to the analysis of the expected first operations of SPIDER in terms of single-beamlet and multiple-beamlet simulations of the hydrogen beam optics in various operational conditions. The effectiveness of the methods adopted to compensate for the magnetic deflection of the particles is also assessed. Indications for a sequence of the experimental activities are obtained.

  3. On the spider genus Arboricaria with the description of a new species (Araneae, Gnaphosidae).

    Science.gov (United States)

    Mikhailov, Kirill G

    2016-01-01

    The spider genus Arboricaria Bosmans, 2000 is redefined and an updated diagnosis given. The differences between Arboricaria and Micaria Westring, 1851 are discussed in detail. A key to all five species of the genus is provided. One new species, Arboricaria zonsteini sp. n. (♂♀), is described based on specimens from Kyrgyzstan and Azerbaijan. One new synonym is proposed: Arboricaria koeni Bosmans in Bosmans & Blick, 2000, syn. n. is assigned to Arboricaria sociabilis Kulczyński in Chyzer & Kulczyński, 1897. Data on the distribution of Arboricaria in Russia and adjacent countries are presented with references to the papers on local spider faunas.

  4. Genes and evolution of two-domain toxins from lynx spider venom.

    Science.gov (United States)

    Sachkova, Maria Y; Slavokhotova, Anna A; Grishin, Eugene V; Vassilevski, Alexander A

    2014-03-01

    Spiderines are comparatively long polypeptide toxins (∼110 residues) from lynx spiders (genus Oxyopes). They are built of an N-terminal linear cationic domain (∼40 residues) and a C-terminal knottin domain (∼60 residues). The linear domain empowers spiderines with strong cytolytic activity. In the present work we report 16 novel spiderine sequences from Oxyopes takobius and Oxyopes lineatus classified into two subfamilies. Strikingly, negative selection acts on both linear and knottin domains. Genes encoding Oxyopes two-domain toxins were sequenced and found to be intronless. We further discuss a possible scenario of lynx spider modular toxin evolution.

  5. Characterization of Three Venom Peptides from the Spitting Spider Scytodes thoracica

    Science.gov (United States)

    Ariki, Nathanial K.; Muñoz, Lisa E.; Armitage, Elizabeth L.; Goodstein, Francesca R.; George, Kathryn G.; Smith, Vanessa L.; Vetter, Irina; Herzig, Volker; King, Glenn F.; Loening, Nikolaus M.

    2016-01-01

    We present the solution-state NMR structures and preliminary functional characterizations of three venom peptides identified from the spitting spider Scytodes thoracica. Despite little sequence identity to other venom peptides, structural characterization reveals that these peptides contain an inhibitor cystine knot motif common to many venom peptides. These are the first structures for any peptide or protein from spiders of the Scytodidae family. Many venom peptides target neuronal ion channels or receptors. However, we have not been able to determine the target of these Scytodes peptides so we can only state with certainty the channels and receptors that they do not target. PMID:27227898

  6. Characterization of Three Venom Peptides from the Spitting Spider Scytodes thoracica.

    Directory of Open Access Journals (Sweden)

    Nathanial K Ariki

    Full Text Available We present the solution-state NMR structures and preliminary functional characterizations of three venom peptides identified from the spitting spider Scytodes thoracica. Despite little sequence identity to other venom peptides, structural characterization reveals that these peptides contain an inhibitor cystine knot motif common to many venom peptides. These are the first structures for any peptide or protein from spiders of the Scytodidae family. Many venom peptides target neuronal ion channels or receptors. However, we have not been able to determine the target of these Scytodes peptides so we can only state with certainty the channels and receptors that they do not target.

  7. A rare finding of mites (Arachnida: Acari: Leeuwenhoekiidae) parasitising a whip spider (Arachnida: Amblypygi: Charinidae).

    Science.gov (United States)

    Gonçalves-Souza, Thiago; Giupponi, Alessandro P L; Hernandes, Fabio A

    2014-04-01

    Twelve larvae of unidentified species of Odontacarus Ewing, 1929 (Acari: Leeuwenhoekiidae) were found parasitising an adult male whip spider Charinus brasilianus Weygoldt (Charinidae) in Santa Teresa, mountainous region of Espirito Santo state, southeastern Brazil. These larvae occurred in the intersegmental membrane of prosoma and legs. This is the first report of ectoparasitic mites infecting a charinid whip spider and the first record of leeuwenhoekiid mites parasitising an invertebrate host. We suggest that future studies are essential to understand the reasons why these events of parasitism are so rare in the order Amblypygi.

  8. Structural characterization of a variety of spider silks from Turkey using different biophysical techniques

    OpenAIRE

    İDE, Semra; Bayarı, Sevgi Haman; TÜRKEŞ, Tuncay; Mergen, Y. Orhan; Çelik, Ömer; Bütün, Vural; Sargon, Mustafa F; Kocatepe, Neslihan; Kriechbaum, Manfred

    2011-01-01

    Various experimental methods (XRD, FTIR, SAXS, DLS and SEM) were used to investigate structures of the silk samples weaved by spiders in Turkey. Silk samples were collected from the natural habitats belonging to the spider species (i.e., Near Salt Lake/şereflikoçhisar, İvriz Dam/Ereǧli-Konya, Karataş Lake/Burdur and several locations in Black Sea Region of Turkey). Among all collected species, Araneidae (Araneus angulatus, Argiope bruennichi, Argiope lobata, Larinoides cornutus), Eresidae (Er...

  9. Numerical simulations of the first operational conditions of the negative ion test facility SPIDER

    Science.gov (United States)

    Serianni, G.; Agostinetti, P.; Antoni, V.; Baltador, C.; Cavenago, M.; Chitarin, G.; Marconato, N.; Pasqualotto, R.; Sartori, E.; Toigo, V.; Veltri, P.

    2016-02-01

    In view of the realization of the negative ion beam injectors for ITER, a test facility, named SPIDER, is under construction in Padova (Italy) to study and optimize production and extraction of negative ions. The present paper is devoted to the analysis of the expected first operations of SPIDER in terms of single-beamlet and multiple-beamlet simulations of the hydrogen beam optics in various operational conditions. The effectiveness of the methods adopted to compensate for the magnetic deflection of the particles is also assessed. Indications for a sequence of the experimental activities are obtained.

  10. Solid-phase synthesis and biological evaluation of Joro spider toxin-4 from Nephila clavata

    DEFF Research Database (Denmark)

    Barslund, Anne Fuglsang; Poulsen, Mette Homann; Bach, Tinna Brøbech;

    2011-01-01

    Polyamine toxins from orb weaver spiders are attractive pharmacological tools particularly for studies of ionotropic glutamate (iGlu) receptors in the brain. These polyamine toxins are biosynthesized in a combinatorial manner, providing a plethora of related, but structurally complex toxins...... to be exploited in biological studies. Here, we have used solid-phase synthetic methodology for the efficient synthesis of Joro spider toxin-4 (JSTX-4) (1) from Nephila clavata, providing sufficient amounts of the toxin for biological evaluation at iGlu receptor subtypes using electrophysiology. Biological...

  11. RFLP analysis of ribosomal DNA in sibling species of spider mite, genus Panonychus (Acari: Tetranychidae).

    Science.gov (United States)

    Osakabe, M; Sakagami, Y

    1994-02-01

    Ribosomal DNA (rDNA) restriction fragment length of spider mites was analysed in three sibling species of genus Panonychus (P. mori, P. citri and P. ulmi) and Tetranychus urticae. Seventy-one fragments were detected by enhanced chemiluminescence (ECL) after Southern hybridization with two genomic rDNA probes of mouse. Percentages of shared fragments within species were larger than those among species, indicating that the variation of rDNAs was useful in phylogenetic studies of spider mite species. In a phenogram based on differences of the rDNA fragment length, the relationship among Panonychus species was compatible with the results of analysis based on the morphological characters. PMID:7915173

  12. Quantitative analysis of spider locomotion employing computer-automated video tracking

    DEFF Research Database (Denmark)

    Baatrup, E; Bayley, M

    1993-01-01

    consecutive 12-h periods, alternating between white and red (lambda > 600 nm) illumination. Male spiders were significantly more locomotor active than female spiders under both lighting conditions. They walked, on average, twice the distance of females, employed higher velocities, and spent less time...... in quiescence. Both male and female P. amentata were significantly less active in red light (simulated dark environment) than in white light. The results also revealed that P. amentata administers its walking velocity and periods of quiescence according to consistent distributions, which can be approximated...

  13. [Intramolecular homologous recombination event occurred in the spider egg case silk gene CySp2 of wasp spider].

    Science.gov (United States)

    Han, L; Nakagaki, M

    2013-01-01

    To gain further understanding of egg case silk proteins gene family, Zhao et al. isolated two full-length cDNAs for egg case silk proteins, cylindrical silk protein 1 (CySpl) and cylindrical silk protein 2 (CySp2), from the wasp spider, Argiope bruennichi. CySp2 was reported to contain no apparent signal peptide sequences, and the CySp1-CySp2 complex, which would possess a signal peptide, would be transported across the endoplasmic reticulum and secreted to the Golgi. Genomic DNA sequencing is one approach that can be successfully utilized to retrieve 5' ends of silk genes; using this method, we retrieved the 5' end of CySp2. We found that CySp2 contained a typical signal peptide similar to that found in CySp1; thus, due to technical limitations, an artificial error had occurred in the CySp2 sequence reported by Zhao et al. PMID:25509350

  14. From Midges to Spiders: Mercury Biotransport in Riparian Zones Near the Buffalo River Area of Concern (AOC), USA.

    Science.gov (United States)

    Pennuto, C M; Smith, M

    2015-12-01

    Riparian communities can receive environmental contaminants from adjacent aquatic 'donor' habitats. We investigated mercury biotransport from aquatic to terrestrial habitats via aquatic insect emergence and uptake by riparian spiders at sites within and upstream of the Buffalo River Area of Concern (AOC), a site with known sediment Hg contamination. Mercury concentration in emerging midges was roughly 10× less than contaminated sediment levels with the AOC, but biomagnification factors from midges to spiders ranged from 2.0 to 2.65 between sites. There was a significantly negative body mass:total mercury relationship in spiders (p mercury depuration is rapid or tissue dilution occurs in these riparian predators. Spiders contained significantly more mercury than their midge prey and spiders upstream of the AOC had higher mercury concentrations than spiders from within the AOC. Collectively, these data indicate that riparian spiders can be good mercury sentinels in urban environments, and that riparian communities upstream from the AOC may be at greater risk to mercury than has been previously considered.

  15. A Proteomics and Transcriptomics Investigation of the Venom from the Barychelid Spider Trittame loki (Brush-Foot Trapdoor

    Directory of Open Access Journals (Sweden)

    Eivind A. B. Undheim

    2013-12-01

    Full Text Available Although known for their potent venom and ability to prey upon both invertebrate and vertebrate species, the Barychelidae spider family has been entirely neglected by toxinologists. In striking contrast, the sister family Theraphosidae (commonly known as tarantulas, which last shared a most recent common ancestor with Barychelidae over 200 million years ago, has received much attention, accounting for 25% of all the described spider toxins while representing only 2% of all spider species. In this study, we evaluated for the first time the venom arsenal of a barychelid spider, Trittame loki, using transcriptomic, proteomic, and bioinformatic methods. The venom was revealed to be dominated by extremely diverse inhibitor cystine knot (ICK/knottin peptides, accounting for 42 of the 46 full-length toxin precursors recovered in the transcriptomic sequencing. In addition to documenting differential rates of evolution adopted by different ICK/knottin toxin lineages, we discovered homologues with completely novel cysteine skeletal architecture. Moreover, acetylcholinesterase and neprilysin were revealed for the first time as part of the spider-venom arsenal and CAP (CRiSP/Allergen/PR-1 were identified for the first time in mygalomorph spider venoms. These results not only highlight the extent of venom diversification in this neglected ancient spider lineage, but also reinforce the idea that unique venomous lineages are rich pools of novel biomolecules that may have significant applied uses as therapeutics and/or insecticides.

  16. A proteomics and transcriptomics investigation of the venom from the barychelid spider Trittame loki (brush-foot trapdoor).

    Science.gov (United States)

    Undheim, Eivind A B; Sunagar, Kartik; Herzig, Volker; Kely, Laurence; Low, Dolyce H W; Jackson, Timothy N W; Jones, Alun; Kurniawan, Nyoman; King, Glenn F; Ali, Syed A; Antunes, Agostino; Ruder, Tim; Fry, Bryan G

    2013-12-13

    Although known for their potent venom and ability to prey upon both invertebrate and vertebrate species, the Barychelidae spider family has been entirely neglected by toxinologists. In striking contrast, the sister family Theraphosidae (commonly known as tarantulas), which last shared a most recent common ancestor with Barychelidae over 200 million years ago, has received much attention, accounting for 25% of all the described spider toxins while representing only 2% of all spider species. In this study, we evaluated for the first time the venom arsenal of a barychelid spider, Trittame loki, using transcriptomic, proteomic, and bioinformatic methods. The venom was revealed to be dominated by extremely diverse inhibitor cystine knot (ICK)/knottin peptides, accounting for 42 of the 46 full-length toxin precursors recovered in the transcriptomic sequencing. In addition to documenting differential rates of evolution adopted by different ICK/knottin toxin lineages, we discovered homologues with completely novel cysteine skeletal architecture. Moreover, acetylcholinesterase and neprilysin were revealed for the first time as part of the spider-venom arsenal and CAP (CRiSP/Allergen/PR-1) were identified for the first time in mygalomorph spider venoms. These results not only highlight the extent of venom diversification in this neglected ancient spider lineage, but also reinforce the idea that unique venomous lineages are rich pools of novel biomolecules that may have significant applied uses as therapeutics and/or insecticides.

  17. A revision of the spider genus Zaitunia (Araneae, Filistatidae

    Directory of Open Access Journals (Sweden)

    Sergei Zonstein

    2016-07-01

    Full Text Available The spider genus Zaitunia Lehtinen, 1967 (Araneae, Filistatidae is revised. It was found to include 24 species distributed in the Eastern Mediterranean, Middle East and Central Asia: ♀ Z. afghana (Roewer, 1962 (Afghanistan, ♀ Z. alexandri Brignoli, 1982 (Iran, ♀ Z. akhanii Marusik & Zamani, 2015 (Iran, ♂♀ Z. annulipes (Kulczyński, 1908 (Cyprus, ♂♀ Z. beshkentica (Andreeva & Tyshchenko, 1969 (Tajikistan, Uzbekistan, ♀ Z. brignoliana sp. nov. (Iran, ♂♀ Z. ferghanensis sp. nov. (Kyrgyzstan, Uzbekistan, ♀ Z. feti sp. nov. (Turkmenistan, ♀ Z. halepensis sp. nov. (Syria, ♀ Z. huberi sp. nov. (Afghanistan, ♀ Z. inderensis Ponomarev, 2005 (Kazakhstan, ♂♀ Z. kunti sp. nov. (Cyprus, Turkey, ♂♀ Z. logunovi sp. nov. (Kazakhstan, Kyrgyzstan, ♂♀ Z. maracandica (Charitonov, 1946 (Uzbekistan, Kazakhstan, ♂♀ Z. martynovae (Andreeva & Tyshchenko, 1969 (Tajikistan, Turkmenistan, ♀ Z. medica Brignoli, 1982 (Iran, ♂♀ Z. minoica sp. nov. (Greece, ♀ Z. minuta sp. nov. (Uzbekistan, ♀ Z. persica Brignoli, 1982 (Iran, ♂ Z. psammodroma sp. nov. (Turkmenistan, ♂♀ Z. schmitzi (Kulczyński, 1911, the type species (Egypt, Israel, ♂♀ Z. spinimana sp. nov. (Kazakhstan, Turkmenistan, ♂♀ Z. wunderlichi sp. nov. (Kyrgyzstan and ♀ Z. zonsteini Fomichev & Marusik, 1969 (Kazakhstan. Twelve above-listed species are newly described, and males of Z. annulipes, Z. beshkentica, Z. maracandica and Z. martynovae are described for the first time. Two new combinations are established: Z. annulipes (Kulczyński, 1908 comb. nov., ex Filistata, and Pholcoides monticola (Spassky, 1941 comb. nov., ex Zaitunia. New data on distribution of the considered taxa are provided.

  18. Novel class of spider toxin: active principle from the yellow sac spider Cheiracanthium punctorium venom is a unique two-domain polypeptide.

    Science.gov (United States)

    Vassilevski, Alexander A; Fedorova, Irina M; Maleeva, Ekaterina E; Korolkova, Yuliya V; Efimova, Svetlana S; Samsonova, Olga V; Schagina, Ludmila V; Feofanov, Alexei V; Magazanik, Lev G; Grishin, Eugene V

    2010-10-15

    Venom of the yellow sac spider Cheiracanthium punctorium (Miturgidae) was found unique in terms of molecular composition. Its principal toxic component CpTx 1 (15.1 kDa) was purified, and its full amino acid sequence (134 residues) was established by protein chemistry and mass spectrometry techniques. CpTx 1 represents a novel class of spider toxin with modular architecture. It consists of two different yet homologous domains (modules) each containing a putative inhibitor cystine knot motif, characteristic of the widespread single domain spider neurotoxins. Venom gland cDNA sequencing provided precursor protein (prepropeptide) structures of three CpTx 1 isoforms (a-c) that differ by single residue substitutions. The toxin possesses potent insecticidal (paralytic and lethal), cytotoxic, and membrane-damaging activities. In both fly and frog neuromuscular preparations, it causes stable and irreversible depolarization of muscle fibers leading to contracture. This effect appears to be receptor-independent and is inhibited by high concentrations of divalent cations. CpTx 1 lyses cell membranes, as visualized by confocal microscopy, and destabilizes artificial membranes in a manner reminiscent of other membrane-active peptides by causing numerous defects of variable conductance and leading to bilayer rupture. The newly discovered class of modular polypeptides enhances our knowledge of the toxin universe.

  19. Exposure Therapy for Fear of Spiders in an Adult with Learning Disabilities: A Case Report

    Science.gov (United States)

    Cowdrey, Felicity A.; Walz, Linda

    2015-01-01

    The evidence-base for exposure therapy in people with learning disabilities experiencing specific phobias is sparse. This case study describes the assessment, formulation and treatment of spider phobia in a woman with learning disabilities using an exposure-based intervention augmented with mindfulness practice and bereavement work. To evaluate…

  20. Nuptial gifts of male spiders: sensory exploitation of the female's maternal care instinct or foraging motivation?

    DEFF Research Database (Denmark)

    Bilde, T.; Tuni, Cristina; Elsayed, Rehab;

    2007-01-01

    Nuptial feeding can evolve as sensory traps where the male exploits the female's foraging motivation in a sexual context. The nuptial prey gift of the nursery-web spider Pisaura mirabilis is wrapped in white silk, and it has been suggested that males initially exploit the maternal care instinct...

  1. Web-sharing Sociality and Cooperative Prey Capture in a Malagasy Spitting Spider (Araneae: Scytodidae)

    NARCIS (Netherlands)

    Miller, J.A.

    2006-01-01

    Web-sharing sociality and cooperative prey capture are reported for Scytodes socialis, sp. nov., a spitting spider discovered in a dry deciduous forest in Eastern Madagascar. Transect-based sampling was used to investigate colony demographics, estimate web volume and stratigraphic position, and asse

  2. Molecular identification of adult and juvenile linyphiid and theridiid spiders in Alpine glacier foreland communities.

    Directory of Open Access Journals (Sweden)

    Lorna Raso

    Full Text Available In glacier forelands spiders constitute a large proportion of the invertebrate community. Therefore, it is important to be able to determine the species that can be found in these areas. Linyphiid and theridiid spider identification is currently not possible in juvenile specimens using traditional morphological based methods, however, a large proportion of the population in these areas are usually juveniles. Molecular methods permit identification of species at different life stages, making juvenile identification possible. In this study we tested a molecular tool to identify the 10 most common species of Linyphiidae and Theridiidae found in three glacier foreland communities of the Austrian Alps. Two multiplex PCR systems were developed and over 90% of the 753 field-collected spiders were identified successfully. The species targeted were found to be common in all three valleys during the summer of 2010. A comparison between the molecular and morphological data showed that although there was a slight difference in the results, the overall outcome was the same independently of the identification method used. We believe the quick and reliable identification of the spiders via the multiplex PCR assays developed here will aid the study of these families in Alpine habitats.

  3. A 4-year study of invasive and native spider populations in Maine

    Science.gov (United States)

    Jakob, Elizabeth M.; Porter, Adam H.; Ginsberg, Howard; Bednarski, Julie V.; Houser, Jeremy

    2011-01-01

    Invasive spiders pose potential threats to native spiders. In 2002, the European spider Linyphia triangularis (Clerck, 1757) (Araneae: Linyphiidae) was discovered in all but one county in Maine. At Acadia National Park, we conducted a 4-year study of L. triangularis and three native linyphiid species of a similar size (Frontinella communis (Hentz, 1850), Pityohyphantes subarcticus Chamberlin and Ivie, 1943, and Neriene radiata (Walckenaer, 1842)). Using line-transect surveys, we measured population densities in coastal and forest habitat. The density of L. triangularis varied across years but was always significantly higher on the coast than in the forest. In contrast, only one native species was present on the coast and at very low numbers. Coastal L. triangularis were larger and in better condition than those in the forest, and numbers and biomass of insect prey were also higher on the coast. In 2 years, we also conducted transects at a second coastal location in Maine where the invader was at low density. At that site, native densities were substantially higher than at either Acadia site. Our data are consistent with the hypothesis that L. triangularis is reducing populations of native spiders. Companion studies suggest that L. triangularis negatively impacts natives by usurping both web sites and webs.

  4. Geri Keams: "Coyote and Spider Woman and Other Creation Stories." Cue Sheet.

    Science.gov (United States)

    Carr, Gail

    This performance guide is designed for teachers to use with students before and after a storytelling performance of "Coyote and Spider Woman and Other Creation Stories," by Geri Keams, a Navajo storyteller. The guide, called a "Cuesheet," contains seven activity sheets for use in class, addressing: (1) The Storyteller Tells Her Story (where the…

  5. Do males evaluate female age for precopulatory mate guarding in the two-spotted spider mite?

    NARCIS (Netherlands)

    Oku, K.; Saito, Y.

    2014-01-01

    In the two-spotted spider mite Tetranychus urticae (Acari: Tetranychidae), because only the first mating results in fertilisation, adult males guard quiescent deutonymph females, the stage immediately before adult emergence. Previous studies showed that T. urticae males prefer to guard older rather

  6. Along Came a Spider: Using Live Arthropods in a Predator-Prey Activity

    Science.gov (United States)

    Richardson, Matthew L.; Hari, Janice

    2011-01-01

    We developed a predator-prey activity with eighth-grade students in which they used wolf spiders ("Lycosa carolinensis"), house crickets ("Acheta domestica"), and abiotic factors to address how (1) adaptations in predators and prey shape their interaction and (2) abiotic factors modify the interaction between predators and prey. We tested student…

  7. Spiders, Firesouls, and Little Fingers: Necessary Magic in University-Community Collaboration

    Science.gov (United States)

    Nocon, Honorine; Nilsson, Monica; Cole, Michael

    2004-01-01

    On the basis of extensive research on university-community collaborative education projects in southern California and southern Sweden, this article proposes two roles and a research strategy and approach as elements essential to sustained collaboration. Recognition and fulfillment of the roles of "spider" and "firesoul," while "leading with the…

  8. Visual fields and eye morphology support color vision in a color-changing crab-spider.

    Science.gov (United States)

    Insausti, Teresita C; Defrize, Jérémy; Lazzari, Claudio R; Casas, Jérôme

    2012-03-01

    Vision plays a major role in many spiders, being involved in prey hunting, orientation or substrate choice, among others. In Misumena vatia, which experiences morphological color changes, vision has been reported to be involved in substrate color matching. Electrophysiological evidence reveals that at least two types of photoreceptors are present in this species, but these data are not backed up by morphological evidence. This work analyzes the functional structure of the eyes of this spider and relates it to its color-changing abilities. A broad superposition of the visual field of the different eyes was observed, even between binocular regions of principal and secondary eyes. The frontal space is simultaneously analyzed by four eyes. This superposition supports the integration of the visual information provided by the different eye types. The mobile retina of the principal eyes of this spider is organized in three layers of three different types of rhabdoms. The third and deepest layer is composed by just one large rhabdom surrounded by dark screening pigments that limit the light entry. The three pairs of secondary eyes have all a single layer of rhabdoms. Our findings provide strong support for an involvement of the visual system in color matching in this spider.

  9. The time course of location-avoidance learning in fear of spiders

    NARCIS (Netherlands)

    Rinck, M.; Koene, M.; Telli, S.; Moerman-van den Brink, W.; Verhoeven, B.; Becker, E.S.

    2016-01-01

    Two experiments were designed to study the time course of avoidance learning in spider fearfuls (SFs) under controlled experimental conditions. To achieve this, we employed an immersive virtual environment (IVE): While walking freely through a virtual art museum to search for specific paintings, the

  10. Fecal and Salivary Cortisol Concentrations in Woolly (Lagothrix ssp.) and Spider Monkeys (Ateles spp.)

    NARCIS (Netherlands)

    Ange-van Heugten, K.D.; Heugten, van E.; Timmer, S.; Bosch, G.; Elias, A.; Whisnant, S.; Swarts, H.J.M.; Ferket, P.; Verstegen, M.W.A.

    2009-01-01

    Detrimental physiological effects due to stressors can contribute to the low captive success of primates. The objective of this research was to investigate the potential impact of diet composition on cortisol concentrations in feces and saliva in woolly (n=27) and spider monkeys (n=61). The research

  11. The age and evolution of sociality in Stegodyphus spiders: a molecular phylogenetic perspective.

    Science.gov (United States)

    Johannesen, Jes; Lubin, Yael; Smith, Deborah R; Bilde, Trine; Schneider, Jutta M

    2007-01-22

    Social, cooperative breeding behaviour is rare in spiders and generally characterized by inbreeding, skewed sex ratios and high rates of colony turnover, processes that when combined may reduce genetic variation and lower individual fitness quickly. On these grounds, social spider species have been suggested to be unstable in evolutionary time, and hence sociality a rare phenomenon in spiders. Based on a partial molecular phylogeny of the genus Stegodyphus, we address the hypothesis that social spiders in this genus are evolutionary transient. We estimate the age of the three social species, test whether they represent an ancestral or derived state and assess diversification relative to subsocial congeners. Intraspecific sequence divergence was high in all of the social species, lending no support for the idea that they are young, transient species. The age of the social lineages, constant lineage branching and the likelihood that social species are independently derived suggest that either the social species are 'caught in sociality' or they have evolved into cryptic species. PMID:17148252

  12. Coercive copopulation in two sexually cannibalistic camel-spider species (Arachnida: Solifugae)

    DEFF Research Database (Denmark)

    Hrusková-Martisová, M.; Pekár, S.; Bilde, T.

    2010-01-01

    Males can overcome female resistance to mating either by using luring behaviour or through sexual coercion. We studied mating behaviour in two sexually cannibalistic camel-spider species Galeodes caspius subfuscus (Galeodidae) and Gluvia dorsalis (Desiidae), to determine the presence of luring an......-predation strategy, as sexual cannibalism occurred in c. 40% of all sexual interactions....

  13. Characterization of microsatellite loci in the subsocial spider Stegodyphus lineatus (Araneae: Eresidae)

    DEFF Research Database (Denmark)

    Bilde, T.; Tuni, Cristina; Cariani, A.;

    2009-01-01

    Stegodyphus lineatus spiders live in groups consisting of closely related individuals. There appears to be no discrimination against related individuals as mates but females mate multiply, despite the fact that matings are shown to carry a cost. We have developed eight polymorphic dinucleotide...

  14. Brown spider (Loxosceles genus) venom toxins: Evaluation of biological conservation by immune cross-reactivity.

    Science.gov (United States)

    Buch, Daniela Regina; Souza, Fernanda Nunes; Meissner, Gabriel Otto; Morgon, Adriano Marcelo; Gremski, Luiza Helena; Ferrer, Valéria Pereira; Trevisan-Silva, Dilza; Matsubara, Fernando Hitomi; Boia-Ferreira, Mariana; Sade, Youssef Bacila; Chaves-Moreira, Daniele; Gremski, Waldemiro; Veiga, Silvio Sanches; Chaim, Olga Meiri; Senff-Ribeiro, Andrea

    2015-12-15

    Loxosceles spiders are responsible for serious human envenomations worldwide. The collection of symptoms found in victims after accidents is called loxoscelism and is characterized by two clinical conditions: cutaneous loxoscelism and systemic loxocelism. The only specific treatment is serum therapy, in which an antiserum produced with Loxosceles venom is administered to the victims after spider accidents. Our aim was to improve our knowledge, regarding the immunological relationship among toxins from the most epidemiologic important species in Brazil (Loxosceles intermedia, Loxosceles gaucho and Loxosceles laeta). Immunoassays using spider venoms and L. intermedia recombinant toxins were performed and their cross-reactivity assessed. The biological conservation of the main Loxosceles toxins (Phospholipases-D, Astacin-like metalloproteases, Hyaluronidase, ICK-insecticide peptide and TCTP-histamine releasing factor) were investigated. An in silico analysis of the putative epitopes was performed and is discussed on the basis of the experimental results. Our data is an immunological investigation in light of biological conservation throughout the Loxosceles genus. The results bring out new insights on brown spider venom toxins for study, diagnosis and treatment of loxoscelism and putative biotechnological applications concerning immune conserved features in the toxins.

  15. Extant primitively segmented spiders have recently diversified from an ancient lineage

    Science.gov (United States)

    Xu, Xin; Liu, Fengxiang; Cheng, Ren-Chung; Chen, Jian; Xu, Xiang; Zhang, Zhisheng; Ono, Hirotsugu; Pham, Dinh Sac; Norma-Rashid, Y.; Arnedo, Miquel A.; Kuntner, Matjaž; Li, Daiqin

    2015-01-01

    Living fossils are lineages that have retained plesiomorphic traits through long time periods. It is expected that such lineages have both originated and diversified long ago. Such expectations have recently been challenged in some textbook examples of living fossils, notably in extant cycads and coelacanths. Using a phylogenetic approach, we tested the patterns of the origin and diversification of liphistiid spiders, a clade of spiders considered to be living fossils due to their retention of arachnid plesiomorphies and their exclusive grouping in Mesothelae, an ancient clade sister to all modern spiders. Facilitated by original sampling throughout their Asian range, we here provide the phylogenetic framework necessary for reconstructing liphistiid biogeographic history. All phylogenetic analyses support the monophyly of Liphistiidae and of eight genera. As the fossil evidence supports a Carboniferous Euramerican origin of Mesothelae, our dating analyses postulate a long eastward over-land dispersal towards the Asian origin of Liphistiidae during the Palaeogene (39–58 Ma). Contrary to expectations, diversification within extant liphistiid genera is relatively recent, in the Neogene and Late Palaeogene (4–24 Ma). While no over-water dispersal events are needed to explain their evolutionary history, the history of liphistiid spiders has the potential to play prominently in vicariant biogeographic studies. PMID:25948684

  16. Effects of aldicarb and neonicotinoid seed treatments on twospotted spider mite on cotton.

    Science.gov (United States)

    Smith, J F; Catchot, A L; Musser, F R; Gore, J

    2013-04-01

    Twelve field experiments and one laboratory experiment were conducted to determine the effects of furrow applied aldicarb and seed treatments of thiamethoxam, imidacloprid, Avicta (thiamethoxam + abamectin), Aeris (imidacloprid + thiodicarb), and acephate on twospotted spider mite, Tetranychus urticae Koch, on cotton, Cossypium hirsutum L. For the field experiments, data were pooled across all experiments for analysis. Aeris, thiamethoxam, and imidacloprid treatments resulted in twospotted spider mite densities greater than those in the untreated check, aldicarb, and acephate treatments. However, cotton treated with Avicta (thiamethoxam + abamectin) had 34% fewer mites than other neonicotinoid seed treatments when infestations occurred near cotyledon stage. Untreated check and aldicarb treatments had the lowest mite densities. Only aldicarb reduced mite densities below that in the untreated check. In a laboratory trial, the fecundity of twospotted spider mite was measured. While neonicotinoid seed treatments increased mite densities in the field, they did not increase fecundity in the laboratory experiment. Foliar applied thiamethoxam slightly elevated average fecundity in the laboratory experiment. Increased use of neonicotinoid seed treatments instead of furrow applied aldicarb is likely at least partly responsible for recent increased twospotted spider mite infestations in seedling cotton across the mid-south.

  17. Impact of twospotted spider mite (Acari: Tetranychidae) duration of infestation on cotton seedlings.

    Science.gov (United States)

    Scott, W S; Catchot, A; Gore, J; Musser, F; Cook, D

    2013-04-01

    The yield response of cotton, Gossypium hirsutum L., to twospotted spider mite, Tetranychus urticae Koch, duration of infestation during the seedling stage was measured at Starkville and Stoneville, MS, during 2010 and 2011. The treatments included a noninfested control, infestations lasting for 7, 14, 21, or 28 d, and a season long infested control. Twospotted spider mites from a greenhouse colony were inoculated on all of the infested cotton plots during the three-leaf stage. Applications of miticides were made to terminate infestations at the desired timings for each treatment. Twospotted spider mite densities and injury ratings were determined for each treatment at the end of the infestation period and yield was measured at the end of the season. Twospotted spider mite densities and injury rating significantly increased as duration of infestation increased. Significant differences in yield were observed between treatments. These data suggest infestations initiated at the three-leaf cotton growth stage with population densities at a minimum of 0.39 mites/cm2 existing > 14 d could result in reduction of cotton yields.

  18. Testing for collective choices in the two-spotted spider mite.

    Science.gov (United States)

    Astudillo Fernandez, Aina; Hance, Thierry; Clotuche, Gwendoline; Mailleux, Anne-Catherine; Deneubourg, Jean Louis

    2012-09-01

    Silk is a vector for collective behaviour in many spinning arthropods, including social spiders, social caterpillars, and some spider mites. In this study, the potential for silk-mediated collective choices is evaluated for the two-spotted spider mite Tetranychus urticae. This subsocial mite lives in large colonies on plants, sheltered under a collectively spun silk web. The silk has an attractive and arresting effect. We test whether the silk trails left by the spider mites can give rise to the collective choice of a path. The experiment consists in offering two identical paths to a group of migrating mites. Our results show that the presence of a silk trail influences the mites, but not sufficiently to systematically provoke a collective choice. In order to determine the trail following potential of T. urticae, we parameterise a theoretical trail following model to fit our experiments and those found in the literature. Our prediction is that even after a large number of mites have passed (200), a systematic collective choice of path should not be expected under the tested conditions. Our results, combined with what is known from the literature, allow us to propose a general scenario for the dispersal behaviour of T. urticae.

  19. Blood-injection-injury phobia and fear of spiders : Domain specific individual differences in disgust sensitivity

    NARCIS (Netherlands)

    Merckelbach, H; de Jong, Peter

    1998-01-01

    We investigated whether disgust sensitivity is associated with blood-injection-injury (BII) and spider fear. We also explored whether the relationship between disgust sensitivity and phobic fears is domain specific. Ninety-six undergraduates (all women) completed the Disgust Questionnaire (DQ) (Rozi

  20. Drivers of diversity in Macaronesian spiders and the role of species extinctions

    OpenAIRE

    Cardoso, Pedro; Arnedo, Miquel A.; Triantis, Kostas A.; Borges, Paulo A. V.

    2010-01-01

    Copyright © 2010 Blackwell Publishing. AIM To identify the biogeographical factors underlying spider species richness in the Macaronesian region and assess the importance of species extinctions in shaping the current diversity. LOCATION The European archipelagos of Macaronesia with an emphasis on the Azores and Canary Islands.

  1. Ninetis russellsmithi n. sp., an unusual new pholcid spider species from Malawi (Araneae: Pholcidae

    Directory of Open Access Journals (Sweden)

    Bernhard A. Huber

    2002-03-01

    Full Text Available A new species Ninetis russellsmithi n. sp. is described from Malawi. It lacks the most prominent autapomorphy of pholcid spiders, the retrolateral projection of the cymbium (procursus. Biogeographically this species marks the first record for the genus in a 3000 km gap between its African congeners in Namibia and Tanzania.

  2. Side effects of kaolin particle films on apple orchard bug, beetle and spider communities

    NARCIS (Netherlands)

    Marko, V.; Bogya, S.; Kondorosy, E.; Blommers, L.H.M.

    2010-01-01

    The effects of multiple applications of hydrophobic kaolin particle film on apple orchard bug (Heteroptera), beetle (Coleoptera) and spider (Araneae) assemblages were studied in the Netherlands. Insecticide-free orchard plots served as a control. The kaolin applications significantly reduced the abu

  3. Spiders in Motion: Demonstrating Adaptation, Structure-Function Relationships, and Trade-Offs in Invertebrates

    Science.gov (United States)

    Bowlin, Melissa S.; McLeer, Dorothy F.; Danielson-Francois, Anne M.

    2014-01-01

    Evolutionary history and structural considerations constrain all aspects of animal physiology. Constraints on invertebrate locomotion are especially straightforward for students to observe and understand. In this exercise, students use spiders to investigate the concepts of adaptation, structure-function relationships, and trade-offs. Students…

  4. Expression of a wolf spider toxin in tobacco inhibits the growth of microbes and insects

    Science.gov (United States)

    Abstract Lycotoxin I, from the wolf spider (Lycosa carolinensis), is an amphipathic pore-forming peptide that has antimicrobial and anti-insect activity. Constitutive expression of a lycotoxin I odified for oral toxicity to insects in tobacco (Nicotiana abacum) conferred significantly enhanced resis...

  5. Influence of the biogeospatial environment on the distribution of spider communities

    Science.gov (United States)

    The maintenance of local biodiversity is an important aspect of the long-term sustainability of agricultural production. Maintaining biodiversity, especially in regards to predator species, promotes natural pest control and many other ecosystem services. Spiders (Araneae) often prey upon common pest...

  6. 3D Finite Element Analysis of Spider Non-isothermal Forging Process

    Science.gov (United States)

    Niu, Ling; Wei, Wei; Wei, Kun Xia; Alexandrov, Igor V.; Hu, Jing

    2016-06-01

    The differences of effective stress, effective strain, velocity field, and the load-time curves between the spider isothermal and non-isothermal forging processes are investigated by making full use of 3D FEA, and verified by the production experiment of spider forging. Effective stress is mainly concentrated on the pin, and becomes lower closer to the front of the pin. The maximum effective strain in the non-isothermal forging is lower than that in the isothermal. The great majority of strain in the non-isothermal forging process is 1.76, which is larger than the strain of 1.31 in the isothermal forging. The maximum load required in the isothermal forging is higher than that in the non-isothermal. The maximum experimental load and deformation temperature in the spider production are in good agreement with those in the non-isothermal FEA. The results indicate that the non-isothermal 3D FEA results can guide the design of the spider forging process.

  7. The Implicit Relational Assessment Procedure (IRAP) as a Measure of Spider Fear

    Science.gov (United States)

    Nicholson, Emma; Barnes-Holmes, Dermot

    2012-01-01

    A greater understanding of implicit cognition can provide important information regarding the etiology and maintenance of psychological disorders. The current study sought to determine the utility of the Implicit Relational Assessment Procedure (IRAP) as a measure of implicit aversive bias toward spiders in two groups of known variation, high fear…

  8. Palpimanid spiders from Guyana: new species of the genera Fernandezina and Otiothops (Araneae, Palpimanidae, Otiothopinae

    Directory of Open Access Journals (Sweden)

    Grismado Cristian J.

    2002-01-01

    Full Text Available Two new species of the spider family Palpimanidae from Guyana are described: Fernandezina takutu, the first species of this genus known from this country andOtiothops giralunas, that seems to be the sister species of O. goloboffi Grismado, 1996 from northwestern Argentina.

  9. Evidence from Multiple Species that Spider Silk Glue Component ASG2 is a Spidroin

    Science.gov (United States)

    Collin, Matthew A.; Clarke, Thomas H.; Ayoub, Nadia A.; Hayashi, Cheryl Y.

    2016-01-01

    Spiders in the superfamily Araneoidea produce viscous glue from aggregate silk glands. Aggregate glue coats prey-capture threads and hampers the escape of prey from webs, thereby increasing the foraging success of spiders. cDNAs for Aggregate Spider Glue 1 (ASG1) and 2 (ASG2) have been previously described from the golden orb-weaver, Nephila clavipes, and Western black widow, Latrodectus hesperus. To further investigate aggregate glues, we assembled ASG1 and ASG2 from genomic target capture libraries constructed from three species of cob-web weavers and three species of orb-web weavers, all araneoids. We show that ASG1 is unlikely to be a glue, but rather is part of a widespread arthropod gene family, the peritrophic matrix proteins. For ASG2, we demonstrate its remarkable architectural and sequence similarities to spider silk fibroins, indicating that ASG2 is a member of the spidroin gene family. Thus, spidroins have diversified into glues in addition to task-specific, high performance fibers. PMID:26875681

  10. Turkish adaptation of the Fear of Spiders Questionnaire: Reliability and validity in non-clinical samples

    Directory of Open Access Journals (Sweden)

    Robert W. Booth

    2016-12-01

    Full Text Available The rapid, objective measurement of spider fear is important for clinicians, and for researchers studying fear. To facilitate this, we adapted the Fear of Spiders Questionnaire (FSQ into Turkish. The FSQ is quick to complete and easy to understand. Compared to the commonly used Spider Phobia Questionnaire, it has shown superior test-retest reliability and better discrimination of lower levels of spider fear, facilitating fear research in non-clinical samples. In two studies, with 137 and 105 undergraduates and unselected volunteers, our adapted FSQ showed excellent internal consistency (Cronbach’s α = .95 and .96 and test-retest reliability (r = .90, and good discriminant validity against the State–Trait Anxiety Inventory—Trait (r = .23 and Beck Anxiety Inventory—Trait (r = .07. Most importantly, our adapted FSQ significantly predicted 26 students’ self-reported discomfort upon approaching a caged tarantula; however, a measure of behavioural avoidance of the tarantula yielded little variability, so a more sensitive task will be required for future behavioural testing. Based on this initial testing, we recommend our adapted FSQ for research use. Further research is required to verify that our adapted FSQ discriminates individuals with and without phobia effectively. A Turkish-language report of the studies is included as supplementary material.

  11. Research on Focused Spider%主题爬虫研究进展

    Institute of Scientific and Technical Information of China (English)

    王贤明

    2014-01-01

    With the rapid development of the Internet technology, the amount of pages in the WWW has grown dramatically and search engines are irreplaceable for web users and become the entries of the web for people. Web spider, as the data source for search engine, is the most important component of search engine. Introduces the key technologies of web spider. In addition, the growing individual needs of web users as well as the dramatic increase in the number of pages leading general search engines can not meet the specific needs of users. The topic-based search engines have been rapid development. The focused spider has also been great breakthroughs and progress in the meanwhile. Unlike general spiders, general spiders focused crawling general integrity, and the focused spiders emphasize the relevance of a particular topic. Introduces the researches on focused spiders.%随着互联网技术的飞速发展,网页数量急剧增加,搜索引擎的地位已经不可取代,成为人们使用Internet的入口。网络蜘蛛作为搜索引擎的信息来源是搜索引擎必不可少的组成部分。介绍网络蜘蛛设计中的关键技术。另外,随着用户个性化需求越来越强以及网页数量的急剧增加导致通用搜索引擎无法满足特定用户的需求,专业搜索引擎得到快速的发展。同时对于主题爬虫的研究也有很大的突破和进展。主题爬虫有别于通用爬虫,通用爬虫注重爬取的完整性,而主题爬虫强调网页与特定主题的相关性。同时对主题爬虫的研究现状进行介绍和总结。

  12. Interactive effects of fire and large herbivores on web-building spiders.

    Science.gov (United States)

    Foster, C N; Barton, P S; Wood, J T; Lindenmayer, D B

    2015-09-01

    Altered disturbance regimes are a major driver of biodiversity loss worldwide. Maintaining or re-creating natural disturbance regimes is therefore the focus of many conservation programmes. A key challenge, however, is to understand how co-occurring disturbances interact to affect biodiversity. We experimentally tested for the interactive effects of prescribed fire and large macropod herbivores on the web-building spider assemblage of a eucalypt forest understorey and investigated the role of vegetation in mediating these effects using path analysis. Fire had strong negative effects on the density of web-building spiders, which were partly mediated by effects on vegetation structure, while negative effects of large herbivores on web density were not related to changes in vegetation. Fire amplified the effects of large herbivores on spiders, both via vegetation-mediated pathways and by increasing herbivore activity. The importance of vegetation-mediated pathways and fire-herbivore interactions differed for web density and richness and also differed between web types. Our results demonstrate that for some groups of web-building spiders, the effects of co-occurring disturbance drivers may be mostly additive, whereas for other groups, interactions between drivers can amplify disturbance effects. In our study system, the use of prescribed fire in the presence of high densities of herbivores could lead to reduced densities and altered composition of web-building spiders, with potential cascading effects through the arthropod food web. Our study highlights the importance of considering both the independent and interactive effects of disturbances, as well as the mechanisms driving their effects, in the management of disturbance regimes.

  13. Spider trait assembly patterns and resilience under fire-induced vegetation change in South Brazilian grasslands.

    Directory of Open Access Journals (Sweden)

    Luciana R Podgaiski

    Full Text Available Disturbances induce changes on habitat proprieties that may filter organism's functional traits thereby shaping the structure and interactions of many trophic levels. We tested if communities of predators with foraging traits dependent on habitat structure respond to environmental change through cascades affecting the functional traits of plants. We monitored the response of spider and plant communities to fire in South Brazilian Grasslands using pairs of burned and unburned plots. Spiders were determined to the family level and described in feeding behavioral and morphological traits measured on each individual. Life form and morphological traits were recorded for plant species. One month after fire the abundance of vegetation hunters and the mean size of the chelicera increased due to the presence of suitable feeding sites in the regrowing vegetation, but irregular web builders decreased due to the absence of microhabitats and dense foliage into which they build their webs. Six months after fire rosette-form plants with broader leaves increased, creating a favourable habitat for orb web builders which became more abundant, while graminoids and tall plants were reduced, resulting in a decrease of proper shelters and microclimate in soil surface to ground hunters which became less abundant. Hence, fire triggered changes in vegetation structure that lead both to trait-convergence and trait-divergence assembly patterns of spiders along gradients of plant biomass and functional diversity. Spider individuals occurring in more functionally diverse plant communities were more diverse in their traits probably because increased possibility of resource exploitation, following the habitat heterogeneity hypothesis. Finally, as an indication of resilience, after twelve months spider communities did not differ from those of unburned plots. Our findings show that functional traits provide a mechanistic understanding of the response of communities to

  14. SignalSpider: Probabilistic pattern discovery on multiple normalized ChIP-Seq signal profiles

    KAUST Repository

    Wong, Kachun

    2014-09-05

    Motivation: Chromatin immunoprecipitation (ChIP) followed by high-throughput sequencing (ChIP-Seq) measures the genome-wide occupancy of transcription factors in vivo. Different combinations of DNA-binding protein occupancies may result in a gene being expressed in different tissues or at different developmental stages. To fully understand the functions of genes, it is essential to develop probabilistic models on multiple ChIP-Seq profiles to decipher the combinatorial regulatory mechanisms by multiple transcription factors. Results: In this work, we describe a probabilistic model (SignalSpider) to decipher the combinatorial binding events of multiple transcription factors. Comparing with similar existing methods, we found SignalSpider performs better in clustering promoter and enhancer regions. Notably, SignalSpider can learn higher-order combinatorial patterns from multiple ChIP-Seq profiles. We have applied SignalSpider on the normalized ChIP-Seq profiles from the ENCODE consortium and learned model instances. We observed different higher-order enrichment and depletion patterns across sets of proteins. Those clustering patterns are supported by Gene Ontology (GO) enrichment, evolutionary conservation and chromatin interaction enrichment, offering biological insights for further focused studies. We also proposed a specific enrichment map visualization method to reveal the genome-wide transcription factor combinatorial patterns from the models built, which extend our existing fine-scale knowledge on gene regulation to a genome-wide level. Availability and implementation: The matrix-algebra-optimized executables and source codes are available at the authors\\' websites: http://www.cs.toronto.edu/∼wkc/SignalSpider. Contact: Supplementary information: Supplementary data are available at Bioinformatics online.

  15. Thermal conditions during juvenile development affect adult dispersal in a spider.

    Science.gov (United States)

    Bonte, Dries; Travis, Justin M J; De Clercq, Nele; Zwertvaegher, Ingrid; Lens, Luc

    2008-11-01

    Understanding the causes and consequences of dispersal is a prerequisite for the effective management of natural populations. Rather than treating dispersal as a fixed trait, it should be considered a plastic process that responds to both genetic and environmental conditions. Here, we consider how the ambient temperature experienced by juvenile Erigone atra, a spider inhabiting crop habitat, influences adult dispersal. This species exhibits 2 distinct forms of dispersal, ballooning (long distance) and rappelling (short distance). Using a half-sib design we raised individuals under 4 different temperature regimes and quantified the spiders' propensity to balloon and to rappel. Additionally, as an indicator of investment in settlement, we determined the size of the webs build by the spiders following dispersal. The optimal temperature regimes for reproduction and overall dispersal investment were 20 degrees C and 25 degrees C. Propensity to perform short-distance movements was lowest at 15 degrees C, whereas for long-distance dispersal it was lowest at 30 degrees C. Plasticity in dispersal was in the direction predicted on the basis of the risks associated with seasonal changes in habitat availability; long-distance ballooning occurred more frequently under cooler, spring-like conditions and short-distance rappelling under warmer, summer-like conditions. Based on these findings, we conclude that thermal conditions during development provide juvenile spiders with information about the environmental conditions they are likely to encounter as adults and that this information influences the spider's dispersal strategy. Climate change may result in suboptimal adult dispersal behavior, with potentially deleterious population level consequences. PMID:18974219

  16. Interactive effects of fire and large herbivores on web-building spiders.

    Science.gov (United States)

    Foster, C N; Barton, P S; Wood, J T; Lindenmayer, D B

    2015-09-01

    Altered disturbance regimes are a major driver of biodiversity loss worldwide. Maintaining or re-creating natural disturbance regimes is therefore the focus of many conservation programmes. A key challenge, however, is to understand how co-occurring disturbances interact to affect biodiversity. We experimentally tested for the interactive effects of prescribed fire and large macropod herbivores on the web-building spider assemblage of a eucalypt forest understorey and investigated the role of vegetation in mediating these effects using path analysis. Fire had strong negative effects on the density of web-building spiders, which were partly mediated by effects on vegetation structure, while negative effects of large herbivores on web density were not related to changes in vegetation. Fire amplified the effects of large herbivores on spiders, both via vegetation-mediated pathways and by increasing herbivore activity. The importance of vegetation-mediated pathways and fire-herbivore interactions differed for web density and richness and also differed between web types. Our results demonstrate that for some groups of web-building spiders, the effects of co-occurring disturbance drivers may be mostly additive, whereas for other groups, interactions between drivers can amplify disturbance effects. In our study system, the use of prescribed fire in the presence of high densities of herbivores could lead to reduced densities and altered composition of web-building spiders, with potential cascading effects through the arthropod food web. Our study highlights the importance of considering both the independent and interactive effects of disturbances, as well as the mechanisms driving their effects, in the management of disturbance regimes. PMID:25935217

  17. Final Critical Habitat for Kauai cave wolf spider (Adelocosa anops) and the Kauai cave amphipod (Spelaeorchestia koloana).

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — These data identify, in general, the areas of final critical habitat for Kauai cave wolf spider (Adelocosa anops) and the Kauai cave amphipod (Spelaeorchestia...

  18. The biodiversity and species composition of the spider community of Marion Island, a recent survey (Arachnida: Araneae

    Directory of Open Access Journals (Sweden)

    T.T. Khoza

    2005-12-01

    Full Text Available Marion Island, the larger of the Prince Edward Islands, lies in the sub-Antarctic biogeographic region in the southern Indian Ocean. From previous surveys, four spider species are known from Marion. The last survey was undertaken in 1968. During this study a survey was undertaken over a period of four weeks on the island to determine the present spider diversity and to record information about the habitat preferences and general behaviour of the species present. Three collection methods (active search, Tullgren funnels and pitfall traps were used, and spiders were sampled from six habitat sites. A total of 430 spiders represented by four families were collected, Myro kerguelenesis crozetensis Enderlein, 1909 and M. paucispinosus Berland, 1947 (Desidae, Prinerigone vagans (Audouin, 1826 (Linyphiidae, Cheiracanthium furculatum Karsch, 1879 (Miturgidae and an immature Salticidae. The miturgid and salticid are first records. Neomaso antarticus (Hickman, 1939 (Linyphiidae was absent from samples, confirming that the species might have been an erroneous record.

  19. Heterologous expression of five disulfide-bonded insecticidal spider peptides.

    Science.gov (United States)

    Estrada, Georgina; Silva, Anita O; Villegas, Elba; Ortiz, Ernesto; Beirão, Paulo S L; Corzo, Gerardo

    2016-09-01

    The genes of the five disulfide-bonded peptide toxins 1 and 2 (named Oxytoxins or Oxotoxins) from the spider Oxyopes lineatus were cloned into the expression vector pQE30 containing a 6His-tag and a Factor Xa proteolytic cleavage region. These two recombinant vectors were transfected into Escherichia coli BL21 cells and expressed under induction with isopropyl thiogalactoside (IPTG). The product of each gene was named HisrOxyTx1 or HisrOxyTx2, and the protein expression was ca 14 and 6 mg/L of culture medium, respectively. Either recombinant toxin HisrOxyTx1 or HisrOxyTx2 were found exclusively in inclusion bodies, which were solubilized using a chaotropic agent, and then, purified using affinity chromatography and reverse-phase HPLC (RP-HPLC). The HisrOxyTx1 and HisrOxyTx2 products, obtained from the affinity chromatographic step, showed several peptide fractions having the same molecular mass of 9913.1 and 8030.1 Da, respectively, indicating that both HisrOxyTx1 and HisrOxyTx2 were oxidized forming several distinct disulfide bridge arrangements. The isoforms of both HisrOxyTx1 and HisrOxyTx2 after DTT reduction eluted from the column as a single protein component of 9923 and 8040 Da, respectively. In vitro folding of either HisrOxyTx1 or HisrOxyTx2 yielded single oxidized components, which were cleaved independently by the proteolytic enzyme Factor Xa to give the recombinant peptides rOxyTx1 and rOxyTx2. The experimental molecular masses of rOxyTx1 and rOxyTx2 were 8059.0 and 6176.4 Da, respectively, which agree with their expected theoretical masses. The recombinant peptides rOxyTx1 and rOxyTx2 showed lower but comparable toxicity to the native toxins when injected into lepidopteran larvae; furthermore, rOxyTx1 was able to inhibit calcium ion currents on dorsal unpaired median (DUM) neurons from Periplaneta americana. PMID:27263806

  20. Influence of Crop Management and Environmental Factors on Wolf Spider Assemblages (Araneae: Lycosidae) in an Australian Cotton Cropping System.

    Science.gov (United States)

    Rendon, Dalila; Whitehouse, Mary E A; Hulugalle, Nilantha R; Taylor, Phillip W

    2015-02-01

    Wolf spiders (Lycosidae) are the most abundant ground-hunting spiders in the Australian cotton (Gossypium hirsutum L.) agroecosystems. These spiders have potential in controlling pest bollworms, Helicoverpa spp. (Lepidoptera: Noctuidae) in minimum-tilled fields. A study was carried out during a wet growing season (2011-2012) in Narrabri, New South Wales, Australia, to determine how different crop rotations and tillage affect wolf spider assemblages in cotton fields. Spider abundance and species richness did not differ significantly between simple plots (no winter crop) and complex plots (cotton-wheat Triticum aestivum L.-vetch Vicia benghalensis L. rotation). However, the wolf spider biodiversity, as expressed by the Shannon-Weaver and Simpson's indices, was significantly higher in complex plots. Higher biodiversity reflected a more even distribution of the most dominant species (Venatrix konei Berland, Hogna crispipes Koch, and Tasmanicosa leuckartii Thorell) and the presence of more rare species in complex plots. T. leuckartii was more abundant in complex plots and appears to be sensitive to farming disturbances, whereas V. konei and H. crispipes were similarly abundant in the two plot types, suggesting higher resilience or recolonizing abilities. The demographic structure of these three species varied through the season, but not between plot types. Environmental variables had a significant effect on spider assemblage, but effects of environment and plot treatment were overshadowed by the seasonal progression of cotton stages. Maintaining a high density and even distribution of wolf spiders that prey on Helicoverpa spp. should be considered as a conservation biological control element when implementing agronomic and pest management strategies.

  1. Old maids have more appeal: effects of age and pheromone source on mate attraction in an orb-web spider

    OpenAIRE

    Cory, Anna-Lena; Schneider, Jutta M

    2016-01-01

    Background. In many insects and spider species, females attract males with volatile sex pheromones, but we know surprisingly little about the costs and benefits of female pheromone emission. Here, we test the hypothesis that mate attraction by females is dynamic and strategic in the sense that investment in mate attraction is matched to the needs of the female. We use the orb-web spider Argiope bruennichi in which females risk the production of unfertilised egg clutches if they do not receive...

  2. Warring arthropod societies: Social spider colonies can delay annihilation by predatory ants via reduced apparency and increased group size.

    Science.gov (United States)

    Keiser, Carl N; Wright, Colin M; Pruitt, Jonathan N

    2015-10-01

    Sociality provides individuals with benefits via collective foraging and anti-predator defense. One of the costs of living in large groups, however, is increased apparency to natural enemies. Here, we test how the individual-level and collective traits of spider societies can increase the risk of discovery and death by predatory ants. We transplanted colonies of the social spider Stegodyphus dumicola into a habitat dense with one of their top predators, the pugnacious ant Anoplolepis custodiens. With three different experiments, we test how colony-wide survivorship in a predator-dense habitat can be altered by colony apparency (i.e., the presence of a capture web), group size, and group composition (i.e., the proportion of bold and shy personality types present). We also test how spiders' social context (i.e., living solitarily vs. among conspecifics) modifies their behaviour toward ants in their capture web. Colonies with capture webs intact were discovered by predatory ants on average 25% faster than colonies with the capture web removed, and all discovered colonies eventually collapsed and succumbed to predation. However, the lag time from discovery by ants to colony collapse was greater for colonies containing more individuals. The composition of individual personality types in the group had no influence on survivorship. Spiders in a social group were more likely to approach ants caught in their web than were isolated spiders. Isolated spiders were more likely to attack a safe prey item (a moth) than they were to attack ants and were more likely to retreat from ants after contact than they were after contact with moths. Together, our data suggest that the physical structures produced by large animal societies can increase their apparency to natural enemies, though larger groups can facilitate a longer lag time between discovery and demise. Lastly, the interaction between spiders and predatory ants seems to depend on the social context in which spiders reside

  3. Effect of summer fire on cursorial spider (Aranei and beetle (Coleoptera assemblages in meadow steppes of Central European Russia

    Directory of Open Access Journals (Sweden)

    Polchaninova Nina

    2016-12-01

    Full Text Available Fire is an important structuring force for grassland ecosystems. Despite increased incidents of fire in European steppes, their impact on arthropod communities is still poorly studied. We assessed short-term changes in cursorial beetle and spider assemblages after a summer fire in the meadow steppe in Central European Russia. The responses of spider and beetle assemblages to the fire event were different. In the first post-fire year, the same beetle species dominated burnt and unburnt plots, the alpha-diversity of beetle assemblages was similar, and there were no pronounced changes in the proportions of trophic groups. Beetle species richness and activity density increased in the second post-fire year, while that of the spiders decreased. The spider alpha-diversity was lowest in the first post-fire year, and the main dominants were pioneer species. In the second year, the differences in spider species composition and activity density diminished. The main conclusion of our study is that the large-scale intensive summer fire caused no profound changes in cursorial beetle and spider assemblages of this steppe plot. Mitigation of the fire effect is explained by the small plot area, its location at the edge of the fire site and the presence of adjacent undisturbed habitats with herbaceous vegetation.

  4. Changes in species diversity of arboreal spiders in Mexican coffee agroecosystems: untangling the web of local and landscape influences driving diversity

    Directory of Open Access Journals (Sweden)

    Zachary Hajian-Forooshani

    2014-11-01

    Full Text Available Agricultural intensification is implicated as a major driver of global biodiversity loss. Local management and landscape scale factors both influence biodiversity in agricultural systems, but there are relatively few studies to date looking at how local and landscape scales influence biodiversity in tropical agroecosystems. Understanding what drives the diversity of groups of organisms such as spiders is important from a pragmatic point of view because of the important biocontrol services they offer to agriculture. Spiders in coffee are somewhat enigmatic because of their positive or lack of response to agricultural intensification. In this study, we provide the first analysis, to our knowledge, of the arboreal spiders in the shade trees of coffee plantations. In the Soconusco region of Chiapas, Mexico we sampled across 38 sites on 9 coffee plantations. Tree and canopy connectedness were found to positively influence overall arboreal spider richness and abundance. We found that different functional groups of spiders are responding to different local and landscape factors, but overall elevation was most important variable influencing arboreal spider diversity. Our study has practical management applications that suggest having shade grown coffee offers more suitable habitat for arboreal spiders due to a variety of the characteristics of the shade trees. Our results which show consistently more diverse arboreal spider communities in lower elevations are important in light of looming global climate change. As the range of suitable elevations for coffee cultivation shrinks promoting arboreal spider diversity will be important in sustaining the viability of coffee.

  5. Changes in species diversity of arboreal spiders in Mexican coffee agroecosystems: untangling the web of local and landscape influences driving diversity.

    Science.gov (United States)

    Hajian-Forooshani, Zachary; Gonthier, David J; Marín, Linda; Iverson, Aaron L; Perfecto, Ivette

    2014-01-01

    Agricultural intensification is implicated as a major driver of global biodiversity loss. Local management and landscape scale factors both influence biodiversity in agricultural systems, but there are relatively few studies to date looking at how local and landscape scales influence biodiversity in tropical agroecosystems. Understanding what drives the diversity of groups of organisms such as spiders is important from a pragmatic point of view because of the important biocontrol services they offer to agriculture. Spiders in coffee are somewhat enigmatic because of their positive or lack of response to agricultural intensification. In this study, we provide the first analysis, to our knowledge, of the arboreal spiders in the shade trees of coffee plantations. In the Soconusco region of Chiapas, Mexico we sampled across 38 sites on 9 coffee plantations. Tree and canopy connectedness were found to positively influence overall arboreal spider richness and abundance. We found that different functional groups of spiders are responding to different local and landscape factors, but overall elevation was most important variable influencing arboreal spider diversity. Our study has practical management applications that suggest having shade grown coffee offers more suitable habitat for arboreal spiders due to a variety of the characteristics of the shade trees. Our results which show consistently more diverse arboreal spider communities in lower elevations are important in light of looming global climate change. As the range of suitable elevations for coffee cultivation shrinks promoting arboreal spider diversity will be important in sustaining the viability of coffee.

  6. Intra-community infanticide and forced copulation in spider monkeys: a multi-site comparison between Cocha Cashu, Peru and Punta Laguna, Mexico.

    Science.gov (United States)

    Gibson, K Nicole; Vick, Laura G; Palma, Ana Cristina; Carrasco, Farah M; Taub, David; Ramos-Fernández, Gabriel

    2008-05-01

    We describe two cases of infanticide, two suspected infanticides, and a forced copulation by familiar resident males in two populations of wild spider monkeys (Ateles belzebuth chamek and A. geoffroyi yucatanensis). These are the first known infanticides and forced copulation in spider monkeys. Data were gathered from four neighboring communities of spider monkeys in Manu National Park at the Cocha Cashu Biological Station, Peru and two communities in the Otoch Ma'ax Yetel Kooh Reserve at Punta Laguna, Mexico, during intensive field studies of over 2,000 hr each. These are rare behaviors, but results suggest that mating history and sexual coercion are important in spider monkey social relationships. PMID:18064591

  7. Changes in species diversity of arboreal spiders in Mexican coffee agroecosystems: untangling the web of local and landscape influences driving diversity.

    Science.gov (United States)

    Hajian-Forooshani, Zachary; Gonthier, David J; Marín, Linda; Iverson, Aaron L; Perfecto, Ivette

    2014-01-01

    Agricultural intensification is implicated as a major driver of global biodiversity loss. Local management and landscape scale factors both influence biodiversity in agricultural systems, but there are relatively few studies to date looking at how local and landscape scales influence biodiversity in tropical agroecosystems. Understanding what drives the diversity of groups of organisms such as spiders is important from a pragmatic point of view because of the important biocontrol services they offer to agriculture. Spiders in coffee are somewhat enigmatic because of their positive or lack of response to agricultural intensification. In this study, we provide the first analysis, to our knowledge, of the arboreal spiders in the shade trees of coffee plantations. In the Soconusco region of Chiapas, Mexico we sampled across 38 sites on 9 coffee plantations. Tree and canopy connectedness were found to positively influence overall arboreal spider richness and abundance. We found that different functional groups of spiders are responding to different local and landscape factors, but overall elevation was most important variable influencing arboreal spider diversity. Our study has practical management applications that suggest having shade grown coffee offers more suitable habitat for arboreal spiders due to a variety of the characteristics of the shade trees. Our results which show consistently more diverse arboreal spider communities in lower elevations are important in light of looming global climate change. As the range of suitable elevations for coffee cultivation shrinks promoting arboreal spider diversity will be important in sustaining the viability of coffee. PMID:25392751

  8. Spiders (Arachnida: Araneae of the vegetation layer of the Mkambati Nature Reserve, Eastern Cape, South Africa

    Directory of Open Access Journals (Sweden)

    Anna S. Dippenaar-Schoeman

    2011-03-01

    Full Text Available The Pondoland region of the Eastern Cape province, South Africa is very poorly studied with regard to invertebrate diversity, particularly in the case of arachnids. Accordingly, and in view of proposed infrastructural and mining developments in this ecologically sensitive area of high plant endemism, baseline data are provided on spiders (Araneae of the vegetation layer (i.e. excluding the ground-dwelling fauna of the Mkambati Nature Reserve (MNR. Spiders were collected at 26 sites (six forest and 20 grassland sites in the MNR over an eight-day period, using sweep sampling and active searching of flowers in grassland and tree beating in forests, as part of a broader biodiversity survey. Additional specimens were collected with Malaise and pan traps. A total of 1275 specimens were sampled, representing 132 species (6.6% of the total number recorded in South Africa in 103 genera and 29 families. Theridiidae and Araneidae were the most diverse spider families in the reserve, represented by 22 species each (16.7% of the total, followed by Thomisidae with 19 species (14.4% and Salticidae with 18 species (13.6%. Grassland and forest had distinct spider faunas, with only 24.2% of species being recorded from both biomes. The average number of species sampled per site in grassland and forest was 26 species for both habitats, although values for the two biomes are not directly comparable because different sampling methods were used. All 132 species are new records for the reserve, of which 20 were new records for the Eastern Cape and at least eight spider species may be new to science. The spider diversity captured despite temporal and methodological limits indicates that many additional species are likely to occur in the reserve. Conservation implications: If the MNR is not adequately conserved at least five new species, which may be confined to the area, would be at high risk of extinction and 15 other species endemic to the Pondoland and Kwa

  9. Wild tomato leaf extracts for spider mite and cowpea aphid control.

    Science.gov (United States)

    Antonious, George F; Kamminga, Katherine; Snyder, John C

    2014-01-01

    Glandular trichomes on the leaves of wild tomato, L. hirsutum f. hirsutum Mull, also known as Solanum habrochaites (Solanaceae), synthesize and accumulate high levels of methyl ketones (MKs). L. hirsutum accession LA 407, having high concentration of MKs, was grown from seeds under greenhouse conditions. Four MKs (2-undecanone, 2-dodecanone, 2-tridecanone, and 2-pentadecanone) were screened for their toxicity to spider mites, Tetranychus urticae Koch and cowpea aphids, Aphis craccivora Koch. The objectives of this investigation were to: (1) develop a bioassay for testing MKs on spider mite and cowpea aphid mortality and (2) compare the efficacies of wild tomato leaf crude extracts and pure standard materials of MKs against spider mite and cowpea aphid mortality. Our results revealed that spider mites are most sensitive to 2-tridecanone (LC50 = 0.08 μmole cm(-2) of treated leaf surface) and least sensitive to 2-undecanone (LC50 = 1.5 μmole cm(-2) of treated leaf surface) 4 h after treatment. Similarly, 2-tridecanone caused greatest mortality (LC50 = 0.2 μmole cm(-2) of treated leaf surface), whereas 2-undecanone caused the lowest morality (LC50 = 0.48 μmole cm(-2) of treated surface) of cowpea aphid. We concluded that all MKs tested in this investigation are toxic to spider mites and aphids. 2-Tridecanone is more effective in killing mites and aphids compared to other MKs. Toxicity of crude extracts, prepared from the leaves of L. hirsutum accession LA 407, to spider mites and cowpea aphids revealed greater mortality compared to a combined mixture of MKs standard material (used at the same concentration as found on LA 407 leaves). This indicates that in addition to MKs, other unidentified compounds in LA 407 leaf extract also have pesticidal properties. Accordingly, leaf extracts of LA 407 could be explored in crop protection, and they might open a new area of MK formulations and discovery of biorational alternatives for pest control in agricultural fields. PMID

  10. Wild tomato leaf extracts for spider mite and cowpea aphid control.

    Science.gov (United States)

    Antonious, George F; Kamminga, Katherine; Snyder, John C

    2014-01-01

    Glandular trichomes on the leaves of wild tomato, L. hirsutum f. hirsutum Mull, also known as Solanum habrochaites (Solanaceae), synthesize and accumulate high levels of methyl ketones (MKs). L. hirsutum accession LA 407, having high concentration of MKs, was grown from seeds under greenhouse conditions. Four MKs (2-undecanone, 2-dodecanone, 2-tridecanone, and 2-pentadecanone) were screened for their toxicity to spider mites, Tetranychus urticae Koch and cowpea aphids, Aphis craccivora Koch. The objectives of this investigation were to: (1) develop a bioassay for testing MKs on spider mite and cowpea aphid mortality and (2) compare the efficacies of wild tomato leaf crude extracts and pure standard materials of MKs against spider mite and cowpea aphid mortality. Our results revealed that spider mites are most sensitive to 2-tridecanone (LC50 = 0.08 μmole cm(-2) of treated leaf surface) and least sensitive to 2-undecanone (LC50 = 1.5 μmole cm(-2) of treated leaf surface) 4 h after treatment. Similarly, 2-tridecanone caused greatest mortality (LC50 = 0.2 μmole cm(-2) of treated leaf surface), whereas 2-undecanone caused the lowest morality (LC50 = 0.48 μmole cm(-2) of treated surface) of cowpea aphid. We concluded that all MKs tested in this investigation are toxic to spider mites and aphids. 2-Tridecanone is more effective in killing mites and aphids compared to other MKs. Toxicity of crude extracts, prepared from the leaves of L. hirsutum accession LA 407, to spider mites and cowpea aphids revealed greater mortality compared to a combined mixture of MKs standard material (used at the same concentration as found on LA 407 leaves). This indicates that in addition to MKs, other unidentified compounds in LA 407 leaf extract also have pesticidal properties. Accordingly, leaf extracts of LA 407 could be explored in crop protection, and they might open a new area of MK formulations and discovery of biorational alternatives for pest control in agricultural fields.

  11. Spiders on a Hot Volcanic Roof: Colonisation Pathways and Phylogeography of the Canary Islands Endemic Trap-Door Spider Titanidiops canariensis (Araneae, Idiopidae)

    Science.gov (United States)

    Opatova, Vera; Arnedo, Miquel A.

    2014-01-01

    Studies conducted on volcanic islands have greatly contributed to our current understanding of how organisms diversify. The Canary Islands archipelago, located northwest of the coast of northern Africa, harbours a large number of endemic taxa. Because of their low vagility, mygalomorph spiders are usually absent from oceanic islands. The spider Titanidiops canariensis, which inhabits the easternmost islands of the archipelago, constitutes an exception to this rule. Here, we use a multi-locus approach that combines three mitochondrial and four nuclear genes to investigate the origins and phylogeography of this remarkable trap-door spider. We provide a timeframe for the colonisation of the Canary Islands using two alternative approaches: concatenation and species tree inference in a Bayesian relaxed clock framework. Additionally, we investigate the existence of cryptic species on the islands by means of a Bayesian multi-locus species delimitation method. Our results indicate that T. canariensis colonised the Canary Islands once, most likely during the Miocene, although discrepancies between the timeframes from different approaches make the exact timing uncertain. A complex evolutionary history for the species in the archipelago is revealed, which involves two independent colonisations of Fuerteventura from the ancestral range of T. canariensis in northern Lanzarote and a possible back colonisation of southern Lanzarote. The data further corroborate a previously proposed volcanic refugium, highlighting the impact of the dynamic volcanic history of the island on the phylogeographic patterns of the endemic taxa. T. canariensis includes at least two different species, one inhabiting the Jandia peninsula and central Fuerteventura and one spanning from central Fuerteventura to Lanzarote. Our data suggest that the extant northern African Titanidiops lineages may have expanded to the region after the islands were colonised and, hence, are not the source of colonisation. In

  12. CSTX-9, a toxic peptide from the spider Cupiennius salei: amino acid sequence, disulphide bridge pattern and comparison with other spider toxins containing the cystine knot structure.

    Science.gov (United States)

    Schalle, J; Kämpfer, U; Schürch, S; Kuhn-Nentwig, L; Haeberli, S; Nentwig, W

    2001-09-01

    CSTX-9 (68 residues, 7530.9 Da) is one of the most abundant toxic polypeptides in the venom of the wandering spider Cupiennius salei. The amino acid sequence was determined by Edman degradation using reduced and alkylated CSTX-9 and peptides generated by cleavages with endoproteinase Asp-N and trypsin, respectively. Sequence comparison with CSTX-1, the most abundant and the most toxic polypeptide in the crude spider venom, revealed a high degree of similarity (53% identity). By means of limited proteolysis with immobilised trypsin and RP-HPLC, the cystine-containing peptides of CSTX-9 were isolated and the disulphide bridges were assigned by amino acid analysis, Edman degradation and nanospray tandem mass spectrometry. The four disulphide bonds present in CSTX-9 are arranged in the following pattern: 1-4, 2-5, 3-8 and 6-7 (Cys6-Cys21, Cys13-Cys30, Cys20-Cys48, Cys32-Cys46). Sequence comparison of CSTX-1 with CSTX-9 clearly indicates the same disulphide bridge pattern, which is also found in other spider polypeptide toxins, e.g. agatoxins (omega-AGA-IVA, omega-AGA-IVB, mu-AGA-I and mu-AGA-VI) from Agelenopsis aperta, SNX-325 from Segestria florentina and curtatoxins (CT-I, CT-II and CT-III) from Hololena curta. CSTX-1/CSTX-9 belong to the family of ion channel toxins containing the inhibitor cystine knot structural motif. CSTX-9, lacking the lysine-rich C-terminal tail of CSTX-1, exhibits a ninefold lower toxicity to Drosophila melanogaster than CSTX-1. This is in accordance with previous observations of CSTX-2a and CSTX-2b, two truncated forms of CSTX-1 which, like CSTX-9, also lack the C-terminal lysine-rich tail. PMID:11693532

  13. 采用多种策略的分布式Web Spider%New Distributed Web Spider by Applying Many Optimization Strategies

    Institute of Scientific and Technical Information of China (English)

    陈炎龙; 段红玉

    2012-01-01

    For the increasingly prominent web access problems, A New Distributed Web Spicier (NDWS) was proposed NDWS uses central control node to coordinate actions of all web spiders,employs Breadth-First search to obtain high-quality web pages, caches DNS to improve speed of access to web server, increases number of concurrent threads to increase download speed of web pages. Meanwhile, NDWS also can dynamically add web spider node and sub-cent ralcontrol-node so that NDWS has strong flexibility and expansion capability. Experi-mental results show that as a front-end of search engine, NDWS can quickly and efficiently download web pages, and has better performance.%针对日益突出的网页访问问题,设计了一种新型分布式Web Spider.该分布式Web Spider采用中央控制节点来协调各个web spider的行为,利用宽度优先搜索来获得高质量的网页,通过对DNS缓存来提高访问web server的速度,以增加并行线程数量的方式来增加网页下载速度,并能动态地加入web spider节点和子中央控制节点,具有很强的灵活性和扩张能力.实验结果表明该分布式Web Spider作为搜索引擎的前端能够快速有效地下载网页,具有较好的性能.

  14. Spiders on a Hot Volcanic Roof: Colonisation Pathways and Phylogeography of the Canary Islands Endemic Trap-Door Spider Titanidiops canariensis (Araneae, Idiopidae.

    Directory of Open Access Journals (Sweden)

    Vera Opatova

    Full Text Available Studies conducted on volcanic islands have greatly contributed to our current understanding of how organisms diversify. The Canary Islands archipelago, located northwest of the coast of northern Africa, harbours a large number of endemic taxa. Because of their low vagility, mygalomorph spiders are usually absent from oceanic islands. The spider Titanidiops canariensis, which inhabits the easternmost islands of the archipelago, constitutes an exception to this rule. Here, we use a multi-locus approach that combines three mitochondrial and four nuclear genes to investigate the origins and phylogeography of this remarkable trap-door spider. We provide a timeframe for the colonisation of the Canary Islands using two alternative approaches: concatenation and species tree inference in a Bayesian relaxed clock framework. Additionally, we investigate the existence of cryptic species on the islands by means of a Bayesian multi-locus species delimitation method. Our results indicate that T. canariensis colonised the Canary Islands once, most likely during the Miocene, although discrepancies between the timeframes from different approaches make the exact timing uncertain. A complex evolutionary history for the species in the archipelago is revealed, which involves two independent colonisations of Fuerteventura from the ancestral range of T. canariensis in northern Lanzarote and a possible back colonisation of southern Lanzarote. The data further corroborate a previously proposed volcanic refugium, highlighting the impact of the dynamic volcanic history of the island on the phylogeographic patterns of the endemic taxa. T. canariensis includes at least two different species, one inhabiting the Jandia peninsula and central Fuerteventura and one spanning from central Fuerteventura to Lanzarote. Our data suggest that the extant northern African Titanidiops lineages may have expanded to the region after the islands were colonised and, hence, are not the source

  15. Ferromagnetic behaviour of anthropogenic multi-walled carbon nanotubes trapped in spider web indoor.

    Science.gov (United States)

    Sonkar, Sumit Kumar; Tripathi, Kumud Malika; Sarkar, Sabyasachi

    2014-03-01

    Black carbon (BC) (as partly burnt black particulate matter) present indoor are deposited on interior surfaces of the indoors (easily visualize over the blades of electric fan/exhausts and over domestic spider webs) are known to be a potential indoor pollution problem. We detect with the help of indoor spider webs the floating BC contains a significant amount of defective multiwalled carbon nanotubes (MWCNTs) possessing room temperature ferromagnetism. Microscopic studies shows a lot of internal and surfacial defects in these indoor-MWCNTs. Electron paramagnetic resonance (EPR) showed the presence of very stable carbon centred radicals in these indoor-MWCNTs. Room temperature ferromagnetism most importantly originated by the presence of a large amount of unpaired spin frustrated carbon centred radicals (trapped in defects, junctions and fractures) which are inadvertently formed during the pyrolysis of carbonaceous materials through routine domestic activities. PMID:24745259

  16. Bugs as drugs, part two: worms, leeches, scorpions, snails, ticks, centipedes, and spiders.

    Science.gov (United States)

    Cherniack, E Paul

    2011-03-01

    In this second of a two-part series analyzing the evidence for the use of organisms as medicine, the use of a number of different "bugs" (worms, leeches, snails, ticks, centipedes, and spiders) is detailed. Several live organisms are used as treatments: leeches for plastic surgery and osteoarthritis and the helminths Trichuris suis and Necator americanus for inflammatory bowel disease. Leech saliva is the source of a number of anticoagulants, including the antithrombin agent hirudin and its synthetic analogues, which have been approved for human use. Predatory arthropods, such as certain species of snails, spiders, scorpions, centipedes, and ticks provide a trove of potential analgesic peptides in their venom. A synthetic analogue of a snail venom peptide, ziconotide, has been approved for human use and is used as an alternative to opioids in severe pain cases. Arthropods, such as ticks, have venom that contains anticoagulants and centipede venom has a protein that corrects abnormalities in lipid metabolism. PMID:21438646

  17. Development of an Ionization Chamber for the SPIDER Fission Fragment Detector

    Science.gov (United States)

    Meierbachtol, K.; Tovesson, F.; Arnold, C. W.; Laptev, A. B.; Bredeweg, T. A.; Jandel, M.; Nelson, R. O.; White, M. C.

    2014-05-01

    The ionization chamber component of the SPIDER detector has been designed to measure energy loss and kinetic energy of fragments produced through neutron-induced fission with energy resolutions of <1% and a time-dependent signal collection. Important design elements implemented are an axial configuration of the electrodes for improved energy loss and measurement and a thin silicon nitride entrance window to minimize both energy loss and energy straggling of the incoming fragments. High energy resolution and improved charge resolution from the ionization chamber are combined with the high precision of the upstream time-of-flight component of SPIDER to achieve resolutions in mass and nuclear charge of 1 AMU and Z=1. A discussion of the present resolution capabilities of the ionization chamber will be presented.

  18. Male adaptations to minimize sexual cannibalism during reproduction in the funnel-web spider Hololena curta.

    Science.gov (United States)

    Xiao, Yong-Hong; Zunic-Kosi, Alenka; Zhang, Long-Wa; Prentice, Thomas R; McElfresh, J Steven; Chinta, Satya P; Zou, Yun-Fan; Millar, Jocelyn G

    2015-12-01

    Males of many spider species risk being attacked and cannibalized while searching for, courting, and mating with conspecific females. However, there are exceptions. We show that the funnel-web spider, Hololena curta, has 3 adaptations that minimize risk to males during courtship and mating, and enhance reproductive success. First, males detected chemical or tactile signals associated with webs of virgin females, and differentiated them from webs of mated females, enabling males to increase encounter rates with virgin females and avoid aggressive mated females. Second, males produced stereotyped vibrational signals during courting which induced female quiescence and suppressed female aggression. Third, when touched by males, sexually receptive females entered a cataleptic state, allowing males to safely approach and copulate. Because males can mate multiple times and the sex ratio in natural populations of H. curta is female biased, overall reproductive output is likely increased by males of this species avoiding sexual cannibalism. PMID:26033974

  19. Female genital mutilation and monandry in an orb-web spider.

    Science.gov (United States)

    Nakata, Kensuke

    2016-02-01

    Monandry, in which a female has only one mating partner during the reproductive period, is established when a female spontaneously refrains from re-mating, or when a partner male interferes with the attempts of a female to mate again. In the latter case, however, females often have countermeasures against males, which may explain why polyandry is ubiquitous. Here, I demonstrate that the genital appendage, or scape, of the female orb-web spider (Cyclosa argenteoalba) is injured after her first mating, possibly by her first male partner. This female genital mutilation (FGM) permanently precludes copulation, and females appear to have no countermeasures. FGM is considered to confer a strong advantage to males in sexual conflicts over the number of female matings, and it may widely occur in spiders.

  20. Structural Insights into Substrate Binding of Brown Spider Venom Class II Phospholipases D.

    Science.gov (United States)

    Coronado, M A; Ullah, A; da Silva, L S; Chaves-Moreira, D; Vuitika, L; Chaim, O M; Veiga, S S; Chahine, J; Murakami, M T; Arni, R K

    2015-01-01

    Phospholipases D (PLDs), the major dermonecrotic factors from brown spider venoms, trigger a range of biological reactions both in vitro and in vivo. Despite their clinical relevance in loxoscelism, structural data is restricted to the apo-form of these enzymes, which has been instrumental in understanding the functional differences between the class I and II spider PLDs. The crystal structures of the native class II PLD from Loxosceles intermedia complexed with myo-inositol 1-phosphate and the inactive mutant H12A complexed with fatty acids indicate the existence of a strong ligand-dependent conformation change of the highly conserved aromatic residues, Tyr 223 and Trp225 indicating their roles in substrate binding. These results provided insights into the structural determinants for substrate recognition and binding by class II PLDs.