
Sample records for biophysics

  1. Biophysics

    CERN Document Server

    Glaser, Roland


    The message of this book is that biophysics is the science of physical principles underlying the "phenomenon life" on all levels of organization. Rather than teaching "physics for biologists" or "physical methods applied to biology", it regards its subject as a defined discipline with its own network of ideas and approaches. The book starts by explaining molecular structures of biological systems, various kinds of atomic, molecular and ionic interactions, movements, energy transfer, self organization of supramolecular structures and dynamic properties of biological membranes. It then goes on to introduce the biological organism as a non-equilibrium system, before treating thermodynamic concepts of osmotic and electrolyte equilibria as well as currents and potential profiles. It continues with topics of environmental biophysics and such medical aspects as the influence of electromagnetic fields or radiation on living systems and the biophysics of hearing and noice protection. The book concludes with a discussi...

  2. Biophysical chemistry. (United States)

    Häussinger, Daniel; Pfohl, Thomas


    Biophysical chemistry at the Department of Chemistry, University of Basel, covers the NMR analysis of protein-protein interaction using paramagnetic tags and sophisticated microscopy techniques investigating the dynamics of biological matter.

  3. Mathematical biophysics

    CERN Document Server

    Rubin, Andrew


    This book presents concise descriptions and analysis of the classical and modern models used in mathematical biophysics. The authors ask the question "what new information can be provided by the models that cannot be obtained directly from experimental data?" Actively developing fields such as regulatory mechanisms in cells and subcellular systems and electron transport and energy transport in membranes are addressed together with more classical topics such as metabolic processes, nerve conduction and heart activity, chemical kinetics, population dynamics, and photosynthesis. The main approach is to describe biological processes using different mathematical approaches necessary to reveal characteristic features and properties of simulated systems. With the emergence of powerful mathematics software packages such as MAPLE, Mathematica, Mathcad, and MatLab, these methodologies are now accessible to a wide audience. Provides succinct but authoritative coverage of a broad array of biophysical topics and models Wr...

  4. Biophysics of olfaction

    Energy Technology Data Exchange (ETDEWEB)

    Souza, Fabio Marques Simoes de [Cell and Developmental Biology, University of Colorado at Denver and Health Science Center, Campus Box 6511, PO Box 6511, 12801 East 17th Avenue, Aurora, CO 80045 (United States); Antunes, Gabriela [Psychobiology Sector and Department of Chemistry, Faculdade de Filosofia Ciencias e Letras de Ribeirao Preto, Universidade de Sao Paulo, Av. Bandeirantes, 3900, 14040-901, Ribeirao Preto, SP (Brazil)


    The majority of the biophysical models of olfaction have been focused on the electrical properties of the system, which is justified by the relative facility of recording the electrical activity of the olfactory cells. However, depending on the level of detail utilized, a biophysical model can explore molecular, cellular and network phenomena. This review presents the state of the art of the biophysical approach to understanding olfaction. The reader is introduced to the principal problems involving the study of olfaction and guided gradually to comprehend why it is important to develop biophysical models to investigate olfaction. A large number of representative biophysical efforts in olfaction, their main contributions, the trends for the next generations of biophysical models and the improvements that may be explored by future biophysicists of olfaction have been reviewed.

  5. Methods in Modern Biophysics

    CERN Document Server

    Nölting, Bengt


    Incorporating recent dramatic advances, this textbook presents a fresh and timely introduction to modern biophysical methods. An array of new, faster and higher-power biophysical methods now enables scientists to examine the mysteries of life at a molecular level. This innovative text surveys and explains the ten key biophysical methods, including those related to biophysical nanotechnology, scanning probe microscopy, X-ray crystallography, ion mobility spectrometry, mass spectrometry, proteomics, and protein folding and structure. Incorporating much information previously unavailable in tutorial form, Nölting employs worked examples and about 270 illustrations to fully detail the techniques and their underlying mechanisms. Methods in Modern Biophysics is written for advanced undergraduate and graduate students, postdocs, researchers, lecturers, and professors in biophysics, biochemistry and related fields. Special features in the 3rd edition: Introduces rapid partial protein ladder sequencing - an important...

  6. Methods in Modern Biophysics

    CERN Document Server

    Nölting, Bengt


    Incorporating recent dramatic advances, this textbook presents a fresh and timely introduction to modern biophysical methods. An array of new, faster and higher-power biophysical methods now enables scientists to examine the mysteries of life at a molecular level. This innovative text surveys and explains the ten key biophysical methods, including those related to biophysical nanotechnology, scanning probe microscopy, X-ray crystallography, ion mobility spectrometry, mass spectrometry, proteomics, and protein folding and structure. Incorporating much information previously unavailable in tutorial form, Nölting employs worked examples and 267 illustrations to fully detail the techniques and their underlying mechanisms. Methods in Modern Biophysics is written for advanced undergraduate and graduate students, postdocs, researchers, lecturers and professors in biophysics, biochemistry and related fields. Special features in the 2nd edition: • Illustrates the high-resolution methods for ultrashort-living protei...

  7. Biophysics An Introduction

    CERN Document Server

    Glaser, Roland


    Biophysics is the science of physical principles underlying all processes of life, including the dynamics and kinetics of biological systems. This fully revised 2nd English edition is an introductory text that spans all steps of biological organization, from the molecular, to the organism level, as well as influences of environmental factors. In response to the enormous progress recently made, especially in theoretical and molecular biophysics, the author has updated the text, integrating new results and developments concerning protein folding and dynamics, molecular aspects of membrane assembly and transport, noise-enhanced processes, and photo-biophysics. The advances made in theoretical biology in the last decade call for a fully new conception of the corresponding sections. Thus, the book provides the background needed for fundamental training in biophysics and, in addition, offers a great deal of advanced biophysical knowledge.

  8. Advanced Techniques in Biophysics

    CERN Document Server

    Arrondo, José Luis R


    Technical advancements are basic elements in our life. In biophysical studies, new applications and improvements in well-established techniques are being implemented every day. This book deals with advancements produced not only from a technical point of view, but also from new approaches that are being taken in the study of biophysical samples, such as nanotechniques or single-cell measurements. This book constitutes a privileged observatory for reviewing novel applications of biophysical techniques that can help the reader enter an area where the technology is progressing quickly and where a comprehensive explanation is not always to be found.

  9. Encyclopedia of biophysics

    CERN Document Server


    The Encyclopedia of Biophysics is envisioned both as an easily accessible source of information and as an introductory guide to the scientific literature. It includes entries describing both Techniques and Systems.  In the Techniques entries, each of the wide range of methods which fall under the heading of Biophysics are explained in detail, together with the value and the limitations of the information each provides. Techniques covered range from diffraction (X-ray, electron and neutron) through a wide range of spectroscopic methods (X-ray, optical, EPR, NMR) to imaging (from electron microscopy to live cell imaging and MRI), as well as computational and simulation approaches. In the Systems entries, biophysical approaches to specific biological systems or problems – from protein and nucleic acid structure to membranes, ion channels and receptors – are described. These sections, which place emphasis on the integration of the different techniques, therefore provide an inroad into Biophysics from a biolo...

  10. Biophysics of molecular gastronomy. (United States)

    Brenner, Michael P; Sörensen, Pia M


    Chefs and scientists exploring biophysical processes have given rise to molecular gastronomy. In this Commentary, we describe how a scientific understanding of recipes and techniques facilitates the development of new textures and expands the flavor palette. The new dishes that result engage our senses in unexpected ways. PAPERCLIP.

  11. Fetal Biophysical Profile Scoring

    Directory of Open Access Journals (Sweden)

    H.R. HaghighatKhah


    Full Text Available   "nFetal biophysical profile scoring is a sonographic-based method of fetal assessment first described by Manning and Platt in 1980. "nThe biophysical profile score was developed as a method to integrate real-time observations of the fetus and his/her intrauterine environment in order to more comprehensively assess the fetal condition. These findings must be evaluated in the context of maternal/fetal history (i.e., chronic hypertension, post-dates, intrauterine growth restriction, etc, fetal structural integrity (presence or absence of congenital anomalies, and the functionality of fetal support structures (placental and umbilical cord. For example, acute asphyxia due to placental abruption may result in an absence of the acute variables of the biophysical profile score (fetal breathing movements, fetal movement, fetal tone, and fetal heart rate reactivity with a normal amniotic fluid volume. With post maturity the asphyxial event may be intermittent and chronic resulting in a decrease in amniotic fluid volume, but with the acute variables remaining normal. "nWhile the 5 components of the biophysical profile score have remained unchanged since 1980 (Manning, 1980, the definitions of a normal and abnormal parameter have evolved with increasing experience. "nIn 1984 the definition of oligohydramnios was increased from < 1cm pocket of fluid to < 2.0 x 1.0 cm pocket. Oligohydramnios is now defined as a pocket of amniotic fluid < 2.0 x 2.0 cm (Manning, 1995a "nIf the four ultrasound variables are normal, the accuracy of the biophysical profile score was not found to be significantly improved by adding the non-stress test. As a result, in 1987 the profile score was modified to incorporate the non-stress test only when one of the ultrasound variables was abnormal (Manning 1987. Table 1 outlines the current definitions for quantifying a variable as present or absent. "nEach of the 5 components of the biophysical profile score does not have equal

  12. Theoretical Molecular Biophysics

    CERN Document Server

    Scherer, Philipp


    "Theoretical Molecular Biophysics" is an advanced study book for students, shortly before or after completing undergraduate studies, in physics, chemistry or biology. It provides the tools for an understanding of elementary processes in biology, such as photosynthesis on a molecular level. A basic knowledge in mechanics, electrostatics, quantum theory and statistical physics is desirable. The reader will be exposed to basic concepts in modern biophysics such as entropic forces, phase separation, potentials of mean force, proton and electron transfer, heterogeneous reactions coherent and incoherent energy transfer as well as molecular motors. Basic concepts such as phase transitions of biopolymers, electrostatics, protonation equilibria, ion transport, radiationless transitions as well as energy- and electron transfer are discussed within the frame of simple models.

  13. Structure and biophysics

    CERN Document Server

    Puglisi, Joseph D


    This volume is a collection of articles from the proceedings of the ISSBMR 7th Course: Structure and Biophysics - New Technologies for Current Challenges in Biology and Beyond. This NATO Advanced Institute (ASI) was held in Erice at the Ettore Majorana Foundation and Centre for Scientific Culture on 22 June through 3 July 2005. The ASI brought together a diverse group of experts in the fields of Structural Biology, Biophysics and Physics. Prominent lecturers, from seven different countries, and students from around the world participated in the NATO ASI organized by Professors Joseph Puglisi (Stanford University, USA) and Alexander Arseniev (Moscow, RU). Advances in nuclear magnetic resonance spectroscopy (NMR) and x-ray crystallography have allowed the three-dimensional structures of many biological macromolecules and their complexes, including the ribosome and RNA polymerase to be solved. Fundamental principles of NMR spectroscopy and dynamics, x-ray crystallography, computation and experimental dynamics we...

  14. Biophysics an introduction

    CERN Document Server

    Cotteril, Rodney


    Biophysics: An Introduction, is a concise balanced introduction to this subject. Written in an accessible and readable style, the book takes a fresh, modern approach with the author successfully combining key concepts and theory with relevant applications and examples drawn from the field as a whole. Beginning with a brief introduction to the origins of biophysics, the book takes the reader through successive levels of complexity, from atoms to molecules, structures, systems and ultimately to the behaviour of organisms. The book also includes extensive coverage of biopolymers, biomembranes, biological energy, and nervous systems. The text not only explores basic ideas, but also discusses recent developments, such as protein folding, DNA/RNA conformations, molecular motors, optical tweezers and the biological origins of consciousness and intelligence.

  15. Thermal Manikins & Clothing Biophysics Laboratories (United States)

    Federal Laboratory Consortium — Five biophysical evaluation chambers containing fully sensored, articulated, moveable copper manikins, and other metallic models of feet and hands are available for...

  16. Biophysics and cancer

    CERN Document Server

    Nicolini, Claudio


    Since the early times of the Greek philosophers Leucippus and Democritus, and later of the Roman philosopher Lucretius, a simple, fundamental idea emerged that brought the life sciences into the realm of the physical sciences. Atoms, after various interactions, were assumed to acquire stable configurations that corresponded either to the living or to the inanimate world. This simple and unitary theory, which has evolved in successive steps to our present time, remarkably maintained its validity despite several centuries of alternative vicissitudes, and is the foundation of modern biophysics. Some of the recent developments of this ancient idea are the discovery of the direct relationship between spatial structures and chemical activity of such molecules as methane and benzene, and the later discovery of the three-dimensional structure of double-helical DNA, and of its relationship with biological activity. The relationship between the structure of various macromolecules and the function of living cells was on...

  17. Biophysics of DNA

    CERN Document Server

    Vologodskii, Alexander


    Surveying the last sixty years of research, this book describes the physical properties of DNA in the context of its biological functioning. It is designed to enable both students and researchers of molecular biology, biochemistry and physics to better understand the biophysics of DNA, addressing key questions and facilitating further research. The chapters integrate theoretical and experimental approaches, emphasising throughout the importance of a quantitative knowledge of physical properties in building and analysing models of DNA functioning. For example, the book shows how the relationship between DNA mechanical properties and the sequence specificity of DNA-protein binding can be analyzed quantitatively by using our current knowledge of the physical and structural properties of DNA. Theoretical models and experimental methods in the field are critically considered to enable the reader to engage effectively with the current scientific literature on the physical properties of DNA.

  18. Integrated Molecular and Cellular Biophysics

    CERN Document Server

    Raicu, Valerica


    This book integrates concepts and methods from physics, biology, biochemistry and physical chemistry into a standalone, unitary text of biophysics that aims to provide a quantitative description of structures and processes occurring in living matter. The book introduces graduate physics students and physicists interested in biophysics research to 'classical' as well as emerging areas of biophysics. The advanced undergraduate physics students and the life scientists are also invited to join in, by building on their knowledge of basic physics. Essential notions of biochemistry and biology are introduced, as necessary, throughout the book, while the reader's familiarity with basic knowledge of physics is assumed. Topics covered include interactions between biological molecules, physical chemistry of phospholipids association into bilayer membranes, DNA and protein structure and folding, passive and active electrical properties of the cell membrane, classical as well as fractal aspects of reaction kinetics and di...

  19. Fundamental Concepts in Biophysics Volume 1

    CERN Document Server

    Jue, Thomas


    HANDBOOK OF MODERN BIOPHYSICS Series Editor Thomas Jue, PhD Handbook of Modern Biophysics brings current biophysics topics into focus, so that biology, medical, engineering, mathematics, and physical-science students or researchers can learn fundamental concepts and the application of new techniques in addressing biomedical challenges. Chapters explicate the conceptual framework of the physics formalism and illustrate the biomedical applications. With the addition of problem sets, guides to further study, and references, the interested reader can continue to explore independently the ideas presented. Volume I: Fundamental Concepts in Biophysics Editor Thomas Jue, PhD In Fundamental Concepts in Biophysics, prominent professors have established a foundation for the study of biophysics related to the following topics: Mathematical Methods in Biophysics Quantum Mechanics Basic to Biophysical Methods Computational Modeling of Receptor–Ligand Binding and Cellular Signaling Processes Fluorescence Spectroscopy Elec...

  20. Biophysical science in Italy: SIBPA turns 40. (United States)

    Giacomazza, Daniela; Musio, Carlo


    This Special Issue of Biophysical Chemistry includes a selection of the papers presented at the XXI Congress of the Italian Society of Pure and Applied Biophysics (i.e., SIBPA, Società Italiana di Biofisica Pura ed Applicata) held on September 2012 at the University of Ferrara, Ferrara, Italy. Topics cover all biophysical disciplines, from molecular to cellular, to integrative biophysics giving an almost comprehensive view of the interdisciplinary and multidisciplinary approaches, proper of the modern biophysics. SIBPA, which celebrates its 40th anniversary in 2013, has steadily grown and appeals to both specialists and a wider general audience.

  1. Relating biophysical properties across scales. (United States)

    Flenner, Elijah; Marga, Francoise; Neagu, Adrian; Kosztin, Ioan; Forgacs, Gabor


    A distinguishing feature of a multicellular living system is that it operates at various scales, from the intracellular to organismal. Genes and molecules set up the conditions for the physical processes to act, in particular to shape the embryo. As development continues the changes brought about by the physical processes lead to changes in gene expression. It is this coordinated interplay between genetic and generic (i.e., physical and chemical) processes that constitutes the modern understanding of early morphogenesis. It is natural to assume that in this multiscale process the smaller defines the larger. In case of biophysical properties, in particular, those at the subcellular level are expected to give rise to those at the tissue level and beyond. Indeed, the physical properties of tissues vary greatly from the liquid to solid. Very little is known at present on how tissue level properties are related to cell and subcellular properties. Modern measurement techniques provide quantitative results at both the intracellular and tissue level, but not on the connection between these. In the present work we outline a framework to address this connection. We specifically concentrate on the morphogenetic process of tissue fusion, by following the coalescence of two contiguous multicellular aggregates. The time evolution of this process can accurately be described by the theory of viscous liquids. We also study fusion by Monte Carlo simulations and a novel Cellular Particle Dynamics (CPD) model, which is similar to the earlier introduced Subcellular Element Model (SEM; Newman, 2005). Using the combination of experiments, theory and modeling we are able to relate the measured tissue level biophysical quantities to subcellular parameters. Our approach has validity beyond the particular morphogenetic process considered here and provides a general way to relate biophysical properties across scales.

  2. Quantum Nanobiology and Biophysical Chemistry

    DEFF Research Database (Denmark)


    An introduction was provided in the first issue by way of an Editorial to this special two issue volume of Current Physical Chemistry – “Quantum Nanobiology and Biophysical Chemistry” [1]. The Guest Editors would like to thank all the authors and referees who have contributed to this second issue....... demonstrate extremely low detection performance of acyl-homoserine lactone in a biologically relevant system using surface enhanced Raman spectroscopy. Sugihara and Bondar evaluate the influence of methyl-groups and the protein environment on retinal geometries in rhodopsin and bacteriorhodopsin, two...

  3. Biophysical characterization of GPCR oligomerization

    DEFF Research Database (Denmark)

    Mathiasen, Signe

    a quantitative characterization of GPCR oligomerization. The assay provided the first quantification of the association energy of the β2 Adrenergic Receptor (β2AR), a prototypical GPCR. Furthermore we directly observed the time-dependent dimerization of β2AR and Cannabinoid receptor 1 at the single molecule......The biophysical characterization of the fundamental molecular mechanisms behind G-protein coupled receptors (GPCRs) oligomerization is proposed to be paramount for understanding the pharmacological consequence of receptor self-association. Here we developed an in vitro assay that allowed...

  4. The Mechanics and Biophysics of Hearing

    CERN Document Server

    Geisler, C; Matthews, John; Ruggero, Mario; Steele, Charles


    Proceedings of a workshop on the physics and biophysics of hearing that brought together experimenters and modelers working on all aspects of audition. Topics covered include: cochlear mechanical measurements, cochlear models, mechanicals and biophysics of hair cells, efferent control, and ultrastructure.

  5. Relating Biophysical Properties Across Scales

    CERN Document Server

    Flenner, Elijah; Neagu, Adrian; Kosztin, Ioan; Forgacs, Gabor


    A distinguishing feature of a multicellular living system is that it operates at various scales, from the intracellular to organismal. Very little is known at present on how tissue level properties are related to cell and subcellular properties. Modern measurement techniques provide quantitative results at both the intracellular and tissue level, but not on the connection between these. In the present work we outline a framework to address this connection. We specifically concentrate on the morphogenetic process of tissue fusion, by following the coalescence of two contiguous multicellular aggregates. The time evolution of this process can accurately be described by the theory of viscous liquids. We also study fusion by Monte Carlo simulations and a novel Cellular Particle Dynamics (CPD) model, which is similar to the earlier introduced Subcellular Element Model (Newman, 2005). Using the combination of experiments, theory and modeling we are able to relate the measured tissue level biophysical quantities to s...

  6. Historical and Critical Review on Biophysical Economics (United States)

    Adigüzel, Yekbun


    Biophysical economics is initiated with the long history of the relation of economics with ecological basis and biophysical perspectives of the physiocrats. It inherently has social, economic, biological, environmental, natural, physical, and scientific grounds. Biological entities in economy like the resources, consumers, populations, and parts of production systems, etc. could all be dealt by biophysical economics. Considering this wide scope, current work is a “biophysical economics at a glance” rather than a comprehensive review of the full range of topics that may just be adequately covered in a book-length work. However, the sense of its wide range of applications is aimed to be provided to the reader in this work. Here, modern approaches and biophysical growth theory are presented after the long history and an overview of the concepts in biophysical economics. Examples of the recent studies are provided at the end with discussions. This review is also related to the work by Cleveland, “Biophysical Economics: From Physiocracy to Ecological Economics and Industrial Ecology” [C. J. Cleveland, in Advances in Bioeconomics and Sustainability: Essay in Honor of Nicholas Gerogescu-Roegen, eds. J. Gowdy and K. Mayumi (Edward Elgar Publishing, Cheltenham, England, 1999), pp. 125-154.]. Relevant parts include critics and comments on the presented concepts in a parallelized fashion with the Cleveland’s work.

  7. Biophysics software for interdisciplinary education and research

    CERN Document Server

    Deutsch, J M


    Biophysics is a subject that is spread over many disciplines and transcends the skills and knowledge of the individual student. This makes it challenging both to teach and to learn. Educational materials are described to aid in teaching undergraduates biophysics in an interdisciplinary manner. Projects have been devised on topics that range from x-ray diffraction to the Hodgkin Huxley equations. They are team-based and encourage collaboration. The projects make extensive use of software written in Python/Scipy which can be modified to explore a large range of possible phenomena. The software can also be used in lectures and in the teaching of more traditional biophysics courses.

  8. An introduction to environmental biophysics

    CERN Document Server

    Campbell, Gaylon S


    The study of environmental biophysics probably began earlier in man's history than that of any other science. The study of organism-environment interaction provided a key to survival and progress. Systematic study of the science and recording of experimental results goes back many hundreds of years. Ben­ jamin Franklin, the early American statesman, inventor, printer, and scientist studied conduction, evaporation, and radiation. One of his observations is as follows: My desk on which I now write, and the lock of my desk, are both exposed to the same temperature of the air, and have therefore the same degree of heat or cold; yet if I lay my hand successively on the wood and on the metal, the latter feels much the coldest, not that it is really so, but being a better conductor, it more readily than the wood takes away and draws into itself the fire that was in my skin. 1 Franklin probably was not the first to discover this principle, and certainly was not the last. Modem researchers rediscover this principle f...

  9. Black Holes and Biophysical (Mem)-branes

    CERN Document Server

    Armas, Jay


    We argue that the effective theory describing the long-wavelength dynamics of black branes is the same effective theory that describes the dynamics of biophysical membranes. We improve the phase structure of higher-dimensional black rings by considering finite thickness corrections in this effective theory, showing a striking agreement between our analytical results and recent numerical constructions while simultaneously drawing a parallel between gravity and the effective theory of biophysical membranes.

  10. Biophysical regulation of stem cell differentiation. (United States)

    Govey, Peter M; Loiselle, Alayna E; Donahue, Henry J


    Bone adaptation to its mechanical environment, from embryonic through adult life, is thought to be the product of increased osteoblastic differentiation from mesenchymal stem cells. In parallel with tissue-scale loading, these heterogeneous populations of multipotent stem cells are subject to a variety of biophysical cues within their native microenvironments. Bone marrow-derived mesenchymal stem cells-the most broadly studied source of osteoblastic progenitors-undergo osteoblastic differentiation in vitro in response to biophysical signals, including hydrostatic pressure, fluid flow and accompanying shear stress, substrate strain and stiffness, substrate topography, and electromagnetic fields. Furthermore, stem cells may be subject to indirect regulation by mechano-sensing osteocytes positioned to more readily detect these same loading-induced signals within the bone matrix. Such paracrine and juxtacrine regulation of differentiation by osteocytes occurs in vitro. Further studies are needed to confirm both direct and indirect mechanisms of biophysical regulation within the in vivo stem cell niche.

  11. Stochastic biophysical modeling of irradiated cells

    CERN Document Server

    Fornalski, Krzysztof Wojciech


    The paper presents a computational stochastic model of virtual cells irradiation, based on Quasi-Markov Chain Monte Carlo method and using biophysical input. The model is based on a stochastic tree of probabilities for each cell of the entire colony. Biophysics of the cells is described by probabilities and probability distributions provided as the input. The adaptation of nucleation and catastrophe theories, well known in physics, yields sigmoidal relationships for carcinogenic risk as a function of the irradiation. Adaptive response and bystander effect, incorporated into the model, improves its application. The results show that behavior of virtual cells can be successfully modeled, e.g. cancer transformation, creation of mutations, radioadaptation or radiotherapy. The used methodology makes the model universal and practical for simulations of general processes. Potential biophysical curves and relationships are also widely discussed in the paper. However, the presented theoretical model does not describe ...

  12. Biophysical Evaluation of SonoSteam®:

    DEFF Research Database (Denmark)

    Andersen, Ann Zahle; Duelund, Lars; Brewer, Jonathan R.;

    and safety evaluations. Our results show that there are no contradictions between data obtained by either approach. However, the biophysical methods draw a much more nuanced picture of the effects and efficiency of the investigated decontamination method, revealing e.g. an exponential dose/response...... relationship between SonoSteam treatment time and changes in collagen I, and a depth dependency in bacterial reduction, which points toward CFU counts overestimating total bacterial reduction. In conclusion the biophysical methods provide a less biased, reproducible and highly detailed system description......In this study we employ a biophysical and molecular approach for the investigation of qualitative and quantitative changes in both food surface and bacteria upon surface decontamination by SonoSteam®. SonoSteam® is a recently developed method of food surface decontamination, which employs steam...

  13. Biophysical Regulation of Vascular Differentiation and Assembly

    CERN Document Server

    Gerecht, Sharon


    The ability to grow stem cells in the laboratory and to guide their maturation to functional cells allows us to study the underlying mechanisms that govern vasculature differentiation and assembly in health and disease. Accumulating evidence suggests that early stages of vascular growth are exquisitely tuned by biophysical cues from the microenvironment, yet the scientific understanding of such cellular environments is still in its infancy. Comprehending these processes sufficiently to manipulate them would pave the way to controlling blood vessel growth in therapeutic applications. This book assembles the works and views of experts from various disciplines to provide a unique perspective on how different aspects of its microenvironment regulate the differentiation and assembly of the vasculature. In particular, it describes recent efforts to exploit modern engineering techniques to study and manipulate various biophysical cues. Biophysical Regulation of Vascular Differentiation and Assembly provides an inter...

  14. Global energy modeling - A biophysical approach

    Energy Technology Data Exchange (ETDEWEB)

    Dale, Michael


    This paper contrasts the standard economic approach to energy modelling with energy models using a biophysical approach. Neither of these approaches includes changing energy-returns-on-investment (EROI) due to declining resource quality or the capital intensive nature of renewable energy sources. Both of these factors will become increasingly important in the future. An extension to the biophysical approach is outlined which encompasses a dynamic EROI function that explicitly incorporates technological learning. The model is used to explore several scenarios of long-term future energy supply especially concerning the global transition to renewable energy sources in the quest for a sustainable energy system.

  15. Biophysical Cueing and Vascular Endothelial Cell Behavior

    Directory of Open Access Journals (Sweden)

    Joshua A. Wood


    Full Text Available Human vascular endothelial cells (VEC line the vessels of the body and are critical for the maintenance of vessel integrity and trafficking of biochemical cues. They are fundamental structural elements and are central to the signaling environment. Alterations in the normal functioning of the VEC population are associated with a number of vascular disorders among which are some of the leading causes of death in both the United States and abroad. VECs attach to their underlying stromal elements through a specialization of the extracellular matrix, the basement membrane. The basement membrane provides signaling cues to the VEC through its chemical constituents, by serving as a reservoir for cytoactive factors and through its intrinsic biophysical properties. This specialized matrix is composed of a topographically rich 3D felt-like network of fibers and pores on the nano (1–100 nm and submicron (100–1,000 nm size scale. The basement membrane provides biophysical cues to the overlying VECs through its intrinsic topography as well as through its local compliance (relative stiffness. These biophysical cues modulate VEC adhesion, migration, proliferation, differentiation, and the cytoskeletal signaling network of the individual cells. This review focuses on the impact of biophysical cues on VEC behaviors and demonstrates the need for their consideration in future vascular studies and the design of improved prosthetics.

  16. Commentary on “Biophysical Economics” and Evolving Areas (United States)

    Flomenbom, Ophir; Coban, Gul Unal; Adigüzel, Yekbun


    In this Issue, papers in the area of socio-econo-physics and biophysical economics are presented. We have recently introduced socio-econo-physics and biophysical economics in Biophysical Reviews and Letters (BRL), yet saw 3 to 4 relevant papers just in these most recent three quarters. In this commentary, we therefore would like to elaborate on the topics of socio-econo-physics and biophysical economics and to introduce these concepts to the readers of BRL and the biophysical community of science, with the purpose of supporting many more publications here in BRL, in this evolving area.

  17. Biophysics and the Challenges of Emerging Threats

    CERN Document Server

    Puglisi, Joseph D


    This volume is a collection of articles from the proceedings of the International School of Structural Biology and Magnetic Resonance 8th Course: Biophysics and the Challenges of Emerging Threats. This NATO Advance Study Institute (ASI) was held in Erice at the Ettore Majorana Foundation and Centre for Scientific Culture on 19 through 30 June 2007. The ASI brought together a diverse group of experts who bridged the fields of virology and biology, biophysics, chemistry and physics. Prominent lecturers and students from around the world representant a total of 24 countries participated in the NATO ASI organized by Professors Joseph Puglisi (Stanford University, USA) and Alexander Arseniev (Moscow, RU). The central hypothesis underlying this ASI was that interdisciplinary research, merging principles of physics, chemistry and biology, can drive new discovery in detecting and fighting bioterrorism agents, lead to cleaner environments, and help propel development in NATO partner countries. The ASI merged the relat...

  18. Handbook of Single-Molecule Biophysics

    CERN Document Server

    Hinterdorfer, Peter


    The last decade has seen the development of a number of novel biophysical methods that allow the manipulation and study of individual biomolecules. The ability to monitor biological processes at this fundamental level of sensitivity has given rise to an improved understanding of the underlying molecular mechanisms. Through the removal of ensemble averaging, distributions and fluctuations of molecular properties can be characterized, transient intermediates identified, and catalytic mechanisms elucidated. By applying forces on biomolecules while monitoring their activity, important information can be obtained on how proteins couple function to structure. The Handbook of Single-Molecule Biophysics provides an introduction to these techniques and presents an extensive discussion of the new biological insights obtained from them. Coverage includes: Experimental techniques to monitor and manipulate individual biomolecules The use of single-molecule techniques in super-resolution and functional imaging Single-molec...

  19. Biophysics of α-synuclein membrane interactions. (United States)

    Pfefferkorn, Candace M; Jiang, Zhiping; Lee, Jennifer C


    Membrane proteins participate in nearly all cellular processes; however, because of experimental limitations, their characterization lags far behind that of soluble proteins. Peripheral membrane proteins are particularly challenging to study because of their inherent propensity to adopt multiple and/or transient conformations in solution and upon membrane association. In this review, we summarize useful biophysical techniques for the study of peripheral membrane proteins and their application in the characterization of the membrane interactions of the natively unfolded and Parkinson's disease (PD) related protein, α-synuclein (α-syn). We give particular focus to studies that have led to the current understanding of membrane-bound α-syn structure and the elucidation of specific membrane properties that affect α-syn-membrane binding. Finally, we discuss biophysical evidence supporting a key role for membranes and α-syn in PD pathogenesis. This article is part of a Special Issue entitled: Membrane protein structure and function.

  20. The mathematical biophysics of Nicolas Rashevsky. (United States)

    Cull, Paul


    N. Rashevsky (1899-1972) was one of the pioneers in the application of mathematics to biology. With the slogan: mathematical biophysics : biology :: mathematical physics ; physics, he proposed the creation of a quantitative theoretical biology. Here, we will give a brief biography, and consider Rashevsky's contributions to mathematical biology including neural nets and relational biology. We conclude that Rashevsky was an important figure in the introduction of quantitative models and methods into biology.

  1. Unusual biophysics of intrinsically disordered proteins. (United States)

    Uversky, Vladimir N


    Research of a past decade and a half leaves no doubt that complete understanding of protein functionality requires close consideration of the fact that many functional proteins do not have well-folded structures. These intrinsically disordered proteins (IDPs) and proteins with intrinsically disordered protein regions (IDPRs) are highly abundant in nature and play a number of crucial roles in a living cell. Their functions, which are typically associated with a wide range of intermolecular interactions where IDPs possess remarkable binding promiscuity, complement functional repertoire of ordered proteins. All this requires a close attention to the peculiarities of biophysics of these proteins. In this review, some key biophysical features of IDPs are covered. In addition to the peculiar sequence characteristics of IDPs these biophysical features include sequential, structural, and spatiotemporal heterogeneity of IDPs; their rough and relatively flat energy landscapes; their ability to undergo both induced folding and induced unfolding; the ability to interact specifically with structurally unrelated partners; the ability to gain different structures at binding to different partners; and the ability to keep essential amount of disorder even in the bound form. IDPs are also characterized by the "turned-out" response to the changes in their environment, where they gain some structure under conditions resulting in denaturation or even unfolding of ordered proteins. It is proposed that the heterogeneous spatiotemporal structure of IDPs/IDPRs can be described as a set of foldons, inducible foldons, semi-foldons, non-foldons, and unfoldons. They may lose their function when folded, and activation of some IDPs is associated with the awaking of the dormant disorder. It is possible that IDPs represent the "edge of chaos" systems which operate in a region between order and complete randomness or chaos, where the complexity is maximal. This article is part of a Special Issue

  2. Biophysical body-brain-mind unity: theory and practice. (United States)

    Naisberg, Y


    A novel substance-attributed biophysical theory of brain-mind unity is presented. We separate spiritualism and matters of the soul from the medical sphere. Biophysical principles are responsible for the body's operational regimen (BOR) in the homeostatic state which allows for materialization and emergence of the mind; Excitation and/or inhibition modulate 8 BOR stages. There is automatic (somatic) and non-automatic (biophysical and psychological) Circadian cycle control. Computer-analog input and output occurs in wired neuronal electric pathways. Biotechnological devices located in emotional neurons positively signal homeostatic and negatively signal deranged BOR and biophysical mind operations. Macro and/or micro cerebral lesions which affect homeostasis may cause psychopathology, which can be treated with 'instrumental psychotherapy' (IPT) which enables recovery from homeostatic disorder in Phase 1, refining EGO in Phase 2, and social competence in Phase 3. The theory of brain-mind unity and practice of IPT is geared to medical workers and biophysical psychologists.

  3. [Biophysical Characterization of Biopharmaceuticals, Including Antibody Drugs]. (United States)

    Uchiyama, Susumu


    Biopharmaceuticals, including antibody drugs, are now popular because of their high specificity with low adverse effects, especially in the treatment of cancer and autoimmune diseases. However, because the active pharmaceutical ingredients of biopharmaceuticals are proteins, biophysical characterization of these therapeutic proteins should be required. In this manuscript, methods of chemical and physical characterization of therapeutic proteins are described. In terms of chemical characterization, analysis of chemical modifications of the constituent amino acids is explained. Physical characterization includes higher order structural analysis and assessment of protein aggregates. Quantification methods of aggregates with different sizes, recently encouraged by the U.S. Food and Drug Administration (FDA), are introduced. As for the stability of therapeutic proteins, the importance of chemical and physical stability is explained. Finally, the contribution of colloidal and structural stability to the production of an antibody drug less prone to aggregation is introduced.

  4. Biophysical and biological perspective in biosemiotics. (United States)

    Adiguzel, Yekbun


    The cell and its basic constituents are introduced here through a biophysical and information communication theoretic approach in biology and biosemiotics. With this purpose, the requirements of primordial cellular structures, single binding events, and signalling cascades are first mentioned stepwise, in relation to the model of the cellular sensing mechanism. This is followed by the concepts of cross reactions in sensing and pattern recognitions, wherein an information theoretic approach is addressed and the features of multicellularity are discussed along. Multicellularity is introduced as the path that leads to the loss of the direct causal relations. The loss of true causal relation is considered as a form of translation that enables meaning-encoded communication over the informative processes. In this sense, semiosis may not be exclusive. Synthetic biology is exemplified as a form of artificial selection mechanisms for the generation of 'self-reproducing' systems with information coding and processing machineries. These discussions are summarised at the end.

  5. Biophysical studies of cholesterol effects on chromatin. (United States)

    Silva, Isabel T G; Fernandes, Vinicius; Souza, Caio; Treptow, Werner; Santos, Guilherme Martins


    Changes in chromatin structure regulate gene expression and genome maintenance. Molecules that bind to the nucleosome, the complex of DNA and histone proteins, are key modulators of chromatin structure. Previous work indicated that cholesterol, a ubiquitous cellular lipid, may bind to chromatin in vivo, suggesting a potential function for lipids in modulating chromatin architecture. However, the molecular mechanisms of cholesterol action on chromatin structure have remained unclear. Here, we explored the biophysical impact of cholesterol on nucleosome and chromatin fibers reconstituted in vitro and characterized in silico the cholesterol binding to nucleosome. Our findings support that cholesterol assists 10nm and 30nm chromatin formation and induces folding of long chromatin fibers as a result of direct interaction of the cholesterol to six nucleosomal binding sites.

  6. Application of biophysical technologies in dental research (United States)

    Higham, Susan M.; Pender, Neil; de Josselin de Jong, Elbert; Smith, Philip W.


    There is a wealth of evidence to indicate that if dental caries can be recognized at an early stage, it is possible to halt its progression or even reverse it. This has led to an increased interest in the development of diagnostic techniques capable of visualizing caries at an early stage in addition to providing clinicians with an aid to diagnosis. Several techniques are available for research and clinical applications for detecting early demineralization. This manuscript has reviewed some of the techniques currently available to determine their advantages, whether they have any limitations and their applicability to dental research and clinical dentistry. Not one method is the perfect choice in all situations, but what is clear is that the development and application of biophysical technologies have allowed major advances to be made in dental research as well as in clinical dentistry. With continued developments these technologies will play an important role in the future management of dental disease.

  7. Understanding Statistical Mechanics and Biophysics Using Excel (United States)

    Nelson, Peter


    A new approach to teaching statistical mechanics and biophysics is presented using the classic two-box system from statistical mechanics as an example. This approach makes advanced physics concepts accessible to a broad audience including undergraduates with no calculus background. Students develop a simple Excel spreadsheet that implements a kinetic Monte Carlo (kMC) simulation algorithm ``from scratch''. The students discover for themselves the properties of the system by analyzing the simulation output in a directed, activity-based exercise. By changing the number and initial distribution of the particles, students see how the system approaches equilibrium and how system variability changes with system size. A finite difference solution is also implemented in Excel, and students compare its predictions with the kMC results. This approach is quite different from using ``canned'' computer demonstrations, as students design, implement and debug the simulation themselves -- ensuring that they understand the model system intimately.

  8. Review of FEWS NET Biophysical Monitoring Requirements (United States)

    Ross, K. W.; Brown, Molly E.; Verdin, J.; Underwood, L. W.


    The Famine Early Warning System Network (FEWS NET) provides monitoring and early warning support to decision makers responsible for responding to famine and food insecurity. FEWS NET transforms satellite remote sensing data into rainfall and vegetation information that can be used by these decision makers. The National Aeronautics and Space Administration has recently funded activities to enhance remote sensing inputs to FEWS NET. To elicit Earth observation requirements, a professional review questionnaire was disseminated to FEWS NET expert end-users: it focused upon operational requirements to determine additional useful remote sensing data and; subsequently, beneficial FEWS NET biophysical supplementary inputs. The review was completed by over 40 experts from around the world, enabling a robust set of professional perspectives to be gathered and analyzed rapidly. Reviewers were asked to evaluate the relative importance of environmental variables and spatio-temporal requirements for Earth science data products, in particular for rainfall and vegetation products. The results showed that spatio-temporal resolution requirements are complex and need to vary according to place, time, and hazard: that high resolution remote sensing products continue to be in demand, and that rainfall and vegetation products were valued as data that provide actionable food security information.

  9. Biophysical and biomathematical adventures in radiobiology

    Energy Technology Data Exchange (ETDEWEB)

    Scott, B.R.


    Highlights of my biophysical and biomathematical adventures in radiobiology is presented. Early adventures involved developing state-vector models'' for specific harmful effects (cell killing, life shortening) of exposure to radiation. More recent adventures led to developing hazard-function models'' for predicting biological effects (e.g., cell killing, mutations, tumor induction) of combined exposure to different toxicants. Hazard-function models were also developed for predicting harm to man from exposure to large radiation doses. Major conclusions derived from the modeling adventures are as follows: (1) synergistic effects of different genotoxic agents should not occur at low doses; (2) for exposure of the lung or bone marrow to large doses of photon radiation, low rates of exposure should be better tolerated than high rates; and (3) for some types of radiation (e.g., alpha particles and fission neutrons), moderate doses delivered at a low rate may be more harmful than the same dose given at a high rate. 53 refs., 7 figs.

  10. Biophysically realistic minimal model of dopamine neuron (United States)

    Oprisan, Sorinel


    We proposed and studied a new biophysically relevant computational model of dopaminergic neurons. Midbrain dopamine neurons are involved in motivation and the control of movement, and have been implicated in various pathologies such as Parkinson's disease, schizophrenia, and drug abuse. The model we developed is a single-compartment Hodgkin-Huxley (HH)-type parallel conductance membrane model. The model captures the essential mechanisms underlying the slow oscillatory potentials and plateau potential oscillations. The main currents involved are: 1) a voltage-dependent fast calcium current, 2) a small conductance potassium current that is modulated by the cytosolic concentration of calcium, and 3) a slow voltage-activated potassium current. We developed multidimensional bifurcation diagrams and extracted the effective domains of sustained oscillations. The model includes a calcium balance due to the fundamental importance of calcium influx as proved by simultaneous electrophysiological and calcium imaging procedure. Although there are significant evidences to suggest a partially electrogenic calcium pump, all previous models considered only elecrtogenic pumps. We investigated the effect of the electrogenic calcium pump on the bifurcation diagram of the model and compared our findings against the experimental results.

  11. Review of FEWS NET biophysical monitoring requirements

    Energy Technology Data Exchange (ETDEWEB)

    Ross, K W; Underwood, L W [Science Systems and Applications, Incorporated, 411 West Michigan Street, Poplarville, MS 39470 (United States); Brown, M E [NASA-Goddard Space Flight Center, Code 614.4, Greenbelt, MD 20771 (United States); Verdin, J P [United States Geological Survey, National Integrated Drought Information System, NOAA/ESRL, 325 Broadway, Boulder, CO 80305 (United States)], E-mail:, E-mail:, E-mail:, E-mail:


    The Famine Early Warning System Network (FEWS NET) provides monitoring and early warning support to decision makers responsible for responding to famine and food insecurity. FEWS NET transforms satellite remote sensing data into rainfall and vegetation information that can be used by these decision makers. The National Aeronautics and Space Administration has recently funded activities to enhance remote sensing inputs to FEWS NET. To elicit Earth observation requirements, a professional review questionnaire was disseminated to FEWS NET expert end-users; it focused upon operational requirements to determine additional useful remote sensing data and, subsequently, to assess whether such data would be beneficial as FEWS NET biophysical supplementary inputs. The review was completed by over 40 experts from around the world. Reviewers were asked to evaluate the relative importance of environmental variables and spatio-temporal requirements for Earth science data products, in particular for rainfall and vegetation products. The results showed that spatio-temporal resolution requirements are complex and need to vary according to place, time, and hazard; that high resolution remote sensing products continue to be in demand; and that rainfall and vegetation products are valued as data that provide actionable food security information.

  12. Brain Mapping Center Opens at Institute of Biophysics

    Institute of Scientific and Technical Information of China (English)


    @@ Agroup of world-class scie, ntists in brain imaging came to China's capital to .witness the inauguration of the Beijing MRI Center for Brain Research, which was officially opened on May 25 at the CAS Institute of Biophysics.

  13. Developing spatial biophysical accounting for multiple ecosystem services

    NARCIS (Netherlands)

    Remme, R.P.; Schroter, M.; Hein, L.G.


    Ecosystem accounting is receiving increasing interest as a way to systematically monitor the conditions of ecosystems and the ecosystem services they provide. A critical element of ecosystem accounting is understanding spatially explicit flows of ecosystem services. We developed spatial biophysical

  14. The relationship between fetal biophysical profile and cord blood PH

    Directory of Open Access Journals (Sweden)

    Valadan M


    Full Text Available "nBackground: The Biophysical Profile (BPP is a noninvasive test that predicts the presence or absence of fetal asphyxia and, ultimately, the risk of fetal death in the antenatal period. Intervention on the basis of an abnormal biophysical profile result has been reported to yield a significant reduction in prenatal mortality, and an association exists between biophysical profile scoring and a decreased cerebral palsy rate in a given population. The BPP evaluates five characteristics: fetal movement, tone, breathing, heart reactivity, and amniotic fluid (AF volume estimation. The purpose of study was to determine whether there are different degree of acidosis at which the biophysical activity (acute marker are affected. "nMethods: In a prospective study of 140 patients undergoing cesarean section before onset of labor, the fetal biophysical profile was performed 24h before the time of cesarean and was matched with cord arterial PH that was obtained from a cord segment (10-20cm that was double clamped after delivery of newborn. (using cord arterial PH less than 7.20 for the diagnosis of acidosis. "nResults: The fetal biophysical profile was found to have a significant relationship with umbilical blood PH. The sensitivity, specificity, positive predictive value, negative predictive value of fetal biophysical profile score were: 88.9%, 88.6%, 50%, 98.1%. "nConclusion: The first manifestations of fetal acidosis are nonreactive nonstress testing and fetal breathing loss; in advanced acidemia fetal movements and fetal tone are compromised. A protocol of antepartum fetal evaluation is suggested based upon the individual biophysical components rather than the score alone.

  15. Biophysics of Human Hair Structural, Nanomechanical, and Nanotribological Studies

    CERN Document Server

    Bhushan, Bharat


    This book presents the biophysics of hair. It deals with the structure of hair, its mechanical properties, the nanomechanical characterization, tensile deformation, tribological characterization, the thickness distribution and binding interactions on hair surface. Another important topic of the book is the health of hair, human hair and skin, hair care, cleaning and conditioning treatments and damaging processes. It is the first book on the biophysical properties of hair.

  16. Modelling Biophysical Parameters of Maize Using Landsat 8 Time Series (United States)

    Dahms, Thorsten; Seissiger, Sylvia; Conrad, Christopher; Borg, Erik


    Open and free access to multi-frequent high-resolution data (e.g. Sentinel - 2) will fortify agricultural applications based on satellite data. The temporal and spatial resolution of these remote sensing datasets directly affects the applicability of remote sensing methods, for instance a robust retrieving of biophysical parameters over the entire growing season with very high geometric resolution. In this study we use machine learning methods to predict biophysical parameters, namely the fraction of absorbed photosynthetic radiation (FPAR), the leaf area index (LAI) and the chlorophyll content, from high resolution remote sensing. 30 Landsat 8 OLI scenes were available in our study region in Mecklenburg-Western Pomerania, Germany. In-situ data were weekly to bi-weekly collected on 18 maize plots throughout the summer season 2015. The study aims at an optimized prediction of biophysical parameters and the identification of the best explaining spectral bands and vegetation indices. For this purpose, we used the entire in-situ dataset from 24.03.2015 to 15.10.2015. Random forest and conditional inference forests were used because of their explicit strong exploratory and predictive character. Variable importance measures allowed for analysing the relation between the biophysical parameters with respect to the spectral response, and the performance of the two approaches over the plant stock evolvement. Classical random forest regression outreached the performance of conditional inference forests, in particular when modelling the biophysical parameters over the entire growing period. For example, modelling biophysical parameters of maize for the entire vegetation period using random forests yielded: FPAR: R² = 0.85; RMSE = 0.11; LAI: R² = 0.64; RMSE = 0.9 and chlorophyll content (SPAD): R² = 0.80; RMSE=4.9. Our results demonstrate the great potential in using machine-learning methods for the interpretation of long-term multi-frequent remote sensing datasets to model


    Directory of Open Access Journals (Sweden)

    A. Jamal


    Full Text Available "nThe original biophysical profile is time consuming and costly. This study was performed to compare diagnostic value of the original fetal biophysical profile to the modified biophysical profile. Patients were selected from high risk pregnancies referred for fetal assessment and were randomly assigned to two groups. The measures of outcomes were perinatal mortality, Cesarean section for abnormal test, meconium-stained amniotic fluid and 5-minute Apgar score < 7. Diagnostic values of tests were assessed in terms of the incidence of abnormal outcome. In addition comparisons between the positive and negative predictive values of each of these tests as well as the sensitivity and specificity of the tests were reviewed. A total of 200 patients were entered into the study; 104 pregnancies were managed by the original biophysical profile and 96 pregnancies by the modified biophysical profile. There were 30 abnormal (31.3% in modified biophysical profile and 24 (23.1% abnormal tests in original one. There was significant difference in the incidence of meconium passage between two groups. Cesarean section for abnormal tests was 27 of 30 abnormal test (90% in modified and 22 of 24 (91.6% in original profile that was similar in both groups. There was not significant difference in Apgar score < 7 between two groups. We did not find significant difference with comparison of the sensitivity, specificity and negative predictive value of two tests for all measures of outcome except the positive predictive value of meconium passage. Original biophysical profile is more costly and time consuming than modified one.

  18. Biophysical Approaches for Oral Wound Healing: Emphasis on Photobiomodulation (United States)

    Khan, Imran; Arany, Praveen


    Significance: Oral wounds can lead to significant pain and discomfort as well as affect overall general health due to poor diet and inadequate nutrition. Besides many biological and pharmaceutical methods being investigated, there is growing interest in exploring various biophysical devices that utilize electric, magnetic, ultrasound, pressure, and light energy. Recent Advances: Significant insight into mechanisms of these biophysical devices could provide a clear rationale for their clinical use. Preclinical studies are essential precursors in determining physiological mechanisms and elucidation of causal pathways. This will lead to development of safe and effective therapeutic protocols for clinical wound management. Critical Issues: Identification of precise events initiated by biophysical devices, specifically photobiomodulation—the major focus of this review, offers promising avenues in improving oral wound management. The primary phase responses initiated by the interventions that distinctly contribute to the therapeutic response must be clearly delineated from secondary phase responses. The latter events are a consequence of the wound healing process and must not be confused with causal mechanisms. Future Direction: Clinical adoption of these biophysical devices needs robust and efficacious protocols that can be developed by well-designed preclinical and clinical studies. Elucidation of the precise molecular mechanisms of these biophysical approaches could determine optimization of their applications for predictive oral wound care. PMID:26634185

  19. The physical basis of biochemistry the foundations of molecular biophysics

    CERN Document Server

    Bergethon, Peter R


    The objective of this book is to provide a unifying approach to the study of biophysical chemistry for the advanced undergraduate who has had a year of physics, organic chem­ istry, calculus, and biology. This book began as a revised edition of Biophysical Chemistry: Molecules to Membranes, which Elizabeth Simons and I coauthored. That short volume was written in an attempt to provide a concise text for a one-semester course in biophysical chemistry at the graduate level. The experience of teaching biophysical chemistry to bi­ ologically oriented students over the last decade has made it clear that the subject requires a more fundamental text that unifies the many threads of modem science: physics, chem­ istry, biology, mathematics, and statistics. This book represents that effort. This volume is not a treatment of modem biophysical chemistry with its rich history and many contro­ versies, although a book on that topic is also needed. The Physical Basis of Biochemistry is an introduction to the philosophy...

  20. Estimation of rice biophysical parameters using multitemporal RADARSAT-2 images (United States)

    Li, S.; Ni, P.; Cui, G.; He, P.; Liu, H.; Li, L.; Liang, Z.


    Compared with optical sensors, synthetic aperture radar (SAR) has the capability of acquiring images in all-weather conditions. Thus, SAR images are suitable for using in rice growth regions that are characterized by frequent cloud cover and rain. The objective of this paper was to evaluate the probability of rice biophysical parameters estimation using multitemporal RADARSAT-2 images, and to develop the estimation models. Three RADARSTA-2 images were acquired during the rice critical growth stages in 2014 near Meishan, Sichuan province, Southwest China. Leaf area index (LAI), the fraction of photosynthetically active radiation (FPAR), height, biomass and canopy water content (WC) were observed at 30 experimental plots over 5 periods. The relationship between RADARSAT-2 backscattering coefficients (σ 0) or their ratios and rice biophysical parameters were analysed. These biophysical parameters were significantly and consistently correlated with the VV and VH σ 0 ratio (σ 0 VV/ σ 0 VH) throughout all growth stages. The regression model were developed between biophysical parameters and σ 0 VV/ σ 0 VH. The results suggest that the RADARSAT-2 data has great potential capability for the rice biophysical parameters estimation and the timely rice growth monitoring.

  1. Lidar remote sensing of savanna biophysical attributes (United States)

    Gwenzi, David

    plot level biomass into wall-to-wall maps that provide more ecological information. We evaluated the utility of three spatial modeling approaches to address this problem: deterministic methods, geostatistical methods and an image segmentation approach. Overall, the mean pixel biomass estimated by the 3 approaches did not differ significantly but the output maps showed marked differences in the estimation precision and ability of each model to mimic the primary variable's trend across the landscape. The results emphasized the need for future satellite lidar missions to consider increasing the sampling intensity across track so that biomass observations are made and characterized at the scale at which they vary. We used data from the Multiple Altimeter Beam Experimental Lidar (MABEL), an airborne photon counting lidar sensor developed by NASA Goddard to simulate ICESat-2 data. We segmented each transect into different block sizes and calculated canopy top and mean ground elevation based on the structure of the histogram of the block's aggregated photons. Our algorithm was able to compute canopy height and generate visually meaningful vegetation profiles at MABEL's signal and noise levels but a simulation of the expected performance of ICESat-2 by adjusting MABEL data's detected number of signal and noise photons to that predicted using ATLAS instrument model design cases indicated that signal photons will be substantially lower. The lower data resolution reduces canopy height estimation precision especially in areas of low density vegetation cover. Given the clear difficulties in processing simulated ATLAS data, it appears unlikely that it will provide the kind of data required for mapping of the biophysical properties of savanna vegetation. Rather, resources are better concentrated on preparing for the Global Ecosystem Dynamics Investigation (GEDI) mission, a waveform lidar mission scheduled to launch by the end of this decade. In addition to the full waveform technique

  2. Biophysics in drug discovery: impact, challenges and opportunities. (United States)

    Renaud, Jean-Paul; Chung, Chun-Wa; Danielson, U Helena; Egner, Ursula; Hennig, Michael; Hubbard, Roderick E; Nar, Herbert


    Over the past 25 years, biophysical technologies such as X-ray crystallography, nuclear magnetic resonance spectroscopy, surface plasmon resonance spectroscopy and isothermal titration calorimetry have become key components of drug discovery platforms in many pharmaceutical companies and academic laboratories. There have been great improvements in the speed, sensitivity and range of possible measurements, providing high-resolution mechanistic, kinetic, thermodynamic and structural information on compound-target interactions. This Review provides a framework to understand this evolution by describing the key biophysical methods, the information they can provide and the ways in which they can be applied at different stages of the drug discovery process. We also discuss the challenges for current technologies and future opportunities to use biophysical methods to solve drug discovery problems.

  3. Evaluating landscape health: Integrating societal goals and biophysical process (United States)

    Rapport, D.J.; Gaudet, C.; Karr, J.R.; Baron, J. S.; Bohlen, C.; Jackson, W.; Jones, B.; Naiman, R.J.; Norton, B.; Pollock, M. M.


    Evaluating landscape change requires the integration of the social and natural sciences. The social sciences contribute to articulating societal values that govern landscape change, while the natural sciences contribute to understanding the biophysical processes that are influenced by human activity and result in ecological change. Building upon Aldo Leopold's criteria for landscape health, the roles of societal values and biophysical processes in shaping the landscape are explored. A framework is developed for indicators of landscape health and integrity. Indicators of integrity are useful in measuring biological condition relative to the condition in landscapes largely unaffected by human activity, while indicators of health are useful in evaluating changes in highly modified landscapes. Integrating societal goals and biophysical processes requires identification of ecological services to be sustained within a given landscape. It also requires the proper choice of temporal and spatial scales. Societal values are based upon inter-generational concerns at regional scales (e.g. soil and ground water quality). Assessing the health and integrity of the environment at the landscape scale over a period of decades best integrates societal values with underlying biophysical processes. These principles are illustrated in two contrasting case studies: (1) the South Platte River study demonstrates the role of complex biophysical processes acting at a distance; and (2) the Kissimmee River study illustrates the critical importance of social, cultural and economic concerns in the design of remedial action plans. In both studies, however, interactions between the social and the biophysical governed the landscape outcomes. The legacy of evolution and the legacy of culture requires integration for the purpose of effectively coping with environmental change.

  4. The Twilight of Determinism: At Least in Biophysical Novelties

    CERN Document Server

    Gilead, Amihud


    In the 1990s, Richard Lewontin referred to what appeared to be the twilight of determinism in biology. He pointed out that DNA determines only a little part of life phenomena, which are very complex. In fact, organisms determine the environment and vice versa in a nonlinear way. Very recently, biophysicists, Shimon Marom and Erez Braun, have demonstrated that controlled biophysical systems have shown a relative autonomy and flexibility in response which could not be predicted. Within the boundaries of some restraints, most of them genetic, this freedom from determinism is well maintained. Marom and Braun have challenged not only biophysical determinism but also reverse-engineering, naive reductionism, mechanism, and systems biology.

  5. Institutional Factors Affecting Biophysical Outcomes in Forest Management (United States)

    Coleman, Eric A.


    Although there is considerable interest in the impact of diverse policies affecting the biophysical outcomes in forests, gaining a substantial sample over time of forests under different institutional arrangements has been difficult. This article analyzes data from 46 forests located in six countries over time. In forests where policies have been…

  6. Beyond NDVI: Extraction of biophysical variables from remote sensing imagery

    NARCIS (Netherlands)

    Clevers, J.G.P.W.


    This chapter provides an overview of methods used for the extraction of biophysical vegetation variables from remote sensing imagery. It starts with the description of the main spectral regions in the optical window of the electromagnetic spectrum based on typical spectral signatures of land surface

  7. Skin Biophysical Characteristics in Patients with Keratoconus: A Controlled Study

    Directory of Open Access Journals (Sweden)

    Reza M. Robati


    Full Text Available Background. Keratoconus is a relatively common corneal disease causing significant visual disability. Individuals with connective tissue disorders that affect the skin such as Marfan’s syndrome and Ehlers-Danlos syndrome or patients with atopic dermatitis show an increased prevalence of keratoconus. It seems that there are some concurrent alterations of skin and cornea in patients with keratoconus. Objective. We plan to compare skin biophysical characteristics in patients with keratoconus and healthy controls. Methods. Forty patients with keratoconus (18 females and 22 males with mean (SD age of 33.32 (9.55 years (range 19–56 and 40 healthy controls were recruited to this study. Skin biophysical characteristics including cutaneous resonance running time (CRRT, stratum corneum hydration, and melanin values were measured in patients and controls. Results. The median CRRT, stratum corneum hydration, and melanin measurements were significantly lower in patients with keratoconus in comparison with healthy controls. Conclusion. There are some alterations of skin biophysical properties in patients with keratoconus. Therefore, the assessment of these skin parameters could provide us some clues to the possible common biophysical variations of cornea and skin tissue in diseases such as keratoconus.

  8. Skin Biophysical Characteristics in Patients with Keratoconus: A Controlled Study. (United States)

    Robati, Reza M; Einollahi, Bahram; Einollahi, Hoda; Younespour, Shima; Fadaifard, Shahed


    Background. Keratoconus is a relatively common corneal disease causing significant visual disability. Individuals with connective tissue disorders that affect the skin such as Marfan's syndrome and Ehlers-Danlos syndrome or patients with atopic dermatitis show an increased prevalence of keratoconus. It seems that there are some concurrent alterations of skin and cornea in patients with keratoconus. Objective. We plan to compare skin biophysical characteristics in patients with keratoconus and healthy controls. Methods. Forty patients with keratoconus (18 females and 22 males) with mean (SD) age of 33.32 (9.55) years (range 19-56) and 40 healthy controls were recruited to this study. Skin biophysical characteristics including cutaneous resonance running time (CRRT), stratum corneum hydration, and melanin values were measured in patients and controls. Results. The median CRRT, stratum corneum hydration, and melanin measurements were significantly lower in patients with keratoconus in comparison with healthy controls. Conclusion. There are some alterations of skin biophysical properties in patients with keratoconus. Therefore, the assessment of these skin parameters could provide us some clues to the possible common biophysical variations of cornea and skin tissue in diseases such as keratoconus.

  9. Skin Biophysical Characteristics in Patients with Keratoconus: A Controlled Study (United States)

    Robati, Reza M.; Einollahi, Bahram; Einollahi, Hoda; Younespour, Shima; Fadaifard, Shahed


    Background. Keratoconus is a relatively common corneal disease causing significant visual disability. Individuals with connective tissue disorders that affect the skin such as Marfan's syndrome and Ehlers-Danlos syndrome or patients with atopic dermatitis show an increased prevalence of keratoconus. It seems that there are some concurrent alterations of skin and cornea in patients with keratoconus. Objective. We plan to compare skin biophysical characteristics in patients with keratoconus and healthy controls. Methods. Forty patients with keratoconus (18 females and 22 males) with mean (SD) age of 33.32 (9.55) years (range 19–56) and 40 healthy controls were recruited to this study. Skin biophysical characteristics including cutaneous resonance running time (CRRT), stratum corneum hydration, and melanin values were measured in patients and controls. Results. The median CRRT, stratum corneum hydration, and melanin measurements were significantly lower in patients with keratoconus in comparison with healthy controls. Conclusion. There are some alterations of skin biophysical properties in patients with keratoconus. Therefore, the assessment of these skin parameters could provide us some clues to the possible common biophysical variations of cornea and skin tissue in diseases such as keratoconus. PMID:27403376

  10. Delineating Biophysical Environments of the Sunda Banda Seascape, Indonesia

    Directory of Open Access Journals (Sweden)

    Mingshu Wang


    Full Text Available The Sunda Banda Seascape (SBS, located in the center of the Coral Triangle, is a global center of marine biodiversity and a conservation priority. We proposed the first biophysical environmental delineation of the SBS using globally available satellite remote sensing and model-assimilated data to categorize this area into unique and meaningful biophysical classes. Specifically, the SBS was partitioned into eight biophysical classes characterized by similar sea surface temperature, chlorophyll a concentration, currents, and salinity patterns. Areas within each class were expected to have similar habitat types and ecosystem functions. Our work supplemented prevailing global marine management schemes by focusing in on a regional scale with finer spatial resolution. It also provided a baseline for academic research, ecological assessments and will facilitate marine spatial planning and conservation activities in the area. In addition, the framework and methods of delineating biophysical environments we presented can be expanded throughout the whole Coral Triangle to support research and conservation activities in this important region.

  11. Biophysical methods in drug discovery from small molecule to pharmaceutical. (United States)

    Holdgate, Geoffrey; Geschwindner, Stefan; Breeze, Alex; Davies, Gareth; Colclough, Nicola; Temesi, David; Ward, Lara


    Biophysical methods have become established in many areas of drug discovery. Application of these methods was once restricted to a relatively small number of scientists using specialized, low throughput technologies and methods. Now, automated high-throughput instruments are to be found in a growing number of laboratories. Many biophysical methods are capable of measuring the equilibrium binding constants between pairs of molecules crucial for molecular recognition processes, encompassing protein-protein, protein-small molecule, and protein-nucleic acid interactions, and several can be used to measure the kinetic or thermodynamic components controlling these biological processes. For a full characterization of a binding process, determinations of stoichiometry, binding mode, and any conformational changes associated with such interactions are also required. The suite of biophysical methods that are now available represents a powerful toolbox of techniques which can effectively deliver this full characterization.The aim of this chapter is to provide the reader with an overview of the drug discovery process and how biophysical methods, such as surface plasmon resonance (SPR), isothermal titration calorimetry (ITC), nuclear magnetic resonance, mass spectrometry (MS), and thermal unfolding methods can answer specific questions in order to influence project progression and outcomes. The selection of these examples is based upon the experiences of the authors at AstraZeneca, and relevant approaches are highlighted where they have utility in a particular drug discovery scenario.

  12. Prostaglandin phospholipid conjugates with unusual biophysical and cytotoxic properties

    DEFF Research Database (Denmark)

    Pedersen, Palle Jacob; Adolph, Sidsel K.; Andresen, Thomas Lars;


    The synthesis of two secretory phospholipase A(2) IIA sensitive 15-deoxy-Delta(12,14)-prostaglandin J(2) phospholipid conjugates is described and their biophysical and biological properties are reported. The conjugates spontaneously form particles in the liposome size region upon dispersion in an...

  13. Polish Academy of Sciences Institute of Biochemistry and Biophysics research report 1994-1995

    Energy Technology Data Exchange (ETDEWEB)



    Scientific interests of Institute of Biochemistry and Biophysics Polish Academy of Sciences are focused on DNA replication and repair, gene expression, gene sequencing and molecular biophysics. The work reviews research projects of the Institute in 1994-1995.

  14. Small-Angle X-ray Scattering Screening Complements Conventional Biophysical Analysis

    DEFF Research Database (Denmark)

    Tian, Xinsheng; Langkilde, Annette Eva; Thorolfsson, Matthias;


    introduce small-angle X-ray scattering (SAXS) to characterize antibody solution behavior, which strongly complements conventional biophysical analysis. First, we apply a variety of conventional biophysical techniques for the evaluation of structural, conformational, and colloidal stability and report...

  15. Mapping technological and biophysical capacities of watersheds to regulate floods (United States)

    Mogollon, Beatriz; Villamagna, Amy M.; Frimpong, Emmanuel A.; Angermeier, Paul


    Flood regulation is a widely valued and studied service provided by watersheds. Flood regulation benefits people directly by decreasing the socio-economic costs of flooding and indirectly by its positive impacts on cultural (e.g., fishing) and provisioning (e.g., water supply) ecosystem services. Like other regulating ecosystem services (e.g., pollination, water purification), flood regulation is often enhanced or replaced by technology, but the relative efficacy of natural versus technological features in controlling floods has scarcely been examined. In an effort to assess flood regulation capacity for selected urban watersheds in the southeastern United States, we: (1) used long-term flood records to assess relative influence of technological and biophysical indicators on flood magnitude and duration, (2) compared the widely used runoff curve number (RCN) approach for assessing the biophysical capacity to regulate floods to an alternative approach that acknowledges land cover and soil properties separately, and (3) mapped technological and biophysical flood regulation capacities based on indicator importance-values derived for flood magnitude and duration. We found that watersheds with high biophysical (via the alternative approach) and technological capacities lengthened the duration and lowered the peak of floods. We found the RCN approach yielded results opposite that expected, possibly because it confounds soil and land cover processes, particularly in urban landscapes, while our alternative approach coherently separates these processes. Mapping biophysical (via the alternative approach) and technological capacities revealed great differences among watersheds. Our study improves on previous mapping of flood regulation by (1) incorporating technological capacity, (2) providing high spatial resolution (i.e., 10-m pixel) maps of watershed capacities, and (3) deriving importance-values for selected landscape indicators. By accounting for technology that enhances

  16. Biophysical responses upon the interaction of nanomaterials with cellular interfaces. (United States)

    Wu, Yun-Long; Putcha, Nirupama; Ng, Kee Woei; Leong, David Tai; Lim, Chwee Teck; Loo, Say Chye Joachim; Chen, Xiaodong


    The explosion of study of nanomaterials in biological applications (the nano-bio interface) can be ascribed to nanomaterials' growing importance in diagnostics, therapeutics, theranostics (therapeutic diagnostics), and targeted modulation of cellular processes. However, a growing number of critics have raised concerns over the potential risks of nanomaterials to human health and safety. It is essential to understand nanomaterials' potential toxicity before they are tested in humans. These risks are complicated to unravel, however, because of the complexity of cells and their nanoscale macromolecular components, which enable cells to sense and respond to environmental cues, including nanomaterials. In this Account, we explore these risks from the perspective of the biophysical interactions between nanomaterials and cells. Biophysical responses to the uptake of nanomaterials can include conformational changes in biomolecules like DNA and proteins, and changes to the cellular membrane and the cytoskeleton. Changes to the latter two, in particular, can induce changes in cell elasticity, morphology, motility, adhesion, and invasion. This Account reviews what is known about cells' biophysical responses to the uptake of the most widely studied and used nanoparticles, such as carbon-based, metal, metal-oxide, and semiconductor nanomaterials. We postulate that the biophysical structure impairment induced by nanomaterials is one of the key causes of nanotoxicity. The disruption of cellular structures is affected by the size, shape, and chemical composition of nanomaterials, which are also determining factors of nanotoxicity. Currently, popular nanotoxicity characterizations, such as the MTT and lactate dehydrogenase (LDH) assays, only provide end-point results through chemical reactions. Focusing on biophysical structural changes induced by nanomaterials, possibly in real-time, could deepen our understanding of the normal and altered states of subcellular structures and

  17. Numerical integration methods for large-scale biophysical simulations

    CERN Document Server

    Chignola, Roberto; Milotti, Edoardo


    Simulations of biophysical systems inevitably include steps that correspond to time integrations of ordinary differential equations. These equations are often related to enzyme action in the synthesis and destruction of molecular species, and in the regulation of transport of molecules into and out of the cell or cellular compartments. Enzyme action is almost invariably modeled with the quasi-steady-state Michaelis-Menten formula or its close relative, the Hill formula: this description leads to systems of equations that may be stiff and hard to integrate, and poses unusual computational challenges in simulations where a smooth evolution is interrupted by the discrete events that mark the cells' lives. This is the case of a numerical model (Virtual Biophysics Lab - VBL) that we are developing to simulate the growth of three-dimensional tumor cell aggregates (spheroids). The program must be robust and stable, and must be able to accept frequent changes in the underlying theoretical model: here we study the app...

  18. Biophysical climate impacts of recent changes in global forest cover. (United States)

    Alkama, Ramdane; Cescatti, Alessandro


    Changes in forest cover affect the local climate by modulating the land-atmosphere fluxes of energy and water. The magnitude of this biophysical effect is still debated in the scientific community and currently ignored in climate treaties. Here we present an observation-driven assessment of the climate impacts of recent forest losses and gains, based on Earth observations of global forest cover and land surface temperatures. Our results show that forest losses amplify the diurnal temperature variation and increase the mean and maximum air temperature, with the largest signal in arid zones, followed by temperate, tropical, and boreal zones. In the decade 2003-2012, variations of forest cover generated a mean biophysical warming on land corresponding to about 18% of the global biogeochemical signal due to CO2 emission from land-use change.

  19. "The Physics of Life," an undergraduate general education biophysics course

    CERN Document Server

    Parthasarathy, Raghuveer


    Improving the scientific literacy of non-scientists is an important goal, both because of the ever-increasing impact of science and technology on our lives, and because understanding science enriches our experience of the natural world. One route to improving scientific literacy is via general education undergraduate courses -- i.e. courses intended for students not majoring in the sciences or engineering -- which in many cases provide these students' last formal exposure to science. I describe here a course on biophysics for non-science-major undergraduates recently developed at the University of Oregon (Eugene, OR, USA). Biophysics, I claim, is a particularly useful vehicle for addressing scientific literacy. It involves important and general scientific concepts, demonstrates connections between basic science and tangible, familiar phenomena related to health and disease, and illustrates that scientific insights develop by applying tools and perspectives from disparate fields in creative ways. In addition, ...

  20. From hadron therapy to cosmic rays: a life in biophysics

    CERN Multimedia

    Christine Sutton


    In 1954 – the year CERN was founded – another scientific journey began at what is now the Lawrence Berkeley National Laboratory. Beams of protons from a particle accelerator were used for the first time by John Lawrence – a doctor and the brother of Ernest Lawrence, the physicist after whom the Berkeley lab is named – to treat patients with cancer. For many years, Eleanor Blakely has been one of the leaders of that journey. She visited CERN last week and spoke with the Bulletin about her life in biophysics.   Use of the cylcotron beam to mimic "shooting stars" seen by astronauts. Black hood on subject Cornelius Tobias keeps out light during neutron irradiation experiment at the 184-inch accelerator. Helping to position Tobias in the beam line are (left to right) John Lyman of Biomedical Division, and Ralph Thomas of Health Physics. (Photo courtesy of Lawrence Berkeley National Laboratory.) Interested in biophysics, which was still a new...

  1. Biophysical properties of DNA in hydrated ionic liquids (United States)

    Jumbri, Khairulazhar; Ahmad, Haslina; Abdulmalek, Emilia; Rahman, Mohd Basyaruddin Abdul


    The biophysical properties and behavior of natural calf thymus DNA in hydrated 1-ethyl-3-butylimidazolium bromide ionic liquid ([C2bim]Br) have been studied using spectroscopy technique. The effect of ionic liquid concentration and temperature towards the duplex B-DNA conformation were determined. The presence of ionic liquid causes higher duplex DNA stability with the DNA melting temperature of ˜56°C without any addition of buffer solutions. The electrostatic attraction between ionic liquid's cation and DNA phosphates groups was found play a main role in stabilizing native DNA structure. Understanding of the biophysical properties of DNA in this ionic media could be used as a platform for future development of specific solvent for nucleic acid nanotechnology.

  2. Evolution and Biophysics of the Escherichia coli lac Operon (United States)

    Ray, J. Christian; Igoshin, Oleg; Quan, Selwyn; Monds, Russell; Cooper, Tim; Balázsi, Gábor


    To understand, predict, and control the evolution of living organisms, we consider biophysical effects and molecular network architectures. The lactose utilization system of E. coli is among the most well-studied molecular networks in biology, making it an ideal candidate for such studies. Simulations show how the genetic architecture of the wild-type operon attenuates large metabolic intermediate fluctuations that are predicted to occur in an equivalent system with the component genes on separate operons. Quantification of gene expression in the lac operon evolved in growth conditions containing constant lactose, alternating with glucose, or constant glucose, shows characteristic gene expression patterns depending on conditions. We are simulating these conditions to show context-dependent biophysical sources and costs of different lac operon architectures.

  3. Biophysical Study of Archaebacteria Biomembrane and Possible Application in Biomaterials. (United States)


    arrangement of the protonated Schiff base , AsP-85, Asp-212 and Arg-82 in agreement with an electron diffraction derived model (3,9,20,27). The disruption of...this active site upon formation of the M intermediate due to protonation of Asp-85 from the Schiff base is believed to cause ejection of a proton...Asp- 96 to the Schiff base (20). 2. Development of new biophysical techniques to study Archaebacteria membrane proteins: An important aspect of the

  4. The Twilight of Determinism: At Least in Biophysical Novelties


    Gilead, Amihud


    In the 1990s, Richard Lewontin referred to what appeared to be the twilight of determinism in biology. He pointed out that DNA determines only a little part of life phenomena, which are very complex. In fact, organisms determine the environment and vice versa in a nonlinear way. Very recently, biophysicists, Shimon Marom and Erez Braun, have demonstrated that controlled biophysical systems have shown a relative autonomy and flexibility in response which could not be predicted. Within the boun...

  5. Skin Biophysical Characteristics in Patients with Keratoconus: A Controlled Study



    Background. Keratoconus is a relatively common corneal disease causing significant visual disability. Individuals with connective tissue disorders that affect the skin such as Marfan's syndrome and Ehlers-Danlos syndrome or patients with atopic dermatitis show an increased prevalence of keratoconus. It seems that there are some concurrent alterations of skin and cornea in patients with keratoconus. Objective. We plan to compare skin biophysical characteristics in patients with keratoconus and...

  6. Biophysical methods for the study of microbial surfaces

    Directory of Open Access Journals (Sweden)

    Susana eFrases


    Full Text Available The challenge in studying the surface architecture of different microbial pathogens is to integrate the most current biochemical, spectroscopic, microscopic and processing techniques. Individually these methods have insufficient sensitivity to reveal complex structures, such as branched, large, viscous polymers with a high structure hydration, size and complexity. However, when used in combination biophysical techniques are our primary source of information for understanding polydisperse molecules and complex microbial surfaces.Biophysical methods seek to explain biological function in terms of the molecular structures and properties of specific molecules. The sizes of the molecules found in microbial surfaces vary greatly from small fatty acids and sugars to macromolecules like proteins, polysaccharides and pigments, such as melanin. These molecules, which comprise the building blocks of living organisms, assemble into cells, tissues, and whole organisms by forming complex individual structures with dimensions from 10 to 10,000 nm and larger. Biophysics is directed to determining the structure of specific biological molecules and of the larger structures into which they assemble. Some of this effort involves developing new methods, adapting old methods and building new instruments for viewing these structures. The description of biophysical properties in an experimental model where, properties such as flexibility, hydrodynamic characteristics and size can be precisely determined is of great relevance to study the affinity of the surfaces with biologically active and inert substrates and the interaction with host molecules. Furthermore, this knowledge could establish the abilities of different molecules and their structures to differentially activate cellular responses.Recent studies in the fungal pathogen Cryptococcus neoformans have demonstrated that the physical properties of its unique polysaccharide capsule correlate with the biological

  7. Historical contingency and its biophysical basis in glucocorticoid receptor evolution. (United States)

    Harms, Michael J; Thornton, Joseph W


    Understanding how chance historical events shape evolutionary processes is a central goal of evolutionary biology. Direct insights into the extent and causes of evolutionary contingency have been limited to experimental systems, because it is difficult to know what happened in the deep past and to characterize other paths that evolution could have followed. Here we combine ancestral protein reconstruction, directed evolution and biophysical analysis to explore alternative 'might-have-been' trajectories during the ancient evolution of a novel protein function. We previously found that the evolution of cortisol specificity in the ancestral glucocorticoid receptor (GR) was contingent on permissive substitutions, which had no apparent effect on receptor function but were necessary for GR to tolerate the large-effect mutations that caused the shift in specificity. Here we show that alternative mutations that could have permitted the historical function-switching substitutions are extremely rare in the ensemble of genotypes accessible to the ancestral GR. In a library of thousands of variants of the ancestral protein, we recovered historical permissive substitutions but no alternative permissive genotypes. Using biophysical analysis, we found that permissive mutations must satisfy at least three physical requirements--they must stabilize specific local elements of the protein structure, maintain the correct energetic balance between functional conformations, and be compatible with the ancestral and derived structures--thus revealing why permissive mutations are rare. These findings demonstrate that GR evolution depended strongly on improbable, non-deterministic events, and this contingency arose from intrinsic biophysical properties of the protein.

  8. Effect of glucosylceramide on the biophysical properties of fluid membranes. (United States)

    Varela, Ana R P; Gonçalves da Silva, Amélia M P S; Fedorov, Alexander; Futerman, Anthony H; Prieto, Manuel; Silva, Liana C


    Glucosylceramide (GlcCer), a relevant intermediate in the pathways of glycosphingolipid metabolism, plays key roles in the regulation of cell physiology. The molecular mechanisms by which GlcCer regulates cellular processes are unknown, but might involve changes in membrane biophysical properties and formation of lipid domains. In the present study, fluorescence spectroscopy, confocal microscopy and surface pressure-area (π-A) measurements were used to characterize the effect of GlcCer on the biophysical properties of model membranes. We show that C16:0-GlcCer has a high tendency to segregate into highly ordered gel domains and to increase the order of the fluid phase. Monolayer studies support the aggregation propensity of C16:0-GlcCer. π-A isotherms of single C16:0-GlcCer indicate that bilayer domains, or crystal-like structures, coexist within monolayer domains at the air-water interface. Mixtures with POPC exhibit partial miscibility with expansion of the mean molecular areas relative to the additive behavior of the components. Moreover, C16:0-GlcCer promotes morphological alterations in lipid vesicles leading to formation of flexible tubule-like structures that protrude from the fluid region of the bilayer. These results support the hypothesis that alterations in membrane biophysical properties induced by GlcCer might be involved in its mechanism of action.

  9. Biophysical parameters in a wheat producer region in southern Brazil (United States)

    Leivas, Janice F.; de C. Teixeira, Antonio Heriberto; Andrade, Ricardo G.; de C. Victoria, Daniel; Bolfe, Edson L.; Cruz, Caroline R.


    Wheat (Triticum aestivum) is the second most produced cereal in the world, and has major importance in the global agricultural economy. Brazil is a large producer of wheat, especially the Rio Grande do Sul state, located in the south of the country. The purpose of this study was to analyze the estimation of biophysical parameters - evapotranspiration (ET), biomass (BIO) and water productivity (WP) - from satellite images of the municipalities with large areas planted with wheat in Rio Grande do Sul (RS). The evapotranspiration rate was obtained using the SAFER Model (Simple Algorithm for Retrieving Evapotranspiration) on MODIS (Moderate Resolution Imaging Spectroradiometer) images taken in the agricultural year 2012. In order to obtain biomass and water productivity rates we applied the Monteith model and the ratio between BIO and ET. In the beginning of the cycle (the planting period) we observed low values for ET, BIO and WP. During the development period, we observed an increase in the values of the parameters and decline at the end of the cycle, for the period of the wheat harvest. The SAFER model proved effective for estimating the biophysical parameters evapotranspiration, biomass production and water productivity in areas planted with wheat in Brazilian Southern. The methodology can be used for monitoring the crops' water conditions and biomass using satellite images, assisting in estimates of productivity and crop yield. The results may assist the understanding of biophysical properties of important agro-ecosystems, like wheat crop, and are important to improve the rational use of water resources.

  10. Screening of the aerodynamic and biophysical properties of barley malt (United States)

    Ghodsvali, Alireza; Farzaneh, Vahid; Bakhshabadi, Hamid; Zare, Zahra; Karami, Zahra; Mokhtarian, Mohsen; Carvalho, Isabel. S.


    An understanding of the aerodynamic and biophysical properties of barley malt is necessary for the appropriate design of equipment for the handling, shipping, dehydration, grading, sorting and warehousing of this strategic crop. Malting is a complex biotechnological process that includes steeping; germination and finally, the dehydration of cereal grains under controlled temperature and humidity conditions. In this investigation, the biophysical properties of barley malt were predicted using two models of artificial neural networks as well as response surface methodology. Stepping time and germination time were selected as the independent variables and 1 000 kernel weight, kernel density and terminal velocity were selected as the dependent variables (responses). The obtained outcomes showed that the artificial neural network model, with a logarithmic sigmoid activation function, presents more precise results than the response surface model in the prediction of the aerodynamic and biophysical properties of produced barley malt. This model presented the best result with 8 nodes in the hidden layer and significant correlation coefficient values of 0.783, 0.767 and 0.991 were obtained for responses one thousand kernel weight, kernel density, and terminal velocity, respectively. The outcomes indicated that this novel technique could be successfully applied in quantitative and qualitative monitoring within the malting process.

  11. Modelling benthic biophysical drivers of ecosystem structure and biogeochemical response (United States)

    Stephens, Nicholas; Bruggeman, Jorn; Lessin, Gennadi; Allen, Icarus


    The fate of carbon deposited at the sea floor is ultimately decided by biophysical drivers that control the efficiency of remineralisation and timescale of carbon burial in sediments. Specifically, these drivers include bioturbation through ingestion and movement, burrow-flushing and sediment reworking, which enhance vertical particulate transport and solute diffusion. Unfortunately, these processes are rarely satisfactorily resolved in models. To address this, a benthic model that explicitly describes the vertical position of biology (e.g., habitats) and biogeochemical processes is presented that includes biological functionality and biogeochemical response capturing changes in ecosystem structure, benthic-pelagic fluxes and biodiversity on inter-annual timescales. This is demonstrated by the model's ability to reproduce temporal variability in benthic infauna, vertical pore water nutrients and pelagic-benthic solute fluxes compared to in-situ data. A key advance is the replacement of bulk parameterisation of bioturbation by explicit description of the bio-physical processes responsible. This permits direct comparison with observations and determination of key parameters in experiments. Crucially, the model resolves the two-way interaction between sediment biogeochemistry and ecology, allowing exploration of the benthic response to changing environmental conditions, the importance of infaunal functional traits in shaping benthic ecological structure and the feedback the resulting bio-physical processes exert on pore water nutrient profiles. The model is actively being used to understand shelf sea carbon cycling, the response of the benthos to climatic change, food provision and other societal benefits.

  12. PREFACE: Nanoelectronics, sensors and single molecule biophysics Nanoelectronics, sensors and single molecule biophysics (United States)

    Tao, Nongjian


    This special section of Journal of Physics: Condensed Matter (JPCM) is dedicated to Professor Stuart M Lindsay on the occasion of his 60th birthday and in recognition of his outstanding contributions to multiple research areas, including light scattering spectroscopy, scanning probe microscopy, biophysics, solid-liquid interfaces and molecular and nanoelectronics. It contains a collection of 14 papers in some of these areas, including a feature article by Lindsay. Each paper was subject to the normal rigorous review process of JPCM. In Lindsay's paper, he discusses the next generations of hybrid chemical-CMOS devices for low cost and personalized medical diagnosis. The discussion leads to several papers on nanotechnology for biomedical applications. Kawaguchi et al report on the detection of single pollen allergen particles using electrode embedded microchannels. Stern et al describe a structural study of three-dimensional DNA-nanoparticle assemblies. Hihath et al measure the conductance of methylated DNA, and discuss the possibility of electrical detection DNA methylation. Portillo et al study the electrostatic effects on the aggregation of prion proteins and peptides with atomic force microscopy. In an effort to understand the interactions between nanostructures and cells, Lamprecht et al report on the mapping of the intracellular distribution of carbon nanotubes with a confocal Raman imaging technique, and Wang et al focus on the intracellular delivery of gold nanoparticles using fluorescence microscopy. Park and Kristic provide theoretical analysis of micro- and nano-traps and their biological applications. This section also features several papers on the fundamentals of electron transport in single atomic wires and molecular junctions. The papers by Xu et al and by Wandlowksi et al describe new methods to measure conductance and forces in single molecule junctions and metallic atomic wires. Scullion et al report on the conductance of molecules with similar

  13. Biophysical approach to chronic kidney disease management in older patients

    Directory of Open Access Journals (Sweden)

    Alberto Foletti


    Full Text Available Chronic kidney disease (CKD and its clinical progression are a critical issue in an aging population. Therefore, strategies aimed at preventing and managing the decline of renal function are warranted. Recent evidence has provided encouraging results for the improvement of renal function achieved through an integrated biophysical approach, but prospective studies on the clinical efficacy of this strategy are still lacking. This was an open-label prospective pilot study to investigate the effect of electromagnetic information transfer through the aqueous system on kidney function of older patients affected by stage 1 or 2 CKD. Patients received biophysical therapy every 3 months over a 1-year period. Estimated glomerular filtration rate (eGFR values were calculated using the CKD–Epidemiology Collaboration formula, and were recorded at baseline and at the end of treatment. Overall, 58 patients (mean age 74.8 ± 3.7 years were included in the study. At baseline, mean eGFR was 64.6 ± 15.5 mL/min, and it significantly increased to 69.9 ± 15.8 mL/min after 1 year (+5.2 ± 10 mL/min, p<0.0002. The same trend was observed among men (+5.7 ± 10.2 mL/min, p<0.0064 and women (+4.7 ± 9.9 mL/min, p<0.014. When results were analyzed by sex, no difference was found between the 2 groups. Although further and larger prospective studies are needed, our findings suggest that an integrated biophysical approach may be feasible in the management of older patients with early-stage CKD, to reduce and prevent the decline of renal function due to aging or comorbidities.

  14. Constraining canopy biophysical simulations with MODIS reflectance data (United States)

    Drewry, D. T.; Duveiller, G.


    Modern vegetation models incorporate ecophysiological details that allow for accurate estimates of carbon dioxide uptake, water use and energy exchange, but require knowledge of dynamic structural and biochemical traits. Variations in these traits are controlled by genetic factors as well as growth stage and nutrient and moisture availability, making them difficult to predict and prone to significant error. Here we explore the use of MODIS optical reflectance data for constraining key canopy- and leaf-level traits required by forward biophysical models. A multi-objective optimization algorithm is used to invert the PROSAIL canopy radiation transfer model, which accounts for the effects of leaf-level optical properties, foliage distribution and orientation on canopy reflectance across the optical range. Inversions are conducted for several growing seasons for both soybean and maize at several sites in the Central US agro-ecosystem. These inversions provide estimates of seasonal variations, and associated uncertainty, of variables such as leaf area index (LAI) that are then used as inputs into the MLCan biophysical model to conduct forward simulations. MLCan characterizes the ecophysiological functioning of a plant canopy at a half-hourly timestep, and has been rigorously validated for both C3 and C4 crops against observations of canopy CO2 uptake, evapotranspiration and sensible heat exchange across a wide range of meteorological conditions. The inversion-derived canopy properties are used to examine the ability of MODIS data to characterize seasonal variations in canopy properties in the context of a detailed forward canopy biophysical model, and the uncertainty induced in forward model estimates as a function of the uncertainty in the inverted parameters. Special care is made to ensure that the satellite observations match adequately, in both time and space, with the coupled model simulations. To do so, daily MODIS observations are used and a validated model of

  15. Biophysical characteristics reveal neural stem cell differentiation potential.

    Directory of Open Access Journals (Sweden)

    Fatima H Labeed

    Full Text Available BACKGROUND: Distinguishing human neural stem/progenitor cell (huNSPC populations that will predominantly generate neurons from those that produce glia is currently hampered by a lack of sufficient cell type-specific surface markers predictive of fate potential. This limits investigation of lineage-biased progenitors and their potential use as therapeutic agents. A live-cell biophysical and label-free measure of fate potential would solve this problem by obviating the need for specific cell surface markers. METHODOLOGY/PRINCIPAL FINDINGS: We used dielectrophoresis (DEP to analyze the biophysical, specifically electrophysiological, properties of cortical human and mouse NSPCs that vary in differentiation potential. Our data demonstrate that the electrophysiological property membrane capacitance inversely correlates with the neurogenic potential of NSPCs. Furthermore, as huNSPCs are continually passaged they decrease neuron generation and increase membrane capacitance, confirming that this parameter dynamically predicts and negatively correlates with neurogenic potential. In contrast, differences in membrane conductance between NSPCs do not consistently correlate with the ability of the cells to generate neurons. DEP crossover frequency, which is a quantitative measure of cell behavior in DEP, directly correlates with neuron generation of NSPCs, indicating a potential mechanism to separate stem cells biased to particular differentiated cell fates. CONCLUSIONS/SIGNIFICANCE: We show here that whole cell membrane capacitance, but not membrane conductance, reflects and predicts the neurogenic potential of human and mouse NSPCs. Stem cell biophysical characteristics therefore provide a completely novel and quantitative measure of stem cell fate potential and a label-free means to identify neuron- or glial-biased progenitors.

  16. Plant Sucrose Transporters from a Biophysical Point of View

    Institute of Scientific and Technical Information of China (English)

    Dietmar Geiger


    T The majority of higher plants use sucrose as their main mobile carbohydrate. Proton-driven sucrose transporters play a crucial role in cell-to-cell and long-distance distribution of sucrose throughout the plant. A very negative plant membrane potential and the ability of sucrose transporters to accumulate sucrose concentrations of more than 1 M indicate that plants evolved transporters with unique structural and functional features. The knowledge about the transport mechanism and structural/functional domains of these nano-machines is, however, still fragmentary. In this review,the current knowledge about the biophysical properties of plant sucrose transporters is summarized and discussed.

  17. From biophysics to evolutionary genetics: statistical aspects of gene regulation

    Directory of Open Access Journals (Sweden)

    Lässig Michael


    Full Text Available Abstract This is an introductory review on how genes interact to produce biological functions. Transcriptional interactions involve the binding of proteins to regulatory DNA. Specific binding sites can be identified by genomic analysis, and these undergo a stochastic evolution process governed by selection, mutations, and genetic drift. We focus on the links between the biophysical function and the evolution of regulatory elements. In particular, we infer fitness landscapes of binding sites from genomic data, leading to a quantitative evolutionary picture of regulation.

  18. "Bicellar" lipid mixtures as used in biochemical and biophysical studies. (United States)

    Katsaras, John; Harroun, Thad A; Pencer, Jeremy; Nieh, Mu-Ping


    Over the past decade "bicellar" lipid mixtures composed of the long-chain dimyristoyl phosphatidylcholine (DMPC) and the short-chain dihexanoyl PC (DHPC) molecules have emerged as a powerful medium for studying membrane associated, biologically relevant macromolecules and assemblies. Depending on temperature, lipid concentration and composition these lipid mixtures can assume a variety of morphologies, some of them alignable in the presence of a magnetic field. This article will examine the biophysical studies that have elucidated the various morphologies assumed by these lipid mixtures, and their use in the biochemical studies of biomolecules.

  19. ``Bicellar'' Lipid Mixtures as used in Biochemical and Biophysical Studies (United States)

    Katsaras, John; Harroun, Thad A.; Pencer, Jeremy; Nieh, Mu-Ping


    Over the past decade “bicellar” lipid mixtures composed of the long-chain dimyristoyl phosphatidylcholine (DMPC) and the short-chain dihexanoyl PC (DHPC) molecules have emerged as a powerful medium for studying membrane associated, biologically relevant macromolecules and assemblies. Depending on temperature, lipid concentration and composition these lipid mixtures can assume a variety of morphologies, some of them alignable in the presence of a magnetic field. This article will examine the biophysical studies that have elucidated the various morphologies assumed by these lipid mixtures, and their use in the biochemical studies of biomolecules.

  20. Spectromicroscopy in Biophysics with MEPHISTO: Instrumentation Aspects and Technical Improvements (United States)

    de Stasio, Gelsomina; Capozi, Mario; Gilbert, Benjamin; Perfetti, Paolo; Droubay, Tim; Pauli, Brian; Tonner, Giorgio; Margaritondo, Georgio


    The synchrotron imaging photoelectron spectromicroscope MEPHISTO recently reached the world record resolution of 50 nm. We will present the design and performance of this novel instrument, which is mainly dedicated to biophysics experiments in neurobiology, but is also used in materials science research. We will also discuss the possibility of using the MEPHISTO in the transmission mode, as opposed to the photoemission mode, and the unique possibility of studying live cells. Elemental analysis of living biological systems in the microscopic domain is not possible with any other instrument to our knowledge.

  1. Large-scale biophysical evaluation of protein PEGylation effects

    DEFF Research Database (Denmark)

    Vernet, Erik; Popa, Gina; Pozdnyakova, Irina


    PEGylation is the most widely used method to chemically modify protein biopharmaceuticals, but surprisingly limited public data is available on the biophysical effects of protein PEGylation. Here we report the first large-scale study, with site-specific mono-PEGylation of 15 different proteins...... and characterization of 61 entities in total using a common set of analytical methods. Predictions of molecular size were typically accurate in comparison with actual size determined by size-exclusion chromatography (SEC) or dynamic light scattering (DLS). In contrast, there was no universal trend regarding the effect...

  2. Mass spectrometry in structural biology and biophysics architecture, dynamics, and interaction of biomolecules

    CERN Document Server

    Kaltashov, Igor A; Desiderio, Dominic M; Nibbering, Nico M


    The definitive guide to mass spectrometry techniques in biology and biophysics The use of mass spectrometry (MS) to study the architecture and dynamics of proteins is increasingly common within the biophysical community, and Mass Spectrometry in Structural Biology and Biophysics: Architecture, Dynamics, and Interaction of Biomolecules, Second Edition provides readers with detailed, systematic coverage of the current state of the art. Offering an unrivalled overview of modern MS-based armamentarium that can be used to solve the most challenging problems in biophysics, structural biol

  3. Biophysical aspects of human thermoregulation during heat stress. (United States)

    Cramer, Matthew N; Jay, Ollie


    Humans maintain a relatively constant core temperature through the dynamic balance between endogenous heat production and heat dissipation to the surrounding environment. In response to metabolic or environmental disturbances to heat balance, the autonomic nervous system initiates cutaneous vasodilation and eccrine sweating to facilitate higher rates of dry (primarily convection and radiation) and evaporative transfer from the body surface; however, absolute heat losses are ultimately governed by the properties of the skin and the environment. Over the duration of a heat exposure, the cumulative imbalance between heat production and heat dissipation leads to body heat storage, but the consequent change in core temperature, which has implications for health and safety in occupational and athletic settings particularly among certain clinical populations, involves a complex interaction between changes in body heat content and the body's morphological characteristics (mass, surface area, and tissue composition) that collectively determine the body's thermal inertia. The aim of this review is to highlight the biophysical aspects of human core temperature regulation by outlining the principles of human energy exchange and examining the influence of body morphology during exercise and environmental heat stress. An understanding of the biophysical factors influencing core temperature will enable researchers and practitioners to better identify and treat individuals/populations most vulnerable to heat illness and injury during exercise and extreme heat events. Further, appropriate guidelines may be developed to optimize health, safety, and work performance during heat stress.

  4. Complexation of insecticide chlorantraniliprole with human serum albumin: Biophysical aspects

    Energy Technology Data Exchange (ETDEWEB)

    Ding Fei [Department of Chemistry, China Agricultural University, No. 2 Yuanmingyuan Xi Road, Haidian District, Beijing 100193 (China); Liu Wei [College of Economics and Management, China Agricultural University, Beijing 100083 (China); Diao Jianxiong [Department of Chemistry, China Agricultural University, No. 2 Yuanmingyuan Xi Road, Haidian District, Beijing 100193 (China); Yin Bin [Key Laboratory of Pesticide Chemistry and Application Technology, Ministry of Agriculture, Department of Applied Chemistry, China Agricultural University, Beijing 100193 (China); Zhang Li, E-mail: [Key Laboratory of Pesticide Chemistry and Application Technology, Ministry of Agriculture, Department of Applied Chemistry, China Agricultural University, Beijing 100193 (China); Sun Ying, E-mail: [Department of Chemistry, China Agricultural University, No. 2 Yuanmingyuan Xi Road, Haidian District, Beijing 100193 (China)


    Chlorantraniliprole is a novel insecticide belonging to the diamide class of selective ryanodine receptor agonists. A biophysical study on the binding interaction of a novel diamide insecticide, chlorantraniliprole, with staple in vivo transporter, human serum albumin (HSA) has been investigated utilizing a combination of steady-state and time-resolved fluorescence, circular dichroism (CD), and molecular modeling methods. The interaction of chlorantraniliprole with HSA gives rise to fluorescence quenching through static mechanism, this corroborates the fluorescence lifetime outcomes that the ground state complex formation and the predominant forces in the HSA-chlorantraniliprole conjugate are van der Waals forces and hydrogen bonds, as derived from thermodynamic analysis. The definite binding site of chlorantraniliprole in HSA has been identified from the denaturation of protein, competitive ligand binding, and molecular modeling, subdomain IIIA (Sudlow's site II) was designated to possess high-affinity binding site for chlorantraniliprole. Moreover, using synchronous fluorescence, CD, and three-dimensional fluorescence we testified some degree of HSA structure unfolding upon chlorantraniliprole binding. - Highlights: {yields} Our study highlights for the first time how binding dynamics can predominate for the new diamide insecticide, chlorantraniliprole. {yields} Chlorantraniliprole is situated within subdomain IIIA, Sudlow's site II, which is the same as that of indole-benzodiazepine site. {yields} Biophysical and molecular modeling approaches are useful to resolve the ligand interaction with biomacromolecule. {yields} It serves as a protective device in binding and in inactivating potential toxic compounds to which the body is exposed.

  5. Biophysical Modeling of Alpha Rhythms During Halothane-Induced Unconsciousness. (United States)

    Vijayan, Sujith; Ching, ShiNung; Purdon, Patrick L; Brown, Emery N; Kopell, Nancy J


    During the induction of general anesthesia there is a shift in power from the posterior regions of the brain to the frontal cortices; this shift in power is called anteriorization. For many anesthetics, a prominent feature of anteriorization is a shift specifically in the alpha band (8-13 Hz) from posterior to frontal cortices. Here we present a biophysical computational model that describes thalamocortical circuit-level dynamics underlying anteriorization of the alpha rhythm in the case of halothane. Halothane potentiates GABAA and increases potassium leak conductances. According to our model, an increase in potassium leak conductances hyperpolarizes and silences the high-threshold thalamocortical (HTC) cells, a specialized subset of thalamocortical cells that fire at the alpha frequency at relatively depolarized membrane potentials (>-60 mV) and are thought to be the generators of quiet awake occipital alpha. At the same time the potentiation of GABAA imposes an alpha time scale on both the cortical and the thalamic component of the frontal portion of our model. The alpha activity in the frontal component is further strengthened by reciprocal thalamocortical feedback. Thus, we argue that the dual molecular targets of halothane induce the anteriorization of the alpha rhythm by increasing potassium leak conductances, which abolishes occipital alpha, and by potentiating GABAA, which induces frontal alpha. These results provide a computational modeling formulation for studying highly detailed biophysical mechanisms of anesthetic action in silico.

  6. Protein Biophysics Explains Why Highly Abundant Proteins Evolve Slowly

    Directory of Open Access Journals (Sweden)

    Adrian W.R. Serohijos


    Full Text Available The consistent observation across all kingdoms of life that highly abundant proteins evolve slowly demonstrates that cellular abundance is a key determinant of protein evolutionary rate. However, other empirical findings, such as the broad distribution of evolutionary rates, suggest that additional variables determine the rate of protein evolution. Here, we report that under the global selection against the cytotoxic effects of misfolded proteins, folding stability (ΔG, simultaneous with abundance, is a causal variable of evolutionary rate. Using both theoretical analysis and multiscale simulations, we demonstrate that the anticorrelation between the premutation ΔG and the arising mutational effect (ΔΔG, purely biophysical in origin, is a necessary requirement for abundance–evolutionary rate covariation. Additionally, we predict and demonstrate in bacteria that the strength of abundance–evolutionary rate correlation depends on the divergence time separating reference genomes. Altogether, these results highlight the intrinsic role of protein biophysics in the emerging universal patterns of molecular evolution.

  7. Voltage-gated sodium channels: biophysics, pharmacology, and related channelopathies

    Directory of Open Access Journals (Sweden)

    Eleonora eSavio Galimberti


    Full Text Available Voltage-gated sodium channels (VGSC are multi-molecular protein complexes expressed in both excitable and non-excitable cells. They are primarily formed by a pore-forming multi-spanning integral membrane glycoprotein (α-subunit that can be associated with one or more regulatory β-subunits. The latter are single-span integral membrane proteins that modulate the sodium current (INa and can also function as cell-adhesion molecules (CAMs. In-vitro some of the cell-adhesive functions of the β-subunits may play important physiological roles independently of the α-subunits. Other endogenous regulatory proteins named channel partners or channel interacting proteins (ChiPs like caveolin-3 and calmodulin/calmodulin kinase II (CaMKII can also interact and modulate the expression and/or function of VGSC. In addition to their physiological roles in cell excitability and cell adhesion, VGSC are the site of action of toxins (like tetrodotoxin and saxitoxin, and pharmacologic agents (like antiarrhythmic drugs, local anesthetics, antiepileptic drugs, and newly developed analgesics. Mutations in genes that encode α- and/or β-subunits as well as the ChiPs can affect the structure and biophysical properties of VGSC, leading to the development of diseases termed sodium channelopathies. This review will outline the structure, function and biophysical properties of VGSC as well as their pharmacology and associated channelopathies and highlight some of the recent advances in this field

  8. Biophysical basis for noninvasive skin cancer detection using Raman spectroscopy (United States)

    Feng, Xu; Moy, Austin J.; Markey, Mia K.; Fox, Matthew C.; Reichenberg, Jason S.; Tunnell, James W.


    Raman spectroscopy (RS) is proving to be a valuable tool for real time noninvasive skin cancer detection via optical fiber probe. However, current methods utilizing RS for skin cancer diagnosis rely on statistically based algorithms to provide tissue classification and do not elucidate the underlying biophysical changes of skin tissue. Therefore, we aim to use RS to explore skin biochemical and structural characteristics and then correlate the Raman spectrum of skin tissue with its disease state. We have built a custom confocal micro-Raman spectrometer system with an 830nm laser light. The high resolution capability of the system allows us to measure spectroscopic features from individual tissue components in situ. Raman images were collected from human skin samples from Mohs surgical biopsy, which were then compared with confocal laser scanning, two-photon fluorescence and hematoxylin and eosin-stained images to develop a linear model of skin tissue Raman spectra. In this model, macroscopic tissue spectra obtained from RS fiber probe were fit into a linear combination of individual basis spectra of primary skin constituents. The fit coefficient of the model explains the biophysical changes spanning a range of normal and various disease states. The model allows for determining parameters similar to that a pathologist is familiar reading and will be a significant guidance in developing RS diagnostic decision schemes.

  9. Constructing Dual Beam Optical Tweezers for Undergraduate Biophysics Research (United States)

    Daudelin, Brian; West-Coates, Devon; Del'Etoile, Jon; Grotzke, Eric; Paramanathan, Thayaparan

    Optical tweezing, or trapping, is a modern physics technique which allows us to use the radiation pressure from laser beams to trap micron sized particles. Optical tweezers are commonly used in graduate level biophysics research but seldom used at the undergraduate level. Our goal is to construct a dual beam optical tweezers for future undergraduate biophysical research. Dual beam optical tweezers use two counter propagating laser beams to provide a stronger trap. In this study we discuss how the assembly of the dual beam optical tweezers is done through three main phases. The first phase was to construct a custom compressed air system to isolate the optical table from the vibrations from its surroundings so that we can measure pico-newton scale forces that are observed in biological systems. In addition, the biomaterial flow system was designed with a flow cell to trap biomolecules by combining several undergraduate semester projects. During the second phase we set up the optics to image and display the inside of the flow cell. Currently we are in the process of aligning the laser to create an effective trap and developing the software to control the data collection. This optical tweezers set up will enable us to study potential cancer drug interactions with DNA at the single molecule level and will be a powerful tool in promoting interdisciplinary research at the undergraduate level.

  10. Biophysical influence of airborne carbon nanomaterials on natural pulmonary surfactant. (United States)

    Valle, Russell P; Wu, Tony; Zuo, Yi Y


    Inhalation of nanoparticles (NP), including lightweight airborne carbonaceous nanomaterials (CNM), poses a direct and systemic health threat to those who handle them. Inhaled NP penetrate deep pulmonary structures in which they first interact with the pulmonary surfactant (PS) lining at the alveolar air-water interface. In spite of many research efforts, there is a gap of knowledge between in vitro biophysical study and in vivo inhalation toxicology since all existing biophysical models handle NP-PS interactions in the liquid phase. This technical limitation, inherent in current in vitro methodologies, makes it impossible to simulate how airborne NP deposit at the PS film and interact with it. Existing in vitro NP-PS studies using liquid-suspended particles have been shown to artificially inflate the no-observed adverse effect level of NP exposure when compared to in vivo inhalation studies and international occupational exposure limits (OELs). Here, we developed an in vitro methodology called the constrained drop surfactometer (CDS) to quantitatively study PS inhibition by airborne CNM. We show that airborne multiwalled carbon nanotubes and graphene nanoplatelets induce a concentration-dependent PS inhibition under physiologically relevant conditions. The CNM aerosol concentrations controlled in the CDS are comparable to those defined in international OELs. Development of the CDS has the potential to advance our understanding of how submicron airborne nanomaterials affect the PS lining of the lung.

  11. Climate Change Effects on Agriculture: Economic Responses to Biophysical Shocks (United States)

    Nelson, Gerald C.; Valin, Hugo; Sands, Ronald D.; Havlik, Petr; Ahammad, Helal; Deryng, Delphine; Elliott, Joshua; Fujimori, Shinichiro; Hasegawa, Tomoko; Heyhoe, Edwina


    Agricultural production is sensitive to weather and thus directly affected by climate change. Plausible estimates of these climate change impacts require combined use of climate, crop, and economic models. Results from previous studies vary substantially due to differences in models, scenarios, and data. This paper is part of a collective effort to systematically integrate these three types of models. We focus on the economic component of the assessment, investigating how nine global economic models of agriculture represent endogenous responses to seven standardized climate change scenarios produced by two climate and five crop models. These responses include adjustments in yields, area, consumption, and international trade. We apply biophysical shocks derived from the Intergovernmental Panel on Climate Change's representative concentration pathway with end-of-century radiative forcing of 8.5 W/m(sup 2). The mean biophysical yield effect with no incremental CO2 fertilization is a 17% reduction globally by 2050 relative to a scenario with unchanging climate. Endogenous economic responses reduce yield loss to 11%, increase area of major crops by 11%, and reduce consumption by 3%. Agricultural production, cropland area, trade, and prices show the greatest degree of variability in response to climate change, and consumption the lowest. The sources of these differences include model structure and specification; in particular, model assumptions about ease of land use conversion, intensification, and trade. This study identifies where models disagree on the relative responses to climate shocks and highlights research activities needed to improve the representation of agricultural adaptation responses to climate change.

  12. Social and Biophysical Predictors of Public Perceptions of Extreme Fires (United States)

    Hall, T. E.; Kooistra, C. M.; Paveglio, T.; Gress, S.; Smith, A. M.


    To date, what constitutes an 'extreme' fire has been approached separately by biophysical and social scientists. Research on the biophysical characteristics of fires has identified potential dimensions of extremity, including fire size and vegetation mortality. On the social side, factors such as the degree of immediate impact to one's life and property or the extent of social disruption in the community contribute to a perception of extremity. However, some biophysical characteristics may also contribute to perceptions of extremity, including number of simultaneous ignitions, rapidity of fire spread, atypical fire behavior, and intensity of smoke. Perceptions of these impacts can vary within and across communities, but no studies to date have investigated such perceptions in a comprehensive way. In this study, we address the question, to what extent is the magnitude of impact of fires on WUI residents' well-being explained by measurable biophysical characteristics of the fire and subjective evaluations of the personal and community-level impacts of the fire? We bring together diverse strands of psychological theory, including landscape perception, mental models, risk perception, and community studies. The majority of social science research on fires has been in the form of qualitative case studies, and our study is methodologically unique by using a nested design (hierarchical modeling) to enable generalizable conclusions across a wide range of fires and human communities. We identified fires that burned in 2011 or 2012 in the northern Rocky Mountain region that were at least 1,000 acres and that intersected (within 15 km) urban clusters or identified Census places. For fires where an adequately large number of households was located in proximity to the fire, we drew random samples of approximately 150 individuals for each fire. We used a hybrid internet (Qualtrics) and mail survey, following the Dillman method, to measure individual perceptions. We developed two

  13. Biophysics and Thermodynamics: The Scientific Building Blocks of Bio-inspired Drug Delivery Nano Systems. (United States)

    Demetzos, Costas


    Biophysics and thermodynamics are considered as the scientific milestones for investigating the properties of materials. The relationship between the changes of temperature with the biophysical variables of biomaterials is important in the process of the development of drug delivery systems. Biophysics is a challenge sector of physics and should be used complementary with the biochemistry in order to discover new and promising technological platforms (i.e., drug delivery systems) and to disclose the 'silence functionality' of bio-inspired biological and artificial membranes. Thermal analysis and biophysical approaches in pharmaceuticals present reliable and versatile tools for their characterization and for the successful development of pharmaceutical products. The metastable phases of self-assembled nanostructures such as liposomes should be taken into consideration because they represent the thermal events can affect the functionality of advanced drug delivery nano systems. In conclusion, biophysics and thermodynamics are characterized as the building blocks for design and development of bio-inspired drug delivery systems.

  14. Phenomenological vs. biophysical models of thermal stress in aquatic eggs. (United States)

    Martin, Benjamin T; Pike, Andrew; John, Sara N; Hamda, Natnael; Roberts, Jason; Lindley, Steven T; Danner, Eric M


    Predicting species responses to climate change is a central challenge in ecology. These predictions are often based on lab-derived phenomenological relationships between temperature and fitness metrics. We tested one of these relationships using the embryonic stage of a Chinook salmon population. We parameterised the model with laboratory data, applied it to predict survival in the field, and found that it significantly underestimated field-derived estimates of thermal mortality. We used a biophysical model based on mass transfer theory to show that the discrepancy was due to the differences in water flow velocities between the lab and the field. This mechanistic approach provides testable predictions for how the thermal tolerance of embryos depends on egg size and flow velocity of the surrounding water. We found support for these predictions across more than 180 fish species, suggesting that flow and temperature mediated oxygen limitation is a general mechanism underlying the thermal tolerance of embryos.

  15. Biophysics and Structure to Counter Threats and Challenges

    CERN Document Server

    Margaris, Manolia


    This ASI brought together a diverse group of experts who span virology, biology, biophysics, chemistry, physics and engineering.  Prominent lecturers representing world renowned scientists from nine (9) different countries, and students from around the world representing eighteen (18) countries, participated in the ASI organized by Professors Joseph Puglisi (Stanford University, USA) and Alexander Arseniev (Moscow, RU).   The central hypothesis underlying this ASI was that interdisciplinary research, merging principles of physics, chemistry and biology, can drive new discovery in detecting and fighting chemical and bioterrorism agents, lead to cleaner environments and improved energy sources, and help propel development in NATO partner countries.  At the end of the ASI students had an appreciation of how to apply each technique to their own particular research problem and to demonstrate that multifaceted approaches and new technologies are needed to solve the biological challenges of our time.  The course...

  16. Irrigation Requirement Estimation Using Vegetation Indices and Inverse Biophysical Modeling (United States)

    Bounoua, Lahouari; Imhoff, Marc L.; Franks, Shannon


    We explore an inverse biophysical modeling process forced by satellite and climatological data to quantify irrigation requirements in semi-arid agricultural areas. We constrain the carbon and water cycles modeled under both equilibrium, balance between vegetation and climate, and non-equilibrium, water added through irrigation. We postulate that the degree to which irrigated dry lands vary from equilibrium climate conditions is related to the amount of irrigation. The amount of water required over and above precipitation is considered as an irrigation requirement. For July, results show that spray irrigation resulted in an additional amount of water of 1.3 mm per occurrence with a frequency of 24.6 hours. In contrast, the drip irrigation required only 0.6 mm every 45.6 hours or 46% of that simulated by the spray irrigation. The modeled estimates account for 87% of the total reported irrigation water use, when soil salinity is not important and 66% in saline lands.

  17. Biophysics of filament length regulation by molecular motors

    CERN Document Server

    Kuan, Hui-Shun


    Regulating physical size is an essential problem that biological organisms must solve from the subcellular to the organismal scales, but it is not well understood what physical principles and mechanisms organisms use to sense and regulate their size. Any biophysical size-regulation scheme operates in a noisy environment and must be robust to other cellular dynamics and fluctuations. This work develops theory of filament length regulation inspired by recent experiments on kinesin-8 motor proteins, which move with directional bias on microtubule filaments and alter microtubule dynamics. Purified kinesin-8 motors can depolymerize chemically-stabilized microtubules. In the length-dependent depolymerization model, the rate of depolymerization tends to increase with filament length, because long filaments accumulate more motors at their tips and therefore shorten more quickly. When balanced with a constant filament growth rate, this mechanism can lead to a fixed polymer length. However, the mechanism by which kines...

  18. Perspective: Quantum mechanical methods in biochemistry and biophysics. (United States)

    Cui, Qiang


    In this perspective article, I discuss several research topics relevant to quantum mechanical (QM) methods in biophysical and biochemical applications. Due to the immense complexity of biological problems, the key is to develop methods that are able to strike the proper balance of computational efficiency and accuracy for the problem of interest. Therefore, in addition to the development of novel ab initio and density functional theory based QM methods for the study of reactive events that involve complex motifs such as transition metal clusters in metalloenzymes, it is equally important to develop inexpensive QM methods and advanced classical or quantal force fields to describe different physicochemical properties of biomolecules and their behaviors in complex environments. Maintaining a solid connection of these more approximate methods with rigorous QM methods is essential to their transferability and robustness. Comparison to diverse experimental observables helps validate computational models and mechanistic hypotheses as well as driving further development of computational methodologies.

  19. Perspective: Quantum mechanical methods in biochemistry and biophysics (United States)

    Cui, Qiang


    In this perspective article, I discuss several research topics relevant to quantum mechanical (QM) methods in biophysical and biochemical applications. Due to the immense complexity of biological problems, the key is to develop methods that are able to strike the proper balance of computational efficiency and accuracy for the problem of interest. Therefore, in addition to the development of novel ab initio and density functional theory based QM methods for the study of reactive events that involve complex motifs such as transition metal clusters in metalloenzymes, it is equally important to develop inexpensive QM methods and advanced classical or quantal force fields to describe different physicochemical properties of biomolecules and their behaviors in complex environments. Maintaining a solid connection of these more approximate methods with rigorous QM methods is essential to their transferability and robustness. Comparison to diverse experimental observables helps validate computational models and mechanistic hypotheses as well as driving further development of computational methodologies.

  20. Control of Stochastic and Induced Switching in Biophysical Networks (United States)

    Wells, Daniel K.; Kath, William L.; Motter, Adilson E.


    Noise caused by fluctuations at the molecular level is a fundamental part of intracellular processes. While the response of biological systems to noise has been studied extensively, there has been limited understanding of how to exploit it to induce a desired cell state. Here we present a scalable, quantitative method based on the Freidlin-Wentzell action to predict and control noise-induced switching between different states in genetic networks that, conveniently, can also control transitions between stable states in the absence of noise. We apply this methodology to models of cell differentiation and show how predicted manipulations of tunable factors can induce lineage changes, and further utilize it to identify new candidate strategies for cancer therapy in a cell death pathway model. This framework offers a systems approach to identifying the key factors for rationally manipulating biophysical dynamics, and should also find use in controlling other classes of noisy complex networks. PMID:26451275

  1. 19th International School of Biophysics "Ettore Majorana"

    CERN Document Server

    Blank, M; Bioelectrochemistry III : Charge Separation across Biomembranes


    This book contains aseries of review papers related to the lectures given at the Third Course on Bioelectrochemistry held at Erice in November 1988, in the framework of the International School of Biophysics. The topics covered by this course, "Charge Separation Across Biomembranes, " deal with the electrochemical aspects of some basic phenomena in biological systems, such as transport of ions, ATP synthesis, formation and maintenance of ionic and protonic gradients. In the first part of the course some preliminary lectures introduce the students to the most basic phenomena and technical aspects of membrane bioelectrochemistry. The remaining part of the course is devoted to the description of a selected group of membrane-enzyme systems, capable of promoting, or exploiting, the processes of separation of electrically charged entities (electrons or ions) across the membrane barrier. These systems are systematically discussed both from a structural and functional point of view. The effort of the many dis...

  2. Control of Stochastic and Induced Switching in Biophysical Networks (United States)

    Wells, Daniel K.; Kath, William L.; Motter, Adilson E.


    Noise caused by fluctuations at the molecular level is a fundamental part of intracellular processes. While the response of biological systems to noise has been studied extensively, there has been limited understanding of how to exploit it to induce a desired cell state. Here we present a scalable, quantitative method based on the Freidlin-Wentzell action to predict and control noise-induced switching between different states in genetic networks that, conveniently, can also control transitions between stable states in the absence of noise. We apply this methodology to models of cell differentiation and show how predicted manipulations of tunable factors can induce lineage changes, and further utilize it to identify new candidate strategies for cancer therapy in a cell death pathway model. This framework offers a systems approach to identifying the key factors for rationally manipulating biophysical dynamics, and should also find use in controlling other classes of noisy complex networks.

  3. Biophysical Evaluation of Food Decontamination Effects on Tissue and Bacteria

    DEFF Research Database (Denmark)

    Andersen, Ann Zahle; Duelund, Lars; Brewer, Jonathan R.


    Traditionally, the effects and efficiency of food surface decontamination processes, such as chlorine washing, radiation, or heating, have been evaluated by sensoric analysis and colony-forming unit (CFU) counts of surface swabs or carcass rinses. These methods suffice when determining probable...... consumer responses or meeting legislative contamination limits. However, in the often very costly, optimization process of a new method, more quantitative and unbiased results are invaluable. In this study, we employed a biophysical approach for the investigation of qualitative and quantitative changes...... in both food surface and bacteria upon surface decontamination by SonoSteam®. SonoSteam® is a recently developed method of food surface decontamination, which employs steam and ultrasound for effective heat transfer and short treatment times, resulting in significant reduction in surface bacteria. We...

  4. Optimization of Curvilinear Tracing Applied to Solar Physics and Biophysics

    Directory of Open Access Journals (Sweden)

    Markus J. Aschwanden


    Full Text Available We developed an automated pattern recognition code that is particularly well suited to extract one-dimensional curvilinear features from two-dimensional digital images. A former version of this Oriented Coronal Curved Loop Tracing (OCCULT code was applied to spacecraft images of magnetic loops in the solar corona, recorded with the NASA spacecraft, Transition Region And Coronal Explorer (TRACE, in extreme ultra-violet wavelengths. Here, we apply an advanced version of this code (OCCULT-2, also, to similar images from the Solar Dynamics Observatory (SDO, to chromospheric H-α images obtained with the Swedish Solar Telescope (SST and to microscopy images of microtubule filaments in live cells in biophysics. We provide a full analytical description of the code, optimize the control parameters and compare the automated tracing with visual/manual methods. The traced structures differ by up to 16 orders of magnitude in size, which demonstrates the universality of the tracing algorithm.

  5. Biophysical and structural considerations for protein sequence evolution

    Directory of Open Access Journals (Sweden)

    Grahnen Johan A


    Full Text Available Abstract Background Protein sequence evolution is constrained by the biophysics of folding and function, causing interdependence between interacting sites in the sequence. However, current site-independent models of sequence evolutions do not take this into account. Recent attempts to integrate the influence of structure and biophysics into phylogenetic models via statistical/informational approaches have not resulted in expected improvements in model performance. This suggests that further innovations are needed for progress in this field. Results Here we develop a coarse-grained physics-based model of protein folding and binding function, and compare it to a popular informational model. We find that both models violate the assumption of the native sequence being close to a thermodynamic optimum, causing directional selection away from the native state. Sampling and simulation show that the physics-based model is more specific for fold-defining interactions that vary less among residue type. The informational model diffuses further in sequence space with fewer barriers and tends to provide less support for an invariant sites model, although amino acid substitutions are generally conservative. Both approaches produce sequences with natural features like dN/dS Conclusions Simple coarse-grained models of protein folding can describe some natural features of evolving proteins but are currently not accurate enough to use in evolutionary inference. This is partly due to improper packing of the hydrophobic core. We suggest possible improvements on the representation of structure, folding energy, and binding function, as regards both native and non-native conformations, and describe a large number of possible applications for such a model.

  6. A biochemical/biophysical 3D FE intervertebral disc model. (United States)

    Schroeder, Y; Huyghe, J M; van Donkelaar, C C; Ito, K


    Present research focuses on different strategies to preserve the degenerated disc. To assure long-term success of novel approaches, favorable mechanical conditions in the disc tissue are essential. To evaluate these, a model is required that can determine internal mechanical conditions which cannot be directly measured as a function of assessable biophysical characteristics. Therefore, the objective is to evaluate if constitutive and material laws acquired on isolated samples of nucleus and annulus tissue can be used directly in a whole-organ 3D FE model to describe intervertebral disc behavior. The 3D osmo-poro-visco-hyper-elastic disc (OVED) model describes disc behavior as a function of annulus and nucleus tissue biochemical composition, organization and specific constituent properties. The description of the 3D collagen network was enhanced to account for smaller fibril structures. Tissue mechanical behavior tests on isolated nucleus and annulus samples were simulated with models incorporating tissue composition to calculate the constituent parameter values. The obtained constitutive laws were incorporated into the whole-organ model. The overall behavior and disc properties of the model were corroborated against in vitro creep experiments of human L4/L5 discs. The OVED model simulated isolated tissue experiments on confined compression and uniaxial tensile test and whole-organ disc behavior. This was possible, provided that secondary fiber structures were accounted for. The fair agreement (radial bulge, axial creep deformation and intradiscal pressure) between model and experiment was obtained using constitutive properties that are the same for annulus and nucleus. Both tissue models differed in the 3D OVED model only by composition. The composition-based modeling presents the advantage of reducing the numbers of material parameters to a minimum and to use tissue composition directly as input. Hence, this approach provides the possibility to describe internal

  7. EDITORIAL: Focus on Heavy Ions in Biophysics and Medical Physics FOCUS ON HEAVY IONS IN BIOPHYSICS AND MEDICAL PHYSICS (United States)

    Durante, Marco


    Interest in energetic heavy ions is rapidly increasing in the field of biomedicine. Heavy ions are normally excluded from radiation protection, because they are not normally experienced by humans on Earth. However, knowledge of heavy ion biophysics is necessary in two fields: charged particle cancer therapy (hadrontherapy), and radiation protection in space missions. The possibility to cure tumours using accelerated heavy charged particles was first tested in Berkeley in the sixties, but results were not satisfactory. However, about 15 years ago therapy with carbon ions was resumed first in Japan and then in Europe. Heavy ions are preferable to photons for both physical and biological characteristics: the Bragg peak and limited lateral diffusion ensure a conformal dose distribution, while the high relative biological effectiveness and low oxygen enhancement ration in the Bragg peak region make the beam very effective in treating radioresistant and hypoxic tumours. Recent results coming from the National Institute of Radiological Sciences in Chiba (see the paper by Dr Tsujii and co-workers in this issue) and GSI (Germany) provide strong clinical evidence that heavy ions are indeed an extremely effective weapon in the fight against cancer. However, more research is needed in the field, especially on optimization of the treatment planning and risk of late effects in normal tissue, including secondary cancers. On the other hand, high-energy heavy ions are present in galactic cosmic radiation and, although they are rare as compared to protons, they give a major contribution in terms of equivalent dose to the crews of manned space exploratory-class missions. Exploration of the Solar System is now the main goal of the space program, and the risk caused by exposure to galactic cosmic radiation is considered a serious hindrance toward this goal, because of the high uncertainty on late effects of energetic heavy nuclei, and the lack of effective countermeasures. Risks

  8. Building biophysics in mid-century China: the University of Science and Technology of China. (United States)

    Luk, Yi Lai Christine


    Biophysics has been either an independent discipline or an element of another discipline in the United States, but it has always been recognized as a stand-alone discipline in the People's Republic of China (PRC) since 1949. To inquire into this apparent divergence, this paper investigates the formational history of biophysics in China by examining the early institutional history of one of the best-known and prestigious science and technology universities in the PRC, the University of Science and Technology of China (USTC). By showing how the university and its biophysics program co-evolved with national priorities from the school's founding in 1958 to the eve of the Cultural Revolution in 1966, the purpose of this paper is to assess the development of a scientific discipline in the context of national demands and institutional politics. Specific materials for analysis include the school's admission policies, curricula, students' dissertations, and research program. To further contextualize the institutional setting of Chinese biophysics, this paper begins with a general history of proto-biophysical institutions in China during the Nationalist-Communist transitional years. This paper could be of interest to historians wanting to know more about the origin of the biophysics profession in China, and in particular how research areas that constitute biophysics changed in tandem with socio-political contingencies.

  9. Soil functional types: surveying the biophysical dimensions of soil security (United States)

    Cécillon, Lauric; Barré, Pierre


    Soil is a natural capital that can deliver key ecosystem services (ES) to humans through the realization of a series of soil processes controlling ecosystem functioning. Soil is also a diverse and endangered natural resource. A huge pedodiversity has been described at all scales, which is strongly altered by global change. The multidimensional concept soil security, encompassing biophysical, economic, social, policy and legal frameworks of soils has recently been proposed, recognizing the role of soils in global environmental sustainability challenges. The biophysical dimensions of soil security focus on the functionality of a given soil that can be viewed as the combination of its capability and its condition [1]. Indeed, all soils are not equal in term of functionality. They show different processes, provide different ES to humans and respond specifically to global change. Knowledge of soil functionality in space and time is thus a crucial step towards the achievement soil security. All soil classification systems incorporate some functional information, but soil taxonomy alone cannot fully describe the functioning, limitations, resistance and resilience of soils. Droogers and Bouma [2] introduced functional variants (phenoforms) for each soil type (genoform) so as to fit more closely to soil functionality. However, different genoforms can have the same functionality. As stated by McBratney and colleagues [1], there is a great need of an agreed methodology for defining the reference state of soil functionality. Here, we propose soil functional types (SFT) as a relevant classification system for the biophysical dimensions of soil security. Following the definition of plant functional types widely used in ecology, we define a soil functional type as "a set of soil taxons or phenoforms sharing similar processes (e.g. soil respiration), similar effects on ecosystem functioning (e.g. primary productivity) and similar responses to global change (land-use, management or

  10. A biophysical understanding of the applications and implications of nanomaterials (United States)

    Geitner, Nicholas K.

    The last few decades have seen an explosion in the study and application of nanomaterials that continues to grow at a dizzying pace. Despite exciting applications in nano-enabled electronics, materials, medicine, and environmental remediation, an understanding of the interactions of these materials with natural materials and systems and the resulting implications lags severely behind. The purpose of this dissertation is to illuminate these interactions as well as develop novel environmental applications from a biophysical perspective. Following an introduction and literature review in Chapter 1, Chapters 2-4 will explore the application of dendritic polymers as novel and biocompatible oil dispersants for more environmentally conscious response to catastrophic oil spills. Chapter 2 will serve as a proof-of-concept, exploring the interactions between two model dendritic polymers and two model oil hydrocarbons. Next, the biocompatibility of these nanoscale dispersing agents is addressed in Chapter 3, using a soil amoeba as the primary model organism with emphasis on the mechanisms of any observed toxicity. Finally, in an effort to minimize cationic charge-induced cytotoxicity, the cationic terminal functional groups of poly(amidoamine) (PAMAM) dendrimers are replaced with either anionic or neutral functional groups. The resulting changes in structure and oil-dispersing function of the original and modified dendrimers are then investigated. Chapter 5 details a study of the applications and implications of graphene derivatives. Specifically, the environmental persistence of graphene and graphene oxide are assessed by studying their interactions with natural amphiphiles using synergistic experiments and molecular dynamics simulations. The application of graphene oxide for the removal of polyaromatic hydrocarbons from aquatic systems is also investigated and compared to the efficacy of PAMAM dendrimers in the same application. Finally, Chapter 6 explores the interactions

  11. Italian biophysics and SIBPA speed-up the pace towards the long and winding road of the interdisciplinary science. (United States)

    Giacomazza, Daniela; Musio, Carlo


    This Special Issue of Biophysical Chemistry presents a selection of the contributions presented at the XXII National Congress of the Italian Society of Pure and Applied Biophysics (i.e., SIBPA, Società Italiana di Biofisica Pura ed Applicata) held on September 2014 in Palermo, Italy. Topics cover all biophysical disciplines, from molecular to cellular, to integrative biophysics giving a comprehensive view of the inter- and multi-disciplinary approach of modern biophysics. SIBPA, which turned 40 in 2013, continues to grow and attract interest.

  12. Biophysical induction of vascular smooth muscle cell podosomes.

    Directory of Open Access Journals (Sweden)

    Na Young Kim

    Full Text Available Vascular smooth muscle cell (VSMC migration and matrix degradation occurs with intimal hyperplasia associated with atherosclerosis, vascular injury, and restenosis. One proposed mechanism by which VSMCs degrade matrix is through the use of podosomes, transient actin-based structures that are thought to play a role in extracellular matrix degradation by creating localized sites of matrix metalloproteinase (MMP secretion. To date, podosomes in VSMCs have largely been studied by stimulating cells with phorbol esters, such as phorbol 12,13-dibutyrate (PDBu, however little is known about the physiological cues that drive podosome formation. We present the first evidence that physiological, physical stimuli mimicking cues present within the microenvironment of diseased arteries can induce podosome formation in VSMCs. Both microtopographical cues and imposed pressure mimicking stage II hypertension induce podosome formation in A7R5 rat aortic smooth muscle cells. Moreover, wounding using a scratch assay induces podosomes at the leading edge of VSMCs. Notably the effect of each of these biophysical stimuli on podosome stimulation can be inhibited using a Src inhibitor. Together, these data indicate that physical cues can induce podosome formation in VSMCs.

  13. Biophysical profile of blood pressure in school children. (United States)

    Verma, M; Chhatwal, J; George, S M


    The study was conducted in an industrial and prosperous city of Punjab to evaluate the biophysical profile of blood pressure (BP) in apparently healthy school children. A total of 2560 children between the ages of 5-15 years were enrolled. Their age, religion, dietary and family history were recorded. Weight and height of all children were measured and body mass index (BMI) calculated. A value of 2.26 or more was taken as obesity. BP measurements were made as per recommendations of the American Heart Association. Systolic as well as diastolic BP increased with age in both sexes, correlation coefficients being 0.59 and 0.6, respectively. A statistically significant linear relationship between BP and weight and height was noted. Children with BMI of > 2.26 had a significantly higher BP (P vegetarians and also non- vegetarians also did not differ. A family history of hypertension was associated significantly with elevated BP (p obesity and a family history of hypertension in children are associated with elevated BP and such children may be at risk for developing hypertension at a later date. They should be followed up and considered for modification of risk factors.

  14. Influence of silybin on biophysical properties of phospholipid bilayers

    Institute of Scientific and Technical Information of China (English)

    Olga WESO(L)OWSKA; Krystyna MICHALAK; Barbara (L)ANIA-PIETRZAK; Micha(l) KU(Z)D(Z)A(L); Kamila STA(N)CZAK; Daniela MOSI(A)DZ; Piotr DOBRYSZYCKI; Andrzej O(Z)YHAR; Ma(l)gorzata KOMOROWSKA; Andrzej B HENDRICH


    Aim: Silybin (silibinin)is major biologically active flavonolignan extracted from milk thistle (Sylibum marianum). Its biological activities include hepato-protection, anticancer properties, and antioxidant- and membrane-stabilizing functions. Al-though membranes are postulated to be one of the cellular targets for silybin, little is known about its interaction with phospholipid bilayers. Methods: In the present work, the interactions of silybin with phosphatidylcholine bilayers were studied in detail using fluorescence spectroscopy, microcalorimetry and electron spin resonance techniques. Results: The results showed that silybin interacted with the surface of lipid bilayers. It affected the generalized polarization of the fluores-cent probe Prodan, while not influencing the more deeplylocated Laurdan. Silybin lowered the main phospholipid phase transition temperature as judged by microcalorimetry, and caused the immobilization of spin probe Tempo-palmitate located on the surface of membranes. The mobility of spin probes 5-and 16-doxylstearic acid was not affected by silybin. Silybin-induced quenching of 1,6-diphe-nyl-1,3,5-hexatriene fluorescence indicated that some flavonoid molecules parti-tioned into the hydrophobic region of membranes, which did not change signifi-cantly the biophysical properties of the deeper membrane regions. Conclusion: Such a behavior of silybin in membranes is in accordance with its postulated biological functions and neglectable side effects of therapies using silybin.

  15. Biophysical characterization of gold nanoparticles-loaded liposomes. (United States)

    Mady, Mohsen Mahmoud; Fathy, Mohamed Mahmoud; Youssef, Tareq; Khalil, Wafaa Mohamed


    Gold nanoparticles were prepared and loaded into the bilayer of dipalmitoylphosphatidylcholine (DPPC) liposomes, named as gold-loaded liposomes. Biophysical characterization of gold-loaded liposomes was studied by transmission electron microscopy (TEM) and Fourier transform infrared (FTIR) spectroscopy as well as turbidity and rheological measurements. FTIR measurements showed that gold nanoparticles made significant changes in the frequency of the CH(2) stretching bands, revealing that gold nanoparticles increased the number of gauche conformers and create a conformational change within the acyl chains of phospholipids. The transmission electron micrographs (TEM) revealed that gold nanoparticles were loaded in the liposomal bilayer. The zeta potential of DPPC liposomes had a more negative value after incorporating of Au NPs into liposomal membranes. Turbidity studies revealed that the loading of gold nanoparticles into DPPC liposomes results in shifting the temperature of the main phase transition to a lower value. The membrane fluidity of DPPC bilayer was increased by loading the gold nanoparticles as shown from rheological measurements. Knowledge gained in this study may open the door to pursuing liposomes as a viable strategy for Au NPs delivery in many diagnostic and therapeutic applications.

  16. Nanoparticle Density: A Critical Biophysical Regulator of Endothelial Permeability. (United States)

    Tay, Chor Yong; Setyawati, Magdiel Inggrid; Leong, David Tai


    The integrity of the vasculature system is intrinsically sensitive to a short list of biophysical cues spanning from nano to micro scales. We have earlier found that certain nanomaterials could induce endothelial leakiness (nanoparticle induced endothelial leakiness, nanoEL). In this study, we report that the density of the nanomaterial, a basic intrinsic material property not implicated in many nanoparticle-mediated biological effects, predominantly dictates the nanoEL effect. We demonstrated that the impinging force exerted by a library of increasing effective densities but consistently sized silica nanoparticles (SiNPs) could directly increase endothelial permeability. The crossover effective particle density that induced nanoEL was determined to be between 1.57 g/cm(3) to 1.72 g/cm(3). It was also found that a cumulative gravitational-mediated force of around 1.8 nN/μm along the boundaries of the vascular endothelial cadherin (VE-cad) adherens junctions appeared to be a critical threshold force required to perturb endothelial cell-cell adhesion. The net result is the "snapping" of the mechanically pretensed VE-cad (Nanosnap), leading to the formation of micron-sized gaps that would dramatically increase endothelial leakiness.

  17. The biophysical bases of will-less behaviours

    Directory of Open Access Journals (Sweden)

    Jose Luis ePerez Velazquez


    Full Text Available Are there distinctions at the neurophysiological level that correlate with voluntary and involuntary actions? Whereas the wide variety of involuntary behaviours (and here mostly the deviant or pathological ones will be considered will necessarily be represented at some biophysical level in nervous system activity, for after all those cellular activity patterns manifest themselves as behaviours and thus there will be a multiplicity of them, there could be some general tendencies to be discerned amongst that assortment. Collecting observations derived from neurophysiological activity associated with several pathological conditions characterised by presenting will-less actions such as Parkinson’s disease, seizures, alien hand syndrome and tics, it is proposed that a general neurophysiologic tendency of brain activity that correlates with involuntary actions is higher than normal synchrony in specific brain cell networks, depending upon the behaviour in question. Wilful, considered normal behaviour, depends on precise coordination of the collective activity in cell ensembles that may be lost, or diminished, when there are tendencies towards more than normal or aberrant synchronization of cellular activity. Hence, rapid fluctuations in synchrony is associated with normal actions and cognition while less variability in brain recordings particularly with regards to synchronization could be a signature of unconscious and deviant behaviours in general.

  18. Biophysical mechanism of transient retinal phototropism in rod photoreceptors (United States)

    Zhao, Xiaohui; Thapa, Damber; Wang, Benquan; Gai, Shaoyan; Yao, Xincheng


    Oblique light stimulation evoked transient retinal phototropism (TRP) has been recently detected in frog and mouse retinas. High resolution microscopy of freshly isolated retinas indicated that the TRP is predominated by rod photoreceptors. Comparative confocal microscopy and optical coherence tomography (OCT) revealed that the TRP predominantly occurred from the photoreceptor outer segment (OS). However, biophysical mechanism of rod OS change is still unknown. In this study, frog retinal slices, which open a cross section of retinal photoreceptor and other functional layers, were used to test the effect of light stimulation on rod OS. Near infrared light microscopy was employed to monitor photoreceptor changes in retinal slices stimulated by a rectangular-shaped visible light flash. Rapid rod OS length change was observed after the stimulation delivery. The magnitude and direction of the rod OS change varied with the position of the rods within the stimulated area. In the center of stimulated region the length of the rod OS shrunk, while in the peripheral region the rod OS tip swung towards center region in the plane perpendicular to the incident stimulus light. Our experimental result and theoretical analysis suggest that the observed TRP may reflect unbalanced disc-shape change due to localized pigment bleaching. Further investigation is required to understand biochemical mechanism of the observed rod OS kinetics. Better study of the TRP may provide a noninvasive biomarker to enable early detection of age-related macular degeneration (AMD) and other diseases that are known to produce retinal photoreceptor dysfunctions.

  19. Biophysical principles predict fitness landscapes of drug resistance. (United States)

    Rodrigues, João V; Bershtein, Shimon; Li, Anna; Lozovsky, Elena R; Hartl, Daniel L; Shakhnovich, Eugene I


    Fitness landscapes of drug resistance constitute powerful tools to elucidate mutational pathways of antibiotic escape. Here, we developed a predictive biophysics-based fitness landscape of trimethoprim (TMP) resistance for Escherichia coli dihydrofolate reductase (DHFR). We investigated the activity, binding, folding stability, and intracellular abundance for a complete set of combinatorial DHFR mutants made out of three key resistance mutations and extended this analysis to DHFR originated from Chlamydia muridarum and Listeria grayi We found that the acquisition of TMP resistance via decreased drug affinity is limited by a trade-off in catalytic efficiency. Protein stability is concurrently affected by the resistant mutants, which precludes a precise description of fitness from a single molecular trait. Application of the kinetic flux theory provided an accurate model to predict resistance phenotypes (IC50) quantitatively from a unique combination of the in vitro protein molecular properties. Further, we found that a controlled modulation of the GroEL/ES chaperonins and Lon protease levels affects the intracellular steady-state concentration of DHFR in a mutation-specific manner, whereas IC50 is changed proportionally, as indeed predicted by the model. This unveils a molecular rationale for the pleiotropic role of the protein quality control machinery on the evolution of antibiotic resistance, which, as we illustrate here, may drastically confound the evolutionary outcome. These results provide a comprehensive quantitative genotype-phenotype map for the essential enzyme that serves as an important target of antibiotic and anticancer therapies.

  20. Thermal shell fragment craniofacial injury: biophysics, pathophysiology, and management. (United States)

    Shuker, Sabri T


    This article aims to bring attention to unique risks and burns by thermal shell fragment craniofacial soft tissue injury. Hot shrapnel may inflict burns to major vessel walls and lead to life-threatening hemorrhaging or death, which adds a new challenge for craniofacial surgeons. Morbidity of thermal deep tissue may lead to deep tissue necrosis and infection.Thermal energy (TE) physics, biophysics, and pathophysiological effects relate directly to the amount of heat generated from shell casing detonation, which transfers to skin, deep tissue, as well as brain and leads to life-threatening burning of organs; this is different from shrapnel kinetic energy injury.The unprecedented increase in using a large range of explosives and high-heat thermobaric weapons contributes to the superfluous and unnecessary suffering caused by thermal injury wounds.Surgeons and medics should recognize that a surprising amount of TE can be found in an explosion or detonation of a steel-encased explosive, resulting in TEs ranging from 400 F up to 1000 F.

  1. Biophysical model of prokaryotic diversity in geothermal hot springs. (United States)

    Klales, Anna; Duncan, James; Nett, Elizabeth Janus; Kane, Suzanne Amador


    Recent studies of photosynthetic bacteria living in geothermal hot spring environments have revealed surprisingly complex ecosystems with an unexpected level of genetic diversity. One case of particular interest involves the distribution along hot spring thermal gradients of genetically distinct bacterial strains that differ in their preferred temperatures for reproduction and photosynthesis. In such systems, a single variable, temperature, defines the relevant environmental variation. In spite of this, each region along the thermal gradient exhibits multiple strains of photosynthetic bacteria adapted to several distinct thermal optima, rather than a single thermal strain adapted to the local environmental temperature. Here we analyze microbiology data from several ecological studies to show that the thermal distribution data exhibit several universal features independent of location and specific bacterial strain. These include the distribution of optimal temperatures of different thermal strains and the functional dependence of the net population density on temperature. We present a simple population dynamics model of these systems that is highly constrained by biophysical data and by physical features of the environment. This model can explain in detail the observed thermal population distributions, as well as certain features of population dynamics observed in laboratory studies of the same organisms.

  2. Universal buffers for use in biochemistry and biophysical experiments

    Directory of Open Access Journals (Sweden)

    Dewey Brooke


    Full Text Available The use of buffers that mimic biological solutions is a foundation of biochemical and biophysical studies. However, buffering agents have both specific and nonspecific interactions with proteins. Buffer molecules can induce changes in conformational equilibria, dynamic behavior, and catalytic properties merely by their presence in solution. This effect is of concern because many of the standard experiments used to investigate protein structure and function involve changing solution conditions such as pH and/or temperature. In experiments in which pH is varied, it is common practice to switch buffering agents so that the pH is within the working range of the weak acid and conjugate base. If multiple buffers are used, it is not always possible to decouple buffer induced change from pH or temperature induced change. We have developed a series of mixed biological buffers for protein analysis that can be used across a broad pH range, are compatible with biologically relevant metal ions, and avoid complications that may arise from changing the small molecule composition of buffers when pH is used as an experimental variable.

  3. Biophysical and biological meanings of healthspan from C. elegans cohort

    Energy Technology Data Exchange (ETDEWEB)

    Suda, Hitoshi, E-mail:


    Highlights: • We focus on a third factor, noise, as well as on genetic and environmental factors. • C. elegans fed a healthy food had an extended healthspan as compared to those fed a conventional diet. • An amplification of ATP noise was clearly evident from around the onset of biodemographic aging. • The extension of timing of noise amplification may contribute to effectively extending the healthspan. • The same mechanism of the mean lifespan extension in C. elegans may be realized in humans. - Abstract: Lifespan among individuals ranges widely in organisms from yeast to mammals, even in an isogenic cohort born in a nearly uniform environment. Needless to say, genetic and environmental factors are essential for aging and lifespan, but in addition, a third factor or the existence of a stochastic element must be reflected in aging and lifespan. An essential point is that lifespan or aging is an unpredictable phenomenon. The present study focuses on elucidating the biophysical and biological meanings of healthspan that latently indwells a stochastic nature. To perform this purpose, the nematode Caenorhabditis elegans served as a model animal. C. elegans fed a healthy food had an extended healthspan as compared to those fed a conventional diet. Then, utilizing this phenomenon, we clarified a mechanism of healthspan extension by measuring the single-worm ATP and estimating the ATP noise (or the variability of the ATP content) among individual worms and by quantitatively analyzing biodemographic data with the lifespan equation that was derived from a fluctuation theory.

  4. Symposium on Biophysics and Physiology of Biological Transport

    CERN Document Server

    Capraro, V; Porter, K; Robertson, J


    The study of cell membranes began to attract increasing interest before the turn of the present century with the observations of 0 verton. Since that time many investigators have become interested in the broad problem of structure and function of the membrane and today we find ourselVes at a stage in which several branches of research, particularly physical chemistry, biochemistry, biophysics, physiology and pharmacology have come together, leading to the possibility of obtaining a better perspective of the overall problems. The purpose of this Symposium was to assemble in an orderly sequence representations of the knowledge of membranes achieved to date in the areas of the various disciplines. It was thought that to bring together many points of view on a problem should allow the conferees to see better what had been accomplished, what has been overlooked and what needs further development. It is to be hoped that efforts of this type have and will fulfill the desired purpose. This volume contains the majorit...

  5. The biophysical bases of will-less behaviors. (United States)

    Perez Velazquez, José L


    Are there distinctions at the neurophysiological level that correlate with voluntary and involuntary actions? Whereas the wide variety of involuntary behaviors (and here mostly the deviant or pathological ones will be considered) will necessarily be represented at some biophysical level in nervous system activity-for after all those cellular activity patterns manifest themselves as behaviors and thus there will be a multiplicity of them-there could be some general tendencies to be discerned amongst that assortment. Collecting observations derived from neurophysiological activity associated with several pathological conditions characterized by presenting will-less actions such as Parkinson's disease, seizures, alien hand syndrome and tics, it is proposed that a general neurophysiologic tendency of brain activity that correlates with involuntary actions is higher than normal synchrony in specific brain cell networks, depending upon the behavior in question. Wilful, considered normal behavior, depends on precise coordination of the collective activity in cell ensembles that may be lost, or diminished, when there are tendencies toward more than normal or aberrant synchronization of cellular activity. Hence, rapid fluctuations in synchrony is associated with normal actions and cognition while less variability in brain recordings particularly with regards to synchronization could be a signature of unconscious and deviant behaviors in general.

  6. Energy efficient neural stimulation: coupling circuit design and membrane biophysics.

    Directory of Open Access Journals (Sweden)

    Thomas J Foutz

    Full Text Available The delivery of therapeutic levels of electrical current to neural tissue is a well-established treatment for numerous indications such as Parkinson's disease and chronic pain. While the neuromodulation medical device industry has experienced steady clinical growth over the last two decades, much of the core technology underlying implanted pulse generators remain unchanged. In this study we propose some new methods for achieving increased energy-efficiency during neural stimulation. The first method exploits the biophysical features of excitable tissue through the use of a centered-triangular stimulation waveform. Neural activation with this waveform is achieved with a statistically significant reduction in energy compared to traditional rectangular waveforms. The second method demonstrates energy savings that could be achieved by advanced circuitry design. We show that the traditional practice of using a fixed compliance voltage for constant-current stimulation results in substantial energy loss. A portion of this energy can be recuperated by adjusting the compliance voltage to real-time requirements. Lastly, we demonstrate the potential impact of axon fiber diameter on defining the energy-optimal pulse-width for stimulation. When designing implantable pulse generators for energy efficiency, we propose that the future combination of a variable compliance system, a centered-triangular stimulus waveform, and an axon diameter specific stimulation pulse-width has great potential to reduce energy consumption and prolong battery life in neuromodulation devices.

  7. Overproduction and biophysical characterization of human HSP70 proteins. (United States)

    Boswell-Casteel, Rebba C; Johnson, Jennifer M; Duggan, Kelli D; Tsutsui, Yuko; Hays, Franklin A


    Heat shock proteins (HSP) perform vital cellular functions and modulate cell response pathways to physical and chemical stressors. A key feature of HSP function is the ability to interact with a broad array of protein binding partners as a means to potentiate downstream response pathways or facilitate protein folding. These binding interactions are driven by ATP-dependent conformational rearrangements in HSP proteins. The HSP70 family is evolutionarily conserved and is associated with diabetes and cancer progression and the etiopathogenesis of hepatic, cardiovascular, and neurological disorders in humans. However, functional characterization of human HSP70s has been stymied by difficulties in obtaining large quantities of purified protein. Studies of purified human HSP70 proteins are essential for downstream investigations of protein-protein interactions and in the rational design of novel family-specific therapeutics. Within this work, we present optimized protocols for the heterologous overexpression and purification of either the nucleotide binding domain (NBD) or the nucleotide and substrate binding domains of human HSPA9, HSPA8, and HSPA5 in either Escherichia coli or Saccharomyces cerevisiae. We also include initial biophysical characterization of HSPA9 and HSPA8. This work provides the basis for future biochemical studies of human HSP70 protein function and structure.

  8. Sodium channel biophysics, late sodium current and genetic arrhythmic syndromes. (United States)

    Chadda, Karan R; Jeevaratnam, Kamalan; Lei, Ming; Huang, Christopher L-H


    Arrhythmias arise from breakdown of orderly action potential (AP) activation, propagation and recovery driven by interactive opening and closing of successive voltage-gated ion channels, in which one or more Na(+) current components play critical parts. Early peak, Na(+) currents (I Na) reflecting channel activation drive the AP upstroke central to cellular activation and its propagation. Sustained late Na(+) currents (I Na-L) include contributions from a component with a delayed inactivation timecourse influencing AP duration (APD) and refractoriness, potentially causing pro-arrhythmic phenotypes. The magnitude of I Na-L can be analysed through overlaps or otherwise in the overall voltage dependences of the steady-state properties and kinetics of activation and inactivation of the Na(+) conductance. This was useful in analysing repetitive firing associated with paramyotonia congenita in skeletal muscle. Similarly, genetic cardiac Na(+) channel abnormalities increasing I Na-L are implicated in triggering phenomena of automaticity, early and delayed afterdepolarisations and arrhythmic substrate. This review illustrates a wide range of situations that may accentuate I Na-L. These include (1) overlaps between steady-state activation and inactivation increasing window current, (2) kinetic deficiencies in Na(+) channel inactivation leading to bursting phenomena associated with repetitive channel openings and (3) non-equilibrium gating processes causing channel re-opening due to more rapid recoveries from inactivation. All these biophysical possibilities were identified in a selection of abnormal human SCN5A genotypes. The latter presented as a broad range of clinical arrhythmic phenotypes, for which effective therapeutic intervention would require specific identification and targeting of the diverse electrophysiological abnormalities underlying their increased I Na-L.

  9. Biophysical Assessment and Predicted Thermophysiologic Effects of Body Armor.

    Directory of Open Access Journals (Sweden)

    Adam W Potter

    Full Text Available Military personnel are often required to wear ballistic protection in order to defend against enemies. However, this added protection increases mass carried and imposes additional thermal burden on the individual. Body armor (BA is known to reduce combat casualties, but the effects of BA mass and insulation on the physical performance of soldiers are less well documented. Until recently, the emphasis has been increasing personal protection, with little consideration of the adverse impacts on human performance.The purpose of this work was to use sweating thermal manikin and mathematical modeling techniques to quantify the tradeoff between increased BA protection, the accompanying mass, and thermal effects on human performance.Using a sweating thermal manikin, total insulation (IT, clo and vapor permeability indexes (im were measured for a baseline clothing ensemble with and without one of seven increasingly protective U.S. Army BA configurations. Using mathematical modeling, predictions were made of thermal impact on humans wearing each configuration while working in hot/dry (desert, hot/humid (jungle, and temperate environmental conditions.In nearly still air (0.4 m/s, IT ranged from 1.57 to 1.63 clo and im from 0.35 to 0.42 for the seven BA conditions, compared to IT and im values of 1.37 clo and 0.45 respectively, for the baseline condition (no BA.Biophysical assessments and predictive modeling show a quantifiable relationship exists among increased protection and increased thermal burden and decreased work capacity. This approach enables quantitative analysis of the tradeoffs between ballistic protection, thermal-work strain, and physical work performance.

  10. Gravitropism of cucumber hypocotyls: biophysical mechanism of altered growth (United States)

    Cosgrove, D. J.


    The biophysical basis for the changes in cell elongation rate during gravitropism was examined in aetiolated cucumber (Cucumis sativus L.) hypocotyls. Bulk osmotic pressures on the two sides of the stem and in the epidermal cells were not altered during the early time course of gravitropism. By the pressure-probe technique, a small increase in turgor (0.3 bar, 30 kPa) was detected on the upper (inhibited) side, whereas there was a negligible decrease in turgor on the lower (stimulated) side. These small changes in turgor and water potential appeared to be indirect, passive consequences of the altered growth and the small resistance for water movement from the xylem, and indicated that the change in growth was principally due to changes in wall properties. The results indicate that the hydraulic conductance of the water-transport pathway was large (.25 h-1 bar-1) and the water potential difference supporting cell expansion was no greater than 0.3 bar (30 kPa). From pressure-block experiments, it appeared that upon gravitropic stimulation (1) the yield threshold of the lower half of the stem did not decrease and (2) the wall on the upper side of the stem was not made more rigid by a cross-linking process. Mechanical measurements of the stress/strain properties of the walls showed that the initial development of gravitropism did not involve an alteration of the mechanical behaviour of the isolated walls. Thus, gravitropism in cucumber hypocotyls occurs principally by an alteration of the wall relaxation process, without a necessary change in wall mechanical properties.

  11. Biophysics of Magnetic Orientation: Radical Pairs, Biogenic Magnetite, or both? (United States)

    Kirschvink, Joe


    Two major biophysical mechanisms for magnetoreception in terrestrial animals, one based on biogenic magnetite and another on radical-pair biochemical reactions, have been the subject of experiment and debate for the past 30 years. The magnetite hypothesis has stood the test of time: biogenic magnetite is synthesized biochemically in Bacteria, Protists, and numerous Animal phyla, as well as in some plants. Chains of single-domain crystals have been detected by clean-lab based SQUID magnetometry in animal tissues in all major phyla, followed by high-resolution TEM in selected model organisms, as well as by electrophysiological studies demonstrating the role of the ophthalmic branch of the trigeminal nerve in the magnetoreceptive process. Pulse-remagnetization - configured to uniquely flip the polarity of single-domain ferromagnets - has dramatic effects on the behavior of many birds, honeybees, mole rats, turtles, and bats, to cite a growing list. Magnetite-containing cells in the vicinity of these neurons in fish are now the subject of intense study by our consortium. The existence of a specialized class of magnetite-containing magnetoreceptor cells in animal tissues is no longer controversial. In contrast, less success has been achieved in gaining experimental support across a range of taxa for the radical-pair hypothesis. Although this mechanism was proposed to explain an early observation that birds would not respond to complete inversion of the magnetic vector, many organisms (even some birds) do indeed respond to the field polarity. We also note that few, if any, of these critical experiments have been done using fully double-blind methods. This is joint work with: M. M. Walker (University of Auckland, New Zealand) and M. Winklhofer (LMU Munich, Germany).

  12. Microbial Life in Soil - Linking Biophysical Models with Observations (United States)

    Or, Dani; Tecon, Robin; Ebrahimi, Ali; Kleyer, Hannah; Ilie, Olga; Wang, Gang


    Microbial life in soil occurs within fragmented aquatic habitats formed in complex pore spaces where motility is restricted to short hydration windows (e.g., following rainfall). The limited range of self-dispersion and physical confinement promote spatial association among trophically interdepended microbial species. Competition and preferences for different nutrient resources and byproducts and their diffusion require high level of spatial organization to sustain the functioning of multispecies communities. We report mechanistic modeling studies of competing multispecies microbial communities grown on hydrated surfaces and within artificial soil aggregates (represented by 3-D pore network). Results show how trophic dependencies and cell-level interactions within patchy diffusion fields promote spatial self-organization of motile microbial cells. The spontaneously forming patterns of segregated, yet coexisting species were robust to spatial heterogeneities and to temporal perturbations (hydration dynamics), and respond primarily to the type of trophic dependencies. Such spatially self-organized consortia may reflect ecological templates that optimize substrate utilization and could form the basic architecture for more permanent surface-attached microbial colonies. Hydration dynamics affect structure and spatial arrangement of aerobic and anaerobic microbial communities and their biogeochemical functions. Experiments with well-characterized artificial soil microbial assemblies grown on porous surfaces provide access to community dynamics during wetting and drying cycles detected through genetic fingerprinting. Experiments for visual observations of spatial associations of tagged bacterial species with known trophic dependencies on model porous surfaces are underway. Biophysical modeling provide a means for predicting hydration-mediated critical separation distances for activation of spatial self-organization. The study provides new modeling and observational tools

  13. Biophysics, Pathophysiology and Pharmacology of Ion Channel Gating Pores

    Directory of Open Access Journals (Sweden)

    Adrien eMoreau


    Full Text Available Voltage sensor domain (VSDs are a feature of voltage gated ion channel (VGICs and voltage sensitive proteins. They are composed of four transmembrane (TM segments (S1 to S4. Currents leaking through VSDs are called omega or gating pore currents.Gating pores are caused by mutations of the highly conserved positively charged amino acids in the S4 segment that disrupt interactions between the S4 segment and the gating charge transfer center (GCTC. The GCTC separates the intracellular and extracellular water crevices. The disruption of S4–GCTC interactions allows these crevices to communicate and create a fast activating and non-inactivating alternative cation-selective permeation pathway of low conductance, or a gating pore.Gating pore currents have recently been shown to cause periodic paralysis phenotypes. There is also increasing evidence that gating pores are linked to several other familial diseases. For example, gating pores in Nav1.5 and Kv7.2 channels may underlie mixed arrhythmias associated with dilated cardiomyopathy (DCM phenotypes and peripheral nerve hyperexcitability (PNH respectively. There is little evidence for the existence of gating pore blockers. Moreover, it is known that a number of toxins bind to the VSD of a specific domain of Na+ channels. These toxins may thus modulate gating pore currents. This focus on the VSD motif opens up a new area of research centered on developing molecules to treat a number of cell excitability disorders such as epilepsy, cardiac arrhythmias, and pain.The purpose of the present review is to summarize existing knowledge of the pathophysiology, biophysics, and pharmacology of gating pore currents and to serve as a guide for future studies aimed at improving our understanding of gating pores and their pathophysiological roles.

  14. Untreatable Pain Resulting from Abdominal Cancer: New Hope from Biophysics?

    Directory of Open Access Journals (Sweden)

    Marineo G


    Full Text Available CONTEXT: Visceral pain characterizing pancreatic cancer is the most difficult symptom of the disease to control and can significantly impair the quality of life which remains and increase the demand for euthanasia. AIM: To investigate a possible new method based on biophysical principles (scrambler therapy to be used in the effective treatment of drug-resistant oncological pain of the visceral/neuropathic type. SETTING: Eleven terminal cancer patients (3 pancreas, 4 colon, 4 gastric suffering from elevated drug resistant visceral pain. DESIGN: The trial program was related to the first ten treatment sessions. Subsequently, each patient continued to receive treatment until death. MAIN OUTCOME MEASURES: Pain measures were performed using the visual analogue scale before and after each treatment session and accompanied by diary recordings of the duration of analgesia in the hours following each single application. Any variation in pain-killing drug consumption was also recorded. RESULTS: All patients reacted positively to the treatment throughout the whole reference period. Pain intensity showed a significant decrease (P less than 0.001, accompanied by a gradual rise both in the pain threshold and the duration of analgesia. Nine (81.8% of the patients suspended pain-killers within the first 5 applications, while the remaining two (18.2% considerably reduced the dosage taken prior to scrambler therapy. No undesirable side effects were observed. Compliance was found to be optimal. CONCLUSIONS: The preliminary results obtained using scrambler therapy are extremely encouraging, both in terms of enhanced pain control after each treatment session and in view of the possible maintenance of effectiveness over time.

  15. The Colorado Plateau II: biophysical, socioeconomic, and cultural research (United States)

    Mattson, David J.; van Riper, Charles


    The publication of The Colorado Plateau: Cultural, Biological, and Physical Research in 2004 marked a timely summation of current research in the Four Corners states. This new volume, derived from the seventh Biennial Conference on the Colorado Plateau in 2003, complements the previous book by focusing on the integration of science into resource management issues. The 32 chapters range in content from measuring human impacts on cultural resources, through grazing and the wildland-urban interface issues, to parameters of climate change on the Plateau. The book also introduces economic perspectives by considering shifting patterns and regional disparities in the Colorado Plateau economy. A series of chapters on mountain lions explores the human-wildland interface. These chapters deal with the entire spectrum of challenges associated with managing this large mammal species in Arizona and on the Colorado Plateau, conveying a wealth of timely information of interest to wildlife managers and enthusiasts. Another provocative set of chapters on biophysical resources explores the management of forest restoration, from the micro scale all the way up to large-scale GIS analyses of ponderosa pine ecosystems on the Colorado Plateau. Given recent concerns for forest health in the wake of fires, severe drought, and bark-beetle infestation, these chapters will prove enlightening for forest service, park service, and land management professionals at both the federal and state level, as well as general readers interested in how forest management practices will ultimately affect their recreation activities. With broad coverage that touches on topics as diverse as movement patterns of rattlesnakes, calculating watersheds, and rescuing looted rockshelters, this volume stands as a compendium of cutting-edge research on the Colorado Plateau that offers a wealth of insights for many scholars.

  16. Current status of research on biophysical effects of ultrasound. (United States)

    Barnett, S B; ter Haar, G R; Ziskin, M C; Nyborg, W L; Maeda, K; Bang, J


    This overview of bioeffects of ultrasound presents some key aspects of selected papers dealing with biophysical end-points. Its purpose is to establish a basis for exposure and dosimetric standards for medical ultrasonic equipment. It is intended to provide essential background resource material for the medical/scientific community, and more specifically for scientific working groups. This document was prepared by members of the Safety Committee of the World Federation for Ultrasound in Medicine and Biology. It was produced as a resource document in response to a request for information by Working Group 12 (Ultrasound exposure parameters) of the International Electrotechnical Commission Technical Committee 87, Ultrasonics. IEC TC 87, WG12 is the working group responsible for generating international standards for the classification of equipment by its acoustic fields based on safety thresholds. Our paper is intended to update and supplement information on the thermal mechanism provided in the publication, "WFUMB Symposium on Safety and Standardisation in Medical Ultrasound: Issues and Recommendations Regarding Thermal Mechanisms for Biological Effects of Ultrasound" (WFUMB 1992). It also provides an overview of trends in research into nonthermal mechanisms as a preliminary to the next WFUMB Symposium on Safety of Medical Ultrasound when this subject will be examined in detail by a select group of international experts. The WFUMB-sponsored workshop will take place in Utsunomiya, Japan during 11-15th July, 1994. The purpose of the meeting is to evaluate the scientific literature and to formulate internationally accepted recommendations on the safe use of diagnostic ultrasound that may be endorsed as official policy of the WFUMB. It should be noted that the current publication is not intended for review or endorsement as an official WFUMB document. It is produced as a scientific paper by individuals who are members of the WFUMB Safety Committee, and it therefore

  17. Biophysics and bioinformatics of transcription regulation in bacteria and bacteriophages (United States)

    Djordjevic, Marko


    Due to rapid accumulation of biological data, bioinformatics has become a very important branch of biological research. In this thesis, we develop novel bioinformatic approaches and aid design of biological experiments by using ideas and methods from statistical physics. Identification of transcription factor binding sites within the regulatory segments of genomic DNA is an important step towards understanding of the regulatory circuits that control expression of genes. We propose a novel, biophysics based algorithm, for the supervised detection of transcription factor (TF) binding sites. The method classifies potential binding sites by explicitly estimating the sequence-specific binding energy and the chemical potential of a given TF. In contrast with the widely used information theory based weight matrix method, our approach correctly incorporates saturation in the transcription factor/DNA binding probability. This results in a significant reduction in the number of expected false positives, and in the explicit appearance---and determination---of a binding threshold. The new method was used to identify likely genomic binding sites for the Escherichia coli TFs, and to examine the relationship between TF binding specificity and degree of pleiotropy (number of regulatory targets). We next address how parameters of protein-DNA interactions can be obtained from data on protein binding to random oligos under controlled conditions (SELEX experiment data). We show that 'robust' generation of an appropriate data set is achieved by a suitable modification of the standard SELEX procedure, and propose a novel bioinformatic algorithm for analysis of such data. Finally, we use quantitative data analysis, bioinformatic methods and kinetic modeling to analyze gene expression strategies of bacterial viruses. We study bacteriophage Xp10 that infects rice pathogen Xanthomonas oryzae. Xp10 is an unusual bacteriophage, which has morphology and genome organization that most closely

  18. The Multistream Self: Biophysical, Mental, Social, and Existential

    Directory of Open Access Journals (Sweden)

    Vinod D. Deshmukh


    Full Text Available Self is difficult to define because of its multiple, constitutive streams of functional existence. A more comprehensive and expanded definition of self is proposed. The standard bio-psycho-social model of psyche is expanded to biophysical-mental-social and existential self. The total human experience is better understood and explained by adding the existential component. Existential refers to lived human experience, which is firmly rooted in reality. Existential living is the capacity to live fully in the present, and respond freely and flexibly to new experience without fear. Four common fears of isolation, insecurity, insignificance, and death can be overcome by developing a lifestyle of whole-hearted engagement in the present reality, creative problem solving, self-actualization, and altruism. Such integrative living creates a sense of presence with self-awareness, understanding, and existential well-being. Well-being is defined as a life of happiness, contentment, low distress, and good health with positive outlook. Self is a complex, integrative process of living organisms. It organizes, coordinates, and integrates energy-information within and around itself, spontaneously, unconsciously, and consciously. Self-process is understood in terms of synergetics, coordination dynamics, and energy-information–directed self-organization. It is dynamic, composite, ever renewing, and enduring. It can be convergent or divergent, and can function as the source or target of its own behavior-mentation. The experience of self is continuously generated by spontaneous activation of neural networks in the cerebral neocortex by the brainstem-diencephalic arousal system. The multiple constitutive behavioral-mental streams develop concurrently into a unique experience of self, specific for a person at his/her developmental stage. The chronological neuro-behavioral-mental development of self is described in detail from embryonic stage to old age. Self can be

  19. The multistream self: biophysical, mental, social, and existential. (United States)

    Deshmukh, Vinod D


    Self is difficult to define because of its multiple, constitutive streams of functional existence. A more comprehensive and expanded definition of self is proposed. The standard bio-psycho-social model of psyche is expanded to biophysical-mental-social and existential self. The total human experience is better understood and explained by adding the existential component. Existential refers to lived human experience, which is firmly rooted in reality. Existential living is the capacity to live fully in the present, and respond freely and flexibly to new experience without fear. Four common fears of isolation, insecurity, insignificance, and death can be overcome by developing a lifestyle of whole-hearted engagement in the present reality, creative problem solving, self-actualization, and altruism. Such integrative living creates a sense of presence with self-awareness, understanding, and existential well-being. Well-being is defined as a life of happiness, contentment, low distress, and good health with positive outlook. Self is a complex, integrative process of living organisms. It organizes, coordinates, and integrates energy-information within and around itself, spontaneously, unconsciously, and consciously. Self-process is understood in terms of synergetics, coordination dynamics, and energy-information-directed self-organization. It is dynamic, composite, ever renewing, and enduring. It can be convergent or divergent, and can function as the source or target of its own behavior-mentation. The experience of self is continuously generated by spontaneous activation of neural networks in the cerebral neocortex by the brainstem-diencephalic arousal system. The multiple constitutive behavioral-mental streams develop concurrently into a unique experience of self, specific for a person at his/her developmental stage. The chronological neuro-behavioral-mental development of self is described in detail from embryonic stage to old age. Self can be behaviorally

  20. Energy return on investment: Theory and application to biophysical economics (United States)

    Murphy, David J.

    This dissertation is comprised of an introduction and five manuscripts split into two main sections: theory and application. Manuscripts one and four have been published, manuscript three has been accepted for publication, and manuscripts two and five are currently in review for publication. The theory sections contains the first two manuscripts. The first manuscript is a review of the literature on Energy Return on Investment (EROI) analysis. I cover five areas in this manuscript, including: (1) EROI and corn ethanol, (2) EROI for most major fuels, (3) alternative EROI applications, (4) EROI and the economy, and (5) the minimum EROI for society. The second manuscript provides a methodological framework for performing EROI analysis. I cover the following areas in this manuscript: (1) boundaries of analysis, (2) energy quality corrections, (3) energy intensity values, and lastly (4) alternative EROI statistics. The applications section contains manuscripts three through five. The third manuscript provides a biophysical model of economic growth indicating that the feedback mechanisms between oil supply and oil price have created a growth paradox: maintaining business as usual economic growth will require the production of new sources of oil, yet the only sources of oil remaining require high oil prices, thus hampering economic growth. The fourth manuscript is a study on the geographic variability of corn ethanol production. The main conclusions of this study were: (1) the statistical error associated with calculating the EROI of corn ethanol was enough to cast doubt as to whether corn ethanol yields net energy, and (2) failure to account for the geographic variation in corn yields and fertilizer inputs artificially inflated previous estimates of the EROI or corn ethanol. In the fifth manuscript I measure the impact of the Urban Heat Island within the metropolitan area of San Juan, Puerto Rico, on the electricity demand within the city. I calculated that the UHI

  1. Biotic games and cloud experimentation as novel media for biophysics education (United States)

    Riedel-Kruse, Ingmar; Blikstein, Paulo


    First-hand, open-ended experimentation is key for effective formal and informal biophysics education. We developed, tested and assessed multiple new platforms that enable students and children to directly interact with and learn about microscopic biophysical processes: (1) Biotic games that enable local and online play using galvano- and photo-tactic stimulation of micro-swimmers, illustrating concepts such as biased random walks, Low Reynolds number hydrodynamics, and Brownian motion; (2) an undergraduate course where students learn optics, electronics, micro-fluidics, real time image analysis, and instrument control by building biotic games; and (3) a graduate class on the biophysics of multi-cellular systems that contains a cloud experimentation lab enabling students to execute open-ended chemotaxis experiments on slimemolds online, analyze their data, and build biophysical models. Our work aims to generate the equivalent excitement and educational impact for biophysics as robotics and video games have had for mechatronics and computer science, respectively. We also discuss how scaled-up cloud experimentation systems can support MOOCs with true lab components and life-science research in general.

  2. Novel Acoustic Wave Microsystems for Biophysical Studies of Cells (United States)

    Senveli, Sukru Ufuk

    biocompatible polymer, for dispensing cells into microcavities. A high frequency PCB including a matching circuit was designed for the SAW devices. 3D printed housing was also prepared for demonstrating the integration capability. Experimental results were collected first for analysis of high glycerin content in deionized water. Furthermore, polystyrene microbeads were counted with the system, and their sizes were differentiated experimentally to demonstrate the operation with solid media. Ultimately, biological cells were sensed and characterized. After tumor cells in media were transported to and trapped in microcavities, the proposed platform used SAW interaction between the substrate and the cells to extract their mechanical stiffness based on the ultrasound velocity. Measurements showed that output phase information is an indicator of the stiffness modulus of the trapped cells. Small populations of various types of cells such as MCF7, MDA-MB-231, SKBR3, and JJ012 were characterized and characteristic moduli were estimated for each cell population. In conclusion, the results indicate that high frequency stiffness modulus is a possible biomarker for aggressiveness of the tumor and that microcavity coupled SAW devices are a good candidate for non-invasive interrogation and high frequency biophysical studies of single cells. The proposed system is a successfully miniaturized ultrasonic biosensor and can be integrated with microchannels to obtain higher throughput upon refinement of the design as evidenced by the initial results with microfluidics. Improvement in performance and signal strength is also shown to be possible through matching circuits as demonstrated.

  3. Biophysical interactions in the Cabo Frio upwelling system, southeastern Brazil

    Directory of Open Access Journals (Sweden)

    Sergio Augusto Coelho-Souza


    Full Text Available The rising of cold water from deeper levels characterizes coastal upwelling systems. This flow makes nutrients available in the euphotic layer, which enhances phytoplankton production and growth. On the Brazilian coast, upwelling is most intense in the Cabo Frio region (RJ. The basic knowledge of this system was reviewed in accordance with concepts of biophysical interactions. The high frequency and amplitude of the prevailing winds are the main factor promoting the rise of South Atlantic Central Water, but meanders and eddies in the Brazil Current as well as local topography and coast line are also important. Upwelling events are common during spring/summer seasons. Primary biomass is exported by virtue of the water circulation and is also controlled by rapid zooplankton predation. Small pelagic fish regulate plankton growth and in their turn are preyed on by predatory fish. Sardine furnishes an important regional fish stock. Shoreline irregularities define the embayment formation of the Marine Extractive Reserve of Arraial do Cabo making it an area with evident different intensities of upwelled water that harbors high species diversity. Consequently, on a small spatial scale there are environments with tropical and subtropical features, a point to be explored as a particularity of this ecosystem.Os sistemas costeiros de ressurgência são caracterizados pela ascensão de águas frias que tornam os nutrientes disponíveis na camada eufótica para o crescimento e aumento da produção fitoplanctônica. No Brasil, a região do Cabo Frio (RJ é o principal sistema de ressurgência costeira. O objetivo desse artigo foi revisar o atual conhecimento desse sistema através dos conceitos sobre interações biofísicas. A ascensão da Água Central do Atlântico Sul ocorre devido à alta frequência e amplitude dos ventos, à presença de meandros e vórtices na Corrente do Brasil, além da topografia local e da linha de costa. Os eventos de ressurg

  4. Materials science and biophysics applications at the ISOLDE radioactive ion beam facility

    CERN Document Server

    Wahl, U


    The ISOLDE isotope separator facility at CERN provides a variety of radioactive ion beams, currently more than 800 different isotopes from ~65 chemical elements. The radioisotopes are produced on-line by nuclear reactions from a 1.4 GeV proton beam with various types of targets, outdiffusion of the reaction products and, if possible, chemically selective ionisation, followed by 60 kV acceleration and mass separation. While ISOLDE is mainly used for nuclear and atomic physics studies, applications in materials science and biophysics account for a significant part (currently ~15%) of the delivered beam time, requested by 18 different experiments. The ISOLDE materials science and biophysics community currently consists of ~80 scientists from more than 40 participating institutes and 21 countries. In the field of materials science, investigations focus on the study of semiconductors and oxides, with the recent additions of nanoparticles and metals, while the biophysics studies address the toxicity of metal ions i...

  5. Ultrasound assessment of the fetal biophysical profile: What does an radiologist need to know?

    Energy Technology Data Exchange (ETDEWEB)

    Guimaraes Filho, Helio Antonio [Sao Paulo' s Federal University, Paulista Medical School (Unifesp- EPM), Sao Paulo (Brazil); ECOCLINICA, Paraiba (Brazil)], E-mail:; Araujo Junior, Edward; Marcondes Machado Nardozza, Luciano [Sao Paulo' s Federal University, Paulista Medical School (Unifesp-EPM), Sao Paulo (Brazil); Linhares Dias da Costa, Lavoisier [ECOCLINICA, Paraiba (Brazil); Fernandes Moron, Antonio; Mattar, Rosiane [Sao Paulo' s Federal University, Paulista Medical School (Unifesp-EPM), Sao Paulo (Brazil)


    Proposed by Frank Manning about 26 years ago, fetal biophysical profile has been incorporated to the propaedeutics of non-invasive fetal well being assessment in high-risk gestations. Despite the existence of other methods for assessing fetal vitality, as Doppler flowmetry, the biophysical profile continues to be important in estimating the risk of hypoxia and perinatal morbimortality for those fetuses. In the present article, the authors review the regulatory mechanisms of fetal biophysical activities, as well as physiological and pathological factors that interfere with them. The main objective of the study is to discuss the present and important aspects of the method, and the practical applications and interpretation of its findings, in order to help radiologists improve their knowledge in this specific area of fetal ultrasonography.

  6. Introducing interdisciplinary science to second year undergraduates in a Current Topics in Biophysics course

    CERN Document Server

    Jerzak, Stanislaw


    We offer second year students the opportunity to explore Current Topics in Biophysics in a course co-taught by a physicist and a biologist. The interdisciplinary course allows university students to engage in analytical thinking that integrates physics and biology. The students are either biophysics majors (50%) or from a diversity of science majors (about 30% life sciences). All will have taken first year courses in biology, physics and mathematics. The course is divided into: 1) The application of physical approaches to biological problems using case studies (how high can a tree grow? and biological pumps are two examples); 2) An introduction to physics concepts for which potential applications are explored (biophotonics and its application in fluorescence microscopy and photodynamic therapy is one example); and 3) Presentations from industry and university researchers who describe careers, research and clinical applications of biophysics. Over the six years the course has been offered, students have achiev...

  7. Electrophysiological Data and the Biophysical Modelling of Local Cortical Circuits

    Directory of Open Access Journals (Sweden)

    Dimitris Pinotsis


    Full Text Available This paper shows how recordings of gamma oscillations – under different experimental conditions or from different subjects – can be combined with a class of population models called neural fields and dynamic causal modeling (DCM to distinguish among alternative hypotheses regarding cortical structure and function. This approach exploits inter-subject variability and trial-specific effects associated with modulations in the peak frequency of gamma oscillations. It draws on the computational power of Bayesian model inversion, when applied to neural field models of cortical dynamics. Bayesian model comparison allows one to adjudicate among different mechanistic hypotheses about cortical excitability, synaptic kinetics and the cardinal topographic features of local cortical circuits. It also provides optimal parameter estimates that quantify neuromodulation and the spatial dispersion of axonal connections or summation of receptive fields in the visual cortex. This paper provides an overview of a family of neural field models that have been recently implemented using the DCM toolbox of the academic freeware Statistical Parametric Mapping (SPM. The SPM software is a popular platform for analyzing neuroimaging data, used by several neuroscience communities worldwide. DCM allows for a formal (Bayesian statistical analysis of cortical network connectivity, based upon realistic biophysical models of brain responses. It is this particular feature of DCM – the unique combination of generative models with optimization techniques based upon (variational Bayesian principles – that furnishes a novel way to characterize functional brain architectures. In particular, it provides answers to questions about how the brain is wired and how it responds to different experimental manipulations. For a review of the general role of neural fields in SPM the reader can consult e.g. see [1]. Neural fields have a long and illustrious history in mathematical

  8. Structural and biophysical characteristics of human skin in maintaining proper epidermal barrier function. (United States)

    Boer, Magdalena; Duchnik, Ewa; Maleszka, Romuald; Marchlewicz, Mariola


    The complex structure of human skin and its physicochemical properties turn it into an efficient outermost defence line against exogenous factors, and help maintain homeostasis of the human body. This role is played by the epidermal barrier with its major part - stratum corneum. The condition of the epidermal barrier depends on individual and environmental factors. The most important biophysical parameters characterizing the status of this barrier are the skin pH, epidermal hydration, transepidermal water loss and sebum excretion. The knowledge of biophysical skin processes may be useful for the implementation of prophylactic actions whose aim is to restore the barrier function.

  9. Biophysical characterization of hematopoietic cells from normal and leukemic sources with distinct primitiveness (United States)

    Tan, Youhua; Fung, Tsz-Kan; Wan, Haixia; Wang, Kaiqun; Leung, Anskar Y. H.; Sun, Dong


    This letter reported the biophysical characterization of immunophenotypically distinct hematopoietic cells from normal and leukemic sources, through manipulation with optical tweezers at single cell level. The results show that the percentage of cells that are stretchable and their deformability are significantly higher in the more primitive cell populations. This study provides the evidence that normal and leukemic hematopoietic cell populations with distinct primitiveness exhibit differential biophysical properties. These findings raise a hypothesis that the high deformability may be related to the unique functions and activities of primitive hematopoietic cells.

  10. Study of the Peculiarities of Color Vision in the Course of "Biophysics" in a Pedagogical University (United States)

    Petrova, Elena Borisovna; Sabirova, Fairuza Musovna


    The article substantiates the necessity of studying the peculiarities of color vision of human in the course "Biophysics" that have been integrated into many types of higher education institutions. It describes the experience of teaching this discipline in a pedagogical higher education institution. The article presents a brief review of…

  11. Coupling Biophysical and Socioeconomic Models for Coral Reef Systems in Quintana Roo, Mexican Caribbean

    Directory of Open Access Journals (Sweden)

    Elizabeth A. Fulton


    Full Text Available Transdisciplinary approaches that consider both socioeconomic and biophysical processes are central to understanding and managing rapid change in coral reef systems worldwide. To date, there have been limited attempts to couple the two sets of processes in dynamic models for coral reefs, and these attempts are confined to reef systems in developed countries. We present an approach to coupling existing biophysical and socioeconomic models for coral reef systems in the Mexican state of Quintana Roo. The biophysical model is multiscale, using dynamic equations to capture local-scale ecological processes on individual reefs, with reefs connected at regional scales by the ocean transport of larval propagules. The agent-based socioeconomic model simulates changes in tourism, fisheries, and urbanization in the Quintana Roo region. Despite differences in the formulation and currencies of the two models, we were able to successfully modify and integrate them to synchronize and define information flows and feedbacks between them. A preliminary evaluation of the coupled model system indicates that the model gives reasonable predictions for fisheries and ecological variables and can be used to examine scenarios for future social–ecological change in Quintana Roo. We provide recommendations for where efforts might usefully be focused in future attempts to integrate models of biophysical and socioeconomic processes, based on the limitations of our coupled system.

  12. 6th international conference on biophysics and synchrotron radiation. Program/Abstracts

    Energy Technology Data Exchange (ETDEWEB)

    Pittroff, Connie; Strasser, Susan Barr [lead editors


    This STI product consists of the Program/Abstracts book that was prepared for the participants in the Sixth International Conference on Biophysics and Synchrotron Radiation that was held August 4-8, 1998, at the Advanced Photon Source, Argonne National Laboratory. This book contains the full conference program and abstracts of the scientific presentations.

  13. Quenching of Tryptophan Fluorescence in Unfolded Cytochrome "c": A Biophysics Experiment for Physical Chemistry Students (United States)

    Schlamadinger, Diana E.; Kats, Dina I.; Kim, Judy E.


    Laboratory experiments that focus on protein folding provide excellent opportunities for undergraduate students to learn important topics in the expanding interdisciplinary field of biophysics. Here, we describe the use of Stern-Volmer plots to determine the extent of solvent accessibility of the single tryptophan residue (trp-59) in unfolded and…

  14. A biophysical index for predicting hydration-mediated microbial diversity in soils (United States)

    Wang, G.; Or, D.


    Exploring the origins of soil microbial diversity represents an immense and uncharted scientific frontier. Progress in resolving mechanisms that promote and sustain the unparalleled soil microbial diversity found in soil requires development of process-based predictive tools that consider dynamic biophysical interactions at highly resolved spatial and temporal scales. We report a novel biophysical metric for hydration-mediated microbial coexistence in soils by integrating key biophysical variables, such as aquatic habitat size and connectivity, nutrient diffusion affecting microbial growth, and aqueous films controlling motility and dispersal, into a predictive index. Results show a surprisingly narrow range of hydration conditions (a few kPa) that mark a sharp transition from suppression (wet) to promotion (dry) of microbial diversity in unsaturated soils in agreement with limited observations and with simulation results based on individual-based models of competing populations. The framework enables systematic hypothesis testing for key factors that regulate microbial populations and affect soil bio-geochemical functions, and represents a step towards deciphering key mechanisms that support soil microbial diversity. New insights into the different roles of biophysical mechanisms in promoting soil microbial diversity enable predictions concerning microbial consortia function and bioremediation activities in soils, and may shape how we quantify microbial diversity within the context of land resources and biogeochemical cycling.

  15. Biophysical inhibition of synthetic vs. naturally-derived pulmonary surfactant preparations by polymeric nanoparticles. (United States)

    Beck-Broichsitter, Moritz; Ruppert, Clemens; Schmehl, Thomas; Günther, Andreas; Seeger, Werner


    Reasonable suspicion has accumulated that inhaled nano-scale particulate matter influences the biophysical function of the pulmonary surfactant system. Hence, it is evident to provide novel insights into the extent and mechanisms of nanoparticle-surfactant interactions in order to facilitate the fabrication of safe nanomedicines suitable for pulmonary applications. Negatively- and positively-charged poly(styrene) nanoparticles (diameters of ~100nm) served as model carriers. Nanoparticles were incubated with several synthetic and naturally-derived pulmonary surfactants to characterize the sensitivity of each preparation to biophysical inactivation. Changes in surface properties (i.e. adsorption and dynamic surface tension behavior) were monitored in a pulsating bubble surfactometer. Both nanoparticle formulations revealed a dose-dependent influence on the biophysical behavior of all investigated pulmonary surfactants. However, the surfactant sensitivity towards inhibition depended on both the carrier type, where negatively-charged nanoparticles showed increased inactivation potency compared to their positively-charged counterparts, and surfactant composition. Among the surfactants tested, synthetic mixtures (i.e. phospholipids, phospholipids supplemented with surfactant protein B, and Venticute®) were more susceptible to surface-activity inhibition as the more complex naturally-derived preparations (i.e. Alveofact® and large surfactant aggregates isolated from rabbit bronchoalveolar lavage fluid). Overall, nanoparticle characteristics and surfactant constitution both influence the extent of biophysical inhibition of pulmonary surfactants.

  16. Biophysical inhibition of pulmonary surfactant function by polymeric nanoparticles: role of surfactant protein B and C. (United States)

    Beck-Broichsitter, Moritz; Ruppert, Clemens; Schmehl, Thomas; Günther, Andreas; Seeger, Werner


    The current study investigated the mechanisms involved in the process of biophysical inhibition of pulmonary surfactant by polymeric nanoparticles (NP). The minimal surface tension of diverse synthetic surfactants was monitored in the presence of bare and surface-decorated (i.e. poloxamer 407) sub-100 nm poly(lactide) NP. Moreover, the influence of NP on surfactant composition (i.e. surfactant protein (SP) content) was studied. Dose-elevations of SP advanced the biophysical activity of the tested surfactant preparation. Surfactant-associated protein C supplemented phospholipid mixtures (PLM-C) were shown to be more susceptible to biophysical inactivation by bare NP than phospholipid mixture supplemented with surfactant protein B (PLM-B) and PLM-B/C. Surfactant function was hindered owing to a drastic depletion of the SP content upon contact with bare NP. By contrast, surface-modified NP were capable of circumventing unwanted surfactant inhibition. Surfactant constitution influences the extent of biophysical inhibition by polymeric NP. Steric shielding of the NP surface minimizes unwanted NP-surfactant interactions, which represents an option for the development of surfactant-compatible nanomedicines.

  17. Biophysical and human factors determine the distribution of poached elephants in Tsavo East National Park, Kenya

    NARCIS (Netherlands)

    Kyale, D.M.; Ngene, S.M.; Maingi, J.


    This study investigates the distribution of poached elephants as well as the biophysical and anthropogenic factors that determine the distribution of the poached elephants in Tsavo East National Park (TENP), Kenya. Data on the distribution of poached elephants, from 1990 to 2005, were acquired from

  18. Significance of Landcover Biophysical Parameters Derived from Remote Sensing Data for Environmental Studies (United States)

    Zoran, M.; Stefan, S.


    Remote sensing is a key application in global-change science, being very useful for local and regional climatology and landuse/landcover dynamics analysis. Based on satellite images (LANDSAT TM, ETM and ASTER) of Romanian Black Sea coastal zone, centered on Constantza urban area were derived surface biophysical parameters for 1975 - 2003 period.

  19. From global change to a butterfly flapping: biophysics and behaviour affect tropical climate change impacts. (United States)

    Bonebrake, Timothy C; Boggs, Carol L; Stamberger, Jeannie A; Deutsch, Curtis A; Ehrlich, Paul R


    Difficulty in characterizing the relationship between climatic variability and climate change vulnerability arises when we consider the multiple scales at which this variation occurs, be it temporal (from minute to annual) or spatial (from centimetres to kilometres). We studied populations of a single widely distributed butterfly species, Chlosyne lacinia, to examine the physiological, morphological, thermoregulatory and biophysical underpinnings of adaptation to tropical and temperate climates. Microclimatic and morphological data along with a biophysical model documented the importance of solar radiation in predicting butterfly body temperature. We also integrated the biophysics with a physiologically based insect fitness model to quantify the influence of solar radiation, morphology and behaviour on warming impact projections. While warming is projected to have some detrimental impacts on tropical ectotherms, fitness impacts in this study are not as negative as models that assume body and air temperature equivalence would suggest. We additionally show that behavioural thermoregulation can diminish direct warming impacts, though indirect thermoregulatory consequences could further complicate predictions. With these results, at multiple spatial and temporal scales, we show the importance of biophysics and behaviour for studying biodiversity consequences of global climate change, and stress that tropical climate change impacts are likely to be context-dependent.

  20. Learning from Our Evolving Understanding of Biophysical Interactions to Improve River Restoration Practice. (United States)

    Sear, D. A.


    Restoration of riverine habitats has largely proceeded on the assumption that by improving physical habitat, and more latterly processes, biophysical interactions will reassemble to a state similar to that prior to the disturbance event. Whilst there had been little monitoring to support this view, there is increasing evidence that the complexity of ecological systems demands a greater understanding of these biophysical interactions before we can state that a restoration has succeeded. In this paper I will draw on two examples to demonstrate the importance of understanding the spatial as well as the temporal scale of biophysical interactions. In the first example, field and modelling was used to demonstrate how different location of large wood and forest restoration can result in different hydrological outcomes. Similarly, as the forest matures it is possible to see change in restoration outcomes, extending beyond the lifetime of the project. In the second example I demonstrate how climate and land use drive the biophysical interactions within spawning salmonid habitats, research that questions accepted models used in the restoration of salmonid spawning habitat. Finally the paper reflects on the problems of restoring complex ecosystems; and points towards the need for improvements in how we research and communicate with stakeholders who ultimately live by the streams we restore.

  1. An ethnographic study: Becoming a physics expert in a biophysics research group (United States)

    Rodriguez, Idaykis

    Expertise in physics has been traditionally studied in cognitive science, where physics expertise is understood through the difference between novice and expert problem solving skills. The cognitive perspective of physics experts only create a partial model of physics expertise and does not take into account the development of physics experts in the natural context of research. This dissertation takes a social and cultural perspective of learning through apprenticeship to model the development of physics expertise of physics graduate students in a research group. I use a qualitative methodological approach of an ethnographic case study to observe and video record the common practices of graduate students in their biophysics weekly research group meetings. I recorded notes on observations and conduct interviews with all participants of the biophysics research group for a period of eight months. I apply the theoretical framework of Communities of Practice to distinguish the cultural norms of the group that cultivate physics expert practices. Results indicate that physics expertise is specific to a topic or subfield and it is established through effectively publishing research in the larger biophysics research community. The participant biophysics research group follows a learning trajectory for its students to contribute to research and learn to communicate their research in the larger biophysics community. In this learning trajectory students develop expert member competencies to learn to communicate their research and to learn the standards and trends of research in the larger research community. Findings from this dissertation expand the model of physics expertise beyond the cognitive realm and add the social and cultural nature of physics expertise development. This research also addresses ways to increase physics graduate student success towards their PhD. and decrease the 48% attrition rate of physics graduate students. Cultivating effective research

  2. Past and Present Biophysical Redundancy of Countries as a Buffer to Changes in Food Supply (United States)

    Fader, Marianela; Rulli, Maria Cristina; Carr, Joel; Dell' Angelo, Jampel; D' Odorico, Paolo; Gephart, Jessica A.; Kummu, Matti; Magliocca, Nicholas; Porkka, Miina; Prell, Christina; Puma, Michael J.


    Spatially diverse trends in population growth, climate change, industrialization, urbanization and economic development are expected to change future food supply and demand. These changes may affect the suitability of land for food production, implying elevated risks especially for resource constrained, food-importing countries. We present the evolution of biophysical redundancy for agricultural production at country level, from 1992 to 2012. Biophysical redundancy, defined as unused biotic and abiotic environmental resources, is represented by the potential food production of 'spare land', available water resources (i.e., not already used for human activities), as well as production increases through yield gap closure on cultivated areas and potential agricultural areas. In 2012, the biophysical redundancy of 75 (48) countries, mainly in North Africa, Western Europe, the Middle East and Asia, was insufficient to produce the caloric nutritional needs for at least 50% (25%) of their population during a year. Biophysical redundancy has decreased in the last two decades in 102 out of 155 countries, 11 of these went from high to limited redundancy, and nine of these from limited to very low redundancy. Although the variability of the drivers of change across different countries is high, improvements in yield and population growth have a clear impact on the decreases of redundancy towards the very low redundancy category. We took a more detailed look at countries classified as 'Low Income Economies (LIEs)' since they are particularly vulnerable to domestic or external food supply changes, due to their limited capacity to offset for food supply decreases with higher purchasing power on the international market. Currently, nine LIEs have limited or very low biophysical redundancy. Many of these showed a decrease in redundancy over the last two decades, which is not always linked with improvements in per capita food availability.

  3. Past and present biophysical redundancy of countries as a buffer to changes in food supply (United States)

    Fader, Marianela; Rulli, Maria Cristina; Carr, Joel; Dell'Angelo, Jampel; D'Odorico, Paolo; Gephart, Jessica A.; Kummu, Matti; Magliocca, Nicholas; Porkka, Miina; Prell, Christina; Puma, Michael J.; Ratajczak, Zak; Seekell, David A.; Suweis, Samir; Tavoni, Alessandro


    Spatially diverse trends in population growth, climate change, industrialization, urbanization and economic development are expected to change future food supply and demand. These changes may affect the suitability of land for food production, implying elevated risks especially for resource-constrained, food-importing countries. We present the evolution of biophysical redundancy for agricultural production at country level, from 1992 to 2012. Biophysical redundancy, defined as unused biotic and abiotic environmental resources, is represented by the potential food production of ‘spare land’, available water resources (i.e., not already used for human activities), as well as production increases through yield gap closure on cultivated areas and potential agricultural areas. In 2012, the biophysical redundancy of 75 (48) countries, mainly in North Africa, Western Europe, the Middle East and Asia, was insufficient to produce the caloric nutritional needs for at least 50% (25%) of their population during a year. Biophysical redundancy has decreased in the last two decades in 102 out of 155 countries, 11 of these went from high to limited redundancy, and nine of these from limited to very low redundancy. Although the variability of the drivers of change across different countries is high, improvements in yield and population growth have a clear impact on the decreases of redundancy towards the very low redundancy category. We took a more detailed look at countries classified as ‘Low Income Economies (LIEs)’ since they are particularly vulnerable to domestic or external food supply changes, due to their limited capacity to offset for food supply decreases with higher purchasing power on the international market. Currently, nine LIEs have limited or very low biophysical redundancy. Many of these showed a decrease in redundancy over the last two decades, which is not always linked with improvements in per capita food availability.

  4. Satellite mapping of surface biophysical parameters at the biome scale over the North American grasslands a case study (United States)

    Wylie, B.K.; Meyer, D.J.; Tieszen, L.L.; Mannel, S.


    Quantification of biophysical parameters is needed by terrestrial process modeling and other applications. A study testing the role of multispectral data for monitoring biophysical parameters was conducted over a network of grassland field sites in the Great Plains of North America. Grassland biophysical parameters [leaf area index (LAI), fraction of absorbed photosynthetically active radiation (fPAR), and biomass] and their relationships with ground radiometer normalized difference vegetation index (NDVI) were established in this study (r2=.66-.85) from data collected across the central and northern Great Plains in 1995. These spectral/biophysical relationships were compared to 1996 field data from the Tallgrass Prairie Preserve in northeastern Oklahoma and showed no consistent biases, with most regression estimates falling within the respective 95% confidence intervals. Biophysical parameters were estimated for 21 "ground pixels" (grids) at the Tallgrass Prairie Preserve in 1996, representing three grazing/burning treatments. Each grid was 30 ?? 30 m in size and was systematically sampled with ground radiometer readings. The radiometric measurements were then converted to biophysical parameters and spatially interpolated using geostatistical kriging. Grid-based biophysical parameters were monitored through the growing season and regressed against Landsat Thematic Mapper (TM) NDVI (r2=.92-.94). These regression equations were used to estimate biophysical parameters for grassland TM pixels over the Tallgrass Prairie Preserve in 1996. This method maintained consistent regression development and prediction scales and attempted to minimize scaling problems associated with mixed land cover pixels. A method for scaling Landsat biophysical parameters to coarser resolution satellite data sets (1 km2) was also investigated. ?? 2002 Elsevier Science Inc. All rights reserved.

  5. Canopy-scale biophysical controls on transpiration and evaporation in the Amazon Basin

    DEFF Research Database (Denmark)

    Mallick, Kaniska; Trebs, Ivonne; Bøgh, Eva


    to directly quantify the canopy-scale biophysical controls on λET and λEE over multiple plant functional types (PFTs) in the Amazon Basin. Combining data from six LBA (Large-scale Biosphere-Atmosphere Experiment in Amazonia) eddy covariance tower sites and a TR-driven physically based modeling approach, we...... predominantly radiation driven and net radiation (RN) determines 75 to 80 % of the variances of λET. However, biophysical control on λET is dramatically increased during the dry seasons, and particularly the 2005 drought year, explaining 50 to 65 % of the variances of λET, and indicates λET to be substantially...

  6. A selective view of stochastic inference and modeling problems in nanoscale biophysics

    Institute of Scientific and Technical Information of China (English)

    KOU S. C.


    Advances in nanotechnology enable scientists for the first time to study biological processes on a nanoscale molecule-by-molecule basis. They also raise challenges and opportunities for statisticians and applied probabilists. To exemplify the stochastic inference and modeling problems in the field, this paper discusses a few selected cases, ranging from likelihood inference, Bayesian data augmentation, and semi- and non-parametric inference of nanometric biochemical systems to the utilization of stochastic integro-differential equations and stochastic networks to model single-molecule biophysical processes. We discuss the statistical and probabilistic issues as well as the biophysical motivation and physical meaning behind the problems, emphasizing the analysis and modeling of real experimental data.

  7. A selective view of stochastic inference and mod-eling problems in nanoscale biophysics

    Institute of Scientific and Technical Information of China (English)

    KOU; S.C.


    Advances in nanotechnology enable scientists for the first time to study biological pro-cesses on a nanoscale molecule-by-molecule basis.They also raise challenges and opportunities for statisticians and applied probabilists.To exemplify the stochastic inference and modeling problems in the field,this paper discusses a few selected cases,ranging from likelihood inference,Bayesian data augmentation,and semi-and non-parametric inference of nanometric biochemical systems to the uti-lization of stochastic integro-differential equations and stochastic networks to model single-molecule biophysical processes.We discuss the statistical and probabilistic issues as well as the biophysical motivation and physical meaning behind the problems,emphasizing the analysis and modeling of real experimental data.

  8. Biophysical Measurements of Cells, Microtubules, and DNA with an Atomic Force Microscope

    CERN Document Server

    Devenica, Luka M; Cabrejo, Raysa; Kurek, Matthew; Deveney, Edward F; Carter, Ashley R


    Atomic force microscopes (AFMs) are ubiquitous in research laboratories and have recently been priced for use in teaching laboratories. Here we review several AFM platforms (Dimension 3000 by Digital Instruments, EasyScan2 by Nanosurf, ezAFM by Nanomagnetics, and TKAFM by Thorlabs) and describe various biophysical experiments that could be done in the teaching laboratory using these instruments. In particular, we focus on experiments that image biological materials and quantify biophysical parameters: 1) imaging cells to determine membrane tension, 2) imaging microtubules to determine their persistence length, 3) imaging the random walk of DNA molecules to determine their contour length, and 4) imaging stretched DNA molecules to measure the tensional force.

  9. Surface-enhanced Raman scattering: a new optical probe in molecular biophysics and biomedicine

    DEFF Research Database (Denmark)

    Kneipp, J.; Wittig, B.; Bohr, Henrik


    Sensitive and detailed molecular structural information plays an increasing role in molecular biophysics and molecular medicine. Therefore, vibrational spectroscopic techniques, such as Raman scattering, which provide high structural information content are of growing interest in biophysical...... of the free electrons in the metal. This effect of surface-enhanced Raman scattering (SERS) allows us to push vibrational spectroscopy to new limits in detection sensitivity, lateral resolution, and molecular structural selectivity. This opens up exciting perspectives also in molecular biospectroscopy...... and biomedical research. Raman spectroscopy can be revolutionized when the inelastic scattering process takes place in the very close vicinity of metal nanostructures. Under these conditions, strongly increased Raman signals can be obtained due to resonances between optical fields and the collective oscillations...

  10. Protein-protein interactions: a supra-structural phenomenon demanding trans-disciplinary biophysical approaches. (United States)

    Byron, Olwyn; Vestergaard, Bente


    Responsive formation of protein:protein interaction (PPI) upon diverse stimuli is a fundament of cellular function. As a consequence, PPIs are complex, adaptive entities, and exist in structurally heterogeneous interplays defined by the energetic states of the free and complexed protomers. The biophysical and structural investigations of PPIs consequently demand hybrid approaches, implementing orthogonal methods and strategies for global data analysis. Currently, impressive developments in hardware and software within several methodologies define a new era for the biostructural community. Data can be obtained at increasing resolution, at relevant time-scales and under increasingly relevant experimental conditions, intricate data are interpreted reliably, and the questions posed and answered grow in complexity. With this review, highlights from the study of PPIs using a multitude of biophysical methods, are reported. The aim is to depict how the elucidation of the interplay of structures requires the interplay of methods.

  11. The Role of Biophysical Parameters in the Antilipopolysaccharide Activities of Antimicrobial Peptides from Marine Fish

    Directory of Open Access Journals (Sweden)

    Ramamourthy Gopal


    Full Text Available Numerous antimicrobial peptides (AMPs from marine fish have been identified, isolated and characterized. These peptides act as host defense molecules that exert antimicrobial effects by targeting the lipopolysaccharide (LPS of Gram-negative bacteria. The LPS-AMP interactions are driven by the biophysical properties of AMPs. In this review, therefore, we will focus on the physiochemical properties of AMPs; that is, the contributions made by their sequences, net charge, hydrophobicity and amphipathicity to their mechanism of action. Moreover, the interactions between LPS and fish AMPs and the structure of fish AMPs with LPS bound will also be discussed. A better understanding of the biophysical properties will be useful in the design of AMPs effective against septic shock and multidrug-resistant bacterial strains, including those that commonly produce wound infections.

  12. Biophysical properties of Saccharomyces cerevisiae and their relationship with HOG pathway activation


    Schaber, Jörg; Adrover, Miquel Àngel; Eriksson, Emma; Pelet, Serge; Petelenz-Kurdziel, Elzbieta; Klein, Dagmara; Posas, Francesc; Goksör, Mattias; Peter, Mathias; Hohmann, Stefan; Klipp, Edda


    Parameterized models of biophysical and mechanical cell properties are important for predictive mathematical modeling of cellular processes. The concepts of turgor, cell wall elasticity, osmotically active volume, and intracellular osmolarity have been investigated for decades, but a consistent rigorous parameterization of these concepts is lacking. Here, we subjected several data sets of minimum volume measurements in yeast obtained after hyper-osmotic shock to a thermodynamic modeling frame...

  13. Biophysics of skin and its treatments structural, nanotribological, and nanomechanical studies

    CERN Document Server

    Bhushan, Bharat


    This book provides a comprehensive overview of the structural, nanotribological and nanomechanical properties of skin with and without cream treatment as a function of operating environment. The biophysics of skin as the outer layer covering human or animal body is discussed as a complex biological structure. Skin cream is used to improve skin health and create a smooth, soft, and flexible surface with moist perception by altering the surface roughness, friction, adhesion, elastic modulus, and surface charge of the skin surface. .

  14. Structural and biophysical characteristics of human skin in maintaining proper epidermal barrier function


    Boer, Magdalena; Duchnik, Ewa; Maleszka, Romuald; Marchlewicz, Mariola


    The complex structure of human skin and its physicochemical properties turn it into an efficient outermost defence line against exogenous factors, and help maintain homeostasis of the human body. This role is played by the epidermal barrier with its major part – stratum corneum. The condition of the epidermal barrier depends on individual and environmental factors. The most important biophysical parameters characterizing the status of this barrier are the skin pH, epidermal hydration, transep...

  15. Assessment of bio-physical drought hazards. A case study of Karkheh River basin in Iran (United States)

    Kamali, Bahareh; Abbaspour, Karim; Houshmand Kouchi, Delaram; Yang, Hong


    Iran has been affected by frequent droughts. Climate change is expected to intensify the situation in the future. Extreme drought events have had serious impacts on hydrological and agricultural sector. Thus, identification of bio-physical drought hazard is critically important for formulating effective adaptive measures to improve water and food security. This study aims to investigate temporal and spatial pattern of drought hazards in meteorological, hydrological, and agricultural (inclusively biophysical) sectors in the Karkheh River Basin of Iran in the historical and future climate change context. To do so, drought hazard indices were built based on the severity and frequency of standardized precipitation index (SPI), standardized runoff index (SRI), and standardized soil moisture index (SSMI), which represent the three aspects of drought hazards. Variables required for calculating these indices were obtained from SWAT (Soil and Water Assessment Tool) model constructed for the basin. The model was calibrated based on monthly runoff using the Sequential Uncertainty Fitting (SUFI-2) algorithm in SWAT-CUP. Based on the climate variability and drought analysis, three drought hazard classes, namely low, medium and high, were defined. This help identify how agricultural and hydrological sectors are related to meteorological droughts. Additionally, the bio-physical drivers of drought hazards were identified for each class. Comparing the results during historic and future scenarios revealed that the frequency of high- severity hazards will increase, whereas the same is not predicted for the area with medium hazard intensity. Inferred from findings of this study, the combined application of the SWAT model with bio-physical drought hazard concept helps better understanding of climate risks to water and food security. The developed approach is replicable at different scales to provide a robust planning tool for policy makers.

  16. A Hydration-Based Biophysical Index for the Onset of Soil Microbial Coexistence


    Gang Wang; Dani Or


    Mechanistic exploration of the origins of the unparalleled soil microbial biodiversity represents a vast and uncharted scientific frontier. Quantification of candidate mechanisms that promote and sustain such diversity must be linked with microbial functions and measurable biophysical interactions at appropriate scales. We report a novel microbial coexistence index (CI) that links macroscopic soil hydration conditions with microscale aquatic habitat fragmentation that impose restrictions on c...

  17. Materials science and biophysics applications at the ISOLDE radioactive ion beam facility

    Energy Technology Data Exchange (ETDEWEB)

    Wahl, U., E-mail: [Instituto Tecnologico e Nuclear, Estrada Nacional 10, 2686-953 Sacavem (Portugal); Centro de Fisica Nuclear da Universidade de Lisboa, Av. Prof. Gama Pinto 2, 1649-003 Lisboa (Portugal)


    The ISOLDE isotope separator facility at CERN provides a variety of radioactive ion beams, currently more than 800 different isotopes from {approx}70 chemical elements. The radioisotopes are produced on-line by nuclear reactions from a 1.4 GeV proton beam with various types of targets, outdiffusion of the reaction products and, if possible, chemically selective ionisation, followed by 60 kV acceleration and mass separation. While ISOLDE is mainly used for nuclear and atomic physics studies, applications in materials science and biophysics account for a significant part (currently {approx}15%) of the delivered beam time, requested by 18 different experiments. The ISOLDE materials science and biophysics community currently consists of {approx}80 scientists from more than 40 participating institutes and 21 countries. In the field of materials science, investigations focus on the study of semiconductors and oxides, with the recent additions of nanoparticles and metals, while the biophysics studies address the toxicity of metal ions in biological systems. The characterisation methods used are typical radioactive probe techniques such as Moessbauer spectroscopy, perturbed angular correlation, emission channeling, and tracer diffusion studies. In addition to these 'classic' methods of nuclear solid state physics, also standard semiconductor analysis techniques such as photoluminescence or deep level transient spectroscopy profit from the application of radioactive isotopes, which helps them to overcome their chemical 'blindness' since the nuclear half life of radioisotopes provides a signal that changes in time with characteristic exponential decay or saturation curves. In this presentation an overview will be given on the recent research activities in materials science and biophysics at ISOLDE, presenting some of the highlights during the last five years, together with a short outlook on the new developments under way.

  18. Increasing the effectiveness of vaginal microbicides: a biophysical framework to rethink behavioral acceptability.

    Directory of Open Access Journals (Sweden)

    Stéphane Verguet

    Full Text Available BACKGROUND: Microbicide candidates delivered via gel vehicles are intended to coat the vaginal epithelium after application. The coating process depends on intrinsic biophysical properties of the gel texture, which restricts the potential choices for an effective product: the gel first must be physically synthesizable, then acceptable to the user, and finally applied in a manner promoting timely adequate coating, so that the user adherence is optimized. We present a conceptual framework anchoring microbicide behavioral acceptability within the fulfillment of the product biophysical requirements. METHODS: We conducted a semi-qualitative/quantitative study targeting women aged 18-55 in Northern California to assess user preferences for microbicide gel attributes. Attributes included: (i the wait time between application and intercourse, (ii the gel texture and (iii the trade-off between wait time and gel texture. Wait times were assessed using a mathematical model determining coating rates depending upon the gel's physical attributes. RESULTS: 71 women participated. Results suggest that women would independently prefer a gel spreading rapidly, in 2 to 15 minutes (P0.10 for use with a steady partner, a preference for a watery gel spreading rapidly rather than one having intermediate properties for use with a casual partner (P = 0.024. CONCLUSIONS: Biophysical constraints alter women's preferences regarding acceptable microbicide attributes. Product developers should offer a range of formulations in order to address all preferences. We designed a conceptual framework to rethink behavioral acceptability in terms of biophysical requirements that can help improve adherence in microbicide use ultimately enhancing microbicide effectiveness.

  19. Biomedical engineering and biophysics at Forschungszentrum Karlsruhe; Medizintechnik und Biophysik im Forschungszentrum Karlsruhe

    Energy Technology Data Exchange (ETDEWEB)

    Knapp, U. [Forschungszentrum Karlsruhe GmbH Technik und Umwelt (Germany). Programm Mikrosystemtechnik


    Three central topics dominate this R and D-field: Systems development for surgical interventions and diagnostics, encompassing dedicated operation theater systems, training systems for minimally invasive surgery, and image understanding techniques. Activities in support of rehabilitation medicine comprising biophysical investigations and the development of multifunctional prostheses. Application of radioisotope techniques for diagnostics and therapy. Most of the developments are being done in close collaboration with clinical and industrial partners. (orig.)

  20. Recent microwave research studies of Gazi Biophysics & Gazi Non-Ionizing Radiation Protection Center


    SEYHAN, Nesrin


    Gazi Biophysics is located in Ankara at the Medical Faculty of Gazi University and has been carrying out in vivo and in vitro research studies on the biological impacts of Static, Extremely Low Frequency (ELF) and Microwave (MW) electromagnetic fields (EMF) since 1989. Our laboratory includes: Physicists, biologists, electrical engineers, all of whom are studying how living systems respond to EMF. Our research team includes physicists, biologists, electrical engineers, physicians, biochemists...

  1. Interplay of mycolic acids, antimycobacterial compounds and pulmonary surfactant membrane: a biophysical approach to disease. (United States)

    Pinheiro, Marina; Giner-Casares, Juan J; Lúcio, Marlene; Caio, João M; Moiteiro, Cristina; Lima, José L F C; Reis, Salette; Camacho, Luis


    This work focuses on the interaction of mycolic acids (MAs) and two antimycobacterial compounds (Rifabutin and N'-acetyl-Rifabutin) at the pulmonary membrane level to convey a biophysical perspective of their role in disease. For this purpose, accurate biophysical techniques (Langmuir isotherms, Brewster angle microscopy, and polarization-modulation infrared reflection spectroscopy) and lipid model systems were used to mimic biomembranes: MAs mimic bacterial lipids of the Mycobacterium tuberculosis (MTb) membrane, whereas Curosurf® was used as the human pulmonary surfactant (PS) membrane model. The results obtained show that high quantities of MAs are responsible for significant changes on PS biophysical properties. At the dynamic inspiratory surface tension, high amounts of MAs decrease the order of the lipid monolayer, which appears to be a concentration dependent effect. These results suggest that the amount of MAs might play a critical role in the initial access of the bacteria to their targets. Both molecules also interact with the PS monolayer at the dynamic inspiratory surface. However, in the presence of higher amounts of MAs, both compounds improve the phospholipid packing and, therefore, the order of the lipid surfactant monolayer. In summary, this work discloses the putative protective effects of antimycobacterial compounds against the MAs induced biophysical impairment of PS lipid monolayers. These protective effects are most of the times overlooked, but can constitute an additional therapeutic value in the treatment of pulmonary tuberculosis (Tb) and may provide significant insights for the design of new and more efficient anti-Tb drugs based on their behavior as membrane ordering agents.

  2. A Biophysical-Computational Perspective of Breast Cancer Pathogenesis and Treatment Response (United States)


    metastasis through the vasculature. For instance, MMP2 and -14 secreted by tumors cells can cleave pro laminin-5 to expose a cryptic site within...poly acrylamide to bis acrylamide cross-linker, a range of quantifiable matrix stiffnesses can be achieved onto which ligand of choice can be...throughout the life span of the female . A myriad of continuously evolving biochemical and biophysical cues are required to direct the proper formation

  3. Effects of biophysical and biochemical cues on human corneal epithelial cell behavior (United States)

    Tocce, Elizabeth J.


    Recent advances in the design of biomaterials aim at mimicking the natural biophysical and biochemical components found in a tissue's extracellular environment (ECM). Of particular interest in this work is mimicking the specialized ECM of the human corneal epithelium called the basement membrane (BM) and understanding how corneal epithelial cells (HCECs) respond to biophysical and biochemical cues. To this end, well defined topographic features with dimension of the BM (20 to 200 nm) were fabricated to support controlled cell interactions with biochemical motifs (e.g., adhesive peptide ligands) found in the BM. Here, features of 30 to 70 nm that represent the smallest features found in the BM were used to demonstrate that the smallest features that HCECs can recognize are 30 and 45 nm, depending on the soluble environment. In addition, HCECs demonstrate contact guidance on the smallest BM features (30 to 70 nm) and on the largest BM features (200 nm), but differs from contact guidance on micron-scale features, suggesting that BM scale topography scale is an influential factor in regulating HCEC behavior. To study the simultaneous presentation of biophysical and biochemical cues, topographic features are coated with thin films using a layer-by-layer deposition of covalently reacting polymers, poly(ethylene imine) and poly(2-vinyl-4,4-dimethylazlactone (PEI/PVDMA). The films are functionalized with the bioactive peptide argenine-glycine-aspartic acid (RGD) to control cell-substrate interactions. We demonstrate that PEI/PVDMA films can be functionalized with monotonically increasing densities of ROD to control HCEC attachment and proliferation. In addition PEI/PVDMA films functionalized with RGD were used to demonstrate that HCEC response to topographic cues is dependent on the scale of the topography, the surface chemical composition and the soluble environment. Results from these studies will advance the understanding of how BM-relevant biophysical and biochemical

  4. Biophysical and sociocultural factors underlying spatial trade-offs of ecosystem services in semiarid watersheds

    Directory of Open Access Journals (Sweden)

    Marina García-Llorente


    Full Text Available Biophysical and social systems are linked to form social-ecological systems whose sustainability depends on their capacity to absorb uncertainty and cope with disturbances. In this study, we explored the key biophysical and socio-cultural factors underlying ecosystem service supply in two semiarid watersheds of southern Spain. These included variables associated with the role that freshwater flows and biodiversity play in securing the system's capacity to sustain essential ecosystem services and their relationship with social demand for services, local water governance, and land-use intensification. Our results reveal the importance of considering the invisible dimensions of water and biodiversity, i.e. green freshwater flows and trait-based indicators, because of their relevance to the supply of ecosystem services. Furthermore, they uncover the importance of traditional irrigation canals, a local water governance system, in maintaining the ecosystems' capacity to supply services. The study also highlights the complex trade-offs that occur because of the spatial mismatch between ecosystem service supply (upstream and ecosystem service demand (downstream in watersheds. Finally, we found that land-use intensification generally resulted in losses of the biophysical factors that underpin the supply of some ecosystem services, increases in social demand for less diversified services, and the abandonment of local governance practices. Attempts to manage social-ecological systems toward sustainability at the local scale should identify the key biophysical and socio-cultural factors that are essential for maintaining ecosystem services and should recognize existing interrelationships between them. Land-use management should also take into account ecosystem service trade-offs and the consequences resulting from land-use intensification.

  5. Estimation efficiency of usage satellite derived and modelled biophysical products for yield forecasting (United States)

    Kolotii, Andrii; Kussul, Nataliia; Skakun, Sergii; Shelestov, Andrii; Ostapenko, Vadim; Oliinyk, Tamara


    Efficient and timely crop monitoring and yield forecasting are important tasks for ensuring of stability and sustainable economic development [1]. As winter crops pay prominent role in agriculture of Ukraine - the main focus of this study is concentrated on winter wheat. In our previous research [2, 3] it was shown that usage of biophysical parameters of crops such as FAPAR (derived from Geoland-2 portal as for SPOT Vegetation data) is far more efficient for crop yield forecasting to NDVI derived from MODIS data - for available data. In our current work efficiency of usage such biophysical parameters as LAI, FAPAR, FCOVER (derived from SPOT Vegetation and PROBA-V data at resolution of 1 km and simulated within WOFOST model) and NDVI product (derived from MODIS) for winter wheat monitoring and yield forecasting is estimated. As the part of crop monitoring workflow (vegetation anomaly detection, vegetation indexes and products analysis) and yield forecasting SPIRITS tool developed by JRC is used. Statistics extraction is done for landcover maps created in SRI within FP-7 SIGMA project. Efficiency of usage satellite based and modelled with WOFOST model biophysical products is estimated. [1] N. Kussul, S. Skakun, A. Shelestov, O. Kussul, "Sensor Web approach to Flood Monitoring and Risk Assessment", in: IGARSS 2013, 21-26 July 2013, Melbourne, Australia, pp. 815-818. [2] F. Kogan, N. Kussul, T. Adamenko, S. Skakun, O. Kravchenko, O. Kryvobok, A. Shelestov, A. Kolotii, O. Kussul, and A. Lavrenyuk, "Winter wheat yield forecasting in Ukraine based on Earth observation, meteorological data and biophysical models," International Journal of Applied Earth Observation and Geoinformation, vol. 23, pp. 192-203, 2013. [3] Kussul O., Kussul N., Skakun S., Kravchenko O., Shelestov A., Kolotii A, "Assessment of relative efficiency of using MODIS data to winter wheat yield forecasting in Ukraine", in: IGARSS 2013, 21-26 July 2013, Melbourne, Australia, pp. 3235 - 3238.

  6. Biophysical Approach to Mechanisms of Cancer Prevention and Treatment with Green Tea Catechins

    Directory of Open Access Journals (Sweden)

    Masami Suganuma


    Full Text Available Green tea catechin and green tea extract are now recognized as non-toxic cancer preventives for humans. We first review our brief historical development of green tea cancer prevention. Based on exciting evidence that green tea catechin, (−-epigallocatechin gallate (EGCG in drinking water inhibited lung metastasis of B16 melanoma cells, we and other researchers have studied the inhibitory mechanisms of metastasis with green tea catechins using biomechanical tools, atomic force microscopy (AFM and microfluidic optical stretcher. Specifically, determination of biophysical properties of cancer cells, low cell stiffness, and high deformability in relation to migration, along with biophysical effects, were studied by treatment with green tea catechins. The study with AFM revealed that low average values of Young’s moduli, indicating low cell stiffness, are closely associated with strong potential of cell migration and metastasis for various cancer cells. It is important to note that treatments with EGCG and green tea extract elevated the average values of Young’s moduli resulting in increased stiffness (large elasticity of melanomas and various cancer cells. We discuss here the biophysical basis of multifunctions of green tea catechins and green tea extract leading to beneficial effects for cancer prevention and treatment.

  7. Identification of Optimal Hyperspectral Bands for Estimation of Rice Biophysical Parameters

    Institute of Scientific and Technical Information of China (English)

    Fu-Min Wang; Jing-Feng Huang; Xiu-Zhen Wang


    The present study aims to identify the narrow spectral bands that are most suitable for characterizing rice biophysical parameters. The data used for this study come from ground-level hyperspectral reflectance measurements for five rice species at three levels of nitrogen fertilization during the growing period. Reflectance was measured in discrete narrow bands between 350 and 2 500 nm. Observed rice biophysical parameters included leaf area index (LAI), wet biomass and dry biomass. The stepwise regression method was applied to identify the optimal bands for rice biophysical parameter estimation. This research indicated that combinations of four narrow bands in stepwise regression models explained 69% to 83% variability for LAI, 56% to 73% for aboveground wet biomass and 70% to 83% for leaf wet biomass. An overwhelming proportion of rice information was in a particular portion of near infrared (NIR) (1 100-1 150 nm), red-edge (700-750 nm), and a longer portion of green (550-600 nm). These were followed by the moisture-sensitive NIR (950-1 000 nm), the intermediate portion of shortwave infrared (SWIR) (1 650-1 700 nm), and another portion of NIR (t 000-1 050 nm).


    Rao, Archana N; Grainger, David W


    Both clinical and analytical metrics produced by microarray-based assay technology have recognized problems in reproducibility, reliability and analytical sensitivity. These issues are often attributed to poor understanding and control of nucleic acid behaviors and properties at solid-liquid interfaces. Nucleic acid hybridization, central to DNA and RNA microarray formats, depends on the properties and behaviors of single strand (ss) nucleic acids (e.g., probe oligomeric DNA) bound to surfaces. ssDNA's persistence length, radius of gyration, electrostatics, conformations on different surfaces and under various assay conditions, its chain flexibility and curvature, charging effects in ionic solutions, and fluorescent labeling all influence its physical chemistry and hybridization under assay conditions. Nucleic acid (e.g., both RNA and DNA) target interactions with immobilized ssDNA strands are highly impacted by these biophysical states. Furthermore, the kinetics, thermodynamics, and enthalpic and entropic contributions to DNA hybridization reflect global probe/target structures and interaction dynamics. Here we review several biophysical issues relevant to oligomeric nucleic acid molecular behaviors at surfaces and their influences on duplex formation that influence microarray assay performance. Correlation of biophysical aspects of single and double-stranded nucleic acids with their complexes in bulk solution is common. Such analysis at surfaces is not commonly reported, despite its importance to microarray assays. We seek to provide further insight into nucleic acid-surface challenges facing microarray diagnostic formats that have hindered their clinical adoption and compromise their research quality and value as genomics tools.

  9. A biotic video game smart phone kit for formal and informal biophysics education (United States)

    Kim, Honesty; Lee, Seung Ah; Riedel-Kruse, Ingmar


    Novel ways for formal and informal biophysics education are important. We present a low-cost biotic game design kit that incorporates microbial organisms into an interactive gaming experience: A 3D-printable microscope containing four LEDs controlled by a joystick enable human players to provide directional light stimuli to the motile single-celled organism Euglena gracilis. These cellular behaviors are displayed on the integrated smart phone. Real time cell-tracking couples these cells into interactive biotic video game play, i.e., the human player steers Euglena to play soccer with virtual balls and goals. The player's learning curve in mastering this fun game is intrinsically coupled to develop a deeper knowledge about Euglena's cell morphology and the biophysics of its phototactic behavior. This kit is dual educational - via construction and via play - and it provides an engaging theme for a formal biophysics devices class as well as to be presented in informal outreach activities; its low cost and open soft- and hardware should enable wide adoption.

  10. Time-resolved methods in biophysics. 9. Laser temperature-jump methods for investigating biomolecular dynamics. (United States)

    Kubelka, Jan


    Many important biochemical processes occur on the time-scales of nanoseconds and microseconds. The introduction of the laser temperature-jump (T-jump) to biophysics more than a decade ago opened these previously inaccessible time regimes up to direct experimental observation. Since then, laser T-jump methodology has evolved into one of the most versatile and generally applicable methods for studying fast biomolecular kinetics. This perspective is a review of the principles and applications of the laser T-jump technique in biophysics. A brief overview of the T-jump relaxation kinetics and the historical development of laser T-jump methodology is presented. The physical principles and practical experimental considerations that are important for the design of the laser T-jump experiments are summarized. These include the Raman conversion for generating heating pulses, considerations of size, duration and uniformity of the temperature jump, as well as potential adverse effects due to photo-acoustic waves, cavitation and thermal lensing, and their elimination. The laser T-jump apparatus developed at the NIH Laboratory of Chemical Physics is described in detail along with a brief survey of other laser T-jump designs in use today. Finally, applications of the laser T-jump in biophysics are reviewed, with an emphasis on the broad range of problems where the laser T-jump methodology has provided important new results and insights into the dynamics of the biomolecular processes.

  11. Human Pluripotent Stem Cell Mechanobiology: Manipulating the Biophysical Microenvironment for Regenerative Medicine and Tissue Engineering Applications. (United States)

    Ireland, Ronald G; Simmons, Craig A


    A stem cell in its microenvironment is subjected to a myriad of soluble chemical cues and mechanical forces that act in concert to orchestrate cell fate. Intuitively, many of these soluble and biophysical factors have been the focus of intense study to successfully influence and direct cell differentiation in vitro. Human pluripotent stem cells (hPSCs) have been of considerable interest in these studies due to their great promise for regenerative medicine. Culturing and directing differentiation of hPSCs, however, is currently extremely labor-intensive and lacks the efficiency required to generate large populations of clinical-grade cells. Improved efficiency may come from efforts to understand how the cell biophysical signals can complement biochemical signals to regulate cell pluripotency and direct differentiation. In this concise review, we explore hPSC mechanobiology and how the hPSC biophysical microenvironment can be manipulated to maintain and differentiate hPSCs into functional cell types for regenerative medicine and tissue engineering applications.

  12. Relationship between clinical features of facial dry skin and biophysical parameters in Asians. (United States)

    Baek, J H; Lee, M Y; Koh, J S


    There have been few reports classifying the biophysical characteristics of Korean women with healthy skin. Consequently, the aim of this study was to find the most useful parameters for categorizing skin types based on a clinical assessment. One hundred and three female volunteers, aged 20-59, participated in this study. We conducted a self-evaluation questionnaire, a clinical assessment of the facial skin, and non-invasive measurements on the cheek under controlled environmental conditions. The questionnaire survey indicated that 72% of respondents had dry skin. However, results of the clinical assessment focusing on skin roughness and scaling of the cheek showed that 6 subjects had very dry skin (6%), 29 had dry skin (28%) and 68 had normal skin with sufficient moisture (66%). We analysed the correlation between the clinical assessment and biophysical parameters. As a result, we obtained six biophysical parameters that had relatively higher correlations with clinical assessment than other parameters. Our study provided general information about the physiological characteristics of normal skin in Korean women and suggested useful parameters for characterizing dry skin.

  13. Final report for Conference Support Grant "From Computational Biophysics to Systems Biology - CBSB12"

    Energy Technology Data Exchange (ETDEWEB)

    Hansmann, Ulrich H.E.


    This report summarizes the outcome of the international workshop From Computational Biophysics to Systems Biology (CBSB12) which was held June 3-5, 2012, at the University of Tennessee Conference Center in Knoxville, TN, and supported by DOE through the Conference Support Grant 120174. The purpose of CBSB12 was to provide a forum for the interaction between a data-mining interested systems biology community and a simulation and first-principle oriented computational biophysics/biochemistry community. CBSB12 was the sixth in a series of workshops of the same name organized in recent years, and the second that has been held in the USA. As in previous years, it gave researchers from physics, biology, and computer science an opportunity to acquaint each other with current trends in computational biophysics and systems biology, to explore venues of cooperation, and to establish together a detailed understanding of cells at a molecular level. The conference grant of $10,000 was used to cover registration fees and provide travel fellowships to selected students and postdoctoral scientists. By educating graduate students and providing a forum for young scientists to perform research into the working of cells at a molecular level, the workshop adds to DOE's mission of paving the way to exploit the abilities of living systems to capture, store and utilize energy.

  14. Age of oil palm plantations causes a strong change in surface biophysical variables (United States)

    Sabajo, Clifton; le Maire, Guerric; Knohl, Alexander


    Over the last decades, Indonesia has experienced dramatic land transformations with an expansion of oil palm plantations at the expense of tropical forests. As vegetation is a modifier of the climate near the ground these large-scale land transformations are expected to have major impacts on the surface biophysical variables i.e. surface temperature, albedo, and vegetation indices, e.g. the NDVI. Remote sensing data are needed to assess such changes at regional scale. We used 2 Landsat images from Jambi Province in Sumatra/Indonesia covering a chronosequence of oil palm plantations to study the 20 - 25 years life cycle of oil palm plantations and its relation with biophysical variables. Our results show large differences between the surface temperature of young oil palm plantations and forest (up to 9.5 ± 1.5 °C) indicating that the surface temperature is raised substantially after the establishment of oil palm plantations following the removal of forests. During the oil palm plantation lifecycle the surface temperature differences gradually decreases and approaches zero around an oil palm plantation age of 10 years. Similarly, NDVI increases and the albedo decreases approaching typical values of forests. Our results show that in order to assess the full climate effects of oil palm expansion biophysical processes play an important role and the full life cycle of oil palm plantations need to be considered.

  15. Biophysical Approach to Mechanisms of Cancer Prevention and Treatment with Green Tea Catechins. (United States)

    Suganuma, Masami; Takahashi, Atsushi; Watanabe, Tatsuro; Iida, Keisuke; Matsuzaki, Takahisa; Yoshikawa, Hiroshi Y; Fujiki, Hirota


    Green tea catechin and green tea extract are now recognized as non-toxic cancer preventives for humans. We first review our brief historical development of green tea cancer prevention. Based on exciting evidence that green tea catechin, (-)-epigallocatechin gallate (EGCG) in drinking water inhibited lung metastasis of B16 melanoma cells, we and other researchers have studied the inhibitory mechanisms of metastasis with green tea catechins using biomechanical tools, atomic force microscopy (AFM) and microfluidic optical stretcher. Specifically, determination of biophysical properties of cancer cells, low cell stiffness, and high deformability in relation to migration, along with biophysical effects, were studied by treatment with green tea catechins. The study with AFM revealed that low average values of Young's moduli, indicating low cell stiffness, are closely associated with strong potential of cell migration and metastasis for various cancer cells. It is important to note that treatments with EGCG and green tea extract elevated the average values of Young's moduli resulting in increased stiffness (large elasticity) of melanomas and various cancer cells. We discuss here the biophysical basis of multifunctions of green tea catechins and green tea extract leading to beneficial effects for cancer prevention and treatment.

  16. Vegetation dynamics and climate variability-associated biophysical process in West Africa (United States)

    Song, G.; Xue, Y.; Cox, P. M.


    West Africa is a bioclimatic zone of predominantly annual grasses with shrubs and trees with a steep gradient in climate, soils, vegetation, fauna, land use and human utilization. West Africa ecosystem region suffered from the most severe and longest drought in the world during the Twentieth Century since the later 1960s. This study systematically investigates how climate variability and anomalies in West Africa affect the regional terrestrial ecosystem, including plant functional types' (PFT) spatial distribution and temporal variations and vegetation characteristics, through biophysical and photosynthesis processes at different scales. We use the offline Simplified Simple Biosphere Version 4/ Top-down Representation of Interactive Foliage and Flora Including Dynamics Model (SSiB4/TRIFFID), which is a fully coupled biophysical-dynamic vegetation (DVM) model to adequately incorporate the complex non-linear coupling dynamics between ecosystem and climate variability. The biophysical parameters in SSiB4 are adjusted with TRIFFID-produced vegetation parameter values, which ensure adequate biophysical process coupling. A 59-year simulation from 1948 was conducted using the meteorological forcing, which consists of substantial seasonal, interannual, and interdecal variability and long term dry trend. The results show that the simulated PFT's and leaf area index (LAI) correspond well to climate variability and are consistent with satellite derived vegetation conditions. The simulated inter-decadal variability in vegetation conditions is consistent with the Sahel drought in the 1970s and the 1980s and partial recovery in the 1990s and the 2000s (fig1). To further understand the biophysical mechanism of interactions of water, carbon, radiation, and vegetation dynamics, analyses are conducted to find relationships between vegetation variability and environmental conditions. It is found that the vegetation characteristics simulated by SSiB4/TRIFFID responds primarily to five

  17. Membrane Biophysics

    CERN Document Server

    Ashrafuzzaman, Mohammad


    Physics, mathematics and chemistry all play a vital role in understanding the true nature and functioning of biological membranes, key elements of living processes. Besides simple spectroscopic observations and electrical measurements of membranes we address in this book the phenomena of coexistence and independent existence of different membrane components using various theoretical approaches. This treatment will be helpful for readers who want to understand biological processes by applying both simple observations and fundamental scientific analysis. It provides a deep understanding of the causes and effects of processes inside membranes, and will thus eventually open new doors for high-level pharmaceutical approaches towards fighting membrane- and cell-related diseases.

  18. Biophysics Education (United States)

    Panijpan, Bhinyo


    Many topics in basic physics are presented to the students based on examples that they find too intangible, uninteresting and unrelated to the real world. We propose here some examples from the biological world that can equally be used to illustrate seemingly arcane physical principles and laws [1] [2]. Energetic aspects of the Krebs Cycle, the Calvin Cycle, and the ion pump can make learning of thermodynamics and electricity much more realistic. The contraction relaxation cycle of a muscle sarcomere can be used to represent that of a machine "photographs" of the sarcomere and large biopolymers such as ordered protein and nucleic acid structures illustrate Bragg's Law about regular submicron distances as well as those from crystals of inorganic salts. Movements of nanostructures of the proton pump subunits and sliding filaments are just as good for calculation of the moment of inertia and mechanical energy involved. Transport of sugars made from photosynthesis in the leaf into the fruit can pose problems about concentration gradient very realistically. Aspect about light such as absorption and fluorescence of biological molecules such as chlorophylls and rhodopsins should make such phenomena more interesting and real. Interference of visible light from feathers and scales should also be used to showchanges of apparent colors and patterns when viewed from different angles. Circular dichroism and streaming birefringence of biological macromolecules should make students appreciate polarization better.

  19. Biophysical Profile (United States)

    ... or previous pregnancy complications A baby who has decreased fetal movements or possible fetal growth problems Preterm ... for women who have an increased risk of pregnancy loss, it's not always clear that ... the fetal heart rate. Typically, the test lasts 20 minutes. However, if ...

  20. Effects of LiDAR point density, sampling size and height threshold on estimation accuracy of crop biophysical parameters. (United States)

    Luo, Shezhou; Chen, Jing M; Wang, Cheng; Xi, Xiaohuan; Zeng, Hongcheng; Peng, Dailiang; Li, Dong


    Vegetation leaf area index (LAI), height, and aboveground biomass are key biophysical parameters. Corn is an important and globally distributed crop, and reliable estimations of these parameters are essential for corn yield forecasting, health monitoring and ecosystem modeling. Light Detection and Ranging (LiDAR) is considered an effective technology for estimating vegetation biophysical parameters. However, the estimation accuracies of these parameters are affected by multiple factors. In this study, we first estimated corn LAI, height and biomass (R2 = 0.80, 0.874 and 0.838, respectively) using the original LiDAR data (7.32 points/m2), and the results showed that LiDAR data could accurately estimate these biophysical parameters. Second, comprehensive research was conducted on the effects of LiDAR point density, sampling size and height threshold on the estimation accuracy of LAI, height and biomass. Our findings indicated that LiDAR point density had an important effect on the estimation accuracy for vegetation biophysical parameters, however, high point density did not always produce highly accurate estimates, and reduced point density could deliver reasonable estimation results. Furthermore, the results showed that sampling size and height threshold were additional key factors that affect the estimation accuracy of biophysical parameters. Therefore, the optimal sampling size and the height threshold should be determined to improve the estimation accuracy of biophysical parameters. Our results also implied that a higher LiDAR point density, larger sampling size and height threshold were required to obtain accurate corn LAI estimation when compared with height and biomass estimations. In general, our results provide valuable guidance for LiDAR data acquisition and estimation of vegetation biophysical parameters using LiDAR data.

  1. Linking biophysical models and public preferences for ecosystem service assessments: a case study for the Southern Rocky Mountains (United States)

    Bagstad, Kenneth J.; Reed, James; Semmens, Darius J.; Sherrouse, Ben C.; Troy, Austin


    Through extensive research, ecosystem services have been mapped using both survey-based and biophysical approaches, but comparative mapping of public values and those quantified using models has been lacking. In this paper, we mapped hot and cold spots for perceived and modeled ecosystem services by synthesizing results from a social-values mapping study of residents living near the Pike–San Isabel National Forest (PSI), located in the Southern Rocky Mountains, with corresponding biophysically modeled ecosystem services. Social-value maps for the PSI were developed using the Social Values for Ecosystem Services tool, providing statistically modeled continuous value surfaces for 12 value types, including aesthetic, biodiversity, and life-sustaining values. Biophysically modeled maps of carbon sequestration and storage, scenic viewsheds, sediment regulation, and water yield were generated using the Artificial Intelligence for Ecosystem Services tool. Hotspots for both perceived and modeled services were disproportionately located within the PSI’s wilderness areas. Additionally, we used regression analysis to evaluate spatial relationships between perceived biodiversity and cultural ecosystem services and corresponding biophysical model outputs. Our goal was to determine whether publicly valued locations for aesthetic, biodiversity, and life-sustaining values relate meaningfully to results from corresponding biophysical ecosystem service models. We found weak relationships between perceived and biophysically modeled services, indicating that public perception of ecosystem service provisioning regions is limited. We believe that biophysical and social approaches to ecosystem service mapping can serve as methodological complements that can advance ecosystem services-based resource management, benefitting resource managers by showing potential locations of synergy or conflict between areas supplying ecosystem services and those valued by the public.

  2. River bank burrowing by invasive crayfish: Spatial distribution, biophysical controls and biogeomorphic significance. (United States)

    Faller, Matej; Harvey, Gemma L; Henshaw, Alexander J; Bertoldi, Walter; Bruno, Maria Cristina; England, Judy


    Invasive species generate significant global environmental and economic costs and represent a particularly potent threat to freshwater systems. The biogeomorphic impacts of invasive aquatic and riparian species on river processes and landforms remain largely unquantified, but have the potential to generate significant sediment management issues within invaded catchments. Several species of invasive (non-native) crayfish are known to burrow into river banks and visual evidence of river bank damage is generating public concern and media attention. Despite this, there is a paucity of understanding of burrow distribution, biophysical controls and the potential significance of this problem beyond a small number of local studies at heavily impacted sites. This paper presents the first multi-catchment analysis of this phenomenon, combining existing data on biophysical river properties and invasive crayfish observations with purpose-designed field surveys across 103 river reaches to derive key trends. Crayfish burrows were observed on the majority of reaches, but burrowing tended to be patchy in spatial distribution, concentrated in a small proportion (<10%) of the length of rivers surveyed. Burrow distribution was better explained by local bank biophysical properties than by reach-scale properties, and burrowed banks were more likely to be characterised by cohesive bank material, steeper bank profiles with large areas of bare bank face, often on outer bend locations. Burrow excavation alone has delivered a considerable amount of sediment to invaded river systems in the surveyed sites (3tkm(-1) impacted bank) and this represents a minimum contribution and certainly an underestimate of the absolute yield (submerged burrows were not recorded). Furthermore, burrowing was associated with bank profiles that were either actively eroding or exposed to fluvial action and/or mass failure processes, providing the first quantitative evidence that invasive crayfish may cause or

  3. Edelfosine and miltefosine effects on lipid raft properties: membrane biophysics in cell death by antitumor lipids. (United States)

    Castro, Bruno M; Fedorov, Aleksander; Hornillos, Valentin; Delgado, Javier; Acuña, A Ulises; Mollinedo, Faustino; Prieto, Manuel


    Edelfosine (1-O-octadecyl-2-O-methyl-sn-glycero-phosphocholine) and miltefosine (hexadecylphosphocholine) are synthetic alkylphospholipids (ALPs) that are reported to selectively accumulate in tumor cell membranes, inducing Fas clustering and activation on lipid rafts, triggering apoptosis. However, the exact mechanism by which these lipids elicit these events is still not fully understood. Recent studies propose that their mode of action might be related with alterations of lipid rafts biophysical properties caused by these lipid drugs. To achieve a clear understanding of this mechanism, we studied the effects of pharmacologically relevant amounts of edelfosine and miltefosine in the properties of model and cellular membranes. The influence of these molecules on membrane order, lateral organization, and lipid rafts molar fraction and size were studied by steady-state and time-resolved fluorescence methods, Förster resonance energy transfer (FRET), confocal and fluorescence lifetime imaging microscopy (FLIM). We found that the global membrane and lipid rafts biophysical properties of both model and cellular membranes were not significantly affected by both the ALPs. Nonetheless, in model membranes, a mild increase in membrane fluidity induced by both alkyl lipids was detected, although this effect was more noticeable for edelfosine than miltefosine. This absence of drastic alterations shows for the first time that ALPs mode of action is unlikely to be directly linked to alterations of lipid rafts biophysical properties caused by these drugs. The biological implications of this result are discussed in the context of ALPs effects on lipid metabolism, mitochondria homeostasis modulation, and their relationship with tumor cell death.

  4. Unravel biophysical factors on river water quality response in Chilean Central-Southern watersheds. (United States)

    Yevenes, Mariela A; Arumí, José L; Farías, Laura


    Identifying the key anthropogenic (land uses) and natural (topography and climate) biophysical drivers affecting river water quality is essential for efficient management of water resources. We tested the hypothesis that water quality can be predicted by different biophysical factors. Multivariate statistics based on a geographical information system (GIS) were used to explore the influence of factors (i.e., precipitation, topography, and land uses) on water quality (i.e., nitrate (NO 3 (-)), phosphate (PO 4 (3-)), silicate (Si(OH)4), dissolved oxygen (DO), suspended solids (TSS), biological oxygen demand (DO), temperature (T), conductivity (EC), and pH) for two consecutive years in the Itata and Biobío river watersheds, Central Chile (36° 00' and 38° 30'). The results showed that (NO 3 (-)), (PO 4 (3-)), Si(OH)4, TSS, EC, and DO were higher during rainy season (austral fall, winter, and spring), whereas BOD and temperature were higher during dry season. The spatial variation of these parameters in both watersheds was related to land use, topography (e.g., soil moisture, soil hydrological group, and erodability), and precipitation. Soil hydrological group and soil moisture were the strongest explanatory predictors for PO 4 (3-) , Si(OH)4 and EC in the river, followed by land use such as agriculture for NO 3 (-) and DO and silviculture for TSS and Si(OH)4. High-resolution water leaching and runoff maps allowed us to identify agriculture areas with major probability of water leaching and higher probability of runoff in silviculture areas. Moreover, redundancy analysis (RDA) revealed that land uses (agriculture and silviculture) explained in 60 % the river water quality variation. Our finding highlights the vulnerability of Chilean river waters to different biophysical drivers, rather than climate conditions alone, which is amplified by human-induced degradation.

  5. Quality Saving Mechanisms of Mitochondria during Aging in a Fully Time-Dependent Computational Biophysical Model.

    Directory of Open Access Journals (Sweden)

    Daniel Mellem

    Full Text Available Mitochondria are essential for the energy production of eukaryotic cells. During aging mitochondria run through various processes which change their quality in terms of activity, health and metabolic supply. In recent years, many of these processes such as fission and fusion of mitochondria, mitophagy, mitochondrial biogenesis and energy consumption have been subject of research. Based on numerous experimental insights, it was possible to qualify mitochondrial behaviour in computational simulations. Here, we present a new biophysical model based on the approach of Figge et al. in 2012. We introduce exponential decay and growth laws for each mitochondrial process to derive its time-dependent probability during the aging of cells. All mitochondrial processes of the original model are mathematically and biophysically redefined and additional processes are implemented: Mitochondrial fission and fusion is separated into a metabolic outer-membrane part and a protein-related inner-membrane part, a quality-dependent threshold for mitophagy and mitochondrial biogenesis is introduced and processes for activity-dependent internal oxidative stress as well as mitochondrial repair mechanisms are newly included. Our findings reveal a decrease of mitochondrial quality and a fragmentation of the mitochondrial network during aging. Additionally, the model discloses a quality increasing mechanism due to the interplay of the mitophagy and biogenesis cycle and the fission and fusion cycle of mitochondria. It is revealed that decreased mitochondrial repair can be a quality saving process in aged cells. Furthermore, the model finds strategies to sustain the quality of the mitochondrial network in cells with high production rates of reactive oxygen species due to large energy demands. Hence, the model adds new insights to biophysical mechanisms of mitochondrial aging and provides novel understandings of the interdependency of mitochondrial processes.

  6. Biophysical Properties of 9 KCNQ1 Mutations Associated with Long QT Syndrome (LQTS) (United States)

    Yang, Tao; Chung, Seo-Kyung; Zhang, Wei; Mullins, Jonathan G.L.; McCulley, Caroline H.; Crawford, Jackie; MacCormick, Judith; Eddy, Carey-Anne; Shelling, Andrew N.; French, John K.; Yang, Ping; Skinner, Jonathan R.; Roden, Dan M.; Rees, Mark I.


    Background Inherited long QT syndrome (LQTS) is characterized by prolonged QT interval on the EKG, syncope and sudden death due to ventricular arrhythmia. Causative mutations occur mostly in cardiac potassium and sodium channel subunit genes. Confidence in mutation pathogenicity is usually reached through family genotype-phenotype tracking, control population studies, molecular modelling and phylogenetic alignments, however, biophysical testing offers a higher degree of validating evidence. Methods and Results By using in-vitro electrophysiological testing of transfected mutant and wild-type LQTS constructs into Chinese Hamster Ovary cells, we investigated the biophysical properties of 9 KCNQ1 missense mutations (A46T, T265I, F269S, A302V, G316E, F339S, R360G, H455Y, and S546L) identified in a New Zealand based LQTS screening programme. We demonstrate through electrophysiology and molecular modeling that seven of the missense mutations have profound pathological dominant negative loss-of-function properties confirming their likely disease-causing nature. This supports the use of these mutations in diagnostic family screening. Two mutations (A46T, T265I) show suggestive evidence of pathogenicity within the experimental limits of biophysical testing, indicating that these variants are disease-causing via delayed or fast activation kinetics. Further investigation of the A46T family has revealed an inconsistent co-segregation of the variant with the clinical phenotype. Conclusions Electrophysiological characterisation should be used to validate LQTS pathogenicity of novel missense channelopathies. When such results are inconclusive, great care should be taken with genetic counselling and screening of such families, and alternative disease causing mechanisms should be considered. PMID:19808498

  7. Quality Saving Mechanisms of Mitochondria during Aging in a Fully Time-Dependent Computational Biophysical Model. (United States)

    Mellem, Daniel; Fischer, Frank; Jaspers, Sören; Wenck, Horst; Rübhausen, Michael


    Mitochondria are essential for the energy production of eukaryotic cells. During aging mitochondria run through various processes which change their quality in terms of activity, health and metabolic supply. In recent years, many of these processes such as fission and fusion of mitochondria, mitophagy, mitochondrial biogenesis and energy consumption have been subject of research. Based on numerous experimental insights, it was possible to qualify mitochondrial behaviour in computational simulations. Here, we present a new biophysical model based on the approach of Figge et al. in 2012. We introduce exponential decay and growth laws for each mitochondrial process to derive its time-dependent probability during the aging of cells. All mitochondrial processes of the original model are mathematically and biophysically redefined and additional processes are implemented: Mitochondrial fission and fusion is separated into a metabolic outer-membrane part and a protein-related inner-membrane part, a quality-dependent threshold for mitophagy and mitochondrial biogenesis is introduced and processes for activity-dependent internal oxidative stress as well as mitochondrial repair mechanisms are newly included. Our findings reveal a decrease of mitochondrial quality and a fragmentation of the mitochondrial network during aging. Additionally, the model discloses a quality increasing mechanism due to the interplay of the mitophagy and biogenesis cycle and the fission and fusion cycle of mitochondria. It is revealed that decreased mitochondrial repair can be a quality saving process in aged cells. Furthermore, the model finds strategies to sustain the quality of the mitochondrial network in cells with high production rates of reactive oxygen species due to large energy demands. Hence, the model adds new insights to biophysical mechanisms of mitochondrial aging and provides novel understandings of the interdependency of mitochondrial processes.

  8. Quality Saving Mechanisms of Mitochondria during Aging in a Fully Time-Dependent Computational Biophysical Model (United States)

    Mellem, Daniel; Fischer, Frank; Jaspers, Sören; Wenck, Horst; Rübhausen, Michael


    Mitochondria are essential for the energy production of eukaryotic cells. During aging mitochondria run through various processes which change their quality in terms of activity, health and metabolic supply. In recent years, many of these processes such as fission and fusion of mitochondria, mitophagy, mitochondrial biogenesis and energy consumption have been subject of research. Based on numerous experimental insights, it was possible to qualify mitochondrial behaviour in computational simulations. Here, we present a new biophysical model based on the approach of Figge et al. in 2012. We introduce exponential decay and growth laws for each mitochondrial process to derive its time-dependent probability during the aging of cells. All mitochondrial processes of the original model are mathematically and biophysically redefined and additional processes are implemented: Mitochondrial fission and fusion is separated into a metabolic outer-membrane part and a protein-related inner-membrane part, a quality-dependent threshold for mitophagy and mitochondrial biogenesis is introduced and processes for activity-dependent internal oxidative stress as well as mitochondrial repair mechanisms are newly included. Our findings reveal a decrease of mitochondrial quality and a fragmentation of the mitochondrial network during aging. Additionally, the model discloses a quality increasing mechanism due to the interplay of the mitophagy and biogenesis cycle and the fission and fusion cycle of mitochondria. It is revealed that decreased mitochondrial repair can be a quality saving process in aged cells. Furthermore, the model finds strategies to sustain the quality of the mitochondrial network in cells with high production rates of reactive oxygen species due to large energy demands. Hence, the model adds new insights to biophysical mechanisms of mitochondrial aging and provides novel understandings of the interdependency of mitochondrial processes. PMID:26771181

  9. Mesoscale simulations of two model systems in biophysics: from red blood cells to DNAs (United States)

    Peng, Zhangli; Chen, Yeng-Long; Lu, Huijie; Pan, Zehao; Chang, Hsueh-Chia


    Computational modeling has become increasingly important in biophysics, but the great challenge in numerical simulations due to the multiscale feature of biological systems limits the capability of modeling in making discoveries in biology. Innovative multiscale modeling approaches are desired to bridge different scales from nucleic acids and proteins to cells and tissues. Although all-atom molecular dynamics has been successfully applied in many microscale biological processes such as protein folding, it is still prohibitively expensive for studying macroscale problems such as biophysics of cells and tissues. On the other hand, continuum-based modeling has become a mature procedure for analysis and design in many engineering fields, but new insights for biological systems in the microscale are limited when molecular details are missing in continuum-based modeling. In this context, mesoscale modeling approaches such as Langevin dynamics, lattice Boltzmann method, and dissipative particle dynamics have become popular by simultaneously incorporating molecular interactions and long-range hydrodynamic interactions, providing insights to properties on longer time and length scales than molecular dynamics. In this review, we summarized several mesoscale simulation approaches for studying two model systems in biophysics: red blood cells (RBCs) and deoxyribonucleic acids (DNAs). The RBC is a model system for cell mechanics and biological membranes, while the DNA represents a model system for biopolymers. We introduced the motivations of studying these problems and presented the key features of different mesoscale methods. Furthermore, we described the latest progresses in these methods and highlighted the major findings for modeling RBCs and DNAs. Finally, we also discussed the challenges and potential issues of different approaches.

  10. Biophysical study of resin acid effects on phospholipid membrane structure and properties

    DEFF Research Database (Denmark)

    Jagalski, Vivien; Barker, Robert; Topgaard, Daniel


    Hydrophobic resin acids (RAs) are synthesized by conifer trees as part of their defense mechanisms. One of the functions of RAs in plant defense is suggested to be the perturbation of the cellular membrane. However, there is a vast diversity of chemical structures within this class of molecules...... membranes and the polar lipid extract of soybeans. The complementarity of the biophysical techniques used (NMR, DLS, NR, DSC, Cryo-TEM) allowed correlating changes at the vesicle level with changes at the molecular level and the co-localization of RAs within DPPC monolayer. Effects on DPPC membranes...... are correlated with the physical chemical properties of the RA and their toxicity....

  11. Tackling the biophysical properties of sphingolipids to decipher their biological roles. (United States)

    Carreira, Ana C; Ventura, Ana E; Varela, Ana R P; Silva, Liana C


    From the most simple sphingoid bases to their complex glycosylated derivatives, several sphingolipid species were shown to have a role in fundamental cellular events and/or disease. Increasing evidence places lipid-lipid interactions and membrane structural alterations as central mechanisms underlying the action of these lipids. Understanding how these molecules exert their biological roles by studying their impact in the physical properties and organization of membranes is currently one of the main challenges in sphingolipid research. Herein, we review the progress in the state-of-the-art on the biophysical properties of sphingolipid-containing membranes, focusing on sphingosine, ceramides, and glycosphingolipids.

  12. Biophysical mechanisms of phospholipase A2 activation and their use in liposome-based drug delivery

    DEFF Research Database (Denmark)

    Jørgensen, Kaj; Davidsen, Jesper; Mouritsen, Ole G.


    Secretory phospholipase A(2) (PLA(2)) is a ubiquitous water-soluble enzyme found in venom, pancreatic, and cancerous fluid. It is also known to play a role in membrane remodeling processes as well as in cellular signaling cascades. PLA(2) is interfacially active and functions mainly on organized...... reviewed. Results obtained from a variety of experimental and theoretical studies of PLA(2) activity on lipid-bilayer substrates are then presented which provide insight into the biophysical mechanisms of PLA(2) activation on lipid bilayers and liposomes of different composition. The insight...

  13. Effects of histochrom and emoxypin on biophysical properties of electroexitable cells. (United States)

    Mischenko, N P; Fedoreev, S A; Zapara, T A; Ratushnyak, A S


    Comparative investigation of effects of antioxidant agents histochrom and emoxypin on biophysical characteristics of isolated neurons from shell Lymnaea stagnalis under normal conditions and during oxidative stress was performed. Differently directed effects of these compounds on resting potential and transmembrane ion currents of neural cells under normal conditions were detected. Histochrom provides hyperpolarizing and emoxypin--depolarizing effect on neuronal membrane potential. Under conditions of oxidative stress both products possess antioxidant action. Obtained data allows coming closer to understanding of cellular-molecular mechanisms of protective action of compounds.

  14. Covariance of biophysical data with digital topograpic and land use maps over the FIFE site

    Energy Technology Data Exchange (ETDEWEB)

    Davis, F.W.; Schimel, D.S.; Friedl, M.A.; Michaelsen, J.C.; Kittel, T.G.F.; Dubayah, R.; Dozier, J. (California Univ., Santa Barbara (United States) Colorado State Univ., Fort Collins (United States) Cooperative Inst. for Research in the Atmosphere, Fort Collins, CO (United States) Maryland Univ., College Park (United States) NASA, Goddard Space Flight Center, Greenbelt, MD (United States))


    This paper discusses the biophysical stratification of the FIFE site, implementation of the stratification utilizing geographic information system methods, and validation of the stratification with respect to field measurements of biomass, Bowen ratio, soil moisture, and the greenness vegetation index (GVI) derived from TM satellite data. Maps of burning and topographic position were significantly associated with variation in GVI, biomass, and Bowen ratio. The stratified design did not significantly alter the estimated site-wide means for surface climate parameters but accounted for between 25 and 45 percent of the sample variance depending on the variable. 30 refs.

  15. Fluctuation theory of solutions applications in chemistry, chemical engineering, and biophysics

    CERN Document Server

    Smith, Paul E


    There are essentially two theories of solutions that can be considered exact: the McMillan-Mayer theory and Fluctuation Solution Theory (FST). The first is mostly limited to solutes at low concentrations, while FST has no such issue. It is an exact theory that can be applied to any stable solution regardless of the number of components and their concentrations, and the types of molecules and their sizes. Fluctuation Theory of Solutions: Applications in Chemistry, Chemical Engineering, and Biophysics outlines the general concepts and theoretical basis of FST and provides a range of applications

  16. Covariance of biophysical data with digital topographic and land use maps over the FIFE site (United States)

    Davis, F. W.; Schimel, D. S.; Friedl, M. A.; Michaelsen, J. C.; Kittel, T. G. F.; Dubayah, R.; Dozier, J.


    Sampling design is critical in locating ground sampling stations for large-scale climatological field experiments. In the stratified sampling design adopted for the First International Satellite Land Surface Climatology Project (ISLSCP) Field Experiment (FIFE), the study region was stratified into 14 different terrain units based on land use/land cover and topographic variables that were hypothesized to have a strong influence on surface biophysical properties. Digital terrain maps were produced to facilitate ground data integration and extrapolation. This paper describes the biophysical stratification of the FIFE site, implementation of the stratification using geographic information system (GIS) techniques, and validation of the stratification with respect to field measurements of biomass, soil moisture, Bowen ratio (β), and the greenness vegetation index (GVI) derived from thematic mapper satellite data. Maps of burning and topographic position were significantly associated with variation in biomass, GVI, and β. The effects of burning and topography were stronger for the Konza Prairie Long-Term Ecological Research (KPLTER) site than for the rest of the FIFE site, where cattle grazing was a major confounding effect. The stratified design did not appreciably change the estimated site-wide means for surface climate parameters but accounted for between 25 and 45% of the sample variance depending on the variable. The design was weakened by undersampling of several strata, by high within-station variance in soil and vegetation data, and by failure to account for diverse land management practices on private lands surrounding KPLTER. We recommend that future large-scale climatological studies include the development of a digital terrain data base well in advance of field campaigns and that multitemporal imagery be used to obtain preliminary estimates of spatial and temporal variance in surface biophysical properties. We also recommend that sampling for the most

  17. Biophysical properties of Saccharomyces cerevisiae and their relationship with HOG pathway activation. (United States)

    Schaber, Jörg; Adrover, Miquel Angel; Eriksson, Emma; Pelet, Serge; Petelenz-Kurdziel, Elzbieta; Klein, Dagmara; Posas, Francesc; Goksör, Mattias; Peter, Mathias; Hohmann, Stefan; Klipp, Edda


    Parameterized models of biophysical and mechanical cell properties are important for predictive mathematical modeling of cellular processes. The concepts of turgor, cell wall elasticity, osmotically active volume, and intracellular osmolarity have been investigated for decades, but a consistent rigorous parameterization of these concepts is lacking. Here, we subjected several data sets of minimum volume measurements in yeast obtained after hyper-osmotic shock to a thermodynamic modeling framework. We estimated parameters for several relevant biophysical cell properties and tested alternative hypotheses about these concepts using a model discrimination approach. In accordance with previous reports, we estimated an average initial turgor of 0.6 ± 0.2 MPa and found that turgor becomes negligible at a relative volume of 93.3 ± 6.3% corresponding to an osmotic shock of 0.4 ± 0.2 Osm/l. At high stress levels (4 Osm/l), plasmolysis may occur. We found that the volumetric elastic modulus, a measure of cell wall elasticity, is 14.3 ± 10.4 MPa. Our model discrimination analysis suggests that other thermodynamic quantities affecting the intracellular water potential, for example the matrix potential, can be neglected under physiological conditions. The parameterized turgor models showed that activation of the osmosensing high osmolarity glycerol (HOG) signaling pathway correlates with turgor loss in a 1:1 relationship. This finding suggests that mechanical properties of the membrane trigger HOG pathway activation, which can be represented and quantitatively modeled by turgor.

  18. Market research on garment-based "wearables" and biophysical monitoring and a new monitoring method. (United States)

    Schultze, Claudia; Burr, Stacey


    Technology advancements are foremost on the minds of scientists and developers who are working to overcome the many hurdles associated with bringing consumers the enhanced benefits associated with next generation wearable health systems. Often the technology work takes a front seat to the basic requirements of traditional consumer apparel. The choices of what consumers elect to place and carry on their body can be practical, logical, emotional and sometimes seemingly random. By providing insights and data to support the claims, developers of wearable health systems of the future will be able improve their chance of consumer adoption and continued use by gaining a clearer picture of the people that will be wearing the systems. Results from 5 different consumer research studies are presented, examining consumer buying patterns, gender differences, regional differences, their receptivity to health benefits delivered via clothing and what they want from technology enhanced clothing. Market research related to biophysical monitoring utilizing smart fabrics or interactive textiles show a critical level of commercial activity. Medical applications focused on the aged, infant and critical patient care are taking the lead. This paper presents a look at the biophysical monitoring market and discusses new materials useful in garment systems and the challenges remaining for their development and integration with textiles. A new method of non-invasive monitoring of periodic activity is discussed.

  19. Simulation of Tillage Systems Impact on Soil Biophysical Properties Using the SALUS Model

    Directory of Open Access Journals (Sweden)

    Luigi Sartori


    Full Text Available A sustainable land management has been defined as the management system that allows for production, while minimizing risk, maintaining quality of soil and water. Tillage systems can significantly decrease soil carbon storage and influence the soil environment of a crop. Crop growth models can be useful tools in evaluating the impact of different tillage systems on soil biophysical properties and on the growth and final yield of the crops. The objectives of this paper were i to illustrate the SALUS model and its tillage component; ii to evaluate the effects of different tillage systems on water infiltration and time to ponding, iii to simulate the effect of tillage systems on some soil biophysical properties. The SALUS (System Approach to Land Use Sustainability model is designed to simulate continuous crop, soil, water and nutrient conditions under different tillage and crop residues management strategies for multiple years. Predictions of changes in surface residue, bulk density, runoff, drainage and evaporation were consistent with expected behaviours of these parameters as described in the literature. The experiment to estimate the time to ponding curve under different tillage system confirmed the theory and showed the beneficial effects of the residue on soil surface with respect to water infiltration. It also showed that the no-tillage system is a more appropriate system to adopt in areas characterized by high intensity rainfall.

  20. Biophysical and biochemical constraints imposed by salt stress:Learning from halophyte

    Directory of Open Access Journals (Sweden)

    Bernardo eDuarte


    Full Text Available Soil salinization is one of the most important factors impacting plant productivity. About 3.6 billion of the world’s 5.2 billion ha of agricultural dryland have already suffered erosion, degradation and salinization. Halophytes typically are considered as plants able to complete their life cycle in environments where the salt concentration is 200 mM NaCl or higher. Different strategies are known to overcome salt stress, as adaptation mechanisms from this type of plants. Salinity adjustment is a complex phenomenon characterized by both biochemical and biophysical adaptations. As photosynthesis is a prerequisite for biomass production, halophytes adapted their electronic transduction pathways and the entire energetic metabolism to overcome the salt excess. The maintenance of ionic homeostasis is in the basis of all cellular stress in particular in terms of redox potential and energy transduction. In the present work the biophysical mechanisms underlying energy capture and transduction in halophytes are discussed alongside with their relation to biochemical mechanisms, integrating data from photosystem light harvesting complexes, electronic transport chains to the quinone pools, carbon harvesting and energy dissipation metabolism.

  1. Mapping Biophysical Parameters for Land Surface Modeling over the Continental US Using MODIS and Landsat

    Directory of Open Access Journals (Sweden)

    Lahouari Bounoua


    Full Text Available In terms of the space cities occupy, urbanization appears as a minor land transformation. However, it permanently modifies land’s ecological functions, altering its carbon, energy, and water fluxes. It is therefore necessary to develop a land cover characterization at fine spatial and temporal scales to capture urbanization’s effects on surface fluxes. We develop a series of biophysical vegetation parameters such as the fraction of photosynthetically active radiation, leaf area index, vegetation greenness fraction, and roughness length over the continental US using MODIS and Landsat products for 2001. A 13-class land cover map was developed at a climate modeling grid (CMG merging the 500 m MODIS land cover and the 30 m impervious surface area from the National Land Cover Database. The landscape subgrid heterogeneity was preserved using fractions of each class from the 500 m and 30 m into the CMG. Biophysical parameters were computed using the 8-day composite Normalized Difference Vegetation Index produced by the North American Carbon Program. In addition to urban impact assessments, this dataset is useful for the computation of surface fluxes in land, vegetation, and urban models and is expected to be widely used in different land cover and land use change applications.

  2. Biophysical and physicochemical methods differentiate highly ligand-efficient human D-amino acid oxidase inhibitors. (United States)

    Lange, Jos H M; Venhorst, Jennifer; van Dongen, Maria J P; Frankena, Jurjen; Bassissi, Firas; de Bruin, Natasja M W J; den Besten, Cathaline; de Beer, Stephanie B A; Oostenbrink, Chris; Markova, Natalia; Kruse, Chris G


    Many early drug research efforts are too reductionist thereby not delivering key parameters such as kinetics and thermodynamics of target-ligand binding. A set of human D-Amino Acid Oxidase (DAAO) inhibitors 1-6 was applied to demonstrate the impact of key biophysical techniques and physicochemical methods in the differentiation of chemical entities that cannot be adequately distinguished on the basis of their normalized potency (ligand efficiency) values. The resulting biophysical and physicochemical data were related to relevant pharmacodynamic and pharmacokinetic properties. Surface Plasmon Resonance data indicated prolonged target-ligand residence times for 5 and 6 as compared to 1-4, based on the observed k(off) values. The Isothermal Titration Calorimetry-derived thermodynamic binding profiles of 1-6 to the DAAO enzyme revealed favorable contributions of both ΔH and ΔS to their ΔG values. Surprisingly, the thermodynamic binding profile of 3 elicited a substantially higher favorable contribution of ΔH to ΔG in comparison with the structurally closely related fused bicyclic acid 4. Molecular dynamics simulations and free energy calculations of 1, 3, and 4 led to novel insights into the thermodynamic properties of the binding process at an atomic level and in the different thermodynamic signatures of 3 and 4. The presented holistic approach is anticipated to facilitate the identification of compounds with best-in-class properties at an early research stage.

  3. NS3 Protease from Hepatitis C Virus: Biophysical Studies on an Intrinsically Disordered Protein Domain

    Directory of Open Access Journals (Sweden)

    Adrian Velazquez-Campoy


    Full Text Available The nonstructural protein 3 (NS3 from the hepatitis C virus (HCV is responsible for processing the non-structural region of the viral precursor polyprotein in infected hepatic cells. NS3 protease activity, located at the N-terminal domain, is a zinc-dependent serine protease. A zinc ion, required for the hydrolytic activity, has been considered as a structural metal ion essential for the structural integrity of the protein. In addition, NS3 interacts with another cofactor, NS4A, an accessory viral protein that induces a conformational change enhancing the hydrolytic activity. Biophysical studies on the isolated protease domain, whose behavior is similar to that of the full-length protein (e.g., catalytic activity, allosteric mechanism and susceptibility to inhibitors, suggest that a considerable global conformational change in the protein is coupled to zinc binding. Zinc binding to NS3 protease can be considered as a folding event, an extreme case of induced-fit binding. Therefore, NS3 protease is an intrinsically (partially disordered protein with a complex conformational landscape due to its inherent plasticity and to the interaction with its different effectors. Here we summarize the results from a detailed biophysical characterization of this enzyme and present new experimental data.

  4. Biophysical features of bacillithiol, the glutathione surrogate of Bacillus subtilis and other firmicutes. (United States)

    Sharma, Sunil V; Arbach, Miriam; Roberts, Alexandra A; Macdonald, Colin J; Groom, Murree; Hamilton, Chris J


    Bacillithiol (BSH) is the major low-molecular-weight (LMW) thiol in many low-G+C Gram-positive bacteria (Firmicutes). Evidence now emerging suggests that BSH functions as an important LMW thiol in redox regulation and xenobiotic detoxification, analogous to what is already known for glutathione and mycothiol in other microorganisms. The biophysical properties and cellular concentrations of such LMW thiols are important determinants of their biochemical efficiency both as biochemical nucleophiles and as redox buffers. Here, BSH has been characterised and compared with other LMW thiols in terms of its thiol pKa , redox potential and thiol-disulfide exchange reactivity. Both the thiol pKa and the standard thiol redox potential of BSH are shown to be significantly lower than those of glutathione whereas the reactivities of the two compounds in thiol-disulfide reactions are comparable. The cellular concentration of BSH in Bacillus subtilis varied over different growth phases and reached up to 5 mM, which is significantly greater than previously observed from single measurements taken during mid-exponential growth. These results demonstrate that the biophysical characteristics of BSH are distinctively different from those of GSH and that its cellular concentrations can reach levels much higher than previously reported.

  5. Sperm morphometry: a tool for detecting biophysical changes associated with viability in cryopreserved bovine spermatozoa. (United States)

    García-Herreros, M; Leal, C L V


    The aim of this study was to determine whether computerised sperm head morphometric analysis can be used as a diagnostic tool for detecting biophysical changes associated with sperm viability in frozen-thawed bovine spermatozoa. Ejaculates from five bulls (4 ejaculates/bull) were pooled and processed for computerised morphometric analysis, and SYBR-14 green/ethidium homodimer-1 fluorescence-based live/dead viability assay was used simultaneously to confirm the viability index of frozen-thawed spermatozoa. Sperm samples were assigned to three experimental groups. The first group was enriched in live spermatozoa (after a double Percoll selection), the second group was enriched in dead spermatozoa (after a refreeze-thaw procedure), and the last group was a 50 : 50 pool of live/dead spermatozoa (from first and second group samples). There were significant differences (P sperm morphometric dimensional parameters among the three groups analysed, being the lowest overall sperm head dimension found in the second (dead spermatozoa) group. In conclusion, sperm head morphometry can be used as a potential diagnostic tool for detecting biophysical changes associated with sperm viability in frozen-thawed bovine spermatozoa.

  6. Remote Sensing of Grassland Biophysical Parameters in the Context of the Sentinel-2 Satellite Mission

    Directory of Open Access Journals (Sweden)

    Karolina Sakowska


    Full Text Available This study investigates the potential of the Sentinel-2 satellite for monitoring the seasonal changes in grassland total canopy chlorophyll content (CCC, fraction of photosynthetically active radiation absorbed by the vegetation canopy (FAPAR, and fraction of photosynthetically active radiation absorbed only by its photosynthesizing components (GFAPAR. Reflectance observations were collected on a continuous basis during growing seasons by means of a newly developed ASD-WhiteRef system. Two models using Sentinel-2 simulated data (linear regression-vegetation indices (VIs approach and multiple regression (MR reflectance approach were tested to estimate vegetation biophysical parameters. To assess whether the use of full solar spectrum reflectance data is able to provide an added value in CCC and GFAPAR estimation accuracy, a third model based on partial least squares regression (PLSR and the ASD-WhiteRef reflectance data was tested. The results showed that FAPAR remained quite stable during the reproduction and senescence stages, and no significant relationships between FAPAR and VIs were found. On the other hand, GFAPAR showed clearer seasonal trends. The comparison of the three models revealed no significant differences in the accuracies of CCC and GFAPAR predictions and demonstrated a strong contribution of SWIR bands to the explained variability of investigated parameters. The promising results highlight the potential of the Sentinel-2 satellite for retrieving biophysical parameters from space.

  7. Algorithms and novel applications based on the isokinetic ensemble. I. Biophysical and path integral molecular dynamics (United States)

    Minary, Peter; Martyna, Glenn J.; Tuckerman, Mark E.


    In this paper (Paper I) and a companion paper (Paper II), novel new algorithms and applications of the isokinetic ensemble as generated by Gauss' principle of least constraint, pioneered for use with molecular dynamics 20 years ago, are presented for biophysical, path integral, and Car-Parrinello based ab initio molecular dynamics. In Paper I, a new "extended system" version of the isokinetic equations of motion that overcomes the ergodicity problems inherent in the standard approach, is developed using a new theory of non-Hamiltonian phase space analysis [M. E. Tuckerman et al., Europhys. Lett. 45, 149 (1999); J. Chem. Phys. 115, 1678 (2001)]. Reversible multiple time step integrations schemes for the isokinetic methods, first presented by Zhang [J. Chem. Phys. 106, 6102 (1997)] are reviewed. Next, holonomic constraints are incorporated into the isokinetic methodology for use in fast efficient biomolecular simulation studies. Model and realistic examples are presented in order to evaluate, critically, the performance of the new isokinetic molecular dynamic schemes. Comparisons are made to the, now standard, canonical dynamics method, Nosé-Hoover chain dynamics [G. J. Martyna et al., J. Chem. Phys. 97, 2635 (1992)]. The new isokinetic techniques are found to yield more efficient sampling than the Nosé-Hoover chain method in both path integral molecular dynamics and biophysical molecular dynamics calculations. In Paper II, the use of isokinetic methods in Car-Parrinello based ab initio molecular dynamics calculations is presented.

  8. Emergy analysis of a farm biogas project in China: A biophysical perspective of agricultural ecological engineering (United States)

    Zhou, S. Y.; Zhang, B.; Cai, Z. F.


    This paper aims to present a biophysical understanding of the agricultural ecological engineering by emergy analysis for a farm biogas project in China as a representative case. Accounting for the resource inputs into and accumulation within the project, as well as the outputs to the social system, emergy analysis provides an empirical study in the biophysical dimension of the agricultural ecological engineering. Economic benefits and ecological economic benefits of the farm biogas project indicated by market value and emergy monetary value are discussed, respectively. Relative emergy-based indices such as renewability (R%), emergy yield ratio (EYR), environmental load ratio (ELR) and environmental sustainability index (ESI) are calculated to evaluate the environmental load and local sustainability of the concerned biogas project. The results show that the farm biogas project has more reliance on the local renewable resources input, less environmental pressure and higher sustainability compared with other typical agricultural systems. In addition, holistic evaluation and its policy implications for better operation and management of the biogas project are presented.

  9. knowledge base model for evaluation of bio-physical tendency of dryland

    Institute of Scientific and Technical Information of China (English)



    The present study aims the evaluation of bio-physical characteristics towards soil-water-vegetation stress and a rule is envisaged to assess the degree of temporal changes. The digital rule for assessment is initialized through the index of land Instability (ILI) where the variance indicates the temporal instability of the pixel i.e., smallest land unit. It is assumed that the biophysical characteristic of land is in command of land-dynamics where there is no change in Land Use/Land Cover (LU&LC). The intensity map on tendency of albedo (IALB) assesses the intensity of soil erosion and water stress whereas intensity map on tendency of NDVI (INDVI) appraises the stress on vegetation. The carry-out study covers a part of semiarid Western India. Primarily remote sensing technique, which carries the digital information of land temporally and spatially, is adopted in this paper. A part of the study area is represented using two sets of IRS IA/1B LISS-I data of March with a decadal time domain 0989-1998) as a test area. It is assumed that the soil-water-vegetation stress is maximum during summer(March-April-May) in any tropical belt and decadal data will stretch the possibilitv of climate as well as man-made activity over the land.

  10. Concentric Gel System to Study the Biophysical Role of Matrix Microenvironment on 3D Cell Migration (United States)

    Kurniawan, Nicholas Agung; Chaudhuri, Parthiv Kant; Lim, Chwee Teck


    The ability of cells to migrate is crucial in a wide variety of cell functions throughout life from embryonic development and wound healing to tumor and cancer metastasis. Despite intense research efforts, the basic biochemical and biophysical principles of cell migration are still not fully understood, especially in the physiologically relevant three-dimensional (3D) microenvironments. Here, we describe an in vitro assay designed to allow quantitative examination of 3D cell migration behaviors. The method exploits the cell’s mechanosensing ability and propensity to migrate into previously unoccupied extracellular matrix (ECM). We use the invasion of highly invasive breast cancer cells, MDA-MB-231, in collagen gels as a model system. The spread of cell population and the migration dynamics of individual cells over weeks of culture can be monitored using live-cell imaging and analyzed to extract spatiotemporally-resolved data. Furthermore, the method is easily adaptable for diverse extracellular matrices, thus offering a simple yet powerful way to investigate the role of biophysical factors in the microenvironment on cell migration. PMID:25867104

  11. The Biophysical Probes 2-fluorohistidine and 4-fluorohistidine: Spectroscopic Signatures and Molecular Properties (United States)

    Kasireddy, Chandana; Ellis, Jonathan M.; Bann, James G.; Mitchell-Koch, Katie R.


    Fluorinated amino acids serve as valuable biological probes, by reporting on local protein structure and dynamics through 19F NMR chemical shifts. 2-fluorohistidine and 4-fluorohistidine, studied here with DFT methods, have even more capabilities for biophysical studies, as their altered pKa values, relative to histidine, allow for studies of the role of proton transfer and tautomeric state in enzymatic mechanisms. Considering the two tautomeric forms of histidine, it was found that 2-fluorohistidine primarily forms the common (for histidine) τ-tautomer at neutral pH, while 4-fluorohistidine exclusively forms the less common π-tautomer. This suggests the two isomers of fluorohistidine can also serve as probes of tautomeric form within biomolecules, both by monitoring NMR chemical shifts and by potential perturbation of the tautomeric equilibrium within biomolecules. Fluorine also enables assignment of tautomeric states in crystal structures. The differences in experimental pKa values between the isomers was found to arise from solvation effects, providing insight into the polarization and molecular properties of each isomer. Results also encompass 13C and 19F NMR chemical shifts, from both tautomers of 2-fluorohistidine and 4-fluorohistidine in a number of different environments. This work can serve as a guide for interpretation of spectroscopic results in biophysical studies employing 2-fluorohistidine and 4-fluorohistidine.

  12. Inferring Neuronal Dynamics from Calcium Imaging Data Using Biophysical Models and Bayesian Inference. (United States)

    Rahmati, Vahid; Kirmse, Knut; Marković, Dimitrije; Holthoff, Knut; Kiebel, Stefan J


    Calcium imaging has been used as a promising technique to monitor the dynamic activity of neuronal populations. However, the calcium trace is temporally smeared which restricts the extraction of quantities of interest such as spike trains of individual neurons. To address this issue, spike reconstruction algorithms have been introduced. One limitation of such reconstructions is that the underlying models are not informed about the biophysics of spike and burst generations. Such existing prior knowledge might be useful for constraining the possible solutions of spikes. Here we describe, in a novel Bayesian approach, how principled knowledge about neuronal dynamics can be employed to infer biophysical variables and parameters from fluorescence traces. By using both synthetic and in vitro recorded fluorescence traces, we demonstrate that the new approach is able to reconstruct different repetitive spiking and/or bursting patterns with accurate single spike resolution. Furthermore, we show that the high inference precision of the new approach is preserved even if the fluorescence trace is rather noisy or if the fluorescence transients show slow rise kinetics lasting several hundred milliseconds, and inhomogeneous rise and decay times. In addition, we discuss the use of the new approach for inferring parameter changes, e.g. due to a pharmacological intervention, as well as for inferring complex characteristics of immature neuronal circuits.

  13. [The history of medical physics and biophysics at the Humboldt University in Berlin]. (United States)

    Schneck, P


    The present Institute of Medical Physics and Biophysics (former Institute of Radiation Research) was established on September 1st in 1923 by Walter Friedrich (1883-1968). It was after the Institute in Frankfurt A.M. (founded by Friedrich Dessauer in 1921) - the second Institute of its kind in Germany. As a physicist who wrote his dissertation under Wilhelm Conrad Röntgen, he did research together with a Gynecologist in Friedburg on problems of radiation therapy and the prevention of radiation injuries. Thus Friedrich became one of the first German Biomedical Physicists and was appointed to a professorship at the university of Berlin and its faculty of medicine. The paper gives a survey of the history of the Institute of Radiation Research in the twenties, in the time of Nazi-rule, the period after the World War II and in the era of GDR until 1990 and up to the present time. The succession of directorship of the Institute and the main research subjects in medical physics and biophysics have been sketched.

  14. Analog VLSI Biophysical Neurons and Synapses With Programmable Membrane Channel Kinetics. (United States)

    Yu, Theodore; Cauwenberghs, Gert


    We present and characterize an analog VLSI network of 4 spiking neurons and 12 conductance-based synapses, implementing a silicon model of biophysical membrane dynamics and detailed channel kinetics in 384 digitally programmable parameters. Each neuron in the analog VLSI chip (NeuroDyn) implements generalized Hodgkin-Huxley neural dynamics in 3 channel variables, each with 16 parameters defining channel conductance, reversal potential, and voltage-dependence profile of the channel kinetics. Likewise, 12 synaptic channel variables implement a rate-based first-order kinetic model of neurotransmitter and receptor dynamics, accounting for NMDA and non-NMDA type chemical synapses. The biophysical origin of all 384 parameters in 24 channel variables supports direct interpretation of the results of adapting/tuning the parameters in terms of neurobiology. We present experimental results from the chip characterizing single neuron dynamics, single synapse dynamics, and multi-neuron network dynamics showing phase-locking behavior as a function of synaptic coupling strength. Uniform temporal scaling of the dynamics of membrane and gating variables is demonstrated by tuning a single current parameter, yielding variable speed output exceeding real time. The 0.5 CMOS chip measures 3 mm 3 mm, and consumes 1.29 mW.

  15. Biophysical Neural Spiking, Bursting, and Excitability Dynamics in Reconfigurable Analog VLSI. (United States)

    Yu, T; Sejnowski, T J; Cauwenberghs, G


    We study a range of neural dynamics under variations in biophysical parameters underlying extended Morris-Lecar and Hodgkin-Huxley models in three gating variables. The extended models are implemented in NeuroDyn, a four neuron, twelve synapse continuous-time analog VLSI programmable neural emulation platform with generalized channel kinetics and biophysical membrane dynamics. The dynamics exhibit a wide range of time scales extending beyond 100 ms neglected in typical silicon models of tonic spiking neurons. Circuit simulations and measurements show transition from tonic spiking to tonic bursting dynamics through variation of a single conductance parameter governing calcium recovery. We similarly demonstrate transition from graded to all-or-none neural excitability in the onset of spiking dynamics through the variation of channel kinetic parameters governing the speed of potassium activation. Other combinations of variations in conductance and channel kinetic parameters give rise to phasic spiking and spike frequency adaptation dynamics. The NeuroDyn chip consumes 1.29 mW and occupies 3 mm × 3 mm in 0.5 μm CMOS, supporting emerging developments in neuromorphic silicon-neuron interfaces.

  16. Considerations for comparing radiation-induced chromosome aberration data with predictions from biophysical models (United States)

    Wu, H.; Furusawa, Y.; George, K.; Kawata, T.; Cucinotta, F.

    Biophysical models addressing the formation of radiation-induced chromosome aberrations are usually based on the assumption that chromosome aberrations are formed by DNA double strand break (DSB) misrejoining, via either the homologous or the non-homologous repair pathway. However, comparing chromosome aberration data with model predictions is not always straightforward. In this paper we discuss some of the aspects that must be considered to make these comparisons meaningful. Firstly, biophysical models are usually applied to DSB rejoining and misrejoining in the G0/G1 phase of the cell cycle, while most chromosome aberration data reported in the literature are analyzed in metaphase. Since cells must progress through the cell cycle check points in order to reach mitosis, model predictions that differ from the metaphase chromosome analysis may actually agree with the aberration data in chromosomes collected in interphase. Secondly, high- LET radiation generally produces more complex aberrations involving exchanges between three or more DSB. While some models have successfully provided quantitative predictions of high-LET radiation induced complex aberrations in human lymphocytes, applying such models to other cell types requires special considerations due to the lack of geometric symmetry of the nucleus. Chromosome aberration data for non-spherical human fibroblast cells bombarded from various directions by high-LET charged particles will be presented, and their implication on physical modeling will be discussed.

  17. Biophysical connectivity explains population genetic structure in a highly dispersive marine species (United States)

    Truelove, Nathan K.; Kough, Andrew S.; Behringer, Donald C.; Paris, Claire B.; Box, Stephen J.; Preziosi, Richard F.; Butler, Mark J.


    Connectivity, the exchange of individuals among locations, is a fundamental ecological process that explains how otherwise disparate populations interact. For most marine organisms, dispersal occurs primarily during a pelagic larval phase that connects populations. We paired population structure from comprehensive genetic sampling and biophysical larval transport modeling to describe how spiny lobster ( Panulirus argus) population differentiation is related to biological oceanography. A total of 581 lobsters were genotyped with 11 microsatellites from ten locations around the greater Caribbean. The overall F ST of 0.0016 ( P = 0.005) suggested low yet significant levels of structuring among sites. An isolation by geographic distance model did not explain spatial patterns of genetic differentiation in P. argus ( P = 0.19; Mantel r = 0.18), whereas a biophysical connectivity model provided a significant explanation of population differentiation ( P = 0.04; Mantel r = 0.47). Thus, even for a widely dispersing species, dispersal occurs over a continuum where basin-wide larval retention creates genetic structure. Our study provides a framework for future explorations of wide-scale larval dispersal and marine connectivity by integrating empirical genetic research and probabilistic modeling.

  18. Incorporating Bio-Physical Sciences into a Decision Support Tool for Sustainable Urban Planning

    Directory of Open Access Journals (Sweden)

    Zina Mitraka


    Full Text Available Deciding upon optimum planning actions in terms of sustainable urban planning involves the consideration of multiple environmental and socio-economic criteria. The transformation of natural landscapes to urban areas affects energy and material fluxes. An important aspect of the urban environment is the urban metabolism, and changes in such metabolism need to be considered for sustainable planning decisions. A spatial Decision Support System (DSS prototyped within the European FP7-funded project BRIDGE (sustainaBle uRban plannIng Decision support accountinG for urban mEtabolism, enables accounting for the urban metabolism of planning actions, by exploiting the current knowledge and technology of biophysical sciences. The main aim of the BRIDGE project was to bridge the knowledge and communication gap between urban planners and environmental scientists and to illustrate the advantages of considering detailed environmental information in urban planning processes. The developed DSS prototype integrates biophysical observations and simulation techniques with socio-economic aspects in five European cities, selected as case studies for the pilot application of the tool. This paper describes the design and implementation of the BRIDGE DSS prototype, illustrates some examples of use, and highlights the need for further research and development in the field.

  19. Biophysical regulation of Chlamydia pneumoniae-infected monocyte recruitment to atherosclerotic foci (United States)

    Evani, Shankar J.; Ramasubramanian, Anand K.


    Chlamydia pneumoniae infection is implicated in atherosclerosis although the contributory mechanisms are poorly understood. We hypothesize that C. pneumoniae infection favors the recruitment of monocytes to atherosclerotic foci by altering monocyte biophysics. Primary, fresh human monocytes were infected with C. pneumoniae for 8 h, and the interactions between monocytes and E-selectin or aortic endothelium under flow were characterized by video microscopy and image analysis. The distribution of membrane lipid rafts and adhesion receptors were analyzed by imaging flow cytometry. Infected cells rolled on E-selectin and endothelial surfaces, and this rolling was slower, steady and uniform compared to uninfected cells. Infection decreases cholesterol levels, increases membrane fluidity, disrupts lipid rafts, and redistributes CD44, which is the primary mediator of rolling interactions. Together, these changes translate to higher firm adhesion of infected monocytes on endothelium, which is enhanced in the presence of LDL. Uninfected monocytes treated with LDL or left untreated were used as baseline control. Our results demonstrate that the membrane biophysical changes due to infection and hyperlipidemia are one of the key mechanisms by which C. pneumoniae can exacerbate atherosclerotic pathology. These findings provide a framework to characterize the role of ‘infectious burden’ in the development and progression of atherosclerosis.

  20. CCR5-CCL Axis in PDL during Orthodontic Biophysical Force Application. (United States)

    Lee, S Y; Yoo, H I; Kim, S H


    Tooth movement by application of orthodontic biophysical force primarily reflects the role of soluble molecules released from the periodontal ligament (PDL). Thus far, many factors have been reported to be involved in orthodontic tooth movement (OTM), but key molecules that orchestrate responses of periodontal tissues to biophysical force are still enigmatic. In this in vivo study, in which the upper first molars in rats were moved, differential display-polymerase chain reaction revealed that CC chemokine receptor 5 (CCR5) level was differentially increased during OTM. Strong immunoreactivity for CCR5 was found in the PDL undergoing force application. Moreover, the in vitro compression or tension force application to primary cultured human PDL cells increased the expression of CCR5 and CCR5 ligands. In vitro tension force on human PDL cells did not induce RANKL, an osteoclastogenesis-inducing factor, but did induce the upregulation of IL12, an osteoclast inhibitory factor, and osteoblast differentiation factors, including Runx2, which was attenuated under tension by CCR5 gene silencing whereas augmented with CCR5 ligands. In contrast, in vitro compression force did not induce the expression of osteoprotegerin, a decoy receptor for RANKL and Runx2, but did induce the upregulation of RANKL, which was attenuated under compression by CCR5 gene silencing. These results suggest that the CCR5-CCR5 ligands axis in PDL cells may play a crucial role in the remodeling of periodontal tissues and can be a therapeutic target for achieving efficient OTM.

  1. Contributions of computational chemistry and biophysical techniques to fragment-based drug discovery. (United States)

    Gozalbes, Rafael; Carbajo, Rodrigo J; Pineda-Lucena, Antonio


    In the last decade, fragment-based drug discovery (FBDD) has evolved from a novel approach in the search of new hits to a valuable alternative to the high-throughput screening (HTS) campaigns of many pharmaceutical companies. The increasing relevance of FBDD in the drug discovery universe has been concomitant with an implementation of the biophysical techniques used for the detection of weak inhibitors, e.g. NMR, X-ray crystallography or surface plasmon resonance (SPR). At the same time, computational approaches have also been progressively incorporated into the FBDD process and nowadays several computational tools are available. These stretch from the filtering of huge chemical databases in order to build fragment-focused libraries comprising compounds with adequate physicochemical properties, to more evolved models based on different in silico methods such as docking, pharmacophore modelling, QSAR and virtual screening. In this paper we will review the parallel evolution and complementarities of biophysical techniques and computational methods, providing some representative examples of drug discovery success stories by using FBDD.

  2. Large-scale overexpression and purification of ADARs from Saccharomyces cerevisiae for biophysical and biochemical studies. (United States)

    Macbeth, Mark R; Bass, Brenda L


    Many biochemical and biophysical analyses of enzymes require quantities of protein that are difficult to obtain from expression in an endogenous system. To further complicate matters, native adenosine deaminases that act on RNA (ADARs) are expressed at very low levels, and overexpression of active protein has been unsuccessful in common bacterial systems. Here we describe the plasmid construction, expression, and purification procedures for ADARs overexpressed in the yeast Saccharomyces cerevisiae. ADAR expression is controlled by the Gal promoter, which allows for rapid induction of transcription when the yeast are grown in media containing galactose. The ADAR is translated with an N-terminal histidine tag that is cleaved by the tobacco etch virus protease, generating one nonnative glycine residue at the N-terminus of the ADAR protein. ADARs expressed using this system can be purified to homogeneity, are highly active in deaminating RNA, and are produced in quantities (from 3 to 10mg of pure protein per liter of yeast culture) that are sufficient for most biophysical studies.

  3. Preparation and Biophysical Characterization of Poly(amidoamine) Dendrimer-Poly(acrylic acid) Graft. (United States)

    Dung, Tran Huu; Do, Le Thanh; Loan, Ta Thi; Yoo, Hoon


    A series of PAMAM dendrimer generation 5-poly(acrylic acid) grafts were prepared to evaluate the potential use of dendritic grafts as a drug encapsulated nanocarrier. The structural features of the synthesized polymer graft were identified by FT-IR and 1H-NMR spectra and the biophysical properties were characterized by measuring its particle size and zeta potential. The prepared dendrimer G5-PAA grafts had particle size in the range of 600 to 900 nm and the size increased proportionally with the number of PAA on dendrimer surface. The electrostatic property of the dendrimer G5-PAA, carried out by HPLC reversed phase column analysis and the measurement of zeta potential, revealed that both migration time and zeta potential were dependent on the number of grafted PAA. The number of free amino groups on dendrimer G5-PAA, determined quantitatively by fluorescamine assay, was in a reverse order with the reaction mole ratio of dendrimer to PAA. In addition, dendrimer G5-PAA showed a pH-dependent solubility in aqueous solution with characteristic pH region of solubility, depending on the dendrimer generation. The observed biophysical properties indicate that PAMAM dendrimer G5-PAA is promising as a drug encapsulated nanocarrier.

  4. Constraining canopy biophysical simulations with daily MODIS reflectance data ensuring pixel-target adequacy (United States)

    Drewry, D.; Duveiller, G.


    Modern vegetation models incorporate ecophysiological details that allow for accurate estimates of carbon dioxide uptake, water use and energy exchange, but require knowledge of dynamic structural and biochemical traits. Variations in these traits are controlled by genetic factors as well as growth stage and nutrient and moisture availability, making them difficult to predict and prone to significant error. Here we explore the use of daily MODIS optical reflectance data for constraining key canopy- and leaf-level traits required by forward biophysical models. A multi-objective optimization algorithm is used to invert the PROSAIL canopy radiation transfer model against MODIS optical reflectance observations. PROSAIL accounts for the effects of leaf-level optical properties, foliage distribution and orientation on canopy reflectance across the optical range. Inversions are conducted for several growing seasons for both soybean and maize at multiple sites across the Central US agro-ecosystem. These inversions provide estimates of seasonal variations, and associated uncertainty, of variables such as leaf area index (LAI). The inversion-derived canopy properties are used to examine the ability of MODIS data to characterize seasonal variations in these states relative to field observations. The canopy properties are then used as inputs into the MLCan biophysical model to conduct forward simulations. MLCan characterizes the ecophysiological functioning of a plant canopy at a half-hourly timestep, and has been rigorously validated for both C3 and C4 crops against observations of canopy CO2 uptake, evapotranspiration and sensible heat exchange. By utilizing the inverted canopy states to drive MLCan over several growing seasons, we are able to assess the impact of uncertainty in the MODIS inversion procedure on uncertainties in forward model flux estimates. This work requires the use of instant (non-composited) observations obtained at a daily frequency from both Terra and

  5. Extraction of Mangrove Biophysical Parameters Using Airborne LiDAR

    Directory of Open Access Journals (Sweden)

    Poonsak Miphokasap


    Full Text Available Tree parameter determinations using airborne Light Detection and Ranging (LiDAR have been conducted in many forest types, including coniferous, boreal, and deciduous. However, there are only a few scientific articles discussing the application of LiDAR to mangrove biophysical parameter extraction at an individual tree level. The main objective of this study was to investigate the potential of using LiDAR data to estimate the biophysical parameters of mangrove trees at an individual tree scale. The Variable Window Filtering (VWF and Inverse Watershed Segmentation (IWS methods were investigated by comparing their performance in individual tree detection and in deriving tree position, crown diameter, and tree height using the LiDAR-derived Canopy Height Model (CHM. The results demonstrated that each method performed well in mangrove forests with a low percentage of crown overlap conditions. The VWF method yielded a slightly higher accuracy for mangrove parameter extractions from LiDAR data compared with the IWS method. This is because the VWF method uses an adaptive circular filtering window size based on an allometric relationship. As a result of the VWF method, the position measurements of individual tree indicated a mean distance error value of 1.10 m. The individual tree detection showed a kappa coefficient of agreement (K value of 0.78. The estimation of crown diameter produced a coefficient of determination (R2 value of 0.75, a Root Mean Square Error of the Estimate (RMSE value of 1.65 m, and a Relative Error (RE value of 19.7%. Tree height determination from LiDAR yielded an R2 value of 0.80, an RMSE value of 1.42 m, and an RE value of 19.2%. However, there are some limitations in the mangrove parameters derived from LiDAR. The results indicated that an increase in the percentage of crown overlap (COL results in an accuracy decrease of the mangrove parameters extracted from the LiDAR-derived CHM, particularly for crown measurements. In this

  6. Computer Simulation and Data Analysis in Molecular Biology and Biophysics An Introduction Using R

    CERN Document Server

    Bloomfield, Victor


    This book provides an introduction, suitable for advanced undergraduates and beginning graduate students, to two important aspects of molecular biology and biophysics: computer simulation and data analysis. It introduces tools to enable readers to learn and use fundamental methods for constructing quantitative models of biological mechanisms, both deterministic and with some elements of randomness, including complex reaction equilibria and kinetics, population models, and regulation of metabolism and development; to understand how concepts of probability can help in explaining important features of DNA sequences; and to apply a useful set of statistical methods to analysis of experimental data from spectroscopic, genomic, and proteomic sources. These quantitative tools are implemented using the free, open source software program R. R provides an excellent environment for general numerical and statistical computing and graphics, with capabilities similar to Matlab®. Since R is increasingly used in bioinformat...

  7. Can biophysical properties of submersed macrophytes be determined by remote sensing?

    Energy Technology Data Exchange (ETDEWEB)

    Malthus, T.J. [Univ. of Edinburgh (United Kingdom); Ciraolo, G.; La Loggia, G. [Univ. of Palermo, Sicily (Italy)] [and others


    This paper details the development of a computationally efficient Monte Carlo simulation program to model photon transport through submersed plant canopies, with emphasis on Seagrass communities. The model incorporates three components: the transmission of photons through a water column of varying depth and turbidity; the interaction of photons within a submersed plant canopy of varying biomass; and interactions with the bottom substrate. The three components of the model are discussed. Simulations were performed based on measured parameters for Posidonia oceanica and compared to measured subsurface reflectance spectra made over comparable seagrass communities in Sicilian coastal waters. It is shown that the output is realistic. Further simulations are undertaken to investigate the effect of depth and turbidity of the overlying water column. Both sets of results indicate the rapid loss of canopy signal as depth increases and water column phytoplankton concentrations increase. The implications for the development of algorithms for the estimation of submersed canopy biophysical parameters are briefly discussed.

  8. Biophysical and biological factors determining the ability to achieve long-term cryobiological preservation

    Energy Technology Data Exchange (ETDEWEB)

    Mazur, P. [Oak Ridge National Lab., TN (United States). Life Sciences Div.


    The BESTCapsule will maintain appropriate biological specimens for decades or centuries at cryogenic temperatures in the living state. Maintenance at temperatures below {approximately} {minus}140 C is not a problem. No ordinary chemical reactions in aqueous solutions can occur. The only source of damage will be the slow accumulation of physical damage to DNA from background ionizing radiation. But this source of damage should not become serious in less than a millennium. Rather, the main problem in cryopreservation is to devise procedures for cooling the biological specimens to {minus}196 C and returning them to normal temperatures without inflicting lethal injury. Regardless of the cell type, there are certain encompassing biophysical factors and constraints that determine whether they will survive or die during freezing and thawing. Superimposed on these may be special biological factors that apply to specific cell types. This paper will emphasize the former and give illustrative examples of the latter.

  9. Optimization of Curvi-Linear Tracing Applied to Solar Physics and Biophysics

    CERN Document Server

    Aschwanden, Markus J; Katrukha, Eugene A


    We developed an automated pattern recognition code that is particularly well suited to extract one-dimensional curvi-linear features from two-dimensional digital images. A former version of this {\\sl Oriented Coronal CUrved Loop Tracing (OCCULT)} code was applied to spacecraft images of magnetic loops in the solar corona, recorded with the NASA spacecraft {\\sl Transition Region And Coronal Explorer (TRACE)} in extreme ultra-violet wavelengths. Here we apply an advanced version of this code ({\\sl OCCULT-2}) also to similar images from the {\\sl Solar Dynamics Observatory (SDO)}, to chromospheric H-$\\alpha$ images obtained with the {\\sl Swedish Solar Telescope (SST)}, and to microscopy images of microtubule filaments in live cells in biophysics. We provide a full analytical description of the code, optimize the control parameters, and compare the automated tracing with visual/manual methods. The traced structures differ by up to 16 orders of magnitude in size, which demonstrates the universality of the tracing a...

  10. Summaries of research projects for fiscal years 1996 and 1997, medical applications and biophysical research

    Energy Technology Data Exchange (ETDEWEB)



    The Medical Applications and Biophysical Research Division of the Office of Biological and Environmental Research supports and manages research in several distinct areas of science and technology. The projects described in this book are grouped by the main budgetary areas: General Life Sciences (structural molecular biology), Medical Applications (primarily nuclear medicine) and Measurement Science (analytical chemistry instrumentation), Environmental Management Science Program, and the Small Business Innovation Research Program. The research funded by this division complements that of the other two divisions in the Office of Biological and Environmental Research (OBER): Health Effects and Life Sciences Research, and Environmental Sciences. Most of the OBER programs are planned and administered jointly by the staff of two or all three of the divisions. This summary book provides information on research supported in these program areas during Fiscal Years 1996 and 1997.

  11. Canopy-scale biophysical controls of transpiration and evaporation in the Amazon Basin (United States)

    Mallick, Kaniska; Trebs, Ivonne; Boegh, Eva; Giustarini, Laura; Schlerf, Martin; Drewry, Darren T.; Hoffmann, Lucien; von Randow, Celso; Kruijt, Bart; Araùjo, Alessandro; Saleska, Scott; Ehleringer, James R.; Domingues, Tomas F.; Ometto, Jean Pierre H. B.; Nobre, Antonio D.; Leal de Moraes, Osvaldo Luiz; Hayek, Matthew; Munger, J. William; Wofsy, Steven C.


    Canopy and aerodynamic conductances (gC and gA) are two of the key land surface biophysical variables that control the land surface response of land surface schemes in climate models. Their representation is crucial for predicting transpiration (λET) and evaporation (λEE) flux components of the terrestrial latent heat flux (λE), which has important implications for global climate change and water resource management. By physical integration of radiometric surface temperature (TR) into an integrated framework of the Penman-Monteith and Shuttleworth-Wallace models, we present a novel approach to directly quantify the canopy-scale biophysical controls on λET and λEE over multiple plant functional types (PFTs) in the Amazon Basin. Combining data from six LBA (Large-scale Biosphere-Atmosphere Experiment in Amazonia) eddy covariance tower sites and a TR-driven physically based modeling approach, we identified the canopy-scale feedback-response mechanism between gC, λET, and atmospheric vapor pressure deficit (DA), without using any leaf-scale empirical parameterizations for the modeling. The TR-based model shows minor biophysical control on λET during the wet (rainy) seasons where λET becomes predominantly radiation driven and net radiation (RN) determines 75 to 80 % of the variances of λET. However, biophysical control on λET is dramatically increased during the dry seasons, and particularly the 2005 drought year, explaining 50 to 65 % of the variances of λET, and indicates λET to be substantially soil moisture driven during the rainfall deficit phase. Despite substantial differences in gA between forests and pastures, very similar canopy-atmosphere "coupling" was found in these two biomes due to soil moisture-induced decrease in gC in the pasture. This revealed the pragmatic aspect of the TR-driven model behavior that exhibits a high sensitivity of gC to per unit change in wetness as opposed to gA that is marginally sensitive to surface wetness variability

  12. Chemical and Biophysical Modulation of Cas9 for Tunable Genome Engineering. (United States)

    Nuñez, James K; Harrington, Lucas B; Doudna, Jennifer A


    The application of the CRISPR-Cas9 system for genome engineering has revolutionized the ability to interrogate genomes of mammalian cells. Programming the Cas9 endonuclease to induce DNA breaks at specified sites is achieved by simply modifying the sequence of its cognate guide RNA. Although Cas9-mediated genome editing has been shown to be highly specific, cleavage events at off-target sites have also been reported. Minimizing, and eventually abolishing, unwanted off-target cleavage remains a major goal of the CRISPR-Cas9 technology before its implementation for therapeutic use. Recent efforts have turned to chemical biology and biophysical approaches to engineer inducible genome editing systems for controlling Cas9 activity at the transcriptional and protein levels. Here, we review recent advancements to modulate Cas9-mediated genome editing by engineering split-Cas9 constructs, inteins, small molecules, protein-based dimerizing domains, and light-inducible systems.

  13. Biophysical Insights from Temperature-Dependent Single-Molecule Förster Resonance Energy Transfer (United States)

    Holmstrom, Erik D.; Nesbitt, David J.


    Single-molecule fluorescence microscopy techniques can be used in combination with micrometer length-scale temperature control and Förster resonance energy transfer (FRET) in order to gain detailed information about fundamental biophysical phenomena. In particular, this combination of techniques has helped foster the development of remarkable quantitative tools for studying both time- and temperature-dependent structural kinetics of biopolymers. Over the past decade, multiple research efforts have successfully incorporated precise spatial and temporal control of temperature into single-molecule FRET (smFRET)-based experiments, which have uncovered critical thermodynamic information on a wide range of biological systems such as conformational dynamics of nucleic acids. This review provides an overview of various temperature-dependent smFRET approaches from our laboratory and others, highlighting efforts in which such methods have been successfully applied to studies of single-molecule nucleic acid folding.


    Directory of Open Access Journals (Sweden)

    Ioana-Andreea, MARINESCU


    Full Text Available Scientific Investigation of sustainability sanitary herein, matters to a define the structure of the health sector; b knowing the contents of the local health systems, c to obtain information about the properties and characteristics associated with health in Romania; d obtaining views on the mission, objectives, goals and targets pursued by health services; e scheduling results, effects and positive consequences among human communities to ensure sustainable health in the framework of sustainable development of the country and, last but not least; f it is intended to measure people's participation and the rule management process, based on biochemical and biophysical control structures. Mainly, it is considered that the sustainability and health have depicted conceptual content that must be secured effectively recovered, concrete operational activities of health systems in laboratories and hospitals.

  15. Radiation biophysical aspects of charged particles: From the nanoscale to therapy (United States)

    Scifoni, Emanuele


    Charged particle applications for radiotherapy are motivated by their specific advantages in terms of dose delivery and biological effect. These advantages have to a large extent originated from the peculiarities of ion beam energy deposition patterns in the medium on a microscopic, down to a nanoscopic scale. A large amount of research was conducted in this direction, especially in the last two decades, profiting also from the parallel investigations going on in radiation protection for space exploration. The main biophysical aspects of charged particles, which are relevant to hadrontherapy are shortly reviewed in the present contribution, namely focusing on relative biological effectiveness (RBE), oxygen enhancement ratio (OER) and combination with radiosensitizers. A summary of present major research direction on both microscopic and macroscopic assessment of the specific mechanism of radiation damage will be given, as well as several open challenges for a better understanding of the whole process, which still limit the full exploitation of ion beams for radiotherapy.

  16. Generation and extraction of second pitch-shift from cochlear biophysics

    CERN Document Server

    Gomez, Florian


    It has been long known that the perceived pitch of a complex harmonic sound changes if the partials of the sound are shifted in frequency by a fixed amount. Rules that this pitch-shift can be expected to follow can be derived from simple nonlinear modeling (first pitch-shift), but clear deviations were observed in corresponding psychoacoustic experiments (second pitch-shift effects). This raises the question of whether these deviations are due to the biophysics of the nonlinear hearing sensor, the cochlea, or are an artifact generated higher up in the auditory pathway. In this article, we explicitly confirm that the second pitch-shift originates in the cochlea, and that the key factors responsible for the phenomenon are combination-tone generation, low-pass filtering and feed-forward coupling in the cochlea. We find, in particular, that the scaling laws of Hopf cochlea combination tones fully explain the psychoacoustical pitch data of G.F. Smoorenburg (1970).

  17. Exploring the biophysical option space for feeding the world without deforestation. (United States)

    Erb, Karl-Heinz; Lauk, Christian; Kastner, Thomas; Mayer, Andreas; Theurl, Michaela C; Haberl, Helmut


    Safeguarding the world's remaining forests is a high-priority goal. We assess the biophysical option space for feeding the world in 2050 in a hypothetical zero-deforestation world. We systematically combine realistic assumptions on future yields, agricultural areas, livestock feed and human diets. For each scenario, we determine whether the supply of crop products meets the demand and whether the grazing intensity stays within plausible limits. We find that many options exist to meet the global food supply in 2050 without deforestation, even at low crop-yield levels. Within the option space, individual scenarios differ greatly in terms of biomass harvest, cropland demand and grazing intensity, depending primarily on the quantitative and qualitative aspects of human diets. Grazing constraints strongly limit the option space. Without the option to encroach into natural or semi-natural land, trade volumes will rise in scenarios with globally converging diets, thereby decreasing the food self-sufficiency of many developing regions.


    Directory of Open Access Journals (Sweden)



    Full Text Available At this hour, a large part of the products obtained through biotechnologies are used in animal fodder, thus contributing to the enhancement of the animal products obtained in economical conditions through optimising the nutrition. In the present study, we wanted to pursue the influence of a high level of cereal in fodder rations, as well as the effect of the yeast Saccharomyces cerevisiae, Yea Sacc1026 strain on some biophysical parameters of the ruminal fluid, such as: pH, density and superficial tension. It has been noted, that Yea Sacc1026 improves the pH and the superficial tension, which represents more stable ruminal fermentation when using fodder rations with a high level of barley.

  19. Biophysical assay for tethered signaling reactions reveals tether-controlled activity for the phosphatase SHP-1 (United States)

    Goyette, Jesse; Salas, Citlali Solis; Coker-Gordon, Nicola; Bridge, Marcus; Isaacson, Samuel A.; Allard, Jun; Dushek, Omer


    Tethered enzymatic reactions are ubiquitous in signaling networks but are poorly understood. A previously unreported mathematical analysis is established for tethered signaling reactions in surface plasmon resonance (SPR). Applying the method to the phosphatase SHP-1 interacting with a phosphorylated tether corresponding to an immune receptor cytoplasmic tail provides five biophysical/biochemical constants from a single SPR experiment: two binding rates, two catalytic rates, and a reach parameter. Tether binding increases the activity of SHP-1 by 900-fold through a binding-induced allosteric activation (20-fold) and a more significant increase in local substrate concentration (45-fold). The reach parameter indicates that this local substrate concentration is exquisitely sensitive to receptor clustering. We further show that truncation of the tether leads not only to a lower reach but also to lower binding and catalysis. This work establishes a new framework for studying tethered signaling processes and highlights the tether as a control parameter in clustered receptor signaling.

  20. Biophysical determinants for cellular uptake of hydrocarbon-stapled peptide helices. (United States)

    Bird, Gregory H; Mazzola, Emanuele; Opoku-Nsiah, Kwadwo; Lammert, Margaret A; Godes, Marina; Neuberg, Donna S; Walensky, Loren D


    Hydrocarbon-stapled peptides are a class of bioactive alpha-helical ligands developed to dissect and target protein interactions. While there is consensus that stapled peptides can be effective chemical tools for investigating protein regulation, their broader utility for therapeutic modulation of intracellular interactions remains an active area of study. In particular, the design principles for generating cell-permeable stapled peptides are empiric, yet consistent intracellular access is essential to in vivo application. Here, we used an unbiased statistical approach to determine which biophysical parameters dictate the uptake of stapled-peptide libraries. We found that staple placement at the amphipathic boundary combined with optimal hydrophobic and helical content are the key drivers of cellular uptake, whereas excess hydrophobicity and positive charge at isolated amino acid positions can trigger membrane lysis at elevated peptide dosing. Our results provide a design roadmap for maximizing the potential to generate cell-permeable stapled peptides with on-mechanism cellular activity.

  1. Validation of Global EO Biophysical Products at JECAM Test Site in Ukraine (United States)

    Skakun, Sergii; Kussul, Nataliia; Kravchenko, Oleksiy; Basarab, Ruslan; Ostapenko, Vadym; Yailymov, Bohdan; Shelestov, Andrii; Kolotii, Andrii; Mironov, Andrii

    Efficient global agriculture monitoring requires appropriate validation of Earth observation (EO) products for different regions and cropping system. This problem is addressed within the Joint Experiment of Crop Assessment and Monitoring (JECAM) initiative which aims to develop monitoring and reporting protocols and best practices for a variety of global agricultural systems. Ukraine is actively involved into JECAM, and a JECAM Ukraine test site was officially established in 2011. The following problems are being solved within JECAM Ukraine: (i) crop identification and crop area estimation [1]; (ii) crop yield forecasting [2]; (iii) EO products validation. The following case study regions were selected for these purposes: (i) the whole Kyiv oblast (28,000 sq. km) indented for crop mapping and acreage estimation; (ii) intensive observation sub-site in Pshenichne which is a research farm from the National University of Life and Environmental Sciences of Ukraine and indented for crop biophysical parameters estimation; (iii) Lviv region for rape-seed identification and crop rotation control; (iv) Crimea region for crop damage assessment due to droughts, and illegial field detection. In 2013, Ukrainian JECAM test site was selected as one of the “Champion User” for the ESA Sentinel-2 for Agriculture project. The test site was observed with SPOT-4 and RapidEye satellites every 5 days. The collected images are then used to simulate Sentinel-2 images for agriculture purposes. JECAM Ukraine is responsible for collecting ground observation data for validation purposes, and is involved in providing user requirements for Sentinel-2 agriculture related products. In particular, three field campaigns to characterize the vegetation biophysical parameters at the Pshenichne test site were carried out: First campaign - 14th to 17th of May 2013; second campaign - 12th to 15th of June 2013; third campaign - 14th to 17th of July 2013. Digital Hemispheric Photographs (DHP) images were

  2. Fructosylation induced structural changes in mammalian DNA examined by biophysical techniques (United States)

    Zaman, Asif; Arif, Zarina; Alam, Khursheed


    Glycosylation of DNA, proteins, lipids, etc. by reducing sugars, can lead to the formation of advanced glycation end products (AGEs). These products may accumulate and involve in the pathogenesis of a number of diseases, contributing to tissue injury via several mechanisms. In this study, fructosylation of calf thymus dsDNA was carried out with varying concentrations of fructose. The neo-structure of fructosylated-DNA was studied by various biophysical techniques and morphological characterization. Fructosylated-DNA showed hyperchromicity, increase in fluorescence intensity and decrease in melting temperature. The CD signal of modified-DNA shifted in the direction of higher wavelength indicative of structural changes in DNA. FTIR results indicated shift in specific band positions in fructosylated-DNA. Morphological characterization of fructosylated-DNA exhibited strand breakage and aggregation. The results suggest that the structure and conformation of DNA may be altered under high concentrations of fructose.

  3. Structural, Biochemical, and Biophysical Characterization of Idelalisib Binding to Phosphoinositide 3-Kinase δ* (United States)

    Somoza, John R.; Koditek, David; Villaseñor, Armando G.; Novikov, Nikolai; Wong, Melanie H.; Liclican, Albert; Xing, Weimei; Lagpacan, Leanna; Wang, Ruth; Schultz, Brian E.; Papalia, Giuseppe A.; Samuel, Dharmaraj; Lad, Latesh; McGrath, Mary E.


    Idelalisib (also known as GS-1101, CAL-101, IC489666, and Zydelig) is a PI3Kδ inhibitor that has recently been approved for the treatment of several hematological malignancies. Given its use in human diseases, we needed a clear picture of how idelalisib binds to and inhibits PI3Kδ. Our data show that idelalisib is a potent and selective inhibitor of the kinase activity of PI3Kδ. A kinetic characterization clearly demonstrated ATP-competitive inhibition, and several additional biochemical and biophysical assays showed that the compound binds reversibly and noncovalently to the kinase. A crystal structure of idelalisib bound to the p110δ subunit of PI3Kδ furthers our understanding of the binding interactions that confer the potency and selectivity of idelalisib. PMID:25631052

  4. Precision and Stability Issues in VBL, the Virtual Biophysics Lab simulation program

    CERN Document Server

    Milotti, Edoardo; Farina, Marcello; Liberati, Diego; Chignola, Roberto


    The network of biochemical reactions inside living organisms is characterized by an overwhelming complexity which stems from the sheer number of reactions and from the complicated topology of biochemical cycles. However the high speed of computers and the sophisticated computational methods that are available today are powerful tools that allow the numerical exploration of these exceedingly interesting dynamical systems. We are now developing a program, the Virtual Biophysics Lab (VBL), that simulates tumor spheroids, and which includes a reduced - but still quite complex - description of the biochemistry of individual cells, plus many diffusion processes that bring oxygen and nutrients into cells and metabolites into the environment. Each simulation step requires the integration of nonlinear differential equations that describe the individual cell's clockwork and the integration of the diffusion equations. These integrations are carried out under widely different conditions, in a changing environment, and fo...

  5. Construction of force measuring optical tweezers instrumentation and investigations of biophysical properties of bacterial adhesion organelles

    CERN Document Server

    Andersson, Magnus


    Optical tweezers are a technique in which microscopic-sized particles, including living cells and bacteria, can be non-intrusively trapped with high accuracy solely using focused light. The technique has therefore become a powerful tool in the field of biophysics. Optical tweezers thereby provide outstanding manipulation possibilities of cells as well as semi-transparent materials, both non-invasively and non-destructively, in biological systems. In addition, optical tweezers can measure minute forces (< 10-12 N), probe molecular interactions and their energy landscapes, and apply both static and dynamic forces in biological systems in a controlled manner. The assessment of intermolecular forces with force measuring optical tweezers, and thereby the biomechanical structure of biological objects, has therefore considerably facilitated our understanding of interactions and structures of biological systems. Adhesive bacterial organelles, so called pili, mediate adhesion to host cells and are therefore crucial...

  6. Modeling the effects of noninvasive transcranial brain stimulation at the biophysical, network, and cognitive Level

    DEFF Research Database (Denmark)

    Hartwigsen, Gesa; Bergmann, Til Ole; Herz, Damian Marc


    Noninvasive transcranial brain stimulation (NTBS) is widely used to elucidate the contribution of different brain regions to various cognitive functions. Here we present three modeling approaches that are informed by functional or structural brain mapping or behavior profiling and discuss how...... these approaches advance the scientific potential of NTBS as an interventional tool in cognitive neuroscience. (i) Leveraging the anatomical information provided by structural imaging, the electric field distribution in the brain can be modeled and simulated. Biophysical modeling approaches generate testable...... predictions regarding the impact of interindividual variations in cortical anatomy on the injected electric fields or the influence of the orientation of current flow on the physiological stimulation effects. (ii) Functional brain mapping of the spatiotemporal neural dynamics during cognitive tasks can...

  7. The biophysical properties of Basal lamina gels depend on the biochemical composition of the gel. (United States)

    Arends, Fabienna; Nowald, Constantin; Pflieger, Kerstin; Boettcher, Kathrin; Zahler, Stefan; Lieleg, Oliver


    The migration of cells within a three-dimensional extracellular matrix (ECM) depends sensitively on the biochemical and biophysical properties of the matrix. An example for a biological ECM is given by reconstituted basal lamina gels purified from the Engelbreth-Holm-Swarm sarcoma of mice. Here, we compare four different commercial variants of this ECM, which have all been purified according to the same protocol. Nevertheless, in those gels, we detect strong differences in the migration behavior of leukocyte cells as well as in the Brownian motion of nanoparticles. We show that these differences correlate with the mechanical properties and the microarchitecture of the gels which in turn arise from small variations in their biochemical composition.

  8. Retrieval of canopy biophysical variables from remote sensing data using contextual information

    Institute of Scientific and Technical Information of China (English)


    In order to improve the accuracy of biophysical parameters retrieved from remotely sensing data,a new algorithm was presented by using spatial contextual to estimate canopy variables from high-resolution remote sensing images.The developed algorithm was used for inversion of leaf area index (LAI) from Enhanced Thematic Mapper Plus (ETM+) data by combining with optimization method to minimize cost functions.The results show that the distribution of LAI is spatially consistent with the false composition imagery from ETM+ and the accuracy of LAI is significantly improved over the results retrieved by the conventional pixelwise retrieval methods,demonstrating that this method can be reliably used to integrate spatial contextual information for inverting LAI from high-resolution remote sensing images.

  9. Quantification of Dance Movement by Simultaneous Measurement of Body Motion and Biophysical Information

    Institute of Scientific and Technical Information of China (English)

    Woong Choi; Tadao Isaka; Mamiko Sakata; Seiya Tsuruta; Kozaburo Hachimura


    The purpose of this research is a quantitative analysis of movement patterns of dance, which cannot be analyzed with a motion capture system alone, using simultaneous measurement of body motion and biophysical information. In this research, two kinds of same leg movement are captured by simultaneous measurement; one is a leg movement with given strength, the other is a leg movement without strength on condition of basic experiment using optical motion capture and electromyography (EMG) equipment in order to quantitatively analyze characteristics of leg movement. Also, we measured the motion of the traditional Japanese dance using the constructed system. We can visualize leg movement of Japanese dance by displaying a 3D CG character animation with motion data and EMG data. In addition, we expect that our research will help dancers and researchers on dance through giving new information on dance movement which cannot be analyzed with only motion capture.

  10. The Physics of Proteins An Introduction to Biological Physics and Molecular Biophysics

    CERN Document Server

    Frauenfelder, Hans; Chan, Winnie S


    Physics and the life sciences have established new connections within the past few decades, resulting in biological physics as an established subfield with strong groups working in many physics departments. These interactions between physics and biology form a two-way street with physics providing new tools and concepts for understanding life, while biological systems can yield new insights into the physics of complex systems. To address the challenges of this interdisciplinary area, The Physics of Proteins: An Introduction to Biological Physics and Molecular Biophysics is divided into three interconnected sections. In Parts I and II, early chapters introduce the terminology and describe the main biological systems that physicists will encounter. Similarities between biomolecules, glasses, and solids are stressed with an emphasis on the fundamental concepts of living systems. The central section (Parts III and IV) delves into the dynamics of complex systems. A main theme is the realization that biological sys...

  11. Magnetic nanoparticles for biophysical applications synthesized by high-power physical dispersion (United States)

    Safronov, A. P.; Beketov, I. V.; Tyukova, I. S.; Medvedev, A. I.; Samatov, O. M.; Murzakaev, A. M.


    The low cost and high output methods of high-power physical dispersion: the electrical explosion of wire and the laser target evaporation were elaborated for the production of iron oxide magnetic nanoparticles (MNPs) with controlled dispersion parameters and highly reproducible functional properties. The synthesized MNPs were spherical in shape with mean diameter 10 nm and lognormal particle size distribution. The phase composition, shape, particle size and functional properties of MNPs were cross-examined by a variety of contemporary experimental techniques. The phase structure of MNPs corresponds to the inverse spinel of magnetite. Meanwhile, due to the non-equilibrium conditions of the dispersion chemical composition of MNPs is close to maghemite-γ-Fe2O3. Their magnetic properties are reproducible and very close to the single domain superparamagnetic behavior. The stability of the suspensions of these MNPs and their applicability in the biophysical purposes such as magneto-induced heating have been demonstrated.

  12. A biophysical signature of network affiliation and sensory processing in mitral cells

    DEFF Research Database (Denmark)

    Angelo, Kamilla; Rancz, Ede A; Pimentel, Diogo


    , the substantial biophysical diversity of neurons of the same morphological class is typically averaged out and ignored. Here we show that the amplitude of hyperpolarization-evoked sag of membrane potential recorded in olfactory bulb mitral cells is an emergent, homotypic property of local networks and sensory......One defining characteristic of the mammalian brain is its neuronal diversity. For a given region, substructure, layer or even cell type, variability in neuronal morphology and connectivity persists. Although it is well known that such cellular properties vary considerably according to neuronal type...... receptor is universally expressed. Population diversity in this intrinsic property therefore reflects differential expression between local mitral cell networks processing distinct odour-related information....

  13. Lessons from the biophysics of interfaces: Lung surfactant and tear fluid

    DEFF Research Database (Denmark)

    Rantamaki, A.; Telenius, J.; Koivuniemi, A.


    The purpose of this review is to provide insight into the biophysical properties and functions of tear fluid and lung surfactant - two similar fluids covering the epithelium of two distinctive organs. Both fluids form a layer-like structure that essentially comprise of an aqueous layer next...... to the epithelium and an anterior lipid layer at the air-water interface. The aqueous layers contain soluble proteins and metabolites, and they are responsible for the host defence system and nutrition of the organ. However, many proteins also interact with the lipid layer and are important for the surface......-active function of the fluid film. The lipid layer of lung surfactant comprises mainly of phospholipids, especially phosphatidylcholines, and only small amounts of non-polar lipids, mainly cholesterol. In contrast, tear fluid lipid layer comprises of a mixture of polar and non-polar lipids. However, the relative...

  14. An analog VLSI implementation of a visual interneuron: enhanced sensory processing through biophysical modeling. (United States)

    Harrison, R R; Koch, C


    Flies are capable of rapid, coordinated flight through unstructured environments. This flight is guided by visual motion information that is extracted from photoreceptors in a robust manner. One feature of the fly's visual processing that adds to this robustness is the saturation of wide-field motion-sensitive neuron responses with increasing pattern size. This makes the cell's responses less dependent on the sparseness of the optical flow field while retaining motion information. By implementing a compartmental neuronal model in silicon, we add this "gain control" to an existing analog VLSI model of fly vision. This results in enhanced performance in a compact, low-power CMOS motion sensor. Our silicon system also demonstrates that modern, biophysically-detailed models of neural sensory processing systems can be instantiated in VLSI hardware.

  15. Biophysical Insights from Temperature-Dependent Single-Molecule Förster Resonance Energy Transfer. (United States)

    Holmstrom, Erik D; Nesbitt, David J


    Single-molecule fluorescence microscopy techniques can be used in combination with micrometer length-scale temperature control and Förster resonance energy transfer (FRET) in order to gain detailed information about fundamental biophysical phenomena. In particular, this combination of techniques has helped foster the development of remarkable quantitative tools for studying both time- and temperature-dependent structural kinetics of biopolymers. Over the past decade, multiple research efforts have successfully incorporated precise spatial and temporal control of temperature into single-molecule FRET (smFRET)-based experiments, which have uncovered critical thermodynamic information on a wide range of biological systems such as conformational dynamics of nucleic acids. This review provides an overview of various temperature-dependent smFRET approaches from our laboratory and others, highlighting efforts in which such methods have been successfully applied to studies of single-molecule nucleic acid folding.

  16. Biophysics of DNA-Protein Interactions From Single Molecules to Biological Systems

    CERN Document Server

    Williams, Mark C


    This book presents a concise overview of current research on the biophysics of DNA-protein interactions. A wide range of new and classical methods are presented by authors investigating physical mechanisms by which proteins interact with DNA. For example, several chapters address the mechanisms by which proteins search for and recognize specific binding sites on DNA, a process critical for cellular function. Single molecule methods such as force spectroscopy as well as fluorescence imaging and tracking are described in these chapters as well as other parts of the book that address the dynamics of protein-DNA interactions. Other important topics include the mechanisms by which proteins engage DNA sequences and/or alter DNA structure. These simple but important model interactions are then placed in the broader biological context with discussion of larger protein-DNA complexes . Topics include replication forks, recombination complexes, DNA repair interactions, and ultimately, methods to understand the chromatin...

  17. Colloquium: Biophysical principles of undulatory self-propulsion in granular media (United States)

    Goldman, Daniel I.


    Biological locomotion, movement within environments through self-deformation, encompasses a range of time and length scales in an organism. These include the electrophysiology of the nervous system, the dynamics of muscle activation, the mechanics of the skeletal system, and the interaction mechanics of such structures within natural environments like water, air, sand, and mud. Unlike the many studies of cellular and molecular scale biophysical processes, movement of entire organisms (like flies, lizards, and snakes) is less explored. Further, while movement in fluids like air and water is also well studied, little is known in detail of the mechanics that organisms use to move on and within flowable terrestrial materials such as granular media, ensembles of small particles that collectively display solid, fluid, and gaslike behaviors. This Colloquium reviews recent progress to understand principles of biomechanics and granular physics responsible for locomotion of the sandfish, a small desert-dwelling lizard that "swims" within sand using undulation of its body. Kinematic and muscle activity measurements of sand swimming using high speed x-ray imaging and electromyography are discussed. This locomotion problem poses an interesting challenge: namely, that equations that govern the interaction of the lizard with its environment do not yet exist. Therefore, complementary modeling approaches are also described: resistive force theory for granular media, multiparticle simulation modeling, and robotic physical modeling. The models reproduce biomechanical and neuromechanical aspects of sand swimming and give insight into how effective locomotion arises from the coupling of the body movement and flow of the granular medium. The argument is given that biophysical study of movement provides exciting opportunities to investigate emergent aspects of living systems that might not depend sensitively on biological details.

  18. Synchrony suppression in complex stimulus responses of a biophysical model of the cochlea. (United States)

    Shamma, S A; Morrish, K A


    A minimal biophysical model of the cochlea is used to investigate the validity of the hypothesis that a single compressive nonlinearity at the hair cell level can explain some of the suppression phenomena in cochlear responses to complex stimuli. The dependencies of the model responses on the amplitudes and frequencies of two-tone stimuli resemble in many respects the behavior of the experimental data, and can be traced to explicit biophysical parameters in the model. Most discrepancies between theory and experiment stem from simplifications in parameters of the minimal model that play no direct role in the hypothesis. The analysis and simulations predict further results which, pending experimental verification, may provide a more direct test of the influence of the compressive nonlinearity on the relative amplitudes of the synchronous response components, and hence of its role in synchrony suppression. For instance, regardless of the overall absolute levels of a two-tone stimulus applied to this type of model, the ratio of the amplitudes at the input and the ratio of the corresponding responses at the output remain approximately constant and equal (the output ratio changes by at most 6 dB in favor of the stronger tone). Other nonlinear responses to multitonal stimuli can also be reproduced, such as "spectral edge enhancement" [Horst et al., Peripheral Auditory Mechanisms (Springer, Berlin, 1985)] and some aspects of three-tone suppression [Javel et al., Mechanisms of Hearing (Monash U.P., Australia, 1983)]. In contrast to the complex behavior of suppression with increasing sound intensity and the drastic influence of the compressive nonlinearity on the absolute response measures on the auditory nerve (e.g., average rate and synchrony profiles), the percepts of complex sounds are relatively stable. This suggests that the invariant relative response measures are more likely used in the encoding and CNS extraction of the spectrum of complex stimuli such as speech.

  19. Relaxin Affects Smooth Muscle Biophysical Properties and Mechanical Activity of the Female Mouse Colon. (United States)

    Squecco, Roberta; Garella, Rachele; Idrizaj, Eglantina; Nistri, Silvia; Francini, Fabio; Baccari, Maria Caterina


    The hormone relaxin (RLX) has been reported to influence gastrointestinal motility in mice. However, at present, nothing is known about the effects of RLX on the biophysical properties of the gastrointestinal smooth muscle cells (SMCs). Other than extending previous knowledge of RLX on colonic motility, the purpose of this study was to investigate the ability of the hormone to induce changes in resting membrane potential (RMP) and on sarcolemmal ion channels of colonic SMCs of mice that are related to its mechanical activity. To this aim, we used a combined mechanical and electrophysiological approach. In the mechanical experiments, we observed that RLX caused a decay of the basal tone coupled to an increase of the spontaneous contractions, completely abolished by the guanylate cyclase inhibitor 1H-[1,2,4]oxadiazolo[4,3-a]-quinoxalin-1-one (ODQ). The electrophysiological results indicate for the first time that RLX directly affects the SMC biophysical properties inducing hyperpolarization of RMP and cycles of slow hyperpolarization/depolarization oscillations. The effects of RLX on RMP were abolished by ODQ as well as by a specific inhibitor of the cGMP-dependent protein kinase, KT5823. RLX reduced Ca(2+) entry through the voltage-dependent L-type channels and modulated either voltage- or ATP-dependent K(+) channels. These effects were abolished by ODQ, suggesting the involvement of the nitric oxide/guanylate cyclase pathway in the effects of RLX on RMP and ion channel modulation. These actions of RLX on membrane properties may contribute to the regulation of the proximal colon motility by the nitric oxide/cGMP/cGMP-dependent protein kinase pathway.

  20. Resolving the biophysics of axon transmembrane polarization in a single closed-form description (United States)

    Melendy, Robert F.


    When a depolarizing event occurs across a cell membrane there is a remarkable change in its electrical properties. A complete depolarization event produces a considerably rapid increase in voltage that propagates longitudinally along the axon and is accompanied by changes in axial conductance. A dynamically changing magnetic field is associated with the passage of the action potential down the axon. Over 75 years of research has gone into the quantification of this phenomenon. To date, no unified model exist that resolves transmembrane polarization in a closed-form description. Here, a simple but formative description of propagated signaling phenomena in the membrane of an axon is presented in closed-form. The focus is on using both biophysics and mathematical methods for elucidating the fundamental mechanisms governing transmembrane polarization. The results presented demonstrate how to resolve electromagnetic and thermodynamic factors that govern transmembrane potential. Computational results are supported by well-established quantitative descriptions of propagated signaling phenomena in the membrane of an axon. The findings demonstrate how intracellular conductance, the thermodynamics of magnetization, and current modulation function together in generating an action potential in a unified closed-form description. The work presented in this paper provides compelling evidence that three basic factors contribute to the propagated signaling in the membrane of an axon. It is anticipated this work will compel those in biophysics, physical biology, and in the computational neurosciences to probe deeper into the classical and quantum features of membrane magnetization and signaling. It is hoped that subsequent investigations of this sort will be advanced by the computational features of this model without having to resort to numerical methods of analysis.

  1. Biophysical and molecular comparison of sodium current in cells isolated from canine atria and pulmonary vein. (United States)

    Barajas-Martinez, Hector; Goodrow, Robert J; Hu, Dan; Patel, Payal; Desai, Mayurika; Panama, Brian K; Treat, Jacqueline A; Aistrup, Gary L; Cordeiro, Jonathan M


    The collar of the pulmonary vein (PV) is the focal point for the initiation of atrial arrhythmias, but the mechanisms underlying how PV cells differ from neighboring left atrial tissue are unclear. We examined the biophysical and molecular properties of INa in cells isolated from the canine pulmonary sleeve and compared the properties to left atrial tissue. PV and left atrial myocytes were isolated and patch clamp techniques were used to record INa. Action potential recordings from either tissue type were made using high-resistance electrodes. mRNA was determined using quantitative RT-PCR and proteins were determined by Western blot. Analysis of the action potential characteristics showed that PV tissue had a lower Vmax compared with left atrial tissue. Fast INa showed that current density was slightly lower in PV cells compared with LA cells (-96 ± 18.7 pA/pF vs. -120 ± 6.7 pA/pF, respectively, p < 0.05). The recovery from inactivation of INa in PV cells was slightly slower but no marked difference in steady-state inactivation was noted. Analysis of late INa during a 225-ms pulse showed that late INa was significantly smaller in PV cells compared to LA cells at all measured time points into the pulse. These results suggest PV cells have lower density of both peak and late INa. Molecular analysis of Nav1.5 and the four beta subunits showed lower levels of Nav1.5 as well as Navβ1 subunits, confirming the biophysical findings. These data show that a lower density of INa may lead to depression of excitability and predispose the PV collar to re-entrant circuits under pathophysiological conditions.

  2. Biophysical characterisation of calumenin as a charged F508del-CFTR folding modulator.

    Directory of Open Access Journals (Sweden)

    Rashmi Tripathi

    Full Text Available The cystic fibrosis transmembrane regulator (CFTR is a cyclic-AMP dependent chloride channel expressed at the apical surface of epithelial cells lining various organs such as the respiratory tract. Defective processing and functioning of this protein caused by mutations in the CFTR gene results in loss of ionic balance, defective mucus clearance, increased proliferation of biofilms and inflammation of human airways observed in cystic fibrosis (CF patients. The process by which CFTR folds and matures under the influence of various chaperones in the secretory pathway remains incompletely understood. Recently, calumenin, a secretory protein, belonging to the CREC family of low affinity calcium binding proteins has been identified as a putative CFTR chaperone whose biophysical properties and functions remain uncharacterized. We compared hydropathy, instability, charge, unfoldability, disorder and aggregation propensity of calumenin and other CREC family members with CFTR associated chaperones and calcium binding proteins, wild-type and mutant CFTR proteins and intrinsically disordered proteins (IDPs. We observed that calumenin, along with other CREC proteins, was significantly more charged and less folded compared to CFTR associated chaperones. Moreover like IDPs, calumenin and other CREC proteins were found to be less hydrophobic and aggregation prone. Phylogenetic analysis revealed a close link between calumenin and other CREC proteins indicating how evolution might have shaped their similar biophysical properties. Experimentally, calumenin was observed to significantly reduce F508del-CFTR aggregation in a manner similar to AavLEA1, a well-characterized IDP. Fluorescence microscopy based imaging analysis also revealed altered trafficking of calumenin in bronchial cells expressing F508del-CFTR, indicating its direct role in the pathophysiology of CF. In conclusion, calumenin is characterized as a charged protein exhibiting close similarity with

  3. Biophysical Impacts of Tropical Land Transformation from Forest to Oil Palm and Rubber Plantations in Indonesia (United States)

    Knohl, Alexander; Meijide, Ana; Fan, Yuanchao; Gunawan, Dodo; Hölscher, Dirk; June, Tania; Niu, Furong; Panferov, Oleg; Ringeler, Andre; Röll, Alexander; Sabajo, Clifton; Tiralla, Nina


    Indonesia currently experiences rapid and large-scale land-use changes resulting in forest loss and the expansion of cash crop plantations such as oil palm and rubber. Such land transformations are associated with changes in surface properties that affect biophysical processes influencing the atmosphere. Yet, the overall effect of such land transformations on the atmosphere at local and regional scale remains unclear. In our study, we combine measurements of microclimate, transpiration via sap-flux, surface energy fluxes via eddy covariance, surface temperature via remote sensing, land surface (CLM) and regional climate modeling (WRF) for Jambi Province in Indonesia. Our microclimatic measurements showed that air temperature within the canopy was on average 0.7-0.8°C higher in monoculture plantations (oil palm and rubber) compared to forest. Remote sensing analysis using MODIS and Landsat revealed a higher canopy surface temperature for oil palm plantations (+1.5°C) compared to forest, but only little differences for rubber plantations. Transpiration (T) and evapotranspiration (ET) as well as the contribution of T to ET of oil palm showed a strong age-dependent increase. The sensible to latent heat flux ratio decreased with age. Overall, rubber plantations showed the lowest transpirations rates (320 mm year-1), oil palm intermediate rates (414 mm year-1), and forest the highest rates (558 mm year-1) indicating substantial differences in water use. Despite the differences in water use and the higher within-canopy and surface temperatures of the plantations compared to the forest, there was only a minor effect of land transformation on the atmosphere at the regional scale (<0.2 °C), irrespectively of the large spatial extend of the transformation. In conclusion, our study shows a strong local scale biophysical impact affecting the conditions at the stand level, which is however mitigated in the atmosphere at the regional level.

  4. Biophysical characterisation of calumenin as a charged F508del-CFTR folding modulator. (United States)

    Tripathi, Rashmi; Benz, Nathalie; Culleton, Bridget; Trouvé, Pascal; Férec, Claude


    The cystic fibrosis transmembrane regulator (CFTR) is a cyclic-AMP dependent chloride channel expressed at the apical surface of epithelial cells lining various organs such as the respiratory tract. Defective processing and functioning of this protein caused by mutations in the CFTR gene results in loss of ionic balance, defective mucus clearance, increased proliferation of biofilms and inflammation of human airways observed in cystic fibrosis (CF) patients. The process by which CFTR folds and matures under the influence of various chaperones in the secretory pathway remains incompletely understood. Recently, calumenin, a secretory protein, belonging to the CREC family of low affinity calcium binding proteins has been identified as a putative CFTR chaperone whose biophysical properties and functions remain uncharacterized. We compared hydropathy, instability, charge, unfoldability, disorder and aggregation propensity of calumenin and other CREC family members with CFTR associated chaperones and calcium binding proteins, wild-type and mutant CFTR proteins and intrinsically disordered proteins (IDPs). We observed that calumenin, along with other CREC proteins, was significantly more charged and less folded compared to CFTR associated chaperones. Moreover like IDPs, calumenin and other CREC proteins were found to be less hydrophobic and aggregation prone. Phylogenetic analysis revealed a close link between calumenin and other CREC proteins indicating how evolution might have shaped their similar biophysical properties. Experimentally, calumenin was observed to significantly reduce F508del-CFTR aggregation in a manner similar to AavLEA1, a well-characterized IDP. Fluorescence microscopy based imaging analysis also revealed altered trafficking of calumenin in bronchial cells expressing F508del-CFTR, indicating its direct role in the pathophysiology of CF. In conclusion, calumenin is characterized as a charged protein exhibiting close similarity with IDPs and is

  5. Bio-physical vs. Economic Uncertainty in the Analysis of Climate Change Impacts on World Agriculture (United States)

    Hertel, T. W.; Lobell, D. B.


    Accumulating evidence suggests that agricultural production could be greatly affected by climate change, but there remains little quantitative understanding of how these agricultural impacts would affect economic livelihoods in poor countries. The recent paper by Hertel, Burke and Lobell (GEC, 2010) considers three scenarios of agricultural impacts of climate change, corresponding to the fifth, fiftieth, and ninety fifth percentiles of projected yield distributions for the world’s crops in 2030. They evaluate the resulting changes in global commodity prices, national economic welfare, and the incidence of poverty in a set of 15 developing countries. Although the small price changes under the medium scenario are consistent with previous findings, their low productivity scenario reveals the potential for much larger food price changes than reported in recent studies which have hitherto focused on the most likely outcomes. The poverty impacts of price changes under the extremely adverse scenario are quite heterogeneous and very significant in some population strata. They conclude that it is critical to look beyond central case climate shocks and beyond a simple focus on yields and highly aggregated poverty impacts. In this paper, we conduct a more formal, systematic sensitivity analysis (SSA) with respect to uncertainty in the biophysical impacts of climate change on agriculture, by explicitly specifying joint distributions for global yield changes - this time focusing on 2050. This permits us to place confidence intervals on the resulting price impacts and poverty results which reflect the uncertainty inherited from the biophysical side of the analysis. We contrast this with the economic uncertainty inherited from the global general equilibrium model (GTAP), by undertaking SSA with respect to the behavioral parameters in that model. This permits us to assess which type of uncertainty is more important for regional price and poverty outcomes. Finally, we undertake a

  6. Fab-based bispecific antibody formats with robust biophysical properties and biological activity. (United States)

    Wu, Xiufeng; Sereno, Arlene J; Huang, Flora; Lewis, Steven M; Lieu, Ricky L; Weldon, Caroline; Torres, Carina; Fine, Cody; Batt, Micheal A; Fitchett, Jonathan R; Glasebrook, Andrew L; Kuhlman, Brian; Demarest, Stephen J


    A myriad of innovative bispecific antibody (BsAb) platforms have been reported. Most require significant protein engineering to be viable from a development and manufacturing perspective. Single-chain variable fragments (scFvs) and diabodies that consist only of antibody variable domains have been used as building blocks for making BsAbs for decades. The drawback with Fv-only moieties is that they lack the native-like interactions with CH1/CL domains that make antibody Fab regions stable and soluble. Here, we utilize a redesigned Fab interface to explore 2 novel Fab-based BsAbs platforms. The redesigned Fab interface designs limit heavy and light chain mixing when 2 Fabs are co-expressed simultaneously, thus allowing the use of 2 different Fabs within a BsAb construct without the requirement of one or more scFvs. We describe the stability and activity of a HER2×HER2 IgG-Fab BsAb, and compare its biophysical and activity properties with those of an IgG-scFv that utilizes the variable domains of the same parental antibodies. We also generated an EGFR × CD3 tandem Fab protein with a similar format to a tandem scFv (otherwise known as a bispecific T cell engager or BiTE). We show that the Fab-based BsAbs have superior biophysical properties compared to the scFv-based BsAbs. Additionally, the Fab-based BsAbs do not simply recapitulate the activity of their scFv counterparts, but are shown to possess unique biological activity.

  7. Phospholamban phosphorylation, mutation, and structural dynamics: a biophysical approach to understanding and treating cardiomyopathy (United States)

    Ablorh, Naa-Adjeley D.; Thomas, David D.


    We review the recent development of novel biochemical and spectroscopic methods to determine the site-specific phosphorylation, expression, mutation, and structural dynamics of phospholamban (PLB), in relation to its function (inhibition of the cardiac calcium pump, SERCA2a), with specific focus on cardiac physiology, pathology, and therapy. In the cardiomyocyte, SERCA2a actively transports Ca2+ into the sarcoplasmic reticulum (SR) during relaxation (diastole) to create the concentration gradient that drives the passive efflux of Ca2+ required for cardiac contraction (systole). Unphosphorylated PLB (U-PLB) inhibits SERCA2a, but phosphorylation at S16 and/or T17 (producing P-PLB) changes the structure of PLB to relieve SERCA2a inhibition. Because insufficient SERCA2a activity is a hallmark of heart failure, SERCA2a activation (by gene therapy (Andino et al. 2008; Fish et al. 2013; Hoshijima et al. 2002; Jessup et al. 2011) or drug therapy (Ferrandi et al. 2013; Huang 2013; Khan et al. 2009; Rocchetti et al. 2008; Zhang et al. 2012)) is a widely sought goal for treatment of heart failure. This review describes rational approaches to this goal. Novel biophysical assays, using site-directed labeling and high-resolution spectroscopy, have been developed to resolve the structural states of SERCA2a-PLB complexes in vitro and in living cells. Novel biochemical assays, using synthetic standards and multidimensional immunofluorescence, have been developed to quantitate PLB expression and phosphorylation states in cells and human tissues. The biochemical and biophysical properties of U-PLB, P-PLB, and mutant PLB will ultimately resolve the mechanisms of loss of inhibition and gain of inhibition to guide therapeutic development. These assays will be powerful tools for investigating human tissue samples from the Sydney Heart Bank, for the purpose of analyzing and diagnosing specific disorders. PMID:25774229

  8. Integrating socio-economic and biophysical data to enhance watershed management and planning (United States)

    Pirani, Farshad Jalili; Mousavi, Seyed Alireza


    Sustainability has always been considered as one of the main aspects of watershed management plans. In many developing countries, watershed management practices and planning are usually performed by integrating biophysical layers, and other existing layers which cannot be identified as geographic layers are ignored. We introduce an approach to consider some socioeconomic parameters which are important for watershed management decisions. Ganj basin in Chaharmahal-Bakhtiari Province was selected as the case study area, which includes three traditional sanctums: Ganj, Shiremard and Gerdabe Olya. Socioeconomic data including net agricultural income, net ranching income, population and household number, literacy rate, unemployment rate, population growth rate and active population were mapped within traditional sanctums and then were integrated into other biophysical layers. After overlaying and processing these data to determine management units, different quantitative and qualitative approaches were adopted to achieve a practical framework for watershed management planning and relevant plans for homogeneous units were afterwards proposed. Comparing the results with current plans, the area of allocated lands to different proposed operations considering both qualitative and quantitative approaches were the same in many cases and there was a meaningful difference with current plans; e.g., 3820 ha of lands are currently managed under an enclosure plan, while qualitative and quantitative approaches in this study suggest 1388 and 1428 ha to be allocated to this operation type, respectively. Findings show that despite the ambiguities and complexities, different techniques could be adopted to incorporate socioeconomic conditions in watershed management plans. This introductory approach will help to enhance watershed management decisions with more attention to societal background and economic conditions, which will presumably motivate local communities to participate in

  9. Resolving the biophysics of axon transmembrane polarization in a single closed-form description

    Energy Technology Data Exchange (ETDEWEB)

    Melendy, Robert F., E-mail: [School of Engineering and Computational Sciences, Liberty University, Lynchburg, Virginia 24515 (United States)


    When a depolarizing event occurs across a cell membrane there is a remarkable change in its electrical properties. A complete depolarization event produces a considerably rapid increase in voltage that propagates longitudinally along the axon and is accompanied by changes in axial conductance. A dynamically changing magnetic field is associated with the passage of the action potential down the axon. Over 75 years of research has gone into the quantification of this phenomenon. To date, no unified model exist that resolves transmembrane polarization in a closed-form description. Here, a simple but formative description of propagated signaling phenomena in the membrane of an axon is presented in closed-form. The focus is on using both biophysics and mathematical methods for elucidating the fundamental mechanisms governing transmembrane polarization. The results presented demonstrate how to resolve electromagnetic and thermodynamic factors that govern transmembrane potential. Computational results are supported by well-established quantitative descriptions of propagated signaling phenomena in the membrane of an axon. The findings demonstrate how intracellular conductance, the thermodynamics of magnetization, and current modulation function together in generating an action potential in a unified closed-form description. The work presented in this paper provides compelling evidence that three basic factors contribute to the propagated signaling in the membrane of an axon. It is anticipated this work will compel those in biophysics, physical biology, and in the computational neurosciences to probe deeper into the classical and quantum features of membrane magnetization and signaling. It is hoped that subsequent investigations of this sort will be advanced by the computational features of this model without having to resort to numerical methods of analysis.

  10. Remote Sensing Based Biophysical Characterization of Tropical Deciduous Forest in Central India (United States)

    Singh, R. P.; Goroshi, S.; Sharma, N. K.; Bairagi, G. D.; Sharma, R.; Jalil, P.; Jain, A.; Sonakia, A.; Parihar, J. S.


    The paper reports the measurements of biophysical parameters using field and satellite data over a tropical deciduous forest Kanha National Park (KNP), central India. Field measurement (GBH, LAI, litter, soil moisture) was carried out over ten quadrates of 0.1ha in KNP for characterization of biophysical parameters with specified measurement protocol and sampling. Satellite based remote sensing analysis (LAI, Phenology, and NPP) was carried out using multi date observations of IRS-LISS-III, IMS-1MX, SPOT-VEGETATION and EOS-MODIS instruments. Rank correlation analysis using field data collected in the selected quadrates at KNP showed Sal (Shorea robusta) is dominant forest species followed by Lendia, Jamun (Syzygium cumini), Saja, Harra and Dhawda etc. Field measurement of Sal showed GBH range from 20 cm to 170 cm. Different forest classes such as Sal; Sal mixed with Jamun, Bamboo (Dendrocalamus strictus) etc, including grasslands/scrubland were classified with overall accuracy of 85.56 percent using March, May and October multi spectral data. Sal has distinct growth characteristics (low vegetation growth/ leaf fall in March instead of May) as compared to other vegetation species. As per the Leaf Area Index (LAI) measurement using hemispherical photographs, Sal showed the highest LAI (6.95 m2/m2) during September and lowest LAI (2.63 m2/m2) during March. Overall good agreement (r= 0.79) was found between the LAI generated from LISS-III and MODIS data product. It was observed from SPOT-VEGETATION analysis that NPP varied from 8.4 tC/ha/year (dry deciduous forest) to 14.25 tC/ha/year (Moist deciduous forest) in KNP.

  11. Bioabsorbable bypass grafts biofunctionalised with RGD have enhanced biophysical properties and endothelialisation tested in vivo

    Directory of Open Access Journals (Sweden)

    Larisa V Antonova


    Full Text Available Small diameter arterial bypass grafts are considered as unmet clinical need since the current grafts have poor patency of 25% within 5 years. We have developed a 3D scaffold manufactured from natural and synthetic biodegradable polymers, poly(3-hydroxybutyrate-co-3-hydroxyvalerate (PHBV and poly(ε-caprolactone (PCL, respectively. Further to improve the biophysical properties as well as endothelialisation, the grafts were covalently conjugated with arginine-glycine-aspartic acid (RGD bioactive peptides. The biophysical properties as well as endothelialisation of PHBV/PCL and PCL 2 mm diameter bypass grafts were assessed with and without biofunctionalisation with RGD peptides in vitro and in vivo. Morphology of the grafts was assessed by scanning electron microscopy, whereas physico-mechanical properties were evaluated using a physiological circulating system equipped with a state of art ultrasound vascular wall tracking system. Endothelialisation of the grafts in vitro and in vivo were assessed using a cell viability assay and rat abdominal aorta replacement model, respectively. The biofunctionalisation with RGD bioactive peptides decreased mean fiber diameter and mean pore area in PHBV/PCL grafts; however, this was not the case for PCL grafts. Both PHBV/PCL and PCL grafts with RGD peptides had lower durability compared to those without; these durability values were similar to those of internal mammary artery. Modification of PHBV/PCL and PCL grafts with RGD peptides increased endothelial cell viability in vitro by a factor of 8 and enhanced the formation of an endothelial cell monolayer in vivo one month postimplantation. In conclusion, PHBV/PCL small-caliber graft can be a suitable 3D scaffold for the development of a tissue engineering arterial bypass graft.

  12. Incorporating Modeling and Simulations in Undergraduate Biophysical Chemistry Course to Promote Understanding of Structure-Dynamics-Function Relationships in Proteins (United States)

    Hati, Sanchita; Bhattacharyya, Sudeep


    A project-based biophysical chemistry laboratory course, which is offered to the biochemistry and molecular biology majors in their senior year, is described. In this course, the classroom study of the structure-function of biomolecules is integrated with the discovery-guided laboratory study of these molecules using computer modeling and…

  13. A Case Study of Cognitive and Biophysical Models of Education as Linked to Anxiety and Obsessive Compulsive Disorders (United States)

    Maye, Kelly M.


    Cognitive and biophysical factors have been considered contributors linked to identifiable markers of obsessive compulsive and anxiety disorders. Research demonstrates multiple causes and mixed results for the short-term success of educational programs designed to ameliorate problems that children with obsessive compulsive and anxiety disorders…

  14. Biogeochemical and biophysical climate regulation services from converting native grassland to bioenergy production in the US Midwest (United States)

    Zhang, X.; Zhao, K.; Abraha, M.; Gelfand, I.; Izaurralde, R. C.; Thomson, A. M.; Hamilton, S. K.; Chen, J.; Robertson, P.; Xu, M.; Liang, X. Z.


    Land use conversion to bioenergy crops production not only alters biogeochemical cycles, but also modifies surface biophysics, such as albedo and and leaf area. These biophysical perturbations subsequently change radiation budget at land surface and land-atmosphere exchange in water and energy, and ultimately influence local/regional climate. Here, we combine long-term in situ field measurements, remote sensing observations, and regional earth system modeling to improve our understanding of changes in biophysical climate regulation services from converting native grassland to perennial bioenergy crops. In the US Midwest, albedo change as a result of cultivating native grassland for cellulosic bioenergy feedstocks could enhance the net greenhouse gases (GHGs) mitigation benefit of cellulosic bioenergy production (116.5 MgCO2 ha-1) by 20% over a time horizon of 50 years. With an integrated climate-agroecosystem model, parameterized with in situ and remote sensing data, we further demonstrate that cultivating native grassland may result in noticeable difference in simulated regional climate (e.g. precipitation, temperature, and radiation budget), highlighting the importance of additionally including biophysical climate services in evaluating land-based climate mitigation activities, such as bioenergy production.

  15. Modelling the influence of land-use changes on biophysical and biochemical interactions at regional and global scales. (United States)

    Devaraju, N; Bala, G; Nemani, R


    Land-use changes since the start of the industrial era account for nearly one-third of the cumulative anthropogenic CO2 emissions. In addition to the greenhouse effect of CO2 emissions, changes in land use also affect climate via changes in surface physical properties such as albedo, evapotranspiration and roughness length. Recent modelling studies suggest that these biophysical components may be comparable with biochemical effects. In regard to climate change, the effects of these two distinct processes may counterbalance one another both regionally and, possibly, globally. In this article, through hypothetical large-scale deforestation simulations using a global climate model, we contrast the implications of afforestation on ameliorating or enhancing anthropogenic contributions from previously converted (agricultural) land surfaces. Based on our review of past studies on this subject, we conclude that the sum of both biophysical and biochemical effects should be assessed when large-scale afforestation is used for countering global warming, and the net effect on global mean temperature change depends on the location of deforestation/afforestation. Further, although biochemical effects trigger global climate change, biophysical effects often cause strong local and regional climate change. The implication of the biophysical effects for adaptation and mitigation of climate change in agriculture and agroforestry sectors is discussed.

  16. Sustainable urban metabolism as a link between bio-physical sciences and urban planning: The BRIDGE project

    NARCIS (Netherlands)

    Chrysoulakis, N.; Lopes, M.; San José, R.; Grimmond, C.S.B.; Jones, M.B.; Magliulo, V.; Klostermann, J.E.M.; Synnefa, A.; Mitraka, Z.; Castro, E.; González, A.; Vogt, R.; Vesala, T.; Spano, D.; Pigeon, G.; Freer-Smith, P.; Staszewski, T.; Hodges, N.; Mills, G.; Cartalis, C.


    Urban metabolism considers a city as a system with flows of energy and material between it and the environment. Recent advances in bio-physical sciences provide methods and models to estimate local scale energy, water, carbon and pollutant fluxes. However, good communication is required to provide t

  17. Integrating Economic Models with Biophysical Models in the Willamette Water 2100 Project (United States)

    Jaeger, W. K.; Plantinga, A.


    This paper highlights the human system modeling components for Willamette Water 2100, a comprehensive, highly integrated study of hydrological, ecological, and human factors affecting water scarcity in the Willamette River Basin (WRB). The project is developing a spatiotemporal simulation model to predict future trajectories of water scarcity, and to evaluate mitigation policies. Economic models of land use and water use are the main human system models in WW2100. Water scarcity depends on both supply and demand for water, and varies greatly across time and space (Jaeger et al., 2013). Thus, the locations of human water use can have enormous influence on where and when water is used, and hence where water scarcity may arise. Modeling the locations of human uses of water (e.g., urban versus agricultural) as well as human values and choices, are the principal quantitative ways that social science can contribute to research of this kind. Our models are empirically-based models of human resource allocation. Each model reflects private behavior (choices by households, farms, firms), institutions (property rights, laws, markets, regulations), public infrastructure (dams, canals, highways), and also 'external drivers' that influence the local economy (migration, population growth, national markets and policies). This paper describes the main model components, emphasizing similarities between human and biophysical components of the overall project, and the model's linkages and feedbacks relevant to our predictions of changes in water scarcity between now and 2100. Results presented include new insights from individual model components as well as available results from the integrated system model. Issues include water scarcity and water quality (temperature) for out-of-stream and instream uses, the impact of urban expansion on water use and potential flood damage. Changes in timing and variability of spring discharge with climate change, as well as changes in human uses of

  18. BOLTS: a BiOphysical Larval Tracking System for Measuring Dispersal Characteristics and Marine Population Connectivity (United States)

    Paris, C. B.; Srinivasan, A.; Kourafalou, V.; Sponaugle, S.; Cowen, R. K.


    While metapopulation research with hypothetical dispersal matrices has shown how the scales of larval dispersal, transport processes, local recruitment, and temporal and spatial variability in dispersal influence population persistence, the pattern of demographic connectivity produced by larval dispersal is still a key uncertainty. To address this problem, a coupled bio-physical model has been developed that quantifies the degree of connectivity between populations. Such spatially explicit models, forced by dynamic currents coupled to a realistic seascape and life history traits, produce dispersal kernels for a range of scales over which dispersal is practically unquantifiable by current empirical methods. The BiOphysical Larval Tracking System (BOLTS) presented here allows a Lagrangian stochastic individual-based model (IBM) to be coupled via OPENDAP framework to any 3-dimensional fields of circulation models including to domains of various resolutions through 'Lagrangian nesting'. We demonstrate the capabilities of the software in measuring the characteristics of dispersal and evaluating the variability of larval connectivity through two examples at different scales: 1) Caribbean-scale simulations of BOLTS using the large scale (resolution ~7 km) Hybrid Coordinate Ocean Model (HYCOM) from the Global Data Assimilative Experiment (GODAE) provide us with expected connectivity patterns of a reef building coral. By seeding the model with a large number of active particles, it is possible to assemble dispersal kernels and migration matrices from the start (spawning) and the end point (settlement) of individual particle trajectories. Any single run is a stochastic realization of a probabilistic process, thus the full probability density function (pdf) of the kernel requires averaging over many dispersal events. The model output is further corroborated with empirical measures of gene flow among coral colonies around the Caribbean. 2) Coastal-scale simulations of BOLTS

  19. Chromosome aberrations and cell death by ionizing radiation: Evolution of a biophysical model (United States)

    Ballarini, Francesca; Carante, Mario P.


    The manuscript summarizes and discusses the various versions of a radiation damage biophysical model, implemented as a Monte Carlo simulation code, originally developed for chromosome aberrations and subsequently extended to cell death. This extended version has been called BIANCA (BIophysical ANalysis of Cell death and chromosome Aberrations). According to the basic assumptions, complex double-strand breaks (called ;Cluster Lesions;, or CLs) produce independent chromosome free-ends, mis-rejoining within a threshold distance d (or un-rejoining) leads to chromosome aberrations, and ;lethal aberrations; (i.e., dicentrics plus rings plus large deletions) lead to clonogenic cell death. The mean number of CLs per Gy and per cell is an adjustable parameter. While in BIANCA the threshold distance d was the second parameter, in a subsequent version, called BIANCA II, d has been fixed as the mean distance between two adjacent interphase chromosome territories, and a new parameter, f, has been introduced to represent the chromosome free-end un-rejoining probability. Simulated dose-response curves for chromosome aberrations and cell survival obtained by the various model versions were compared with literature experimental data. Such comparisons provided indications on some open questions, including the role of energy deposition clustering at the nm and the μm level, the probability for a chromosome free-end to remain un-rejoined, and the relationship between chromosome aberrations and cell death. Although both BIANCA and BIANCA II provided cell survival curves in general agreement with human and hamster fibroblast survival data, BIANCA II allowed for a better reproduction of dicentrics, rings and deletions considered separately. Furthermore, the approach adopted in BIANCA II for d is more consistent with estimates reported in the literature. After testing against aberration and survival data, BIANCA II was applied to investigate the depth-dependence of the radiation

  20. Neural-Based Pattern Matching for Selection of Biophysical Model Meteorological Forcings (United States)

    Coleman, A. M.; Wigmosta, M. S.; Li, H.; Venteris, E. R.; Skaggs, R. J.


    The current interest and demand for developing renewable and sustainable bio-based energies has brought microalgae and other terrestrial feedstocks into the active research domain where different components and strategies of the lifecycle are evaluated for economic and resource efficiency. To understand the potential energy returns and resource requirements of large-scale open- and closed-pond microalgae cultivation facilities and terrestrial feedstock growth on marginal lands, a spatial modeling and biophysical modeling suite, referred to as the Biomass Assessment Tool (BAT), has been developed. BAT is in part comprised of (1) a high spatial resolution multi-criteria land suitability model; (2) a coupled, high-temporal resolution, full mass and energy balance hydrodynamic pond temperature and microalgae growth model; (3) a terrestrial water demand and biomass growth model; and (4) an spatially-based energy, land, and water use optimization routine. Depending on the criteria used, our national spatial land suitability model yields tens of thousands of potential large-scale bioenergy sites for modeling and evaluation of production and resource demand. The fundamental driver of water use and bioenergy production rates in pond-based cultivation systems and traditional terrestrial crop growth is the meteorology; however, a major obstacle in the use of high spatiotemporal resolution biophysical models is the lack of sufficient and readily available meteorological data at the appropriate scale. To address this issue, firstly, the daily meteorology data from 2,522 USDA CLIGEN stations within the conterminous United States were disaggregated to an hourly time-step using the physics-based approach of Waichler and Wigmosta (2003), yielding a high-temporal resolution 30-year meteorological record. Secondly, in order to best describe the meteorological model forcings for a given site and significantly increase modeling efficiency, we developed a novel multi-scale pattern

  1. Biophysical Changes of Lipid Membranes in the Presence of Ethanol at Varying Concentrations. (United States)

    Konas, Ryan M; Daristotle, John L; Harbor, Ndubuisi B; Klauda, Jeffery B


    Ethanol is widely used as an additive to gasoline, and production of ethanol can come from single-celled organisms such as yeast. We systematically studied the influence of ethanol on common lipids found in yeast plasma membranes, specifically phosphatidylserine (PS), phosphatidylethanolamine (PE), and phosphatidylcholine (PC). Molecular dynamics simulations were used to probe changes to the biophysical properties of membranes with varying equilibrated bulk ethanol concentrations less than 25 mol %. The palmitoyl oleoyl (PO, 18:1/16:0) chain was used for all lipids, and a mixed bilayer of POPE/POPS (7:3 ratio) was also simulated. Ethanol was found to interact strongly with POPC, and thus its surface area per lipid, chain order, and electron density profiles differ the most from the neat bilayer. At 12 mol % ethanol in the bulk, ethanol penetrated into the hydrophobic core for all membranes studied, but POPC had the highest penetration. Although the anionic headgroup of POPS acted as a protectant for membrane structure compared to the zwitterionic lipids, this was not the case for the POPE/POPS mixture that showed more penetration of ethanol into the membrane than the single-component membranes. To fully characterize the impact of ethanol on yeast plasma membranes, our results suggest that experiments and simulations need to consider representative mixtures of lipids that exist in vivo.

  2. Biophysical connection between evolutionary dynamics and thermodynamics in in vitro evolution. (United States)

    Aita, Takuyo; Husimi, Yuzuru


    We analyzed a mathematical model of in vitro evolution conducted by repetition of mutagenesis and selection processes. The selection process consists of the selective enrichment and subsequent sampling as follows: each mutant with fitness W is amplified by the Boltzmann factor exp(rW/k(B)T(the)), where the fitness W is defined as the negative Gibbs free energy (-ΔG) in a reaction of the phenotypic molecules and r is the round number of the selective enrichment; then, an arbitrary mutant is randomly chosen from the resulting mutant population and it becomes a new parent in the next generation. As a result, we found that the evolutionary dynamics is described in a mathematical framework similar to thermodynamics: the "evolution constant" k(E) and "evolutionary temperature" T(evo) play key roles similar to the Boltzmann constant k(B) and thermodynamic temperature T(the), respectively. In the stationary state of the evolutionary dynamics, the attractor of the fitness is in inverse proportion to k(E)T(evo). Furthermore, beyond the mathematical analogy, we obtained a biophysical connection between evolutionary dynamics and thermodynamics. Particularly, we found that T(evo) and T(the) are connected by k(E)T(evo)≈k(B)T(the)/2r. These results suggest that we can predict the fitness value in the stationary state by the thermodynamic temperature T(the) in the experimental setup.

  3. Course on Bioelectrochemistry which was the 11th International School of Biophysics

    CERN Document Server

    Blank, Martin


    This is the first course devoted to bioelectrochemistry held within the frame­ work of the International School of Biophysics. Although this branch of scientific research is already about two centuries old, as a truly independent one it has been in a stage of lively development since only a few decades ago and this is why a first course at the E. Majorana Center was devoted to it. Since bioelectrochemistry consists of many sub-fields, it is impossible to include, even superficially, all of them in a short course lasting just a week, and therefore the chapter of redox-reactions was chosen for this first course as being most general in character. But even restricting the course to redox-reactions, only a few subjects could be included and therefore the choice among them was made considering the most general guidelines that could serve as a basis for the further study of individual problems. In this way we hope to give a sound basis to the study of and to stimulate further interest in this branch of both biolog...

  4. Biophysical analysis of the interaction of the serum protein human β2GPI with bacterial lipopolysaccharide

    Directory of Open Access Journals (Sweden)

    Anna Gries


    Full Text Available There are several human serum proteins for which no clear role is yet known. Among these is the abundant serum protein beta2-glycoprotein-I (β2GPI, which is known to bind to negatively charged phospholipids as well as to bacterial lipopolysaccharides (LPS, and was therefore proposed to play a role in the immune response. To understand the details of these interactions, a biophysical analysis of the binding of β2GPI to LPS and phosphatidylserine (PS was performed. The data indicate only a moderate tendency of the protein (1 to influence the LPS-induced cytokine production in vitro, (2 to react exothermally with LPS in a non-saturable way, and (3 to change its local microenvironment upon LPS association. Additionally, we found that the protein binds more strongly to phosphatidylserine (PS than to LPS. Furthermore, β2GPI converts the LPS bilayer aggregates into a stronger multilamellar form, and reduces the fluidity of the hydrocarbon moiety of LPS due to a rigidification of the acyl chains. From these data it can be concluded that β2GPI plays a role as an immune-modulating agent, but there is much less evidence for a role in immune defense against bacterial toxins such as LPS.

  5. Biophysical functionality in polysaccharides: from Lego-blocks to nano-particles. (United States)

    Cesàro, Attilio; Bellich, Barbara; Borgogna, Massimiliano


    The objective of the paper is to show the very important biophysical concepts that have been developed with polysaccharides. In particular, an attempt will be made to relate "a posteriori" the fundamental aspects, both experimental and theoretical, with some industrial applications of polysaccharide-based materials. The overview of chain conformational aspects includes relationships between topological features and local dynamics, exemplified for some naturally occurring carbohydrate polymers. Thus, by using simulation techniques and computational studies, the physicochemical properties of aqueous solutions of polysaccharides are interpreted. The relevance of conformational disorder-order transitions, chain aggregation, and phase separation to the underlying role of the ionic contribution to these processes is discussed. We stress the importance of combining information from analysis of experimental data with that from statistical-thermodynamic models for understanding the conformation, size, and functional stability of industrially important polysaccharides. The peculiar properties of polysaccharides in industrial applications are summarized for the particularly important example of nanoparticles production, a field of growing relevance and scientific interest.

  6. Biophysical modelling of early and delayed radiation damage at chromosome level (United States)

    Andreev, S.; Eidelman, Y.

    Exposure by ionising radiation increases cancer risk in human population Cancer is thought to originate from an altered expression of certain number of specific genes It is now widely recognised that chromosome aberrations CA are involved in stable change in expression of genes by gain or loss of their functions Thus CA can contribute to initiation or progression of cancer Therefore understanding mechanisms of CA formation in the course of cancer development might be valuable tool for quantification and prognosis of different stages of radiation carcinogenesis Early CA are defined as aberrations induced in first post-irradiation mitotic cycle The present work describes the original biophysical technique for early CA modelling It includes the following simulation steps the ionising particle track structure the structural organisation of all chromosomes in G 0 G 1 cell nucleus spatial distribution of radiation induced DNA double-strand breaks dsb within chromosomes dsb rejoining and misrejoining modelling cell cycle taking into account mitotic delay which results in complex time dependence of aberrant cells in first mitosis The results on prediction of dose-response curves for simple and complex CA measured in cells undergoing first division cycle are presented in comparison with recent experimental data There is increasing evidence that CA are also observed in descendents of irradiated cells many generations after direct DNA damage These delayed CA or chromosome instability CI are thought to be a manifestation of genome

  7. Biophysically Inspired Rational Design of Structured Chimeric Substrates for DNAzyme Cascade Engineering (United States)

    Lakin, Matthew R.; Brown, Carl W.; Horwitz, Eli K.; Fanning, M. Leigh; West, Hannah E.; Stefanovic, Darko; Graves, Steven W.


    The development of large-scale molecular computational networks is a promising approach to implementing logical decision making at the nanoscale, analogous to cellular signaling and regulatory cascades. DNA strands with catalytic activity (DNAzymes) are one means of systematically constructing molecular computation networks with inherent signal amplification. Linking multiple DNAzymes into a computational circuit requires the design of substrate molecules that allow a signal to be passed from one DNAzyme to another through programmed biochemical interactions. In this paper, we chronicle an iterative design process guided by biophysical and kinetic constraints on the desired reaction pathways and use the resulting substrate design to implement heterogeneous DNAzyme signaling cascades. A key aspect of our design process is the use of secondary structure in the substrate molecule to sequester a downstream effector sequence prior to cleavage by an upstream DNAzyme. Our goal was to develop a concrete substrate molecule design to achieve efficient signal propagation with maximal activation and minimal leakage. We have previously employed the resulting design to develop high-performance DNAzyme-based signaling systems with applications in pathogen detection and autonomous theranostics. PMID:25347066

  8. Biophysically inspired rational design of structured chimeric substrates for DNAzyme cascade engineering. (United States)

    Lakin, Matthew R; Brown, Carl W; Horwitz, Eli K; Fanning, M Leigh; West, Hannah E; Stefanovic, Darko; Graves, Steven W


    The development of large-scale molecular computational networks is a promising approach to implementing logical decision making at the nanoscale, analogous to cellular signaling and regulatory cascades. DNA strands with catalytic activity (DNAzymes) are one means of systematically constructing molecular computation networks with inherent signal amplification. Linking multiple DNAzymes into a computational circuit requires the design of substrate molecules that allow a signal to be passed from one DNAzyme to another through programmed biochemical interactions. In this paper, we chronicle an iterative design process guided by biophysical and kinetic constraints on the desired reaction pathways and use the resulting substrate design to implement heterogeneous DNAzyme signaling cascades. A key aspect of our design process is the use of secondary structure in the substrate molecule to sequester a downstream effector sequence prior to cleavage by an upstream DNAzyme. Our goal was to develop a concrete substrate molecule design to achieve efficient signal propagation with maximal activation and minimal leakage. We have previously employed the resulting design to develop high-performance DNAzyme-based signaling systems with applications in pathogen detection and autonomous theranostics.

  9. Biophysical analysis of water filtration phenomenon in the roots of halophytes (United States)

    Kim, Kiwoong; Lee, Sang Joon


    The water management systems of plants, such as water collection and water filtration have been optimized through a long history. In this point of view, new bio-inspired technologies can be developed by mimicking the nature's strategies for the survival of the fittest. In this study, the biophysical characteristics of water filtration process in the roots of halophytes are experimentally investigated in the plant hydrodynamic point of view. To understand the functional features of the halophytes 3D morphological structure of their roots are analyzed using advanced bioimaging techniques. The surface properties of the roots of halophytes are also examined Based on the quantitatively analyzed information, water filtration phenomenon in the roots is examined. Sodium treated mangroves are soaked in sodium acting fluorescent dye solution to trace sodium ions in the roots. In addition, in vitroexperiment is carried out by using the roots. As a result, the outermost layer of the roots filters out continuously most of sodium ions. This study on developing halophytes would be helpful for understanding the water filtration mechanism of the roots of halophytes and developing a new bio inspired desalination system. This research was financially supported by the National Research Foundation (NRF) of Korea (Contract grant number: 2008-0061991).

  10. Folding of multidomain proteins: biophysical consequences of tethering even in apparently independent folding. (United States)

    Arviv, Oshrit; Levy, Yaakov


    Most eukaryotic and a substantial fraction of prokaryotic proteins are composed of more than one domain. The tethering of these evolutionary, structural, and functional units raises, among others, questions regarding the folding process of conjugated domains. Studying the folding of multidomain proteins in silico enables one to identify and isolate the tethering-induced biophysical determinants that govern crosstalks generated between neighboring domains. For this purpose, we carried out coarse-grained and atomistic molecular dynamics simulations of two two-domain constructs from the immunoglobulin-like β-sandwich fold. Each of these was experimentally shown to behave as the "sum of its parts," that is, the thermodynamic and kinetic folding behavior of the constituent domains of these constructs seems to occur independently, with the folding of each domain uncoupled from the folding of its partner in the two-domain construct. We show that the properties of the individual domains can be significantly affected by conjugation to another domain. The tethering may be accompanied by stabilizing as well as destabilizing factors whose magnitude depends on the size of the interface, the length, and the flexibility of the linker, and the relative stability of the domains. Accordingly, the folding of a multidomain protein should not be viewed as the sum of the folding patterns of each of its parts, but rather, it involves abrogating several effects that lead to this outcome. An imbalance between these effects may result in either stabilization or destabilization owing to the tethering.

  11. Biophysical Characterization of Protected Areas Globally through Optimized Image Segmentation and Classification

    Directory of Open Access Journals (Sweden)

    Javier Martínez-López


    Full Text Available Protected areas (PAs need to be assessed systematically according to biodiversity values and threats in order to support decision-making processes. For this, PAs can be characterized according to their species, ecosystems and threats, but such information is often difficult to access and usually not comparable across regions. There are currently over 200,000 PAs in the world, and assessing these systematically according to their ecological values remains a huge challenge. However, linking remote sensing with ecological modelling can help to overcome some limitations of conservation studies, such as the sampling bias of biodiversity inventories. The aim of this paper is to introduce eHabitat+, a habitat modelling service supporting the European Commission’s Digital Observatory for Protected Areas, and specifically to discuss a component that systematically stratifies PAs into different habitat functional types based on remote sensing data. eHabitat+ uses an optimized procedure of automatic image segmentation based on several environmental variables to identify the main biophysical gradients in each PA. This allows a systematic production of key indicators on PAs that can be compared globally. Results from a few case studies are illustrated to show the benefits and limitations of this open-source tool.

  12. An estimate of the dispersion of repolarization times based on a biophysical model of the ECG. (United States)

    Sassi, Roberto; Mainardi, Luca T


    Temporal heterogeneity of ventricular repolarization is a key quantity for the development of ventricular reentrant arrhythmia. In this paper, we introduce the V-index, a novel ECG-based estimator of the standard deviation of ventricular myocytes' repolarization times s(ϑ). Differently from other ECG metrics of repolarization heterogeneity, the V-index was derived from the analysis of a biophysical model of the ECG, where repolarization is described by the dominant T-wave (DTW) paradigm. The model explains the shape of T-waves in each lead as a projection of a main waveform (the DTW) and its derivatives weighted by scalars, the lead factors. A mathematical formula is derived to link the heterogeneity of ventricular repolarization s(ϑ) and the V-index. The formula was verified using synthetic 12-lead ECGs generated with a direct electrophysiological model for increasing values of s(ϑ) (in the range 20-70 ms). A linear relationship between the V-index and s(ϑ) was observed, V ≈ 0.675 s(ϑ) + 1.8 ms (R(2) = 0.9992). Finally, 68 ECGs from the E-OTH-12-0068-010 database of the Telemetric and Holter ECG Warehouse were analyzed. The V-index coherently increased after sotalol administration, a drug known to have QT-prolonging potential (p < 0.001).

  13. A Combinatorial Approach to Biophysically Characterise Chemokine-Glycan Binding Affinities for Drug Development

    Directory of Open Access Journals (Sweden)

    Tanja Gerlza


    Full Text Available Chemokine binding to glycosaminoglycans (GAGs is recognised to be an important step in inflammation and other pathological disorders like tumor growth and metastasis. Although different ways and strategies to interfere with these interactions are being pursued, no major breakthrough in the development of glycan-targeting drugs has been reported so far. We have engineered CXCL8 towards a dominant-negative form of this chemokine (dnCXCL8 which was shown to be highly active in various inflammatory animal models due to its inability to bind/activate the cognate CXCL8 GPC receptors on neutrophils in combination with its significantly increased GAG-binding affinity [1]. For the development of GAG-targeting chemokine-based biopharmaceuticals, we have established a repertoire of methods which allow the quantification of protein-GAG interactions. Isothermal fluorescence titration (IFT, surface plasmon resonance (SPR, isothermal titration calorimetry (ITC, and a novel ELISA-like competition assay (ELICO have been used to determine Kd and IC50 values for CXCL8 and dnCXCL8 interacting with heparin and heparan sulfate (HS, the proto-typical members of the GAG family. Although the different methods gave different absolute affinities for the four protein-ligand pairs, the relative increase in GAG-binding affinity of dnCXCL8 compared to the wild type chemokine was found by all methods. In combination, these biophysical methods allow to discriminate between unspecific and specific protein-GAG interactions.

  14. Bio-physical evaluation and in vivo delivery of plant proteinase inhibitor immobilized on silica nanospheres. (United States)

    Khandelwal, Neha; Doke, Dhananjay S; Khandare, Jayant J; Jawale, Priyanka V; Biradar, Ankush V; Giri, Ashok P


    Recombinant expression of Capsicum annuum proteinase inhibitors (CanPI-13) and its application via synthetic carrier for the crop protection is the prime objective of our study. Herein, we explored proteinase inhibitor peptide immobilization on silica based nanospheres and rods followed by its pH mediated release in vitro and in vivo. Initial studies suggested silica nanospheres to be a suitable candidate for peptide immobilization. Furthermore, the interactions were characterized biophysically to ascertain their conformational stability and biological activity. Interestingly, bioactive peptide loading at acidic pH on nanospheres was found to be 62% and showed 56% of peptide release at pH 10, simulating gut milieu of the target pest Helicoverpa armigera. Additionally, in vivo study demonstrated significant reduction in insect body mass (158 mg) as compared to the control insects (265 mg) on 8th day after feeding with CanPI-13 based silica nanospheres. The study confirms that peptide immobilized silica nanosphere is capable of affecting overall growth and development of the feeding insects, which is known to hamper fecundity and fertility of the insects. Our study illustrates the utility and development of peptide-nanocarrier based platform in delivering diverse biologically active complexes specific to gut pH of H. armigera.

  15. Investigating Irregularly Patterned Deep Brain Stimulation Signal Design Using Biophysical Models

    Directory of Open Access Journals (Sweden)

    Samantha Rose Summerson


    Full Text Available Parkinson’s disease (PD is a neurodegenerative disorder which follows from cell loss of dopaminergic neurons in the substantia nigra pars compacta (SNc, a nucleus in the basal ganglia (BG. Deep brain stimulation (DBS is an electrical therapy that modulates the pathological activity to treat the motor symptoms of PD. Although this therapy is currently used in clinical practice, the sufficient conditions for therapeutic efficacy are unknown. In this work we develop a model of critical motor circuit structures in the brain using biophysical cell models as the base components and then evaluate performance of different DBS signals in this model to perform comparative studies of their efficacy. Biological models are an important tool for gaining insights into neural function and, in this case, serve as effective tools for investigating innovative new DBS paradigms. Experiments were performed using the hemi-parkinsonian rodent model to test the same set of signals, verifying the obedience of the model to physiological trends. We show that antidromic spiking from DBS of the subthalamic nucleus (STN has a significant impact on cortical neural activity, which is frequency dependent and additionally modulated by the regularity of the stimulus pulse train used. Irregular spacing between stimulus pulses, where the amount of variability added is bounded, is shown to increase diversification of response of basal ganglia neurons and reduce entropic noise in cortical neurons, which may be fundamentally important to restoration of information flow in the motor circuit.

  16. Systemic evening primrose oil improves the biophysical skin parameters of healthy adults. (United States)

    Muggli, R


    Biophysical skin parameters are indicators of age-related structural and functional changes in skin tissues. This randomized, double-blind, placebo-controlled study in healthy adults tested the effect of Efamol evening primrose oil [EPO, a gamma-linolenic acid (GLA) containing vegetable oil] on skin moisture, transepidermal water loss (TEWL), redness, firmness, elasticity, fatigue resistance and roughness. Efamol EPO was administered orally in soft gel capsules, 3 x 500 mg b.i.d. for 12 weeks. Measurements were taken at baseline and at weeks 4 and 12. The two treatment groups did not differ at baseline and at week 4. At week 12, however, all measured variables, with the exception of skin redness, were significantly different in the EPO group compared with placebo. Skin moisture, TEWL, elasticity, firmness, fatigue resistance and roughness had significantly improved by 12.9, 7.7, 4.7, 16.7, 14.2 and 21.7%, respectively. The two-sided levels of significance in favor of the EPO treatment ranged between 0.034 and 0.001. These findings lend further support to the notion that GLA is a conditionally essential fatty acid for the skin, i.e. it is unable to synthesize GLA, and therefore depends on preformed GLA for optimal structure and function.

  17. A simple biophysically plausible model for long time constants in single neurons. (United States)

    Tiganj, Zoran; Hasselmo, Michael E; Howard, Marc W


    Recent work in computational neuroscience and cognitive psychology suggests that a set of cells that decay exponentially could be used to support memory for the time at which events took place. Analytically and through simulations on a biophysical model of an individual neuron, we demonstrate that exponentially decaying firing with a range of time constants up to minutes could be implemented using a simple combination of well-known neural mechanisms. In particular, we consider firing supported by calcium-controlled cation current. When the amount of calcium leaving the cell during an interspike interval is larger than the calcium influx during a spike, the overall decay in calcium concentration can be exponential, resulting in exponential decay of the firing rate. The time constant of the decay can be several orders of magnitude larger than the time constant of calcium clearance, and it could be controlled externally via a variety of biologically plausible ways. The ability to flexibly and rapidly control time constants could enable working memory of temporal history to be generalized to other variables in computing spatial and ordinal representations.

  18. Possible etiology of calculi formation in salivary glands: biophysical analysis of calculus. (United States)

    Mimura, Masafumi; Tanaka, Nobuyuki; Ichinose, Shizuko; Kimijima, Yutaka; Amagasa, Teruo


    Sialolithiasis is one of the common diseases of the salivary glands. It was speculated that, in the process of calculi formation, degenerative substances are emitted by saliva and calcification then occurs around these substances, and finally calculi are formed. However, the exact mechanism of the formation of calculi is still unclear. In this study, we identify some possible etiologies of calculi formation in salivary glands through biophysical analysis. Calculi from 13 patients with submandibular sialolithiasis were investigated by transmission electron microscopy, scanning electron microscopy, X-ray microanalyzer, and electron diffraction. Transmission electron microscopic observation of calculi was performed in the submandibular gland (n = 13). In 3 of the 13 cases, a number of mitochondria-like structures and lysosomes were found near calcified materials. Scanning electron microscopic examination of these materials revealed that there were lamellar and concentric structures and that the degree of calcification was different among the calculi. X-ray microanalysis disclosed the component elements in the calculi to be Ca, P, S, Na, etc., and the main constituents were Ca and P. The calcium-to-phosphorus ratio was 1.60-1.89. Analysis of the area including mitochondria-like structures, lysosomes, and the fibrous structures by electron diffraction revealed the presence of hydroxyapatite and calcified materials. It is speculated that mitochondria and lysosomal bodies from the ductal system of the submandibular gland are an etiological source for calcification in the salivary gland.

  19. EDTA-induced Membrane Fluidization and Destabilization: Biophysical Studies on Artificial Lipid Membranes

    Institute of Scientific and Technical Information of China (English)



    The molecular mechanism of ethylenediaminetetraacetic acid (EDTA)-induced membrane destabilization has been studied using a combination of four biophysical techniques on artificial lipid membranes.Data from Langmuir film balance and epifluorescence microscopy revealed the fluidization and expansion effect of EDTA on phase behavior of monolayers of either 1,2-dipalmitoyl-sn-glycero-3-phosphocholine (DPPC) or mixtures of DPPC and metal-chelating lipids, such as Nα,Nα-Bis[carboxymethyl]-Nε-[(dioctadecylamino)succinyl]-L-lysine or 1,2-dioleoyl-sn-glycero-3-[N-(5-amino- 1-carboxypentyl iminodiacetic acid) succinyl]. A plausible explanation could be drawn from the electrostatic interaction between negatively charged groups of EDTA and the positively charged choline head group of DPPC.Intercalation of EDTA into the lipid membrane induced membrane curvature as elucidated by atomic force microscopy. Growth in size and shape of the membrane protrusion was found to be time-dependent upon exposure to EDTA. Further loss of material from the lipid membrane surface was monitored in real time using a quartz crystal microbalance. This indicates membrane restabilization by exclusion of the protrusions from the surface. Loss of lipid components facilitates membrane instability, leading to membrane permeabilization and lysis.

  20. Coupled biophysical global ocean model and molecular genetic analyses identify multiple introductions of cryptogenic species. (United States)

    Dawson, Michael N; Sen Gupta, Alex; England, Matthew H


    The anthropogenic introduction of exotic species is one of the greatest modern threats to marine biodiversity. Yet exotic species introductions remain difficult to predict and are easily misunderstood because knowledge of natural dispersal patterns, species diversity, and biogeography is often insufficient to distinguish between a broadly dispersed natural population and an exotic one. Here we compare a global molecular phylogeny of a representative marine meroplanktonic taxon, the moon-jellyfish Aurelia, with natural dispersion patterns predicted by a global biophysical ocean model. Despite assumed high dispersal ability, the phylogeny reveals many cryptic species and predominantly regional structure with one notable exception: the globally distributed Aurelia sp.1, which, molecular data suggest, may occasionally traverse the Pacific unaided. This possibility is refuted by the ocean model, which shows much more limited dispersion and patterns of distribution broadly consistent with modern biogeographic zones, thus identifying multiple introductions worldwide of this cryptogenic species. This approach also supports existing evidence that (i) the occurrence in Hawaii of Aurelia sp. 4 and other native Indo-West Pacific species with similar life histories is most likely due to anthropogenic translocation, and (ii) there may be a route for rare natural colonization of northeast North America by the European marine snail Littorina littorea, whose status as endemic or exotic is unclear.

  1. A biophysical model of S. aurita early life history in the northern Gulf of Guinea (United States)

    Koné, Vamara; Lett, Christophe; Penven, Pierrick; Bourlès, Bernard; Djakouré, Sandrine


    S. aurita is the most abundant small pelagic fish in the northern Gulf of Guinea. Its reproduction and recruitment depend crucially on environmental conditions. We developed a biophysical model of S. aurita early life history by coupling offline an individual-based model with the regional oceanic modeling system (ROMS). We used this model to investigate the main factors driving variability in eggs and larval dispersal and survival in the northern Gulf of Guinea. Precisely, individuals were released from different spawning areas along the coast and tracked for a period of 28 days corresponding to their planktonic phase. Individuals that remained in the coastal recruitment areas at an age more than 7 days, at which they can supposedly actively retain themselves in a favorable area, were considered as recruited. Simulation results show the importance of the spawning areas around Cape Palmas and Cape Three Points where cyclonic eddies trap eggs and larvae along the coast, preventing their advection offshore by the Guinea Current. The spawning period also plays a key role in the recruitment success, with highest coastal retention obtained during the major upwelling period (July-September). We find that a second retention peak can occur during the minor upwelling period (February-March) when larval mortality due to temperature is included in the model. These results are in general agreement with knowledge of S. aurita reproduction in the northern Gulf of Guinea.

  2. ``Physical Concepts in Cell Biology,'' an upper level interdisciplinary course in cell biophysics/mathematical biology (United States)

    Vavylonis, Dimitrios


    I will describe my experience in developing an interdisciplinary biophysics course addressed to students at the upper undergraduate and graduate level, in collaboration with colleagues in physics and biology. The students had a background in physics, biology and engineering, and for many the course was their first exposure to interdisciplinary topics. The course did not depend on a formal knowledge of equilibrium statistical mechanics. Instead, the approach was based on dynamics. I used diffusion as a universal ``long time'' law to illustrate scaling concepts. The importance of statistics and proper counting of states/paths was introduced by calculating the maximum accuracy with which bacteria can measure the concentration of diffuse chemicals. The use of quantitative concepts and methods was introduced through specific biological examples, focusing on model organisms and extremes at the cell level. Examples included microtubule dynamic instability, the search and capture model, molecular motor cooperativity in muscle cells, mitotic spindle oscillations in C. elegans, polymerization forces and propulsion of pathogenic bacteria, Brownian ratchets, bacterial cell division and MinD oscillations.

  3. Biochemical and Biophysical Characterization of Recombinant Yeast Proteasome Maturation Factor UMP1

    Directory of Open Access Journals (Sweden)

    Bebiana Sá-Moura


    Full Text Available Protein degradation is essential for maintaining cellular homeostasis. The proteasome is the central enzyme responsible for non-lysosomal protein degradation in eukaryotic cells. Although proteasome assembly is not yet completely understood, a number of cofactors required for proper assembly and maturation have been identified. Ump1 is a short-lived maturation factor required for the efficient biogenesis of the 20S proteasome. Upon the association of the two precursor complexes, Ump1 is encased and is rapidly degraded after the proteolytic sites in the interior of the nascent proteasome are activated. In order to further understand the mechanisms behind proteasomal maturation, we expressed and purified yeast Ump1 in E. coli for biophysical and structural analysis.We show that recombinant Ump1 is purified as a mixture of different oligomeric species and that oligomerization is mediated by intermolecular disulfide bond formation involving the only cysteine residue present in the protein. Furthermore, a combination of bioinformatics tools, biochemical and structural analysis revealed that Ump1 shows characteristics of an intrinsically disordered protein, which might become structured only upon interaction with the proteasome subunits.

  4. Purification and biophysical characterization of the core protease domain of anthrax lethal factor. (United States)

    Gkazonis, Petros V; Dalkas, Georgios A; Chasapis, Christos T; Vlamis-Gardikas, Alexios; Bentrop, Detlef; Spyroulias, Georgios A


    Anthrax lethal toxin (LeTx) stands for the major virulence factor of the anthrax disease. It comprises a 90kDa highly specific metalloprotease, the anthrax lethal factor (LF). LF possesses a catalytic Zn(2+) binding site and is highly specific against MAPK kinases, thus representing the most potent native biomolecule to alter and inactivate MKK [MAPK (mitogen-activated protein kinase) kinases] signalling pathways. Given the importance of the interaction between LF and substrate for the development of anti-anthrax agents as well as the potential treatment of nascent tumours, the analysis of the structure and dynamic properties of the LF catalytic site are essential to elucidate its enzymatic properties. Here we report the recombinant expression and purification of a C-terminal part of LF (LF(672-776)) that harbours the enzyme's core protease domain. The biophysical characterization and backbone assignments ((1)H, (13)C, (15)N) of the polypeptide revealed a stable, well folded structure even in the absence of Zn(2+), suitable for high resolution structural analysis by NMR.

  5. Transfer of engineered biophysical properties between different antibody formats and expression systems. (United States)

    Schaefer, Jonas V; Plückthun, Andreas


    Recombinant antibodies and their derivatives are receiving ever increasing attention for many applications. Nevertheless, they differ widely in biophysical properties, from stable monomers to metastable aggregation-prone mixtures of oligomers. Previous work from our laboratory presented the combination of structure-based analysis with family consensus alignments as being able to improve the properties of immunoglobulin variable domains. We had identified a series of mutations in the variable domains that greatly influenced both the stability and the expression level of single-chain Fv (scFv) fragments produced in the periplasm of Escherichia coli. We now investigated whether these effects are transferable to Fab fragments and immunoglobulin G (IgG) produced in bacteria, Pichia pastoris, and mammalian cells. Taken together, our data indicate that engineered mutations can increase functional expression levels only for periplasmic expression in prokaryotes. In contrast, stability against thermal and denaturant-induced unfolding is improved by the same mutations in all formats tested, including scFv, Fab and IgG, independent of the expression system. The mutations in V(H) also influenced the structural homogeneity of full-length IgG, and the reducibility of the distant C(H)1-C(L) inter-chain disulfide bond. These results confirm the potential of structure-based protein engineering in the context of full-length IgGs and the transferability of stability improvements discovered with smaller antibody fragments.

  6. Biophysical characterization of G protein ectodomain of group B human respiratory syncytial virus from E. coli. (United States)

    Khan, Wajihul Hasan; Srungaram, V L N Raghuram; Islam, Asimul; Beg, Ilyas; Haider, Md Shakir H; Ahmad, Faizan; Broor, Shobha; Parveen, Shama


    Human respiratory syncytial virus (hRSV) is an important pathogen of acute respiratory tract infection. The G protein of hRSV is a transmembrane glycoprotein that is a neutralizing antigen and is thus a vaccine candidate. In this study, synthetic codon optimized ectodomain G protein [G(ΔTM)] of BA genotype of group B hRSV was cloned, expressed, and characterized using biophysical techniques. The molar absorption coefficient and mean residue ellipticity at 222 nm ([θ]222) of G (ΔTM) was found to be 7950 M(-1) cm(-1) and -19701.7 deg cm(2) dmol(-1) respectively. It was concluded that G(ΔTM) mainly consist of α-helix (74.9%) with some amount of β-sheet (4%). The protein was stable up to 85°C without any transition curve. However, heat-induced denaturation of G(ΔTM) resulted in total loss of β-sheet whereas not much change was observed in the α-helix part of the secondary structure. It was concluded that G(ΔTM) is an α-helical protein and it is highly stable at high temperature, but could be easily denatured using high concentrations of GdmCl/urea or acidic condition. This is the first investigation of cloning, expression, and characterization of G(ΔTM) of BA viruses from India. Structural characterization of G protein will assist in drug designing and vaccine development for hRSV.

  7. Estimating Irrigation Water Requirements using MODIS Vegetation Indices and Inverse Biophysical Modeling (United States)

    Imhoff, Marc L.; Bounoua, Lahouari; Harriss, Robert; Harriss, Robert; Wells, Gordon; Glantz, Michael; Dukhovny, Victor A.; Orlovsky, Leah


    An inverse process approach using satellite-driven (MODIS) biophysical modeling was used to quantitatively assess water resource demand in semi-arid and arid agricultural lands by comparing the carbon and water flux modeled under both equilibrium (in balance with prevailing climate) and non-equilibrium (irrigated) conditions. Since satellite observations of irrigated areas show higher leaf area indices (LAI) than is supportable by local precipitation, we postulate that the degree to which irrigated lands vary from equilibrium conditions is related to the amount of irrigation water used. For an observation year we used MODIS vegetation indices, local climate data, and the SiB2 photosynthesis-conductance model to examine the relationship between climate and the water stress function for a given grid-cell and observed leaf area. To estimate the minimum amount of supplemental water required for an observed cell, we added enough precipitation to the prevailing climatology at each time step to minimize the water stress function and bring the soil to field capacity. The experiment was conducted on irrigated lands on the U.S. Mexico border and Central Asia and compared to estimates of irrigation water used.

  8. Biophysical mechanism for ras-nanocluster formation and signaling in plasma membrane.

    Directory of Open Access Journals (Sweden)

    Thomas Gurry

    Full Text Available Ras GTPases are lipid-anchored G proteins, which play a fundamental role in cell signaling processes. Electron micrographs of immunogold-labeled Ras have shown that membrane-bound Ras molecules segregate into nanocluster domains. Several models have been developed in attempts to obtain quantitative descriptions of nanocluster formation, but all have relied on assumptions such as a constant, expression-level independent ratio of Ras in clusters to Ras monomers (cluster/monomer ratio. However, this assumption is inconsistent with the law of mass action. Here, we present a biophysical model of Ras clustering based on short-range attraction and long-range repulsion between Ras molecules in the membrane. To test this model, we performed Monte Carlo simulations and compared statistical clustering properties with experimental data. We find that we can recover the experimentally-observed clustering across a range of Ras expression levels, without assuming a constant cluster/monomer ratio or the existence of lipid rafts. In addition, our model makes predictions about the signaling properties of Ras nanoclusters in support of the idea that Ras nanoclusters act as an analog-digital-analog converter for high fidelity signaling.

  9. New organelles by gene duplication in a biophysical model of eukaryote endomembrane evolution. (United States)

    Ramadas, Rohini; Thattai, Mukund


    Extant eukaryotic cells have a dynamic traffic network that consists of diverse membrane-bound organelles exchanging matter via vesicles. This endomembrane system arose and diversified during a period characterized by massive expansions of gene families involved in trafficking after the acquisition of a mitochondrial endosymbiont by a prokaryotic host cell >1.8 billion years ago. Here we investigate the mechanistic link between gene duplication and the emergence of new nonendosymbiotic organelles, using a minimal biophysical model of traffic. Our model incorporates membrane-bound compartments, coat proteins and adaptors that drive vesicles to bud and segregate cargo from source compartments, and SNARE proteins and associated factors that cause vesicles to fuse into specific destination compartments. In simulations, arbitrary numbers of compartments with heterogeneous initial compositions segregate into a few compositionally distinct subsets that we term organelles. The global structure of the traffic system (i.e., the number, composition, and connectivity of organelles) is determined completely by local molecular interactions. On evolutionary timescales, duplication of the budding and fusion machinery followed by loss of cross-interactions leads to the emergence of new organelles, with increased molecular specificity being necessary to maintain larger organellar repertoires. These results clarify potential modes of early eukaryotic evolution as well as more recent eukaryotic diversification.

  10. Biophysical characterization of KV3.1 potassium channel activating compounds

    DEFF Research Database (Denmark)

    Taskin, Bahar; von Schoubye, Nadia Lybøl; Sheykhzade, Majid;


    The effect of two positive modulators, RE1 and EX15, on the voltage-gated K+ channel Kv3.1 was investigated using the whole-cell patch-clamp technique on HEK293 cells expressing Kv3.1a. RE1 and EX15 increased the Kv3.1 currents in a concentration-dependent manner with an EC50 value of 4.5 and 1.3µ......M, respectively. However, high compound concentrations caused an inhibition of the Kv3.1 current. The compound-induced activation of Kv3.1 channels showed a profound hyperpolarized shift in activation kinetics. 30µM RE1 shifted V½ from 5.63±0.31mV to -9.71±1.00mV and 10µM EX15 induced a shift from 10.77±0.32m...... the first detailed biophysical characterization of two new Kv3.1 channel modifying compounds with different modulating properties....

  11. Indigenous community health and climate change: integrating biophysical and social science indicators (United States)

    Donatuto, Jamie; Grossman, Eric E.; Konovsky, John; Grossman, Sarah; Campbell, Larry W.


    This article describes a pilot study evaluating the sensitivity of Indigenous community health to climate change impacts on Salish Sea shorelines (Washington State, United States and British Columbia, Canada). Current climate change assessments omit key community health concerns, which are vital to successful adaptation plans, particularly for Indigenous communities. Descriptive scaling techniques, employed in facilitated workshops with two Indigenous communities, tested the efficacy of ranking six key indicators of community health in relation to projected impacts to shellfish habitat and shoreline archaeological sites stemming from changes in the biophysical environment. Findings demonstrate that: when shellfish habitat and archaeological resources are impacted, so is Indigenous community health; not all community health indicators are equally impacted; and, the community health indicators of highest concern are not necessarily the same indicators most likely to be impacted. Based on the findings and feedback from community participants, exploratory trials were successful; Indigenous-specific health indicators may be useful to Indigenous communities who are assessing climate change sensitivities and creating adaptation plans.

  12. Discrimination And Biophysical Characterization Of Brazilian Cerrado Physiognomies With Eo-1 Hyperspectral Hyperion (United States)

    Miura, Tomoaki; Huete, Alfredo R.; Ferreira, Laerte G.; Sano, Edson E.


    The savanna, typically found in the sub-tropics and seasonal tropics, are the dominant vegetation biome type in the southern hemisphere, covering approximately 45% of the South America. In Brazil, the savanna, locally known as "cerrado," is the most intensely stressed biome with both natural environmental pressures (e.g., the strong seasonality in weather, extreme soil nutrient impoverishment, and widespread fire occurrences) and rapid/aggressive land conversions (Skole et al., 1994; Ratter et al., 1997). Better characterization and discrimination of cerrado physiognomies are needed in order to improve understanding of cerrado dynamics and its impact on carbon storage, nutrient dynamics, and the prospect for sustainable land use in the Brazilian cerrado biome. Satellite remote sensing have been known to be a useful tool for land cover and land use mapping (Rougharden et al., 1991; Hansen et al., 2000). However, attempts to discriminate and classify Brazilian cerrado using multi-spectral sensors (e.g., Landsat TM) and/or moderate resolution sensors (e.g., NOAA AVHRR NDVI) have often resulted in a limited success due partly to small contrasts depicted in their multiband, spectral reflectance or vegetation index values among cerrado classes (Seyler et al., 2002; Fran a and Setzer, 1998). In this study, we aimed to improve discrimination as well as biophysical characterization of the Brazilian cerrado physiognomies with hyperspectral remote sensing. We used Hyperion, the first satellite-based hyperspectral imager, onboard the Earth Observing-1 (EO-1) platform.

  13. Biophysical and Functional Characterization of Rhesus Macaque IgG Subclasses

    Directory of Open Access Journals (Sweden)

    Austin W. Boesch


    Full Text Available Antibodies raised in Indian rhesus macaques (Macaca mulatta, MM in many preclinical vaccine studies are often evaluated in vitro for titer, antigen-recognition breadth, neutralization potency, and/or effector function, and in vivo for potential associations with protection. However, despite reliance on this key animal model in translation of promising candidate vaccines for evaluation in first in man studies, little is known about the properties of MM IgG subclasses and how they may compare to human IgG subclasses. Here we evaluate the binding of MM IgG1, IgG2, IgG3, and IgG4 to human FcγR and their ability to elicit the effector functions of human FcγR-bearing cells, and unlike in humans, find a notable absence of subclasses with dramatically silent Fc regions. Biophysical, in vitro, and in vivo characterization revealed MM IgG1 exhibited the greatest effector function activity followed by IgG2 and then IgG3/4. These findings in rhesus are in contrast with the canonical understanding that IgG1 and IgG3 dominate effector function in humans, indicating that subclass-switching profiles observed in rhesus studies may not strictly recapitulate those observed in human vaccine studies.

  14. Distinct biophysical mechanisms of focal adhesion kinase mechanoactivation by different extracellular matrix proteins. (United States)

    Seong, Jihye; Tajik, Arash; Sun, Jie; Guan, Jun-Lin; Humphries, Martin J; Craig, Susan E; Shekaran, Asha; García, Andrés J; Lu, Shaoying; Lin, Michael Z; Wang, Ning; Wang, Yingxiao


    Matrix mechanics controls cell fate by modulating the bonds between integrins and extracellular matrix (ECM) proteins. However, it remains unclear how fibronectin (FN), type 1 collagen, and their receptor integrin subtypes distinctly control force transmission to regulate focal adhesion kinase (FAK) activity, a crucial molecular signal governing cell adhesion/migration. Here we showed, using a genetically encoded FAK biosensor based on fluorescence resonance energy transfer, that FN-mediated FAK activation is dependent on the mechanical tension, which may expose its otherwise hidden FN synergy site to integrin α5. In sharp contrast, the ligation between the constitutively exposed binding motif of type 1 collagen and its receptor integrin α2 was surprisingly tension-independent to induce sufficient FAK activation. Although integrin α subunit determines mechanosensitivity, the ligation between α subunit and the ECM proteins converges at the integrin β1 activation to induce FAK activation. We further discovered that the interaction of the N-terminal protein 4.1/ezrin/redixin/moesin basic patch with phosphatidylinositol 4,5-biphosphate is crucial during cell adhesion to maintain the FAK activation from the inhibitory effect of nearby protein 4.1/ezrin/redixin/moesin acidic sites. Therefore, different ECM proteins either can transmit or can shield from mechanical forces to regulate cellular functions, with the accessibility of ECM binding motifs by their specific integrin α subunits determining the biophysical mechanisms of FAK activation during mechanotransduction.

  15. Influence of expressed TRAIL on biophysical properties of the human leukemic cell line Jurkat

    Institute of Scientific and Technical Information of China (English)

    Kai CHEN; Zong Yao WEN; Shu CHIEN; Dan LI; Yu Hui JIANG; Wei Juan YAO; Xin Juan WANG; Xiao Chao WEI; Jing GAO; Li De XIE; Zong Yi YAN


    The cDNA fragment of human TRAIL (TNF-related apoptosis inducing ligand) was cloned into RevTet-On, a Tetregulated and high-level gene expression system. The gene expression system was constructed in a human leukemic cell line: Jurkat. By using RevTet-On TRAIL gene expression system in Jurkat as a cell model, we studied the influence of TRAIL gene on the changes of cellular apoptosis before and after the TRAIL gene expression, which was induced by adding tetracycline derivative doxycycline (Dox). The results indicated that the cellular apoptosis ratio was largely dependent on the TRAIL gene expression level. Moreover, it was found that the apoptosis-inducing TRAIL could cause significant changes in the biophysical properties of Jurkat cells. The cell surface charge density decreased, the membrane fluidity declined, the elastic coefficients K1 increased, and the proportion of o-helix in membrane protein secondary structure decreased. Thus, the apoptosis-inducing TRAIL gene caused significant changes on the biomechanic properties of Jurkat cells.

  16. Functional imaging in oncology. Biophysical basis and technical approaches. Vol. 1

    Energy Technology Data Exchange (ETDEWEB)

    Luna, Antonio [Health Time Group, Jaen (Spain); University Hospitals, Case Western Reserve Univ., Cleveland, OH (United States). Dept. of Radiology; Vilanova, Joan C. [Clinica Girona - Hospital Sta. Caterina, Girona (Spain); Hygino da Cruz, L. Celso Jr. [CDPI and IRM, Rio de Janeiro, RJ (Brazil). Dept. of Radiology; Rossi, Santiago E. (ed.) [Centro de Diagnostico, Buenos Aires (Argentina)


    Easy-to-read manual on new functional imaging techniques in oncology. Explains current clinical applications and outlines future avenues. Includes numerous high-quality illustrations to highlight the major teaching points. In the new era of functional and molecular imaging, both currently available imaging biomarkers and biomarkers under development are expected to lead to major changes in the management of oncological patients. This well-illustrated two-volume book is a practical manual on the various imaging techniques capable of delivering functional information on cancer, including preclinical and clinical imaging techniques, based on US, CT, MRI, PET and hybrid modalities. This first volume explains the biophysical basis for these functional imaging techniques and describes the techniques themselves. Detailed information is provided on the imaging of cancer hallmarks, including angiogenesis, tumor metabolism, and hypoxia. The techniques and their roles are then discussed individually, covering the full range of modalities in clinical use as well as new molecular and functional techniques. The value of a multiparametric approach is also carefully considered.

  17. Review of in vivo static and ELF electric fields studies performed at Gazi Biophysics Department. (United States)

    Seyhan, Nesrin; Güler, Göknur


    In vivo effects of Static Electric and ELF Magnetic and Electric fields have been carried out for more than 20 years in the Bioelectromagnetic Laboratory at the Biophysics Department of the Medical Faculty of Gazi University. In this article, the results of in vivo ELF Electric field studies are presented as a review. Static and 50 Hz ELF (Extremely Low Frequency) Electric (E) fields effects on free radical synthesis, antioxidant enzyme level, and collagen synthesis were analyzed on tissues of guinea pigs, such as brain, liver, lung, kidney, spleen, testis, and plasma. Animals were exposed to static and ELF electric fields with intensities ranging from 0.3 kV/m to 1.9 kV/m in vertical and horizontal directions. Exposure periods were 1, 3, 5, 7, and 10 days. Electric fields were generated from a specially designed parallel plate capacitor system. The results indicate that the effects of electric fields on the tissues studied depend significantly on the type and magnitude of electric field and exposure period.

  18. EDTA-induced membrane fluidization and destabilization: biophysical studies on artificial lipid membranes. (United States)

    Prachayasittikul, Virapong; Isarankura-Na-Ayudhya, Chartchalerm; Tantimongcolwat, Tanawut; Nantasenamat, Chanin; Galla, Hans-Joachim


    The molecular mechanism of ethylenediaminetetraacetic acid (EDTA)-induced membrane destabilization has been studied using a combination of four biophysical techniques on artificial lipid membranes. Data from Langmuir film balance and epifluorescence microscopy revealed the fluidization and expansion effect of EDTA on phase behavior of monolayers of either 1,2-dipalmitoyl-sn-glycero-3-phosphocholine (DPPC) or mixtures of DPPC and metal-chelating lipids, such as N(alpha),N(alpha)-Bis[carboxymethyl]-N(epsilon)-[(dioctadecylamino)succinyl]-L-lysine or 1,2-dioleoyl-sn-glycero-3-[N-(5-amino-1-carboxypentyl iminodiacetic acid) succinyl]. A plausible explanation could be drawn from the electrostatic interaction between negatively charged groups of EDTA and the positively charged choline head group of DPPC. Intercalation of EDTA into the lipid membrane induced membrane curvature as elucidated by atomic force microscopy. Growth in size and shape of the membrane protrusion was found to be time-dependent upon exposure to EDTA. Further loss of material from the lipid membrane surface was monitored in real time using a quartz crystal microbalance. This indicates membrane restabilization by exclusion of the protrusions from the surface. Loss of lipid components facilitates membrane instability, leading to membrane permeabilization and lysis.

  19. Magnetic nanoparticles for biophysical applications synthesized by high-power physical dispersion

    Energy Technology Data Exchange (ETDEWEB)

    Safronov, A.P., E-mail: [Ural Federal University, Yekaterinburg (Russian Federation); Beketov, I.V. [Ural Federal University, Yekaterinburg (Russian Federation); Institute of Elecrophysics, Ural branch of RAS, Yekaterinburg (Russian Federation); Tyukova, I.S. [Ural Federal University, Yekaterinburg (Russian Federation); Medvedev, A.I. [Ural Federal University, Yekaterinburg (Russian Federation); Institute of Elecrophysics, Ural branch of RAS, Yekaterinburg (Russian Federation); Samatov, O.M.; Murzakaev, A.M. [Institute of Elecrophysics, Ural branch of RAS, Yekaterinburg (Russian Federation)


    The low cost and high output methods of high-power physical dispersion: the electrical explosion of wire and the laser target evaporation were elaborated for the production of iron oxide magnetic nanoparticles (MNPs) with controlled dispersion parameters and highly reproducible functional properties. The synthesized MNPs were spherical in shape with mean diameter 10 nm and lognormal particle size distribution. The phase composition, shape, particle size and functional properties of MNPs were cross-examined by a variety of contemporary experimental techniques. The phase structure of MNPs corresponds to the inverse spinel of magnetite. Meanwhile, due to the non-equilibrium conditions of the dispersion chemical composition of MNPs is close to maghemite—γ-Fe{sub 2}O{sub 3}. Their magnetic properties are reproducible and very close to the single domain superparamagnetic behavior. The stability of the suspensions of these MNPs and their applicability in the biophysical purposes such as magneto-induced heating have been demonstrated. - Highlights: • We present two methods of low-cost and high output production of iron oxide nanoparticles. • We obtained 10 nm spherical maghemite nanoparticles with close to superparamagnetic behavior. • The suspensions of obtained nanoparticles are stable to salt in physiological concentration. • Magneto-induced heating of suspensions fits well with the theoretical predictions.

  20. Remote sensing of climate changes effects on urban green biophysical variables (United States)

    Zoran, Maria A.; Dida, Adrian I.


    Urban vegetation land cover change is a direct measure of quantitative increase or decrease in sources of urban pollution and the dimension of extreme climate events and changes that determine environment quality. This study addresses climate changes effects and anthropogenic impacts on urban green biophysical variables based on time series satellite data in synergy with in-situ data and new analytical methods. This paper explored the use of time-series MODIS Terra/Aqua Normalized Difference Vegetation Index (NDVI/EVI), Land Surface Temperature (LST) and Leaf Area Index (LAI), land surface albedo data to provide vegetation change detection information for Bucharest test area during 2000- 2015 period. Training and validation are based on a reference dataset collected from Landsat ETM remote sensing data. The mean detection accuracy for investigated period was 89%, with a reasonable balance between change commission errors (19.74%), change omission errors (24.72%), and Kappa coefficient of 0.74. Annual change detection rates across the urban/peri-urban green areas over the study period were estimated at 0.77% per annum in the range of 0.45% (2000) to 0.78% (2015).Vegetation dynamics in urban areas at seasonal and longer timescales reflect large-scale interactions between the terrestrial biosphere and the climate system.

  1. Biophysical synaptic dynamics in an analog VLSI network of Hodgkin-Huxley neurons. (United States)

    Yu, Theodore; Cauwenberghs, Gert


    We study synaptic dynamics in a biophysical network of four coupled spiking neurons implemented in an analog VLSI silicon microchip. The four neurons implement a generalized Hodgkin-Huxley model with individually configurable rate-based kinetics of opening and closing of Na+ and K+ ion channels. The twelve synapses implement a rate-based first-order kinetic model of neurotransmitter and receptor dynamics, accounting for NMDA and non-NMDA type chemical synapses. The implemented models on the chip are fully configurable by 384 parameters accounting for conductances, reversal potentials, and pre/post-synaptic voltage-dependence of the channel kinetics. We describe the models and present experimental results from the chip characterizing single neuron dynamics, single synapse dynamics, and multi-neuron network dynamics showing phase-locking behavior as a function of synaptic coupling strength. The 3mm x 3mm microchip consumes 1.29 mW power making it promising for applications including neuromorphic modeling and neural prostheses.

  2. Effects of vegetable oils on biochemical and biophysical properties of membrane retinal pigment epithelium cells. (United States)

    Said, Toihiri; Tremblay-Mercier, Jennifer; Berrougui, Hicham; Rat, Patrice; Khalil, Abdelouahed


    The aim of this study was to investigate the effect of vegetable oil enrichment of retinal pigment epithelial (RPE) cells on their biochemical and biophysical properties. For this, RPE cells were incubated with 4 different vegetables oils (olive oil, corn oil, argan oil, and camelina oil). The cytotoxicity of these vegetable oils was assessed in vivo on 8-week-old mice and in vitro by using the neutral red and YO-PRO-1 tests. Membrane fluidity was evaluated by fluorescence anisotropy using the fluorescent probe diphenylhexatriene, and membrane fatty acid composition was assessed by gas chromatography. None of the oils tested displayed cytotoxic effects. In vitro, omega-3 rich oils improved membrane fluidity by 47% compared with the control cells. The omega-3 PUFA content within membranes decreased by 38% to 55% when cells were incubated separately with olive oil, corn oil, or argan oil, and increased when cells were incubated with a mixture of those oils, or with camelina oil alone (50% and 103% increase, respectively). Our results show that the fatty acids in vegetable oil incorporate into retinal cells and increase the plasma membrane fluidity.

  3. Biophysical characterization of the underappreciated and important relationship between heart rate variability and heart rate. (United States)

    Monfredi, Oliver; Lyashkov, Alexey E; Johnsen, Anne-Berit; Inada, Shin; Schneider, Heiko; Wang, Ruoxi; Nirmalan, Mahesh; Wisloff, Ulrik; Maltsev, Victor A; Lakatta, Edward G; Zhang, Henggui; Boyett, Mark R


    Heart rate (HR) variability (HRV; beat-to-beat changes in the R-wave to R-wave interval) has attracted considerable attention during the past 30+ years (PubMed currently lists >17 000 publications). Clinically, a decrease in HRV is correlated to higher morbidity and mortality in diverse conditions, from heart disease to fetal distress. It is usually attributed to fluctuation in cardiac autonomic nerve activity. We calculated HRV parameters from a variety of cardiac preparations (including humans, living animals, Langendorff-perfused heart, and single sinoatrial nodal cell) in diverse species, combining this with data from previously published articles. We show that regardless of conditions, there is a universal exponential decay-like relationship between HRV and HR. Using 2 biophysical models, we develop a theory for this and confirm that HRV is primarily dependent on HR and cannot be used in any simple way to assess autonomic nerve activity to the heart. We suggest that the correlation between a change in HRV and altered morbidity and mortality is substantially attributable to the concurrent change in HR. This calls for re-evaluation of the findings from many articles that have not adjusted properly or at all for HR differences when comparing HRV in multiple circumstances.

  4. Photophysics of Fluorescent Probes for Single-Molecule Biophysics and Super-Resolution Imaging (United States)

    Ha, Taekjip; Tinnefeld, Philip


    Single-molecule fluorescence spectroscopy and super-resolution microscopy are important elements of the ongoing technical revolution to reveal biochemical and cellular processes in unprecedented clarity and precision. Demands placed on the photophysical properties of the fluorophores are stringent and drive the choice of appropriate probes. Such fluorophores are not simple light bulbs of a certain color and brightness but instead have their own “personalities” regarding spectroscopic parameters, redox properties, size, water solubility, photostability, and several other factors. Here, we review the photophysics of fluorescent probes, both organic fluorophores and fluorescent proteins, used in applications such as particle tracking, single-molecule FRET, stoichiometry determination, and super-resolution imaging. Of particular interest is the thiol-induced blinking of Cy5, a curse for single-molecule biophysical studies that was later overcome using Trolox through a reducing/oxidizing system but a boon for super-resolution imaging owing to the controllable photoswitching. Understanding photophysics is critical in the design and interpretation of single-molecule experiments.

  5. Functional differentiation of cholinergic and noradrenergic modulation in a biophysical model of olfactory bulb granule cells. (United States)

    Li, Guoshi; Linster, Christiane; Cleland, Thomas A


    Olfactory bulb granule cells are modulated by both acetylcholine (ACh) and norepinephrine (NE), but the effects of these neuromodulators have not been clearly distinguished. We used detailed biophysical simulations of granule cells, both alone and embedded in a microcircuit with mitral cells, to measure and distinguish the effects of ACh and NE on cellular and microcircuit function. Cholinergic and noradrenergic modulatory effects on granule cells were based on data obtained from slice experiments; specifically, ACh reduced the conductance densities of the potassium M current and the calcium-dependent potassium current, whereas NE nonmonotonically regulated the conductance density of an ohmic potassium current. We report that the effects of ACh and NE on granule cell physiology are distinct and functionally complementary to one another. ACh strongly regulates granule cell firing rates and afterpotentials, whereas NE bidirectionally regulates subthreshold membrane potentials. When combined, NE can regulate the ACh-induced expression of afterdepolarizing potentials and persistent firing. In a microcircuit simulation developed to investigate the effects of granule cell neuromodulation on mitral cell firing properties, ACh increased spike synchronization among mitral cells, whereas NE modulated the signal-to-noise ratio. Coapplication of ACh and NE both functionally improved the signal-to-noise ratio and enhanced spike synchronization among mitral cells. In summary, our computational results support distinct and complementary roles for ACh and NE in modulating olfactory bulb circuitry and suggest that NE may play a role in the regulation of cholinergic function.

  6. Functional differentiation of cholinergic and noradrenergic modulation in a biophysical model of olfactory bulb granule cells (United States)

    Linster, Christiane


    Olfactory bulb granule cells are modulated by both acetylcholine (ACh) and norepinephrine (NE), but the effects of these neuromodulators have not been clearly distinguished. We used detailed biophysical simulations of granule cells, both alone and embedded in a microcircuit with mitral cells, to measure and distinguish the effects of ACh and NE on cellular and microcircuit function. Cholinergic and noradrenergic modulatory effects on granule cells were based on data obtained from slice experiments; specifically, ACh reduced the conductance densities of the potassium M current and the calcium-dependent potassium current, whereas NE nonmonotonically regulated the conductance density of an ohmic potassium current. We report that the effects of ACh and NE on granule cell physiology are distinct and functionally complementary to one another. ACh strongly regulates granule cell firing rates and afterpotentials, whereas NE bidirectionally regulates subthreshold membrane potentials. When combined, NE can regulate the ACh-induced expression of afterdepolarizing potentials and persistent firing. In a microcircuit simulation developed to investigate the effects of granule cell neuromodulation on mitral cell firing properties, ACh increased spike synchronization among mitral cells, whereas NE modulated the signal-to-noise ratio. Coapplication of ACh and NE both functionally improved the signal-to-noise ratio and enhanced spike synchronization among mitral cells. In summary, our computational results support distinct and complementary roles for ACh and NE in modulating olfactory bulb circuitry and suggest that NE may play a role in the regulation of cholinergic function. PMID:26334007

  7. Biophysically inspired rational design of structured chimeric substrates for DNAzyme cascade engineering.

    Directory of Open Access Journals (Sweden)

    Matthew R Lakin

    Full Text Available The development of large-scale molecular computational networks is a promising approach to implementing logical decision making at the nanoscale, analogous to cellular signaling and regulatory cascades. DNA strands with catalytic activity (DNAzymes are one means of systematically constructing molecular computation networks with inherent signal amplification. Linking multiple DNAzymes into a computational circuit requires the design of substrate molecules that allow a signal to be passed from one DNAzyme to another through programmed biochemical interactions. In this paper, we chronicle an iterative design process guided by biophysical and kinetic constraints on the desired reaction pathways and use the resulting substrate design to implement heterogeneous DNAzyme signaling cascades. A key aspect of our design process is the use of secondary structure in the substrate molecule to sequester a downstream effector sequence prior to cleavage by an upstream DNAzyme. Our goal was to develop a concrete substrate molecule design to achieve efficient signal propagation with maximal activation and minimal leakage. We have previously employed the resulting design to develop high-performance DNAzyme-based signaling systems with applications in pathogen detection and autonomous theranostics.

  8. Wartime spine injuries: understanding the improvised explosive device and biophysics of blast trauma. (United States)

    Kang, Daniel G; Lehman, Ronald A; Carragee, Eugene J


    The improvised explosive device (IED) has been the most significant threat by terrorists worldwide. Blast trauma has produced a wide pattern of combat spinal column injuries not commonly experienced in the civilian community. Unfortunately, explosion-related injuries have also become a widespread reality of civilian life throughout the world, and civilian medical providers who are involved in emergency trauma care must be prepared to manage casualties from terrorist attacks using high-energy explosive devices. Treatment decisions for complex spine injuries after blast trauma require special planning, taking into consideration many different factors and the complicated multiple organ system injuries not normally experienced at most civilian trauma centers. Therefore, an understanding about the effects of blast trauma by spine surgeons in the community has become imperative, as the battlefield has been brought closer to home in many countries through domestic terrorism and mass casualty situations, with the lines blurred between military and civilian trauma. We set out to provide the spine surgeon with a brief overview on the use of IEDs for terrorism and the current conflicts in Iraq and Afghanistan and also a perspective on the biophysics of blast trauma.

  9. Improving the biophysical properties of anti-ricin single-domain antibodies

    Directory of Open Access Journals (Sweden)

    Kendrick B. Turner


    Full Text Available Single-domain antibodies (sdAbs derived from heavy-chain only antibodies produced in camelids are attractive immunoreagents due to their small size, high affinity, and ability to refold and retain binding activity after denaturation. It has been observed that some sdAbs, however, exhibit undesirable properties including reduced solubility when subjected to heating or upon long-term storage at production-relevant concentrations, which can limit their usefulness. Using a multi-step, rational design approach that included consensus-sequence driven sequence repairs, the alteration of net protein charge, and the introduction of non-native disulfide bonds, augmented solubility and increased melting temperatures were achieved. The improved sdAbs tolerated storage in solution at high concentration (10 mg/mL and were able to withstand multiple cycles of heating to high temperature (70 °C. This work demonstrates a pathway for improving the biophysical characteristics of sdAbs which is essential for expanding their utility for both diagnostic as well as therapeutic applications.

  10. Effects of graphene oxide nanosheets on the ultrastructure and biophysical properties of the pulmonary surfactant film. (United States)

    Hu, Qinglin; Jiao, Bao; Shi, Xinghua; Valle, Russell P; Zuo, Yi Y; Hu, Guoqing


    Graphene oxide (GO) is the most common derivative of graphene and has been used in a large range of biomedical applications. Despite considerable progress in understanding its cytotoxicity, its potential inhalation toxicity is still largely unknown. As the pulmonary surfactant (PS) film is the first line of host defense, interaction with the PS film determines the fate of the inhaled nanomaterials and their potential toxicity. Using a coarse-grained molecular dynamics model, we reported, for the first time, a novel mechanism of toxicity caused by the inhaled GO nanosheets. Upon deposition, the GO nanosheets induce pores in the PS film and thus have adverse effects on the ultrastructure and biophysical properties of the PS film. Notably, the pores induced by GO nanosheets result in increasing the compressibility of the PS film, which is an important indication of surfactant inhibition. In vitro experiments have also been conducted to study the interactions between GO and animal-derived natural PS films, qualitatively confirming the simulation results.

  11. Biophysical activity of animal-derived exogenous surfactants mixed with rifampicin. (United States)

    Kolomaznik, M; Calkovska, A; Herting, E; Stichtenoth, G


    Exogenous pulmonary surfactant is a potential delivery system for topical medications via the conducting airways. Due to the sensitivity to inactivation of surfactant, mutual interaction with the shipped drug should be evaluated. Little is known about the interactions between surfactant and antimicrobial drugs. The aim of the present study was to evaluate whether biophysical properties of animal-derived surfactants are modified by the bactericidal antibiotic rifampicin. An intracellular activity and a broad antimicrobiotic spectrum toward Gram-negative and Gram-positive bacteria make rifampicin an interesting substance against pulmonary infections. Curosurf® (porcine surfactant from minced lungs) and Survanta® (bovine surfactant extract) were diluted to 2.5-5.0 mg/ml of phospholipids in 0.9 % NaCl and rifampicin (RIF) was added at 1, 5, and 10 % (w/w). Minimum (γ(min)) and maximum (γ(max)) surface tension of a cyclically compressed bubble in the mixture was assessed with a pulsating bubble surfactometer. After 5 min, γ(min) of Survanta at a concentration of 3 mg/ml was significantly increased after addition of 5 and 10 % RIF (both p surfactant is able to retain good surface activity when mixed with antibiotics.

  12. The conformational stability and biophysical properties of the eukaryotic thioredoxins of Pisum sativum are not family-conserved.

    Directory of Open Access Journals (Sweden)

    David Aguado-Llera

    Full Text Available Thioredoxins (TRXs are ubiquitous proteins involved in redox processes. About forty genes encode TRX or TRX-related proteins in plants, grouped in different families according to their subcellular localization. For instance, the h-type TRXs are located in cytoplasm or mitochondria, whereas f-type TRXs have a plastidial origin, although both types of proteins have an eukaryotic origin as opposed to other TRXs. Herein, we study the conformational and the biophysical features of TRXh1, TRXh2 and TRXf from Pisum sativum. The modelled structures of the three proteins show the well-known TRX fold. While sharing similar pH-denaturations features, the chemical and thermal stabilities are different, being PsTRXh1 (Pisum sativum thioredoxin h1 the most stable isoform; moreover, the three proteins follow a three-state denaturation model, during the chemical-denaturations. These differences in the thermal- and chemical-denaturations result from changes, in a broad sense, of the several ASAs (accessible surface areas of the proteins. Thus, although a strong relationship can be found between the primary amino acid sequence and the structure among TRXs, that between the residue sequence and the conformational stability and biophysical properties is not. We discuss how these differences in the biophysical properties of TRXs determine their unique functions in pea, and we show how residues involved in the biophysical features described (pH-titrations, dimerizations and chemical-denaturations belong to regions involved in interaction with other proteins. Our results suggest that the sequence demands of protein-protein function are relatively rigid, with different protein-binding pockets (some in common for each of the three proteins, but the demands of structure and conformational stability per se (as long as there is a maintained core, are less so.

  13. Obtaining biophysical measurements of woody vegetation from high resolution digital aerial photography in tropical and arid environments: Northern Territory, Australia (United States)

    Staben, G. W.; Lucieer, A.; Evans, K. G.; Scarth, P.; Cook, G. D.


    Biophysical parameters obtained from woody vegetation are commonly measured using field based techniques which require significant investment in resources. Quantitative measurements of woody vegetation provide important information for ecological studies investigating landscape change. The fine spatial resolution of aerial photography enables identification of features such as trees and shrubs. Improvements in spatial and spectral resolution of digital aerial photographic sensors have increased the possibility of using these data in quantitative remote sensing. Obtaining biophysical measurements from aerial photography has the potential to enable it to be used as a surrogate for the collection of field data. In this study quantitative measurements obtained from digital aerial photography captured at ground sampling distance (GSD) of 15 cm (n = 50) and 30 cm (n = 52) were compared to woody biophysical parameters measured from 1 ha field plots. Supervised classification of the aerial photography using object based image analysis was used to quantify woody and non-woody vegetation components in the imagery. There was a high correlation (r ≥ 0.92) between all field measured woody canopy parameters and aerial derived green woody cover measurements, however only foliage projective cover (FPC) was found to be statistically significant (paired t-test; α = 0.01). There was no significant difference between measurements derived from imagery captured at either GSD of 15 cm and 30 cm over the same field site (n = 20). Live stand basal area (SBA) (m2 ha-1) was predicted from the aerial photographs by applying an allometric equation developed between field-measured live SBA and woody FPC. The results show that there was very little difference between live SBA predicted from FPC measured in the field or from aerial photography. The results of this study show that accurate woody biophysical parameters can be obtained from aerial photography from a range of woody vegetation

  14. Structural and Biophysical Analysis of BST-2/Tetherin Ectodomains Reveals an Evolutionary Conserved Design to Inhibit Virus Release


    Swiecki, Melissa; Scheaffer, Suzanne M.; Allaire, Marc; Daved H Fremont; Colonna, Marco; Brett, Tom J.


    BST-2/tetherin is a host antiviral molecule that functions to potently inhibit the release of enveloped viruses from infected cells. In return, viruses have evolved antagonists to this activity. BST-2 traps budding virions by using two separate membrane-anchoring regions that simultaneously incorporate into the host and viral membranes. Here, we detailed the structural and biophysical properties of the full-length BST-2 ectodomain, which spans the two membrane anchors. The 1.6-Å crystal struc...

  15. Effects of nonionic surfactant lauryl alcohol ethoxylated on stratum corneum alternative model biomembranes evaluated by biophysical techniques


    Baby, André R.; Lacerda, Áurea C. L.; Prestes, Paula S.; Velasco, María Valéria R.; Kawano, Yoshio; Kaneko,Telma Mary


    The influence of the nonionic surfactant lauryl alcohol ethoxylate with 12 moles ethylene oxide (LAE-12OE) was evaluated on the Stratum corneum model biomembrane (SCMM) of shed snake skin (Bothrops jararaca and Spilotes pullatus) through the biophysical techniques Fourier transform Raman spectroscopy (FT-Raman) and Fourier transform infrared photoacoustic spectroscopy (PAS-FTIR). The surfactant was used in aqueous solutions above and below the critical micelle concentration (cmc), 50.0 and 0....

  16. Effect of GnRH antagonist on follicular development and uterine biophysical profile in controlled ovarian stimulation

    Directory of Open Access Journals (Sweden)

    Bhawana Tiwary


    Full Text Available Background: Objective of current study was to assess the effect of GnRH antagonist on follicular development, premature luteinization, uterine biophysical profile and pregnancy rate in controlled ovarian stimulation with clomiphene and gonadotropins for intrauterine insemination in women with unexplained infertility. Methods: Randomised controlled trial. Minimal stimulation protocol with or without GnRH antagonist was compared. Setting: Infertility clinic, PGIMER, Chandigarh. Patients: Couples with unexplained infertility, age of female partner between 20-39 years. Intervention: GnRH antagonist 0.25 mg since follicle size 14 mm till hCG administration. Main outcome measures: Follicle characteristics, premature luteinisation, uterine biophysical profile and pregnancy rate. Results: The mean number of follicles recruited in group A was 2.32 +/- 1.01 while that in group B (receiving GnRH antagonist it was 4.10 +/- 1.69. Statistically significant increase in total biophysical profile score was observed in periovulatory phase in the antagonist group. 40% women in group A had premature luteinization whereas only 4% women in group B suffered from premature luteinization. 20% women who received GnRH antagonist conceived against only 6% in group A, this difference however was not statistically significant Conclusions: GnRH antagonist has a role in increasing the number of follicles recruited. Furthermore, GnRH antagonist can improve the total uterine biophysical profile score by improving the endometrial thickness, endometrial pattern, blood flow and decreasing the impedance to the blood flow in uterine artery. The drug can potentially help in improving pregnancy rates by decreasing the rate of premature luteinisation. [Int J Reprod Contracept Obstet Gynecol 2015; 4(1.000: 157-163

  17. Evaluation of UV radiation-induced toxicity and biophysical changes in various skin cells with photo-shielding molecules. (United States)

    Bennet, Devasier; Kim, Sanghyo


    Ultraviolet radiation (UVR) triggers many complex events in different types of skin cells, including benign, malignant and normal cells. Chromophores present in these cells play a crucial role in various cellular processes. Unprecedented methods are required for the real-time monitoring of changes in an in vitro model exposed to intermittent mild and intense UVR to determine the mechanisms underlying cell degeneration and the effects of unexpected toxic, agonist and antagonist agents. This study reports the analytical application of a whole cell-based sensor platform for examining the biophysical effects of UVR. We used human keratinocyte, melanocyte and fibroblast cell lines to determine the normal, pathological and protective roles of UVR. In addition, we examined the real-time morphological, biophysical and biomechanical changes associated with cell degeneration induced by UVR at 254 and 365 nm. Information on UVR-induced changes in the cytoskeleton ultrastructure, cellular integrity, cell spreading area, actin microfilament distribution inflammation, microtubule damage, membrane damage, rupture and death was characterized by examining the loss or increase in biophysical and biomechanical properties of these cells. All cells exposed to UVR at 254 and 365 nm showed a significant increase in surface roughness and stiffness in a time-dependent manner. UVR-induced toxicity in differently pigmented skin cells was compared with that in cells pretreated with melanin, keratin and basic fibroblast growth factor to analyze the shielding efficiency of these agents. Melanin exerted a significant shielding effect compared to the other two agents. The biophysical and biomechanical information obtained in this study could advance our understanding of the UVR-induced degeneration process, and help in developing new interventions strategies.

  18. Structure and Biophysical Properties of a Triple-Stranded Beta-Helix Comprising the Central Spike of Bacteriophage T4. (United States)

    Buth, Sergey A; Menin, Laure; Shneider, Mikhail M; Engel, Jürgen; Boudko, Sergei P; Leiman, Petr G


    Gene product 5 (gp5) of bacteriophage T4 is a spike-shaped protein that functions to disrupt the membrane of the target cell during phage infection. Its C-terminal domain is a long and slender β-helix that is formed by three polypeptide chains wrapped around a common symmetry axis akin to three interdigitated corkscrews. The folding and biophysical properties of such triple-stranded β-helices, which are topologically related to amyloid fibers, represent an unsolved biophysical problem. Here, we report structural and biophysical characterization of T4 gp5 β-helix and its truncated mutants of different lengths. A soluble fragment that forms a dimer of trimers and that could comprise a minimal self-folding unit has been identified. Surprisingly, the hydrophobic core of the β-helix is small. It is located near the C-terminal end of the β-helix and contains a centrally positioned and hydrated magnesium ion. A large part of the β-helix interior comprises a large elongated cavity that binds palmitic, stearic, and oleic acids in an extended conformation suggesting that these molecules might participate in the folding of the complete β-helix.

  19. Some behavioral aspects of energy descent: How a biophysical psychology might help people transition through the lean times ahead

    Directory of Open Access Journals (Sweden)

    Raymond eDe Young


    Full Text Available We may soon face biophysical limits to perpetual growth. Energy supplies may tighten and then begin a long slow descent while defensive expenditures rise to address problems caused by past resource consumption. The outcome may be significant changes in daily routines at the individual and community level. It is difficult to know when this scenario might begin to unfold but it clearly would constitute a new behavioral context, one that the behavioral sciences least attends to. Even if one posits a less dramatic scenario, people may still need to make many urgent and perhaps unsettling transitions. And while a robust response would be needed, it is not at all clear what should be the details of that response. Since it is likely that no single response will fix things everywhere, for all people or for all time it would be useful to conduct many social experiments. Indeed, a culture of small experiments should be fostered which, at the individual and small group level, can be described as behavioral entrepreneurship. This may have begun, hidden in plain sight, but more social experiments are needed. To be of help, it may be useful to both package behavioral insights in a way that is practitioner-oriented and grounded in biophysical trends and to propose a few key questions that need attention. This paper begins the process of developing a biophysical psychology, incomplete as it is at this early stage.

  20. Structure and Biophysical Properties of a Triple-Stranded Beta-Helix Comprising the Central Spike of Bacteriophage T4

    Directory of Open Access Journals (Sweden)

    Sergey A. Buth


    Full Text Available Gene product 5 (gp5 of bacteriophage T4 is a spike-shaped protein that functions to disrupt the membrane of the target cell during phage infection. Its C-terminal domain is a long and slender β-helix that is formed by three polypeptide chains wrapped around a common symmetry axis akin to three interdigitated corkscrews. The folding and biophysical properties of such triple-stranded β-helices, which are topologically related to amyloid fibers, represent an unsolved biophysical problem. Here, we report structural and biophysical characterization of T4 gp5 β-helix and its truncated mutants of different lengths. A soluble fragment that forms a dimer of trimers and that could comprise a minimal self-folding unit has been identified. Surprisingly, the hydrophobic core of the β-helix is small. It is located near the C-terminal end of the β-helix and contains a centrally positioned and hydrated magnesium ion. A large part of the β-helix interior comprises a large elongated cavity that binds palmitic, stearic, and oleic acids in an extended conformation suggesting that these molecules might participate in the folding of the complete β-helix.

  1. Some behavioral aspects of energy descent: how a biophysical psychology might help people transition through the lean times ahead. (United States)

    De Young, Raymond


    We may soon face biophysical limits to perpetual growth. Energy supplies may tighten and then begin a long slow descent while defensive expenditures rise to address problems caused by past resource consumption. The outcome may be significant changes in daily routines at the individual and community level. It is difficult to know when this scenario might begin to unfold but it clearly would constitute a new behavioral context, one that the behavioral sciences least attends to. Even if one posits a less dramatic scenario, people may still need to make many urgent and perhaps unsettling transitions. And while a robust response would be needed, it is not at all clear what should be the details of that response. Since it is likely that no single response will fix things everywhere, for all people or for all time, it would be useful to conduct many social experiments. Indeed, a culture of small experiments should be fostered which, at the individual and small group level, can be described as behavioral entrepreneurship. This may have begun, hidden in plain sight, but more social experiments are needed. To be of help, it may be useful to both package behavioral insights in a way that is practitioner-oriented and grounded in biophysical trends and to propose a few key questions that need attention. This paper begins the process of developing a biophysical psychology, incomplete as it is at this early stage.

  2. Planning for sustainable tourism in southern Pulau Banggi: an assessment of biophysical conditions and their implications for future tourism development. (United States)

    Teh, Lydia; Cabanban, Annadel S


    A priori assessments of a site's biophysical and socio-economic capacity for accommodating tourism are less common than tourism impact studies. A priori evaluations can provide a contextual understanding of ecological, economic and socio-cultural forces, which shape the prospects for sustainable tourism development at the host destination, and can avert adverse impacts of tourism. We conduct an a priori assessment of the biophysical environment of Pulau Banggi, in the Malaysian state of Sabah for sustainable tourism development. We characterise baseline conditions of the island's marine biodiversity, seasonality, and infrastructure. We then evaluate how existing biophysical conditions will influence options for sustainable tourism development. In particular, we suggest conditions, if there are any, which constitute a limit to future tourism development in terms of compatibility for recreation and resilience to visitor impacts. We find that the biggest constraint is the lack of adequate water and sanitation infrastructure. Blast fishing, although occurring less than once per hour, can potentially destroy the major attraction for tourists. We conclude that while Pulau Banggi possesses natural qualities that are attractive for ecotourism, financial and institutional support must be made available to provide facilities and services that will enable local participation in environmental protection and enhance prospects for future sustainable tourism.

  3. Unveiling soil degradation and desertification risk in the Mediterranean basin: a data mining analysis of the relationships between biophysical and socioeconomic factors in agro-forest landscapes

    NARCIS (Netherlands)

    Salvati, L.; Kosmas, C.; Kairis, O.; Karavitis, C.; Hessel, R.; Ritsema, C.J.


    Soil degradation and desertification processes in the Mediterranean basin reflect the interplay between environmental and socioeconomic drivers. An approach to evaluate comparatively the multiple relationships between biophysical variables and socioeconomic factors is illustrated in the present stud

  4. Comparison of Biophysical Characteristics and Predicted Thermophysiological Responses of Three Prototype Body Armor Systems Versus Baseline U.S. Army Body Armor Systems (United States)


    4302. Respondents should be aware that notwithstanding any other provision of law , no person shall be subject to any penalty for failing to comply...Biophysical Assessments Biophysical testing was conducted using a twenty zone sweating thermal manikin ( Newton , 20 zone, Measurement...Mitchell KB. Range of Motion and Reaches of Warfighters in Body Armor. In: Proceedings of the Human Factors and Ergonomics Society Annual Meeting (Vol

  5. Suitability analysis of coral reef area of Samalona Island (Makassar City) for snorkeling and diving based on bio-physical parameters


    Bahar, Ahmad


    The objective of this study was to know suitability of coral reef area of Samalaona Island (Makassar City) for snorkeling and diving based on bio-physical parameters. Sampling was conducted from February to May 2006 at four stations to collect bio-physical data including salinity, temperature, water transparency, water depth, current velocity, wave height, tidal range, bed topography, substrate type, and number of bacteria Eschericia coli in the water. The results showed that in general, c...

  6. Modern Aspects of Halophilism: The Edmond de Rothschild School in Molecular Biophysics (12th) Held in Israel on March 26-April 5, 1989. Program and Abstracts (United States)



  7. Use of passive UAS imaging to measure biophysical parameters in a southern Rocky Mountain subalpine forest (United States)

    Caldwell, M. K.; Sloan, J.; Mladinich, C. S.; Wessman, C. A.


    Unmanned Aerial Systems (UAS) can provide detailed, fine spatial resolution imagery for ecological uses not otherwise obtainable through standard methods. The use of UAS imagery for ecology is a rapidly -evolving field, where the study of forest landscape ecology can be augmented using UAS imagery to scale and validate biophysical data from field measurements to spaceborne observations. High resolution imagery provided by UAS (30 cm2 pixels) offers detailed canopy cover and forest structure data in a time efficient and inexpensive manner. Using a GoPro Hero2 (2 mm focal length) camera mounted in the nose cone of a Raven unmanned system, we collected aerial and thermal data monthly during the summer 2013, over two subalpine forests in the Southern Rocky Mountains in Colorado. These forests are dominated by lodgepole pine (Pinus ponderosae) and have experienced insect-driven (primarily mountain pine beetle; MPB, Dendroctonus ponderosae) mortality. Objectives of this study include observations of forest health variables such as canopy water content (CWC) from thermal imagery and leaf area index (LAI), biomass and forest productivity from the Normalized Difference Vegetation Index (NDVI) from UAS imagery. Observations were, validated with ground measurements. Images were processed using a combination of AgiSoft Photoscan professional software and ENVI remote imaging software. We utilized the software Leaf Area Index Calculator (LAIC) developed by Córcoles et al. (2013) for calculating LAI from digital images and modified to conform to leaf area of needle-leaf trees as in Chen and Cihlar (1996) . LAIC uses a K-means cluster analysis to decipher the RGB levels for each pixel and distinguish between green aboveground vegetation and other materials, and project leaf area per unit of ground surface area (i.e. half total needle surface area per unit area). Preliminary LAIC UAS data shows summer average LAI was 3.8 in the most dense forest stands and 2.95 in less dense

  8. Land Surface Biophysical-Climate Impacts of Tropical Deforestation with Time-dependence: Sensitivity to Deforestation Rates (United States)

    Castillo, C. G.; Gurney, K. R.


    Deforestation perturbs both biophysical and carbon feedbacks on climate. However, biophysical feedbacks operate at more temporally-immediate and spatially-focused scales, and thus may be sensitive to the actual rate at which deforestation occurs rather than just to the total forest cover loss. Most of previous modeling experiments have focused on equilibrium impacts of mass instantaneous replacement of trees; but, anthropogenic deforestation evolves in time and may result in transient climatic changes which holistic assessments of land cover change impacts must be able to characterize for mitigation and adaptation initiatives to be effective. This exploratory work therefore attempts to determine if there exists a time-dependence within biophysical-climate impacts of deforestation; specifically, if indeed the rates of deforestation affect terrestrial biophysics-climate feedbacks during the period of active deforestation as well as the post-deforestation period. Described here is a method for simulating annual tropical deforestation in the fully-coupled Community Climate System Model 3.0 (CCSM3) with the Dynamic Global Vegetation Model (DGVM) for testing biosphere-climate sensitivity to “preservation pathways.” We test two deforestation curves- one with a 10% annual tree population thinning (DFC10-PT10), and one with 1% (DFC1-PT10) - each with a preservation target of 10% tree cover. During the period of active deforestation, surface albedo, net radiation, latent heat flux and climate variables are compared for time-dependence and sensitivity to total tropical tree foliar projective cover across the tropical band, the Amazon Basin, Central Africa and Southeast Asia. The deforestation rates produce characteristic trends in biophysical variables with DFC10-PT10 resulting in rapid increase/decrease during the initial 10-30 years before a slow leveling off, while DFC1-PT10 exhibits more gradual changes. The deforestation rate is also found to have little effect on

  9. Theoretical Insights into the Biophysics of Protein Bi-stability and Evolutionary Switches.

    Directory of Open Access Journals (Sweden)

    Tobias Sikosek


    Full Text Available Deciphering the effects of nonsynonymous mutations on protein structure is central to many areas of biomedical research and is of fundamental importance to the study of molecular evolution. Much of the investigation of protein evolution has focused on mutations that leave a protein's folded structure essentially unchanged. However, to evolve novel folds of proteins, mutations that lead to large conformational modifications have to be involved. Unraveling the basic biophysics of such mutations is a challenge to theory, especially when only one or two amino acid substitutions cause a large-scale conformational switch. Among the few such mutational switches identified experimentally, the one between the GA all-α and GB α+β folds is extensively characterized; but all-atom simulations using fully transferrable potentials have not been able to account for this striking switching behavior. Here we introduce an explicit-chain model that combines structure-based native biases for multiple alternative structures with a general physical atomic force field, and apply this construct to twelve mutants spanning the sequence variation between GA and GB. In agreement with experiment, we observe conformational switching from GA to GB upon a single L45Y substitution in the GA98 mutant. In line with the latent evolutionary potential concept, our model shows a gradual sequence-dependent change in fold preference in the mutants before this switch. Our analysis also indicates that a sharp GA/GB switch may arise from the orientation dependence of aromatic π-interactions. These findings provide physical insights toward rationalizing, predicting and designing evolutionary conformational switches.

  10. Photo- and biophysical studies of lectin-conjugated fluorescent nanoparticles: reduced sensitivity in high density assays. (United States)

    Wang, Yaqi; Gildersleeve, Jeffrey C; Basu, Amit; Zimmt, Matthew B


    Lectin-conjugated, fluorescent silica nanoparticles (fNP) have been developed for carbohydrate-based histopathology evaluations of epithelial tissue biopsies. The fNP platform was selected for its enhanced emissive brightness compared to direct dye labeling. Carbohydrate microarray studies were performed to compare the carbohydrate selectivity of the mannose-recognizing lectin Concanavalin A (ConA) before and after conjugation to fluorescent silica nanoparticles (ConA-fNP). These studies revealed surprisingly low emission intensities upon staining with ConA-fNP compared to those with biotin-ConA/Cy3-streptavidin staining. A series of photophysical and biophysical characterizations of the fNP and ConA-fNP conjugates were performed to probe the low sensitivity from fNP in the microarray assays. Up to 1200 fluorescein (FL) and 80 tetramethylrhodamine (TR) dye molecules were incorporated into 46 nm diameter fNP, yielding emissive brightness values 400 and 35 times larger than the individual dye molecules, respectively. ConA lectin conjugated to carboxylic acid surface-modified nanoparticles covers 15-30% of the fNP surface. The CD spectra and mannose substrate selectivity of ConA conjugated to the fNP differed slightly compared to that of soluble ConA. Although, the high emissive brightness of fNP enhances detection sensitivity for samples with low analyte densities, large fNP diameters limit fNP recruitment and binding to samples with high analyte densities. The high analyte density and nearly two-dimensional target format of carbohydrate microarrays make probe size a critical parameter. In this application, fNP labels afford minimal sensitivity advantage compared to direct dye labeling.

  11. Modeling the effects of noninvasive transcranial brain stimulation at the biophysical, network, and cognitive level. (United States)

    Hartwigsen, Gesa; Bergmann, Til Ole; Herz, Damian Marc; Angstmann, Steffen; Karabanov, Anke; Raffin, Estelle; Thielscher, Axel; Siebner, Hartwig Roman


    Noninvasive transcranial brain stimulation (NTBS) is widely used to elucidate the contribution of different brain regions to various cognitive functions. Here we present three modeling approaches that are informed by functional or structural brain mapping or behavior profiling and discuss how these approaches advance the scientific potential of NTBS as an interventional tool in cognitive neuroscience. (i) Leveraging the anatomical information provided by structural imaging, the electric field distribution in the brain can be modeled and simulated. Biophysical modeling approaches generate testable predictions regarding the impact of interindividual variations in cortical anatomy on the injected electric fields or the influence of the orientation of current flow on the physiological stimulation effects. (ii) Functional brain mapping of the spatiotemporal neural dynamics during cognitive tasks can be used to construct causal network models. These models can identify spatiotemporal changes in effective connectivity during distinct cognitive states and allow for examining how effective connectivity is shaped by NTBS. (iii) Modeling the NTBS effects based on neuroimaging can be complemented by behavior-based cognitive models that exploit variations in task performance. For instance, NTBS-induced changes in response speed and accuracy can be explicitly modeled in a cognitive framework accounting for the speed-accuracy trade-off. This enables to dissociate between behavioral NTBS effects that emerge in the context of rapid automatic responses or in the context of slow deliberate responses. We argue that these complementary modeling approaches facilitate the use of NTBS as a means of dissecting the causal architecture of cognitive systems of the human brain.

  12. Biophysical Characterization and Activity of Lymphostatin, a Multifunctional Virulence Factor of Attaching and Effacing Escherichia coli. (United States)

    Cassady-Cain, Robin L; Blackburn, Elizabeth A; Alsarraf, Husam; Dedic, Emil; Bease, Andrew G; Böttcher, Bettina; Jørgensen, René; Wear, Martin; Stevens, Mark P


    Attaching and effacing Escherichia coli cause diarrhea and typically produce lymphostatin (LifA), an inhibitor of mitogen-activated proliferation of lymphocytes and pro-inflammatory cytokine synthesis. A near-identical factor (Efa1) has been reported to mediate adherence of E. coli to epithelial cells. An amino-terminal region of LifA shares homology with the catalytic domain of the large clostridial toxins, which are retaining glycosyltransferases with a DXD motif involved in binding of a metal ion. Understanding the mode(s) of action of lymphostatin has been constrained by difficulties obtaining a stably transformed plasmid expression clone. We constructed a tightly inducible clone of enteropathogenic E. coli O127:H6 lifA for affinity purification of lymphostatin. The purified protein inhibited mitogen-activated proliferation of bovine T lymphocytes in the femtomolar range. It is a monomer in solution and the molecular envelope was determined using both transmission electron microscopy and small-angle x-ray scattering. Domain architecture was further studied by limited proteolysis. The largest proteolytic fragment containing the putative glycosyltransferase domain was tested in isolation for activity against T cells, and was not sufficient for activity. Tryptophan fluorescence studies indicated thatlymphostatin binds uridine diphosphate-N-acetylglucosamine (UDP-GlcNAc) but not UDP-glucose (UDP-Glc). Substitution of the predicted DXD glycosyltransferase motif with alanine residues abolished UDP-GlcNAc binding and lymphostatin activity, although other biophysical properties were unchanged. The data indicate that lymphostatin has UDP-sugar binding potential that is critical for activity, and is a major leap toward identifying the nature and consequences of modifications of host cell factors.

  13. Thermal Imaging of Forest Canopy Temperatures: Relationships with Biological and Biophysical Drivers and Ecosystem Fluxes (United States)

    Still, C. J.; Kim, Y.; Hanson, C. V.; Law, B. E.; Kwon, H.; Schulze, M.; Pau, S.; Detto, M.


    Temperature is a primary environmental control on plant processes at a range of spatial and temporal scales, affecting enzymatic reactions, ecosystem biogeochemistry, and species distributions. Although most focus is on air temperature, the radiative or skin temperature of plants is more relevant. Canopy skin temperature dynamics reflect biophysical, physiological, and anatomical characteristics and interactions with environmental drivers, and can be used to examine forest responses to stresses like droughts and heat waves. Direct measurements of plant canopy temperatures using thermocouple sensors have been challenging and offer limited information. Such measurements are usually conducted over short periods of time and a limited spatial extent of the canopy. By contrast, thermal infrared (TIR) imaging allows for extensive temporal and spatial measurement of canopy temperature regimes. We present results of TIR imaging of forest canopies at a range of well-studied forest sites in the United States and Panama. These forest types include temperate rainforests, a semi­arid pine forest, and a semi­deciduous tropical forest. Canopy temperature regimes at these sites are highly variable spatially and temporally and display frequent departures from air temperature, particularly during clear sky conditions. Canopy tissue temperatures are often warmer (daytime) and colder (nighttime) than air temperature, and canopy structure seems to have a large influence on the thermal regime. Additionally, comparison of canopy temperatures to eddy covariance fluxes of carbon dioxide, water vapor, and energy reveals relationships not apparent using air temperature. Initial comparisons between our forest canopy temperatures and remotely sensed skin temperature using Landsat and MODIS data show reasonably good agreement. We conclude that temporal and spatial changes in canopy temperature and its relationship to biological and environmental factors can improve our understanding of how

  14. Cystic fibrosis transmembrane conductance regulator chloride channel blockers: Pharmacological, biophysical and physiological relevance

    Institute of Scientific and Technical Information of China (English)

    Paul; Linsdell


    Dysfunction of the cystic fibrosis transmembrane con-ductance regulator(CFTR) chloride channel causes cys-tic fibrosis, while inappropriate activity of this channeloccurs in secretory diarrhea and polycystic kidney dis-ease. Drugs that interact directly with CFTR are there-fore of interest in the treatment of a number of diseasestates. This review focuses on one class of small mol-ecules that interacts directly with CFTR, namely inhibi-tors that act by directly blocking chloride movementthrough the open channel pore. In theory such com-pounds could be of use in the treatment of diarrheaand polycystic kidney disease, however in practice allknown substances acting by this mechanism to inhibitCFTR function lack either the potency or specificity forin vivo use. Nevertheless, this theoretical pharmaco-logical usefulness set the scene for the developmentof more potent, specific CFTR inhibitors. Biophysically,open channel blockers have proven most useful as ex-perimental probes of the structure and function of theCFTR chloride channel pore. Most importantly, the useof these blockers has been fundamental in developing afunctional model of the pore that includes a wide innervestibule that uses positively charged amino acid sidechains to attract both permeant and blocking anionsfrom the cell cytoplasm. CFTR channels are also subjectto this kind of blocking action by endogenous anionspresent in the cell cytoplasm, and recently this blocking effect has been suggested to play a role in the physio-logical control of CFTR channel function, in particular as a novel mechanism linking CFTR function dynamically to the composition of epithelial cell secretions. It has also been suggested that future drugs could target this same pathway as a way of pharmacologically increasing CFTR activity in cystic fibrosis. Studying open channel blockers and their mechanisms of action has resulted in significant advances in our understanding of CFTR as a pharmacological target in disease states, of

  15. Fundamental analysis of recombinant human epidermal growth factor in solution with biophysical methods. (United States)

    Kim, Nam Ah; Lim, Dae Gon; Lim, Jun Yeul; Kim, Ki Hyun; Jeong, Seong Hoon


    Correlation of thermodynamic and secondary structural stability of proteins at various buffer pHs was investigated using differential scanning calorimetry (DSC), dynamic light scattering (DLS) and attenuated total reflection Fourier-transform infrared spectroscopy (ATR FT-IR). Recombinant human epithelial growth factor (rhEGF) was selected as a model protein at various pHs and in different buffers, including phosphate, histidine, citrate, HEPES and Tris. Particle size and zeta potential of rhEGF at each selected pH of buffer were observed by DLS. Four factors were used to characterize the biophysical stability of rhEGF in solution: temperature at maximum heat flux (Tm), intermolecular β-sheet contents, zeta size and zeta potential. It was possible to predict the apparent isoelectric point (pI) of rhEGF as 4.43 by plotting pH against zeta potential. When the pH of the rhEGF solution increased or decreased from pI, the absolute zeta potential increased indicating a reduced possibility of protein aggregation, since Tm increased and β-sheet contents decreased. The contents of induced intermolecular β-sheet in Tris and HEPES buffers were the lowest. Thermodynamic stability of rhEGF markedly increased when pH is higher than 6.2 in histidine buffer where Tm of first transition was all above 70 °C. Moreover, rhEGF in Tris buffer was more thermodynamically stable than in HEPES with higher zeta potential. Tris buffer at pH 7.2 was concluded to be the most favorable.

  16. Biophysical processes leading to the ingress of temperate fish larvae into estuarine nursery areas: A review (United States)

    Teodósio, Maria Alexandra; Paris, Claire B.; Wolanski, Eric; Morais, Pedro


    A series of complementary hypotheses have been proposed to explain the recruitment of marine and temperate pelagic fish larvae originated from pelagic eggs in coastal environments. In this review, we propose a new and complementary hypothesis describing the biophysical processes intervening in the recruitment of temperate fish larvae into estuaries. This new hypothesis, the Sense Acuity And Behavioral (SAAB) hypothesis, recognizes that recruitment is unlikely if the larvae drift passively with the water currents, and that successful recruitment requires the sense acuity of temperate fish larvae and their behavioral response to the estuarine cues present in coastal areas. We propose that temperate fish larvae use a hierarchy of sensory cues (odor, sound, visual and geomagnetic cues) to detect estuarine nursery areas and to aid during navigation towards these areas. The sensorial acuity increases along ontogeny, which coincides with increased swimming capabilities. The swimming strategies of post-flexion larvae differ from offshore areas to the tidal zone. In offshore areas, innate behavior might lead larvae towards the coast guided by a sun compass or by the earth's geomagnetic field. In areas under limited influence of estuarine plumes (either in energetic nearshore areas or offshore), post-flexion larvae display a searching swimming behavior for estuarine disconnected patches (infotaxis strategy). After finding an estuarine plume, larvae may swim along the increasing cue concentration to ingress into the estuary. Here, larvae exhibit a rheotaxis behavior and avoid displacement by longshore currents by keeping bearing during navigation. When larvae reach the vicinity of an estuary, merging diel rhythms with feeding and predator avoidance strategies with tidally induced movements is essential to increase their chances of estuarine ingress. A fish larva recruitment model developed for the Ria Formosa lagoon supports the general framework of the SAAB hypothesis. In

  17. A biophysical model of endocannabinoid-mediated short term depression in hippocampal inhibition.

    Directory of Open Access Journals (Sweden)

    Margarita Zachariou

    Full Text Available Memories are believed to be represented in the synaptic pathways of vastly interconnected networks of neurons. The plasticity of synapses, that is, their strengthening and weakening depending on neuronal activity, is believed to be the basis of learning and establishing memories. An increasing number of studies indicate that endocannabinoids have a widespread action on brain function through modulation of synaptic transmission and plasticity. Recent experimental studies have characterised the role of endocannabinoids in mediating both short- and long-term synaptic plasticity in various brain regions including the hippocampus, a brain region strongly associated with cognitive functions, such as learning and memory. Here, we present a biophysically plausible model of cannabinoid retrograde signalling at the synaptic level and investigate how this signalling mediates depolarisation induced suppression of inhibition (DSI, a prominent form of short-term synaptic depression in inhibitory transmission in hippocampus. The model successfully captures many of the key characteristics of DSI in the hippocampus, as observed experimentally, with a minimal yet sufficient mathematical description of the major signalling molecules and cascades involved. More specifically, this model serves as a framework to test hypotheses on the factors determining the variability of DSI and investigate under which conditions it can be evoked. The model reveals the frequency and duration bands in which the post-synaptic cell can be sufficiently stimulated to elicit DSI. Moreover, the model provides key insights on how the state of the inhibitory cell modulates DSI according to its firing rate and relative timing to the post-synaptic activation. Thus, it provides concrete suggestions to further investigate experimentally how DSI modulates and is modulated by neuronal activity in the brain. Importantly, this model serves as a stepping stone for future deciphering of the role of

  18. Interaction of biocompatible natural rosin-based surfactants with human serum albumin: A biophysical study

    Energy Technology Data Exchange (ETDEWEB)

    Ishtikhar, Mohd [Protein Biophysics Laboratory, Interdisciplinary Biotechnology Unit, Aligarh Muslim University, Aligarh 202002 (India); Ali, Mohd Sajid [Surfactant Research Chair, Department of Chemistry, King Saud University, P.O. Box-2455, Riyadh 11451 (Saudi Arabia); Atta, Ayman M. [Surfactant Research Chair, Department of Chemistry, King Saud University, P.O. Box-2455, Riyadh 11451 (Saudi Arabia); Petroleum Application department, Egyptian Petroleum Research Institute, Ahmad Elzomor St., Nasr city, Cairo-11727 (Egypt); Al-Lohedan, H.A. [Surfactant Research Chair, Department of Chemistry, King Saud University, P.O. Box-2455, Riyadh 11451 (Saudi Arabia); Nigam, Lokesh; Subbarao, Naidu [Centre for Computational Biology and Bioinformatics, School of Computational and Integrative Sciences, Jawaharlal Nehru University, New Delhi 110067 (India); Hasan Khan, Rizwan, E-mail: [Protein Biophysics Laboratory, Interdisciplinary Biotechnology Unit, Aligarh Muslim University, Aligarh 202002 (India)


    Biophysical insight into interaction of biocompatible rosin-based surfactants with human serum albumin (HSA) was studied at physiological conditions using various spectroscopic, calorimetric and molecular docking approaches. The binding constant (K{sub b}), enthalpy (ΔH{sup 0}), entropy (ΔS{sup 0}) and Gibbs free energy change (ΔG{sup 0}) were calculated by spectroscopic and calorimetric method. We have also calculated the probability of energy transfer by FRET analysis. The circular dichroism study showed that the cationic surfactant QRMAE significantly altered the secondary structure of HSA as compared to the nonionic rosin surfactants. The thermodynamic study was performed by ITC to determine binding constant as well as change in enthalpy of HSA in presence of rosin surfactants. It clearly showed that hydrogen binding and hydrophobic interaction play an important role in the binding of HSA to rosin surfactants. We have also performed molecular docking studies to locate the binding site on HSA and to visualize the mode of interaction. The present study provides a significant insight into HSA–rosin surfactants interaction, which also improves our understanding of the possible effect of rosin surfactants on human health. - Highlights: • RMPEG 750 has the highest Kb, Kq and Ksv value as compared to other rosin surfactants. • The probability of energy transfer from HSA to rosin surfactants was maximum in the case of RMPEG 750. • Cationic surfactant QRMAE significantly altered the secondary structure of the HSA as compared to other rosin surfactants. • Molecular docking and ITC experiment studies, to locate the binding site on HSA and to investigate the mode of interaction.

  19. Biophysical characterization and mutational analysis of the antibiotic resistance protein NimA from Deinococcus radiodurans. (United States)

    Leiros, Hanna-Kirsti S; Brandsdal, Bjørn Olav; McSweeney, Seán M


    Metronidazole (MTZ) is an antibiotic commonly used to treat anaerobic bacterial infections in humans and animals. Antibiotic resistance toward this class of 5-nitroimidazole (5-Ni) drug derivatives has been related to the Nim genes thought to encode a reductase. Here we report the biophysical characteristics of the NimA protein from Deinococcus radiodurans (DrNimA) binding to MTZ and three other 5-Ni drugs. The interaction energies of the protein and antibiotic are studied by isothermal titration calorimetry (ITC) and with free energy and linear interaction energy (LIE) calculations, where the latter method revealed that the antibiotic binding is mainly of hydrophobic character. ITC measurements further found that one DrNimA dimer has two antibiotic binding sites which were not affected by mutation of the reactive His71. The observed association constants (K(a)) were in the range of 5.1-4910(4)M(-1) and the enthalpy release upon binding to DrNimA for the four drugs studied was relatively low (approximately -1 kJ/mol) but still measurable. The drug binding is mainly entropy driven and along with the hydrophobic drug binding site found by crystallography, this possibly explains the low observed enthalpy values. The effect of the His71 mutation and the presence of MTZ were studied by differential scanning calorimetry (DSC). Native DrNimA is a yellow colored protein where the interaction from His71 to the cofactor is thought to be responsible for the coloring. Mutations of His71 to Ala, Ser, Leu or Asp all gave transparent, colorless protein solutions, and the two mutant crystal structures of DrNimA-H71A and DrNimA-H71S presented revealed no cofactor binding.

  20. The role of biophysical interactions within the ijzermonding tidal flat sediment dynamics (United States)

    De Backer, Annelies; Van Colen, Carl; Vincx, Magda; Degraer, Steven


    This paper focuses on the importance of biophysical interactions on short-term and long-term sediment dynamics. Therefore, various biological (macrobenthos, photopigments, colloidal EPS) and physical parameters (grain size, water content, sediment stability, bed level) were determined (bi)monthly in nine sampling plots on the IJzermonding tidal flat (Belgium, 51°08'N, 2°44'E) during three consecutive years (July 2005-June 2008). Results showed that sediment stability varied on the short timescale and was directly influenced by biota, while bed level varied mainly on the long-term due to interannual variability. The short-term dynamic relationships between mud content, water content, fucoxanthin and macrobenthos density resulted in a seasonal mud deposition and erosion cycle, and directly influenced sediment stability. Moreover, macrobenthos was proven to be the most important parameter determining sediment stability. On the long-term, a shift was observed from high fucoxanthin/chl a concentration, high mud content and zero to moderate densities of Corophium volutator towards low fucoxanthin/chl a and mud content and high Corophium densities, which resulted in a transition from net accretion to net erosion. However, most measured variables proved to be poor predictors for these long-term bed level changes, indicating that external physical forces, such as waves and storminess, probably were the most important factors triggering long-term sediment dynamics. Nevertheless, biota indirectly influenced bed level changes by mediating short-term changes in sediment stability, thereby influencing the erodability of the sediment. The macrobenthos, and especially the mud shrimp Corophium, was suggested as the (indirect) driving destabilising factor for the sampling plots in the IIzermonding when considering the long-term evolution.

  1. Biophysically realistic filament bending dynamics in agent-based biological simulation. (United States)

    Alberts, Jonathan B


    An appealing tool for study of the complex biological behaviors that can emerge from networks of simple molecular interactions is an agent-based, computational simulation that explicitly tracks small-scale local interactions--following thousands to millions of states through time. For many critical cell processes (e.g. cytokinetic furrow specification, nuclear centration, cytokinesis), the flexible nature of cytoskeletal filaments is likely to be critical. Any computer model that hopes to explain the complex emergent behaviors in these processes therefore needs to encode filament flexibility in a realistic manner. Here I present a numerically convenient and biophysically realistic method for modeling cytoskeletal filament flexibility in silico. Each cytoskeletal filament is represented by a series of rigid segments linked end-to-end in series with a variable attachment point for the translational elastic element. This connection scheme allows an empirically tuning, for a wide range of segment sizes, viscosities, and time-steps, that endows any filament species with the experimentally observed (or theoretically expected) static force deflection, relaxation time-constant, and thermal writhing motions. I additionally employ a unique pair of elastic elements--one representing the axial and the other the bending rigidity- that formulate the restoring force in terms of single time-step constraint resolution. This method is highly local -adjacent rigid segments of a filament only interact with one another through constraint forces-and is thus well-suited to simulations in which arbitrary additional forces (e.g. those representing interactions of a filament with other bodies or cross-links / entanglements between filaments) may be present. Implementation in code is straightforward; Java source code is available at

  2. Biophysically realistic filament bending dynamics in agent-based biological simulation.

    Directory of Open Access Journals (Sweden)

    Jonathan B Alberts

    Full Text Available An appealing tool for study of the complex biological behaviors that can emerge from networks of simple molecular interactions is an agent-based, computational simulation that explicitly tracks small-scale local interactions--following thousands to millions of states through time. For many critical cell processes (e.g. cytokinetic furrow specification, nuclear centration, cytokinesis, the flexible nature of cytoskeletal filaments is likely to be critical. Any computer model that hopes to explain the complex emergent behaviors in these processes therefore needs to encode filament flexibility in a realistic manner. Here I present a numerically convenient and biophysically realistic method for modeling cytoskeletal filament flexibility in silico. Each cytoskeletal filament is represented by a series of rigid segments linked end-to-end in series with a variable attachment point for the translational elastic element. This connection scheme allows an empirically tuning, for a wide range of segment sizes, viscosities, and time-steps, that endows any filament species with the experimentally observed (or theoretically expected static force deflection, relaxation time-constant, and thermal writhing motions. I additionally employ a unique pair of elastic elements--one representing the axial and the other the bending rigidity- that formulate the restoring force in terms of single time-step constraint resolution. This method is highly local -adjacent rigid segments of a filament only interact with one another through constraint forces-and is thus well-suited to simulations in which arbitrary additional forces (e.g. those representing interactions of a filament with other bodies or cross-links / entanglements between filaments may be present. Implementation in code is straightforward; Java source code is available at

  3. Brownian Ratchets in Biophysics: from Diffusing Phospholipids to Polymerizing Actin Filaments (United States)

    van Oudenaarden, Alexander


    In the 'Feynman Lectures on Physics' Feynman introduces a mechanical ratchet and pawl subjected to thermal fluctuations to demonstrate the impossibility to violate the second law of thermodynamics. Since this introduction the Brownian ratchet has evolved from Gedanken experiments to real experiments in the interdisciplinary sciences such as biophysics and biochemistry. In this symposium I will present two experiments in which the concept Brownian ratchet is of key importance. The first experiment addresses a so-called geometrical Brownian ratchet [1]. This ratchet consists of a two-dimensional microfabricated periodic array of asymmetric diffusion barriers. As an experimental realization of a two-dimensional fluid of Brownian particles, a bilayer of phospholipid molecules is used. I will demonstrate that the geometrical Brownian ratchet can be used as a molecular sieve to separate mixtures of membrane molecules without the need to extract them from the membrane. In the second experiment I explore the spontaneous symmetry breaking of polymerizing actin networks [2]. Small submicron size beads coated uniformly with a protein that catalyzes actin polymerization, are initially surrounded by a symmetrical cloud of actin filaments. This symmetry can be broken spontaneously after which the beads undergo directional motion with constant velocity. I will present a simple stochastic theory, in which each filament is modeled as an elastic Brownian ratchet that qualitatively reproduces the experimental results. The presence of the bead couples the dynamics of different filaments which results in a complex collective system of interacting Brownian ratchets that exhibits an emergent symmetry breaking behavior. [1] A. van Oudenaarden and S. G. Boxer, Science 285, 1046 (1999). [2] A. van Oudenaarden and J. A. Theriot, Nature Cell Biology 1, 493 (1999).

  4. Biochemical, cellular, and biophysical characterization of a potent inhibitor of mutant isocitrate dehydrogenase IDH1. (United States)

    Davis, Mindy I; Gross, Stefan; Shen, Min; Straley, Kimberly S; Pragani, Rajan; Lea, Wendy A; Popovici-Muller, Janeta; DeLaBarre, Byron; Artin, Erin; Thorne, Natasha; Auld, Douglas S; Li, Zhuyin; Dang, Lenny; Boxer, Matthew B; Simeonov, Anton


    Two mutant forms (R132H and R132C) of isocitrate dehydrogenase 1 (IDH1) have been associated with a number of cancers including glioblastoma and acute myeloid leukemia. These mutations confer a neomorphic activity of 2-hydroxyglutarate (2-HG) production, and 2-HG has previously been implicated as an oncometabolite. Inhibitors of mutant IDH1 can potentially be used to treat these diseases. In this study, we investigated the mechanism of action of a newly discovered inhibitor, ML309, using biochemical, cellular, and biophysical approaches. Substrate binding and product inhibition studies helped to further elucidate the IDH1 R132H catalytic cycle. This rapidly equilibrating inhibitor is active in both biochemical and cellular assays. The (+) isomer is active (IC50 = 68 nm), whereas the (-) isomer is over 400-fold less active (IC50 = 29 μm) for IDH1 R132H inhibition. IDH1 R132C was similarly inhibited by (+)-ML309. WT IDH1 was largely unaffected by (+)-ML309 (IC50 >36 μm). Kinetic analyses combined with microscale thermophoresis and surface plasmon resonance indicate that this reversible inhibitor binds to IDH1 R132H competitively with respect to α-ketoglutarate and uncompetitively with respect to NADPH. A reaction scheme for IDH1 R132H inhibition by ML309 is proposed in which ML309 binds to IDH1 R132H after formation of the IDH1 R132H NADPH complex. ML309 was also able to inhibit 2-HG production in a glioblastoma cell line (IC50 = 250 nm) and had minimal cytotoxicity. In the presence of racemic ML309, 2-HG levels drop rapidly. This drop was sustained until 48 h, at which point the compound was washed out and 2-HG levels recovered.

  5. Biophysical characterization of KV3.1 potassium channel activating compounds. (United States)

    Taskin, Bahar; von Schoubye, Nadia Lybøl; Sheykhzade, Majid; Bastlund, Jesper Frank; Grunnet, Morten; Jespersen, Thomas


    The effect of two positive modulators, RE1 and EX15, on the voltage-gated K(+) channel Kv3.1 was investigated using the whole-cell patch-clamp technique on HEK293 cells expressing Kv3.1a. RE1 and EX15 increased the Kv3.1 currents in a concentration-dependent manner with an EC50 value of 4.5 and 1.3µM, respectively. However, high compound concentrations caused an inhibition of the Kv3.1 current. The compound-induced activation of Kv3.1 channels showed a profound hyperpolarized shift in activation kinetics. 30µM RE1 shifted V1/2 from 5.63±0.31mV to -9.71±1.00mV and 10µM EX15 induced a shift from 10.77±0.32mV to -15.11±1.57mV. The activation time constant (Tauact) was reduced for both RE1 and EX15, with RE1 being the fastest activator. The deactivation time constant (Taudeact) was also markedly reduced for both RE1 and EX15, with EX15 inducing the most prominent effect. Furthermore, subjected to depolarizing pulses at 30Hz, both compounds were showing a use-dependent effect resulting in a reduction of the compound-mediated effect. However, during these conditions, RE1- and EX15-modified current amplitudes still exceeded the control condition amplitudes by up to 200%. In summary, the present study introduces the first detailed biophysical characterization of two new Kv3.1 channel modifying compounds with different modulating properties.

  6. Biochemical and biophysical investigations of the interaction between human glucokinase and pro-apoptotic BAD. (United States)

    Rexford, Alix; Zorio, Diego A R; Miller, Brian G


    The glycolytic enzyme glucokinase (GCK) and the pro-apoptotic protein BAD reportedly reside within a five-membered complex that localizes to the mitochondria of mammalian hepatocytes and pancreatic β-cells. Photochemical crosslinking studies using a synthetic analog of BAD's BH3 domain and in vitro transcription/translation experiments support a direct interaction between BAD and GCK. To investigate the biochemical and biophysical consequences of the BAD:GCK interaction, we developed a method for the production of recombinant human BAD. Consistent with published reports, recombinant BAD displays high affinity for Bcl-xL (KD = 7 nM), and phosphorylation of BAD at S118, within the BH3 domain, abolishes this interaction. Unexpectedly, we do not detect association of recombinant, full-length BAD with recombinant human pancreatic GCK over a range of protein concentrations using various biochemical methods including size-exclusion chromatography, chemical cross-linking, analytical ultracentrifugation, and isothermal titration calorimetry. Furthermore, fluorescence polarization assays and isothermal titration calorimetry detect no direct interaction between GCK and BAD BH3 peptides. Kinetic characterization of GCK in the presence of high concentrations of recombinant BAD show modest (BAD BH3 peptides. These results raise questions as to the mechanism of action of stapled peptide analogs modeled after the BAD BH3 domain, which reportedly enhance the Vmax value of GCK and stimulate insulin release in BAD-deficient islets. Based on our results, we postulate that the BAD:GCK interaction, and any resultant regulatory effect(s) upon GCK activity, requires the participation of additional members of the mitochondrial complex.

  7. Photoprotective Response in Plants Impacts Estimation of Biophysical Parameters Using Spectral Reflectance (United States)

    Zygielbaum, A. I.; Arkebauer, T. J.; Walter-Shea, E.


    Previously, we reported that reflectance increased across the whole PAR spectrum when plants were subjected to water stress. This effect was shown to exist in maize grown under greenhouse conditions and under field conditions. Greenhouse experiments showed that, in addition to leaf water content, the effect was strongly correlated with incident light intensity. Further, through the use of an integrating sphere, we demonstrated that the change in reflectance was due to a change in absorption rather than in a change scattering or other optical path effect. Time lapse microscopy showed lightening between leaf veins analogous to effects measured by researchers observing cross sections of stressed C4 plants. To further refine our study, additional leaf level and canopy level studies were undertaken. Excised leaf sections were separately exposed to red and white light in the laboratory as the leaf dried. Increasing reflectance and transmittance were observed for the section exposed to white light, while little change was observed under red light. Each of these observations can be explained by chloroplast avoidance movement, a photoprotective response causing chloroplasts to aggregate along cell walls effectively hiding chlorophyll from observation. Chloroplast movement, for example, is driven by blue light; explaining the lack of observed change under red light. Estimation of biophysical parameters, such as chlorophyll content and greenness, are affected by the difference between the "apparent" chlorophyll content and the actual chlorophyll content of leaves and canopies. Up to 30% changes in the VARI remote sensing index have been observed morning to afternoon in field-grown maize. Ten percent changes in chlorophyll estimates have been observed in greenhouse maize. We will report on further research and on the extension of our work to include the impact of chloroplast avoidance on remote sensing of C3 plants, specifically soybean, at leaf and canopy levels.

  8. Regulations of evapotranspiration and ecosystem productivity from biophysical and human drivers in drylands Northern Eurasia (United States)

    Chen, J.; Ouyang, Z.; John, R.; Henebry, G. M.; Xie, Y.; de Beurs, K.; Fan, Y.; Shao, C.; Qi, J.; Wu, J.; Liu, Y.


    The concept of coupled human and environmental systems (CHES) has been a dominant framework in the past decade for understanding the cohesive connections between natural and human systems. Here we focus on how socio-ecological services may be regulated by the regional and local water cycles and by ecosystem production in the drylands of Northern Asia (>40 degree N), which includes Inner Mongolia of China, Kazakhstan, Kyrgyzstan, Mongolia, Tajikistan, Turkmenistan, and Uzbekistan. Total precipitation and evapotranspiration are used as the primary drivers to explain ecosystem production (e.g., GPP) and indicators of social function and structure (e.g., GDP, population) using the data collected from 1980 through 2010 of these seven areas. We hypothesize that the changes in the regional and local water cycles in these contrasting regions and socioeconomic settings significantly affect CHES functioning. Institutional changes, including shifts in policy, can play a much stronger role than those caused by the physical changes in determining the relationships between water cycle and CHES functioning. The complex connections among the biophysical and socioeconomic variables are analyzed through structural equation modeling (SEM) at country and regional scales. The highest water use efficiency (GPP:PET=0.57) was found for Uzbekistan, which also had the highest GDP:GPP (0.66) among the seven areas. In contrast, Mongolia exhibited the lowest values during the study period despite its very high GPP:Population value (45.8). The low population in Mongolia appeared responsible for its rank within the dryland region. Regional institutional changes with global ramifications, such as the collapse of Soviet Union and China joining the World Trade Organization, appears to have affected the CHES of the study areas.

  9. Biophysics of magnetic orientation: strengthening the interface between theory and experimental design (United States)

    Kirschvink, Joseph L.; Winklhofer, Michael; Walker, Michael M.


    The first demonstrations of magnetic effects on the behaviour of migratory birds and homing pigeons in laboratory and field experiments, respectively, provided evidence for the longstanding hypothesis that animals such as birds that migrate and home over long distances would benefit from possession of a magnetic sense. Subsequent identification of at least two plausible biophysical mechanisms for magnetoreception in animals, one based on biogenic magnetite and another on radical-pair biochemical reactions, led to major efforts over recent decades to test predictions of the two models, as well as efforts to understand the ultrastructure and function of the possible magnetoreceptor cells. Unfortunately, progress in understanding the magnetic sense has been challenged by: (i) the availability of a relatively small number of techniques for analysing behavioural responses to magnetic fields by animals; (ii) difficulty in achieving reproducible results using the techniques; and (iii) difficulty in development and implementation of new techniques that might bring greater experimental power. As a consequence, laboratory and field techniques used to study the magnetic sense today remain substantially unchanged, despite the huge developments in technology and instrumentation since the techniques were developed in the 1950s. New methods developed for behavioural study of the magnetic sense over the last 30 years include the use of laboratory conditioning techniques and tracking devices based on transmission of radio signals to and from satellites. Here we consider methodological developments in the study of the magnetic sense and present suggestions for increasing the reproducibility and ease of interpretation of experimental studies. We recommend that future experiments invest more effort in automating control of experiments and data capture, control of stimulation and full blinding of experiments in the rare cases where automation is impossible. We also propose new

  10. A Biophysical Image Compositing Technique for the Global-Scale Extraction and Mapping of Barren Lands

    Directory of Open Access Journals (Sweden)

    Ram C. Sharma


    Full Text Available As the barren lands play a key role in the interaction between land cover dynamics and climate system, an efficient methodology for the global-scale extraction and mapping of the barren lands is important. The discriminative potential of the existing soil/bareness indexes was assessed by collecting globally distributed reference data belonging to major land cover types. The existing soil/bareness indexes parameterized at the local scale did not work satisfactorily everywhere at the global level. A new technique called the Biophysical Image Composite (BIC is proposed in the research by exploiting time-series of the multi-spectral data to capture global-scale barren land attributes effectively. The BIC is a false color composite image made up of Normalized Difference Vegetation Index (NDVI, short wave infrared reflectance, and green reflectance, which were specially selected from the highest vegetation activity period by avoiding signals from the seasonal snowfall. The drastic contrast between the barren lands and vegetation as exhibited by the BIC provides a robust extraction and mapping of the barren lands, and facilitates its visual interpretation. Random Forests based supervised classification approach was applied on the BIC for the mapping of global barren lands. A new global barren land cover map of year 2013 was produced with high accuracy. The comparison of the resulted map with an existing map of the same year showed a substantial discrepancy between two maps due to methodological variation. To cope with this problem, the BIC based mapping methodology, with a special account of the land surface phenological changes, is suggested to standardize the global-scale estimates and mapping of the barren lands.

  11. Human and biophysical influences on fire occurrence in the United States (United States)

    Hawbaker, Todd J.; Radeloff, Volker C.; Stewart, Susan I.; Hammer, Roger B.; Keuler, Nicholas S.; Clayton, Murray K.


    National-scale analyses of fire occurrence are needed to prioritize fire policy and management activities across the United States. However, the drivers of national-scale patterns of fire occurrence are not well understood, and how the relative importance of human or biophysical factors varies across the country is unclear. Our research goal was to model the drivers of fire occurrence within ecoregions across the conterminous United States. We used generalized linear models to compare the relative influence of human, vegetation, climate, and topographic variables on fire occurrence in the United States, as measured by MODIS active fire detections collected between 2000 and 2006. We constructed models for all fires and for large fires only and generated predictive maps to quantify fire occurrence probabilities. Areas with high fire occurrence probabilities were widespread in the Southeast, and localized in the Mountain West, particularly in southern California, Arizona, and New Mexico. Probabilities for large-fire occurrence were generally lower, but hot spots existed in the western and south-central United States The probability of fire occurrence is a critical component of fire risk assessments, in addition to vegetation type, fire behavior, and the values at risk. Many of the hot spots we identified have extensive development in the wildland–urban interface and are near large metropolitan areas. Our results demonstrated that human variables were important predictors of both all fires and large fires and frequently exhibited nonlinear relationships. However, vegetation, climate, and topography were also significant variables in most ecoregions. If recent housing growth trends and fire occurrence patterns continue, these areas will continue to challenge policies and management efforts seeking to balance the risks generated by wildfires with the ecological benefits of fire.

  12. A biophysical basis for mucus solids concentration as a candidate biomarker for airways disease.

    Directory of Open Access Journals (Sweden)

    David B Hill

    Full Text Available In human airways diseases, including cystic fibrosis (CF and chronic obstructive pulmonary disease (COPD, host defense is compromised and airways inflammation and infection often result. Mucus clearance and trapping of inhaled pathogens constitute key elements of host defense. Clearance rates are governed by mucus viscous and elastic moduli at physiological driving frequencies, whereas transport of trapped pathogens in mucus layers is governed by diffusivity. There is a clear need for simple and effective clinical biomarkers of airways disease that correlate with these properties. We tested the hypothesis that mucus solids concentration, indexed as weight percent solids (wt%, is such a biomarker. Passive microbead rheology was employed to determine both diffusive and viscoelastic properties of mucus harvested from human bronchial epithelial (HBE cultures. Guided by sputum from healthy (1.5-2.5 wt% and diseased (COPD, CF; 5 wt% subjects, mucus samples were generated in vitro to mimic in vivo physiology, including intermediate range wt% to represent disease progression. Analyses of microbead datasets showed mucus diffusive properties and viscoelastic moduli scale robustly with wt%. Importantly, prominent changes in both biophysical properties arose at ∼4 wt%, consistent with a gel transition (from a more viscous-dominated solution to a more elastic-dominated gel. These findings have significant implications for: (1 penetration of cilia into the mucus layer and effectiveness of mucus transport; and (2 diffusion vs. immobilization of micro-scale particles relevant to mucus barrier properties. These data provide compelling evidence for mucus solids concentration as a baseline clinical biomarker of mucus barrier and clearance functions.

  13. Design considerations for micro- and nanopositioning: leveraging the latest for biophysical applications. (United States)

    Jordan, S C; Anthony, P C


    Biophysical applications ranging from fluorescence microassays to single-molecule microscopy are increasingly dependent on automated nanoscale positional control and stability. A whirlwind of motion-industry innovation has resulted in an array of new motion options offering significant improvements in application performance, reproducibility and throughput. The challenge to leverage these developments depends on researchers, engineers and motion vendors acquiring a common language of specifications and a shared understanding of the challenges posed by application needs. To assist in building this shared understanding, this article reviews today's motion technologies, beginning with a concise review of key principles of motion control focusing on applications. It progresses through illustrations of sensor/encoder technologies and servo techniques. A spectrum of classical and recent motion technologies is explored, from stepper and servo actuation of conventional microscopy stages, to advanced piezo stack nanopositioners capable of picometer precision, to novel ultrasonic resonant piezomotors and piezo-ceramic-based mechanisms capable of high-force positioning over many millimeters while providing resolutions down into the sub-nanometer range. A special emphasis is placed on the effects of integrating multiple motion technologies into an application, such as stacking a fine nanopositioner atop a long-travel stage. Examples and data are presented to clarify these issues, including important and insightful new stability measurements taken directly from an advanced optical trapping application. The important topics of software and interfacing are also explored from an applications perspective, since design-and-debugging time, synchronization capabilities and overall throughput are heavily dependent on these often-overlooked aspects of motion system design. The discussion is designed to illuminate specifications-related topics that become increasingly important as

  14. Biophysical controls over concentration and depth distribution of soil organic carbon and nitrogen in desert playas (United States)

    McKenna, Owen P.; Sala, Osvaldo E.


    Playa wetlands are important areas of soil organic carbon and nutrient storage in drylands. We conducted this study to assess how catchment biophysical variables control soil organic carbon and nitrogen in playas and how playas function differently than upland ecosystems. We found that playa organic carbon and nitrogen corresponded primarily with catchment vegetation cover and secondarily with catchment area, slope, and soil texture. The effect of increased organic matter production associated with high catchment vegetation cover overshadowed the potential effect of reduced run-on. We also found soil carbon and nitrogen profiles to be significantly shallower in playas than uplands. This trend is correlated with evidence of sedimentation and shallow-rooted plants in playas. Upland soils had a deeper carbon and nitrogen profile, which correlated with organic matter being generated by deeply rooted vegetation. In playas, C:N ratios remained constant through depth but in uplands, C:N ratios increased through depth. We found evidence that differences in rooting depth distributions and soil texture may explain these C:N variations between uplands and playas. In uplands, clay concentration increased with depth, whereas in playas, clay concentration did not change with depth, which highlighted the important role of sedimentation in these ecosystems. Our results suggest that small changes in playa catchment vegetation cover in response to climate change or grazing intensity would greatly impact playa soil organic carbon and nitrogen stocks. This effect would be due to the playa soils dependence on allochthonous organic matter and the large upland area that drains into playas.

  15. Laser therapy of the lung: biophysical background; Lasertherapie in der Lunge: Biophysikalischer Hintergrund

    Energy Technology Data Exchange (ETDEWEB)

    Knappe, V. [Laser- und Medizin-Technologie GmbH Berlin, Berlin (Germany); Mols, A. [Campus Benjamin Franklin, Charite - Universitaetsmedizin Berlin (Germany)


    The laser is a well established surgical instrument in lung therapy. This report provides information on the biophysical basics of the laser-induced thermotherapy (LITT) of lung metastases. Optical properties like absorption and scattering determine the penetration depth of laser radiation in tissue. These parameters vary dynamically during the application and define in combination with thermal tissue properties the achievable destruction volume. Parenchyma behaves very differently compared to more dense tissues due to local inhomogenities and the large amount cavaties filled with air. Beside an account of the affecting parameters an overview of therapy options is given. Therapeutic results depend not only on the tissue properties but also on the technical equipment, e.g. the applicator design and the energy applied. Complex dosimetric models allow for a calculation of the lesion's size in advance. (orig.) [German] Der Laser ist in der Lungenchirurgie ein bereits etabliertes Instrument. In diesem Beitrag werden speziell die biophysikalischen Hintergruende der laserinduzierten Thermotherapie (LITT) von Lungenmetastasen beschrieben. In der Gewebeoptik determinieren Absorption und Streuung die Eindringtiefe von Laserlicht. Diese Parameter veraendern sich dynamisch waehrend der Anwendung und bestimmen in Verbindung mit den thermischen Gewebeeigenschaften die maximal erzielbaren Destruktionsvolumina. Lokale Inhomogenitaeten und der hohe Anteil luftgefuellter Hohlraeume unterscheiden das Parenchym in dieser Hinsicht signifikant von dichteren Geweben. Neben einer Darstellung der beeinflussenden Parameter wird ein Ueberblick ueber die Therapieoptionen gegeben. Der Therapieerfolg haengt neben den genannten gewebeseitigen Parametern von Anzahl und Geometrie der Applikatoren und der applizierten Energie ab und kann mit komplexen Dosimetriemodellen im voraus kalkuliert werden. (orig.)

  16. Biophysical characteristics of a morphologically-complex macrotidal tropical coastal system during a dry season (United States)

    Jones, N. L.; Patten, N. L.; Krikke, D. L.; Lowe, R. J.; Waite, A. M.; Ivey, G. N.


    Four boat-based surveys and several moored measurements were conducted over the dry season in June, July, August and September 2008 in the central Kimberley region of northwestern Australia; a macrotidal tropical coastal region, characterised by numerous island archipelagos and shallow reefs. The objective was to determine the influence of this complex morphology on the biophysical properties of the local coastal water masses and the resultant impact on phytoplankton biomass. Despite negligible rainfall during the dry-season, decreased salinity towards the coast suggested a persistent fresh water source. The water column was weakly vertically-stratified throughout much of the study region, only becoming well-mixed in topographically constricted regions. The vertical stratification resulted in a cross-shore subsurface in situ chl-a fluorescence maxima (at ˜30 m depth) in June, July and August. The presence of a chain of islands and shallow reefs led to the partial isolation of the semi-enclosed embayment, Collier Bay, creating distinct water masses across this relatively small area. The confluence of the two most distinct water masses formed a front at latitude ˜15.65-15.7 °S, in both June and August, indicating it was a persistent feature during the dry season. In situ chl-a fluorescence was highest at the front location. In Collier Bay, NOx concentrations were up to five times higher, with a 20% higher proportion of larger extracted chl-a biomass (cells > 5 μm), a proxy for phytoplankton. In the more open waters of Camden Sound, relatively high concentrations of picophytoplankton, bacteria and viruses were observed. Such spatial shifts in nutrient concentrations, phytoplankton biomass and phytoplankton and microbial community composition across the persistent density front are likely to have important consequences on the region's planktonic food web function.

  17. Hyperspectral measurements for estimating biophysical parameters and CO2 exchanges in a rice field (United States)

    Rossini, M.; Migliavacca, M.; Meroni, M.; Manca, G.; Cogliati, S.; Busetto, L.; Picchi, V.; Galvagno, M.; Colombo, R.; Seufert, G.


    The objective of this work was to monitor the main biophysical and structural parameters as well as the CO2 exchanges between atmosphere and a terrestrial ecosystem from remote and high spectral resolution spectroradiometric measurements. Estimation of photosynthetic rate or gross primary productivity from remotely sensed data is based on the light use efficiency model (LUE), which states that carbon exchange is a function of the photosynthetically active radiation absorbed by vegetation (APAR) and the radiation use efficiency (ɛ) which represents the conversion efficiency of energy to fixed carbon. Hyperspectral data were used in this study in order to derived both the APAR of green vegetation and the ɛ term. The experimental site was a rice paddy field in North Italy equipped with an Eddy Covariance (EC) flux measurement tower (Castellaro IES-JRC site). Intensive field campaigns were conducted during summer 2007 and 2008. In each sampling day, canopy optical properties, canopy structure, biophysical and ecophysiological parameters were measured. EC fluxes were calculated with a time step of 30 minutes according to EUROFLUX methodology. Measured half-hourly net ecosystem exchange (NEE) was partitioned to derive half hourly gross ecosystem production (GEP). Canopy reflectance spectra were collected under clear sky conditions using two portable spectrometers (HR4000, OceanOptics, USA) characterised by different spectral resolutions. A spectrometer characterised by a Full Width at Half Maximum (FWHM) of 0.13 nm was used to estimate steady-state fluorescence (F) and a second one with a FWHM of 2.8 nm was used for the computation of traditional vegetation indices (e.g. NVDI, Normalized Difference Vegetation Index and SAVI, Soil Adjusted Vegetation Index) and PRI (Photochemical Reflectance Index, Gamon et al. 1992). F was estimated by exploiting a variation of the Fraunhofer Line Depth (FLD) principle (Plascyk 1975): the spectral fitting method described in Meroni

  18. Airborne S-Band SAR for Forest Biophysical Retrieval in Temperate Mixed Forests of the UK

    Directory of Open Access Journals (Sweden)

    Ramesh K. Ningthoujam


    Full Text Available Radar backscatter from forest canopies is related to forest cover, canopy structure and aboveground biomass (AGB. The S-band frequency (3.1–3.3 GHz lies between the longer L-band (1–2 GHz and the shorter C-band (5–6 GHz and has been insufficiently studied for forest applications due to limited data availability. In anticipation of the British built NovaSAR-S satellite mission, this study evaluates the benefits of polarimetric S-band SAR for forest biophysical properties. To understand the scattering mechanisms in forest canopies at S-band the Michigan Microwave Canopy Scattering (MIMICS-I radiative transfer model was used. S-band backscatter was found to have high sensitivity to the forest canopy characteristics across all polarisations and incidence angles. This sensitivity originates from ground/trunk interaction as the dominant scattering mechanism related to broadleaved species for co-polarised mode and specific incidence angles. The study was carried out in the temperate mixed forest at Savernake Forest and Wytham Woods in southern England, where airborne S-band SAR imagery and field data are available from the recent AirSAR campaign. Field data from the test sites revealed wide ranges of forest parameters, including average canopy height (6–23 m, diameter at breast-height (7–42 cm, basal area (0.2–56 m2/ha, stem density (20–350 trees/ha and woody biomass density (31–520 t/ha. S-band backscatter-biomass relationships suggest increasing backscatter sensitivity to forest AGB with least error between 90.63 and 99.39 t/ha and coefficient of determination (r2 between 0.42 and 0.47 for the co-polarised channel at 0.25 ha resolution. The conclusion is that S-band SAR data such as from NovaSAR-S is suitable for monitoring forest aboveground biomass less than 100 t/ha at 25 m resolution in low to medium incidence angle range.

  19. Biophysical controls on accretion and elevation change in Caribbean mangrove ecosystems (United States)

    McKee, K.L.


    Habitat stability of coastal ecosystems, such as marshes and mangroves, depends on maintenance of soil elevations relative to sea level. Many such systems are characterized by limited mineral sedimentation and/or rapid subsidence and are consequently dependent upon accumulation of organic matter to maintain elevations. However, little field information exists regarding the contribution of specific biological processes to vertical accretion and elevation change. This study used biogenic mangrove systems in carbonate settings in Belize (BZ) and southwest Florida (FL) to examine biophysical controls on elevation change. Rates of elevation change, vertical accretion, benthic mat formation, and belowground root accumulation were measured in fringe, basin, scrub, and dwarf forest types plus a restored forest. Elevation change rates (mm yr-1) measured with Surface Elevation Tables varied widely: BZ-Dwarf (-3.7), BZ-Scrub (-1.1), FL-Fringe (0.6), FL-Basin (2.1), BZ-Fringe (4.1), and FL-Restored (9.9). Root mass accumulation varied across sites (82-739 g m-2 yr-1) and was positively correlated with elevation change. Root volumetric contribution to vertical change (mm yr-1) was lowest in BZ-Dwarf (1.2) and FL-Fringe (2.4), intermediate in FL-Basin (4.1) and BZ-Scrub (4.3), and highest in BZ-Fringe (8.8) and FL-Restored (11.8) sites. Surface growth of turf-forming algae, microbial mats, or accumulation of leaf litter and detritus also made significant contributions to vertical accretion. Turf algal mats in fringe and scrub forests accreted faster (2.7 mm yr-1) than leaf litter mats in basin forests (1.9 mm yr-1), but similarly to microbial mats in dwarf forests (2.1 mm yr-1). Surface accretion of mineral material accounted for only 0.2-3.3% of total vertical change. Those sites with high root contributions and/or rapid growth of living mats exhibited an elevation surplus (+2 to +8 mm yr-1), whereas those with low root inputs and low (or non-living) mat accumulation showed an

  20. Biophysical feedback mediates effects of invasive grasses on coastal dune shape. (United States)

    Zarnetske, Phoebe L; Hacker, Sally D; Seabloom, Eric W; Ruggiero, Peter; Killian, Jason R; Maddux, Timothy B; Cox, Daniel


    Vegetation at the aquatic-terrestrial interface can alter landscape features through its growth and interactions with sediment and fluids. Even similar species may impart different effects due to variation in their interactions and feedbacks with the environment. Consequently, replacement of one engineering species by another can cause significant change in the physical environment. Here we investigate the species-specific ecological mechanisms influencing the geomorphology of U.S. Pacific Northwest coastal dunes. Over the last century, this system changed from open, shifting sand dunes with sparse vegetation (including native beach grass, Elymus mollis), to densely vegetated continuous foredune ridges resulting from the introduction and subsequent invasions of two nonnative grass species (Ammophila arenaria and Ammophila breviligulata), each of which is associated with different dune shapes and sediment supply rates along the coast. Here we propose a biophysical feedback responsible for differences in dune shape, and we investigate two, non-mutually exclusive ecological mechanisms for these differences: (1) species differ in their ability to capture sand and (2) species differ in their growth habit in response to sand deposition. To investigate sand capture, we used a moveable bed wind tunnel experiment and found that increasing tiller density increased sand capture efficiency and that, under different experimental densities, the native grass had higher sand capture efficiency compared to the Ammophila congeners. However, the greater densities of nonnative grasses under field conditions suggest that they have greater potential to capture more sand overall. We used a mesocosm experiment to look at plant growth responses to sand deposition and found that, in response to increasing sand supply rates, A. arenaria produced higher-density vertical tillers (characteristic of higher sand capture efficiency), while A. breviligulata and E. mollis responded with lower

  1. Biophysical controls on net ecosystem CO2 exchange over a semiarid shrubland in northwest China

    Directory of Open Access Journals (Sweden)

    X. Jia


    Full Text Available The carbon (C cycling in semiarid and arid areas remains largely unexplored, despite the wide distribution of drylands globally. Rehabilitation practices have been carried out in many desertified areas, but information on the C sequestration potential of recovering vegetation is still largely lacking. Using the eddy-covariance technique, we measured the net ecosystem CO2 exchange (NEE over a recovering shrub ecosystem in northwest China throughout 2012 in order to (1 quantify NEE and its components, (2 examine the dependence of C fluxes on biophysical factors at multiple timescales. The annual budget showed a gross ecosystem productivity (GEP of 456 ± 8 g C m−2 yr−1 and an ecosystem respiration (Re of 379 ± 3 g C m−2 yr−1, resulting in a net C sink of 77 ± 7 g C m−2 yr−1. The maximum daily NEE, GEP and Re were −4.7, 6.8 and 3.3 g C m−2 day−1, respectively. Both the maximum C assimilation rate (i.e., at optimum light intensity and the quantum yield varied strongly over the growing season, being higher in summer and lower in spring and autumn. At the half-hourly scale, water stress exerted a major control over daytime NEE, and interacted with heat stress and photoinhibition in constraining C fixation by the vegetation. Low soil moisture also reduced the temperature sensitivity of Re (Q10. At the synoptic scale, rain events triggered immediate pulses of C release from the ecosystem, followed by peaks of CO2 uptake 1–2 days later. Over the entire growing season, leaf area index accounted for 45 and 65% of the seasonal variation in NEE and GEP, respectively. There was a linear dependence of daily Re on GEP, with a slope of 0.34. These results highlight the role of abiotic stresses and their alleviation in regulating C cycling in the face of an increasing frequency and intensity of extreme climatic events.

  2. Laser-plasma accelerator and femtosecond photon sources-based ultrafast radiation chemistry and biophysics (United States)

    Gauduel, Y. A.


    The initial distribution of energy deposition triggered by the interaction of ionizing radiations (far UV and X rays, electron, proton and accelerated ions) with molecular targets or integrated biological systems is often decisive for the spatio-temporal behavior of radiation effects that take place on several orders of magnitude. This contribution deals with an interdisciplinary approach that concerns cutting-edge advances on primary radiation events, considering the potentialities of innovating strategies based on ultrafast laser science, from femtosecond photon sources to laser-driven relativistic particles acceleration. Recent advances of powerful TW laser sources (~ 1019 Wcm‑2) and laser-plasma interactions providing ultrashort relativistic particle beams in the energy domain 2.5–150 MeV open exciting opportunities for the development of high-energy radiation femtochemistry (HERF). Early radiation damages being dependent on the survival probability of secondary electrons and radial distribution of short-lived radicals inside ionization clusters, a thorough knowledge of these processes involves the real-time probing of primary events in the temporal range 10‑14–10‑11 s. In the framework of a closed synergy between low-energy radiation femtochemistry (LERF) and the emerging domain of HERF, the paper focuses on early phenomena that occur in the prethermal regime of low-energy secondary electrons, considering very short-lived quantum effects in aqueous environments. A high dose-rate delivered by femtosecond electron beam (~ 1011–1013 Gy s‑1) can be used to investigate early radiation processes in native ionization tracks, down to 10‑12 s and 10‑9 m. We explain how this breakthrough favours the innovating development of real-time nanodosimetry in biologically relevant environments and open new perspectives for spatio-temporal radiation biophysics. The emerging domain of HERF would provide guidance for understanding the specific bioeffects of

  3. Cyanine dyes in biophysical research: the photophysics of polymethine fluorescent dyes in biomolecular environments. (United States)

    Levitus, Marcia; Ranjit, Suman


    The breakthroughs in single molecule spectroscopy of the last decade and the recent advances in super resolution microscopy have boosted the popularity of cyanine dyes in biophysical research. These applications have motivated the investigation of the reactions and relaxation processes that cyanines undergo in their electronically excited states. Studies show that the triplet state is a key intermediate in the photochemical reactions that limit the photostability of cyanine dyes. The removal of oxygen greatly reduces photobleaching, but induces rapid intensity fluctuations (blinking). The existence of non-fluorescent states lasting from milliseconds to seconds was early identified as a limitation in single-molecule spectroscopy and a potential source of artifacts. Recent studies demonstrate that a combination of oxidizing and reducing agents is the most efficient way of guaranteeing that the ground state is recovered rapidly and efficiently. Thiol-containing reducing agents have been identified as the source of long-lived dark states in some cyanines that can be photochemically switched back to the emissive state. The mechanism of this process is the reversible addition of the thiol-containing compound to a double bond in the polymethine chain resulting in a non-fluorescent molecule. This process can be reverted by irradiation at shorter wavelengths. Another mechanism that leads to non-fluorescent states in cyanine dyes is cis-trans isomerization from the singlet-excited state. This process, which competes with fluorescence, involves the rotation of one-half of the molecule with respect to the other with an efficiency that depends strongly on steric effects. The efficiency of fluorescence of most cyanine dyes has been shown to depend dramatically on their molecular environment within the biomolecule. For example, the fluorescence quantum yield of Cy3 linked covalently to DNA depends on the type of linkage used for attachment, DNA sequence and secondary structure

  4. Biophysical controls on accretion and elevation change in Caribbean mangrove ecosystems (United States)

    McKee, Karen L.


    Habitat stability of coastal ecosystems, such as marshes and mangroves, depends on maintenance of soil elevations relative to sea level. Many such systems are characterized by limited mineral sedimentation and/or rapid subsidence and are consequently dependent upon accumulation of organic matter to maintain elevations. However, little field information exists regarding the contribution of specific biological processes to vertical accretion and elevation change. This study used biogenic mangrove systems in carbonate settings in Belize (BZ) and southwest Florida (FL) to examine biophysical controls on elevation change. Rates of elevation change, vertical accretion, benthic mat formation, and belowground root accumulation were measured in fringe, basin, scrub, and dwarf forest types plus a restored forest. Elevation change rates (mm yr -1) measured with Surface Elevation Tables varied widely: BZ-Dwarf (-3.7), BZ-Scrub (-1.1), FL-Fringe (0.6), FL-Basin (2.1), BZ-Fringe (4.1), and FL-Restored (9.9). Root mass accumulation varied across sites (82-739 g m -2 yr -1) and was positively correlated with elevation change. Root volumetric contribution to vertical change (mm yr -1) was lowest in BZ-Dwarf (1.2) and FL-Fringe (2.4), intermediate in FL-Basin (4.1) and BZ-Scrub (4.3), and highest in BZ-Fringe (8.8) and FL-Restored (11.8) sites. Surface growth of turf-forming algae, microbial mats, or accumulation of leaf litter and detritus also made significant contributions to vertical accretion. Turf algal mats in fringe and scrub forests accreted faster (2.7 mm yr -1) than leaf litter mats in basin forests (1.9 mm yr -1), but similarly to microbial mats in dwarf forests (2.1 mm yr -1). Surface accretion of mineral material accounted for only 0.2-3.3% of total vertical change. Those sites with high root contributions and/or rapid growth of living mats exhibited an elevation surplus (+2 to +8 mm yr -1), whereas those with low root inputs and low (or non-living) mat accumulation

  5. Biophysical Puzzles Concerning Magnetite-Based Magnetoreception in the Common Nematode, Caenorhabditis elegans. (United States)

    Kirschvink, J. L.; Kobayashi, A. K.


    A recent report demonstrating magnetotactic behavior in the nematode worm, C. elegans, presents two intriguing biophysical puzzles. Vidal-Gadea et al. (2015, DOI: 10.7554/eLife.07493) show that wild-type, well-fed populations from both Hemispheres migrate upwards when their soil environment is moist and wet, and downward when starved. Their data show that inverting the vertical component of the magnetic field reverses the migration direction, indicating that it is a magnetically polar (not axial) response. Also, the angle of magnetic migration varies with the inclination angle of the local geomagnetic field at the native site, minimizing travel time. This ancestral magnetic migration direction persists even when strains are taken to different areas. We note that only a single-domain ferromagnetic magnetoreceptor (e.g, magnetite) is capable of producing a polar magnetotactic response, and in support there is one report of magnetosomes in C. elegans (Cranfield et al., 2004;DOI 10.1098/rsbl.2004.0209). However, the polarity of a magnetosome is determined at the time it grows across the SPM/SD threshold, and the magnetic orientation will lock-in randomly unless biased by the strong field of adjacent magnetosomes. Hence, the persistence of a North or South seeking direction preference within these populations demands that stable magnetosome chains of fixed polarity must be transmitted from parents, to the eggs, to the larvae, and then to the new adults. This is similar to the non-genetic inheritance process by which populations of magnetotactic bacteria can maintain North- or South-seeking swimming preference. Furthermore, for a magnetotactic organism to maintain a consistent angle from the magnetic axis is not enough to make it go vertical; it would go in a cone. For them to go vertical as reported (or to deviate at their natal magnetic inclination) demands that they must have a separate gravity sensor with which to measure the inclination angle relative to the

  6. Reciprocal inhibitory coupling: Measure and control of chaos on a biophysically motivated model of bursting (United States)

    Duarte, Jorge; Januário, Cristina; Martins, Nuno


    Bursting activity is an interesting feature of the temporal organization in many cell firing patterns. This complex behavior is characterized by clusters of spikes (action potentials) interspersed with phases of quiescence. As shown in experimental recordings, concerning the electrical activity of real neurons, the analysis of bursting models reveals not only patterned periodic activity but also irregular behavior 1,2]. The interpretation of experimental results, particularly the study of the influence of coupling on chaotic bursting oscillations, is of great interest from physiological and physical perspectives. The inability to predict the behavior of dynamical systems in presence of chaos suggests the application of chaos control methods, when we are more interested in obtaining regular behavior. In the present article, we focus our attention on a specific class of biophysically motivated maps, proposed in the literature to describe the chaotic activity of spiking-bursting cells [Cazelles B, Courbage M, Rabinovich M. Anti-phase regularization of coupled chaotic maps modelling bursting neurons. Europhys Lett 2001;56:504-9]. More precisely, we study a map that reproduces the behavior of a single cell and a map used to examine the role of reciprocal inhibitory coupling, specially on two symmetrically coupled bursting neurons. Firstly, using results of symbolic dynamics, we characterize the topological entropy associated to the maps, which allows us to quantify and to distinguish different chaotic regimes. In particular, we exhibit numerical results about the effect of the coupling strength on the variation of the topological entropy. Finally, we show that complicated behavior arising from the chaotic coupled maps can be controlled, without changing of its original properties, and turned into a desired attracting time periodic motion (a regular cycle). The control is illustrated by an application of a feedback control technique developed by Romeiras et al. [Romeiras

  7. Biochemical, biophysical and IgE-epitope characterization of the wheat food allergen, Tri a 37.

    Directory of Open Access Journals (Sweden)

    Sandra Pahr

    Full Text Available Wheat is an important staple food and potent allergen source. Recently, we isolated a cDNA coding for wheat alpha-purothionin which is recognized by wheat food allergic patients at risk for severe wheat-induced allergy. The purpose of the present study was the biochemical, biophysical and IgE epitope characterization of recombinant alpha-purothionin. Synthetic genes coding for alpha-purothionin were expressed in a prokaryotic system using Escherichia coli and in a eukaryotic expression system based on baculovirus-infected Sf9-insect cells. Recombinant proteins were purified and characterized by SDS-PAGE, mass spectrometry, circular dichroism, chemical cross-linking and size exclusion chromatography. Five overlapping peptide were synthesized for epitope mapping. Alpha-purothionin-specific rabbit antibodies were raised to perform IgE-inhibition experiments and to study the resistance to digestion. The IgE reactivity of the proteins and peptides from ten wheat food allergic patients was studied in non-denaturing RAST-based binding assays. Alpha-purothionin was expressed in the prokaryotic (EcTri a 37 and in the eukaryotic system (BvTri a 37 as a soluble and monomeric protein. However, circular dichroism analysis revealed that EcTri a 37 was unfolded whereas BvTri a 37 was a folded protein. Both proteins showed comparable IgE-reactivity and the epitope mapping revealed the presence of sequential IgE epitopes in the N-terminal basic thionin domain (peptide1:KSCCRSTLGRNCYNLCRARGAQKLCAGVCR and in the C-terminal acidic extension domain (peptide3:KGFPKLALESNSDEPDTIEYCNLGCRSSVC, peptide4:CNLGCRSSVCDYMVNAAADDEEMKLYVEN. Natural Tri a 37 was digested under gastric conditions but resistant to duodenal digestion. Immunization with EcTri a 37 induced IgG antibodies which recognized similar epitopes as IgE antibodies from allergic patients and inhibited allergic patients' IgE binding. Reactivity to Tri a 37 does not require a folded protein and the presence of

  8. Biophysical drivers of net ecosystem exchange in shrublands of the northern Chihuahuan Desert (United States)

    Jaimes, A.; Laney, C.; Tweedie, C. E.


    In the northern Chihuahuan Desert, large areas of southern New Mexico that were formerly dominated by perennial grasses, including black grama (Bouteloua eriopa) and mesa dropseed (Sporobolus flexus) have been replaced by desert shrubland species, in particular creosote bush (Larrea tridentata) and honey mesquite (Prosopis glandulosa). Recent studies suggest that these changes in land cover have the ability to modify near surface microclimate such as soil water holding capacity, albedo, carbon dioxide sequestration, and increases in local air temperature, respiration, sensible heat and evapotranspiration. Despite the recognized importance of the consequences of land cover change in the ecosystem, the rates and tipping points at which these changes occur are not well understood. This knowledge is key to improve predictions in regional and global models, as the region is expected to go through an imminent transition from warm to warmer climate in this century. This study analyze three years of data (2010-2012) from our multi sensor platform situated on the USDA ARS Jornada Experimental Range (JER), about 25 km northeast of Las Cruces, New Mexico, USA. A robust data set that combines high frequency micrometeorological data, plot phenology estimates and spectral indices was used. A combination of statistical analyses based on clustering methods (self-organizing maps) and simple nonparametric regression techniques (regression trees) were used to identify factors controlling fluxes and likely biophysical thresholds and tipping points indicative of different functional system states. Both analyses were implemented through the use of Neural Network Toolbox and Statistics toolbox within MATLAB 7.0. During the period of study the shrubland acted as a carbon sink ranging between -105 to -134 gCO2 m-2 y-1. The largest variation between years in the annual estimated fluxes was the slight decrease of total annual net ecosystem exchange during 2011 (-105 g m-2 s-1) in comparison

  9. Sustained Epigenetic Drug Delivery Depletes Cholesterol-Sphingomyelin Rafts from Resistant Breast Cancer Cells, Influencing Biophysical Characteristics of Membrane Lipids. (United States)

    Raghavan, Vijay; Vijayaraghavalu, Sivakumar; Peetla, Chiranjeevi; Yamada, Masayoshi; Morisada, Megan; Labhasetwar, Vinod


    Cell-membrane lipid composition can greatly influence biophysical properties of cell membranes, affecting various cellular functions. We previously showed that lipid synthesis becomes altered in the membranes of resistant breast cancer cells (MCF-7/ADR); they form a more rigid, hydrophobic lipid monolayer than do sensitive cell membranes (MCF-7). These changes in membrane lipids of resistant cells, attributed to epigenetic aberration, significantly affected drug transport and endocytic function, thus impacting the efficacy of anticancer drugs. The present study's objective was to determine the effects of the epigenetic drug, 5-aza-2'-deoxycytidine (DAC), delivered in sustained-release nanogels (DAC-NGs), on the composition and biophysical properties of membrane lipids of resistant cells. Resistant and sensitive cells were treated with DAC in solution (DAC-sol) or DAC-NGs, and cell-membrane lipids were isolated and analyzed for lipid composition and biophysical properties. In resistant cells, we found increased formation of cholesterol-sphingomyelin (CHOL-SM) rafts with culturing time, whereas DAC treatment reduced their formation. In general, the effect of DAC-NGs was greater in changing the lipid composition than with DAC-sol. DAC treatment also caused a rise in levels of certain phospholipids and neutral lipids known to increase membrane fluidity, while reducing the levels of certain lipids known to increase membrane rigidity. Isotherm data showed increased lipid membrane fluidity following DAC treatment, attributed to decrease levels of CHOL-SM rafts (lamellar beta [Lβ] structures or ordered gel) and a corresponding increase in lipids that form lamellar alpha-structures (Lα, liquid crystalline phase). Sensitive cells showed marginal or insignificant changes in lipid profile following DAC-treatment, suggesting that epigenetic changes affecting lipid biosynthesis are more specific to resistant cells. Since membrane fluidity plays a major role in drug transport

  10. Label-free and quantitative evaluation of cytotoxicity based on surface nanostructure and biophysical property of cells utilizing AFM. (United States)

    Lee, Young Ju; Lee, Gi-Ja; Kang, Sung Wook; Cheong, Youjin; Park, Hun-Kuk


    In this study, the four commonly used cytotoxicity assays and the mechanical properties as evaluated by atomic force microscopy (AFM) were compared in a cellular system. A cytotoxicity assay is the first and most essential test to evaluate biocompatibility of various toxic substances. Many of the cytotoxicity methods require complicated and labor-intensive process, as well as introduce experimental error. In addition, these methods cannot provide instantaneous and quantitative cell viability information. AFM has become an exciting analytical tool in medical, biological, and biophysical research due to its unique abilities. AFM-based force-distance curve measurements precisely measure the changes in the biophysical properties of the cell. Therefore, we observed the morphological changes and mechanical property changes in L929 cells following sodium lauryl sulfate (SLS) treatment utilizing AFM. AFM imaging showed that the toxic effects of SLS changed not only the spindle-like shape of L929 cells into a round shape, but also made a rough cell surface. As the concentration of SLS was increased, the surface roughness of L929 cell was increased, and stiffness decreased. We confirmed that inhibition of proliferation clearly increased with increases in SLS concentration based on results from MTT, WST, neutral red uptake, and LIVE/DEAD viability/cytotoxicity assays. The estimated IC₅₀ value by AFM analysis was similar to those of other conventional assays and was included within the 95% confidence interval range. We suggest that an AFM quantitative analysis of the morphological and biophysical changes in cells can be utilized as a new method for evaluating cytotoxicity.

  11. Perspectives in radiation biophysics: From radiation track structure simulation to mechanistic models of DNA damage and repair (United States)

    Nikjoo, H.; Taleei, R.; Liamsuwan, T.; Liljequist, D.; Emfietzoglou, D.


    In radiation targeted therapy and genetic risk estimation of low dose radiation protection there is a crucial need for full description of DNA damage response and repair (DDR) leading to cell death and cell mutation. We propose such a description can be arrived through realistic track-structure simulations together with mechanistic mathematical formulation of DDR and the availability of experimental data for testing the proof of principle. In this paper we review briefly first the state of the art in DNA damage and repair, and then the recent advances in the physics of track structure which represents an essential tool in radiation biophysics.

  12. Perfil Biofísico Fetal na Ruptura Prematura das Membranas Fetal Biophysical Profile in Premature Rupture of the Membranes

    Directory of Open Access Journals (Sweden)

    Vardeli Alves de Moraes


    modifications due to premature rupture of the membranes of variables of the fetal biophysical profile, comparing them to the ones found in pregnant women with intact membranes. In the group with premature rupture of the membranes, the association of biophysical variables with the Apgar score at the first and fifth minutes and with the occurrence or not of clinical chorioamnionitis and neonatal infection was analyzed. Patients and Methods: in a prospective study, 112 fetal biophysical profiles were established in 60 pregnant women with premature rupture of the membranes at a period between the 28th and the 40th week of pregnancy, and only the last fetal biophysical profile was analyzed and compared to other 60 fetal biophysical profiles of pregnant women with gestational ages identical to the group of study and with intact membranes. Results: statistical analysis of the results revealed that the premature rupture of the membranes diminished the reactivity, not interfering with the body movements of the fetus. It also diminished the frequency of the respiratory movements of the fetus, not determining modifications of the fetal tonus, and considerably decreasing the amniotic fluid index. In terms of prediction of chorioamnionitis and neonatal infection, the fetal biophysical profile did not show any significant statistic validity; however, when the biophysical variables were present, the correlation with the absence of chorioamnionitis and neonatal infection was clearly shown. The result of the last fetal biophysical profile was strongly associated with the Apgar score at the 5th minute. Conclusion: the fetal biophysical profile should be used routinely in pregnant women with premature rupture of the membranes with the purpose of evaluating fetal vitality, and in order to detect those fetuses at a higher risk of infection, specially those with gestational ages of less than 34 weeks. Regarding those fetuses it is best to use a conservative approach.

  13. Applications of the BIOPHYS Algorithm for Physically-Based Retrieval of Biophysical, Structural and Forest Disturbance Information (United States)

    Peddle, Derek R.; Huemmrich, K. Fred; Hall, Forrest G.; Masek, Jeffrey G.; Soenen, Scott A.; Jackson, Chris D.


    Canopy reflectance model inversion using look-up table approaches provides powerful and flexible options for deriving improved forest biophysical structural information (BSI) compared with traditional statistical empirical methods. The BIOPHYS algorithm is an improved, physically-based inversion approach for deriving BSI for independent use and validation and for monitoring, inventory and quantifying forest disturbance as well as input to ecosystem, climate and carbon models. Based on the multiple-forward mode (MFM) inversion approach, BIOPHYS results were summarized from different studies (Minnesota/NASA COVER; Virginia/LEDAPS; Saskatchewan/BOREAS), sensors (airborne MMR; Landsat; MODIS) and models (GeoSail; GOMS). Applications output included forest density, height, crown dimension, branch and green leaf area, canopy cover, disturbance estimates based on multi-temporal chronosequences, and structural change following recovery from forest fires over the last century. Good correspondences with validation field data were obtained. Integrated analyses of multiple solar and view angle imagery further improved retrievals compared with single pass data. Quantifying ecosystem dynamics such as the area and percent of forest disturbance, early regrowth and succession provide essential inputs to process-driven models of carbon flux. BIOPHYS is well suited for large-area, multi-temporal applications involving multiple image sets and mosaics for assessing vegetation disturbance and quantifying biophysical structural dynamics and change. It is also suitable for integration with forest inventory, monitoring, updating, and other programs.

  14. Investigation of quercetin-induced HepG2 cell apoptosis-associated cellular biophysical alterations by atomic force microscopy. (United States)

    Pi, Jiang; Li, Baole; Tu, Lvying; Zhu, Haiyan; Jin, Hua; Yang, Fen; Bai, Haihua; Cai, Huaihong; Cai, Jiye


    Quercetin, a wildly distributed bioflavonoid, has been proved to possess excellent antitumor activity on hepatocellular carcinoma (HCC). In the present study, the biophysical properties of HepG2 cells were qualitatively and quantitatively determined using high resolution atomic force microscopy (AFM) to understand the anticancer effects of quercetin on HCC cells at nanoscale. The results showed that quercetin could induce severe apoptosis in HepG2 cells through arrest of cell cycle and disruption of mitochondria membrane potential. Additionally, the nuclei and F-actin structures of HepG2 cells were destroyed by quercetin treatment as well. AFM morphological data showed some typical apoptotic characterization of HepG2 cells with increased particle size and roughness in the ultrastructure of cell surface upon quercetin treatment. As an important biophysical property of cells, the membrane stiffness of HepG2 cells was further quantified by AFM force measurements, which indicated that HepG2 cells became much stiffer after quercetin treatment. These results collectively suggest that quercetin can be served as a potential therapeutic agent for HCC, which not only extends our understanding of the anticancer effects of quercetin against HCC cells into nanoscale, but also highlights the applications of AFM for the investigation of anticancer drugs.

  15. Continuous monitoring of biophysical Eucalyptus sp. parameters using interferometric synthetic aperture radar data in P and X bands (United States)

    Gama, Fábio Furlan; dos Santos, João Roberto; Mura, José Claudio


    This work aims to verify the applicability of models obtained using interferometric synthetic aperture radar (SAR) data for estimation of biophysical Eucalyptus saligna parameters [diameter of breast height (DBH), total height and volume], as a method of continuous forest inventory. In order to obtain different digital elevation models, and the interferometric height (Hint) to retrieve the tree heights, SAR surveying was carried out by an airborne interferometric SAR in two frequencies X and P bands. The study area, located in the Brazilian southeast region (S 22°53‧22″/W 45°26‧16″ and S 22°53‧22″/W 45°26‧16″), comprises 128.64 hectares of Eucalyptus saligna stands. The methodological procedures encompassed: forest inventory, topographic surveying, radar mapping, radar processing, and multivariable regression techniques to build Eucalyptus volume, DBH, and height models. The statistical regression pointed out Hint and interferometric coherence as the most important variables for the total height and DBH estimation; for the volume model, however, only the Hint variable was selected. The performance of the biophysical models from the second campaign, two years later (2006), were consistent and its results are very promising for updating annual inventories needed for managing Eucalyptus plantations.

  16. Stakeholder analysis and social-biophysical interdependencies for common pool resource management: La Brava Wetland (Argentina) as a case study. (United States)

    Romanelli, Asunción; Massone, Héctor E; Escalante, Alicia H


    This article gives an account of the implementation of a stakeholder analysis framework at La Brava Wetland Basin, Argentina, in a common-pool resource (CPR) management context. Firstly, the context in which the stakeholder framework was implemented is described. Secondly, a four-step methodology is applied: (1) stakeholder identification, (2) stakeholder differentiation-categorization, (3) investigation of stakeholders' relationships, and (4) analysis of social-biophysical interdependencies. This methodology classifies stakeholders according to their level of influence on the system and their potential in the conservation of natural resources. The main influential stakeholders are La Brava Village residents and tourism-related entrepreneurs who are empowered to make the more important decisions within the planning process of the ecosystem. While these key players are seen as facilitators of change, there are other groups (residents of the inner basin and fishermen) which are seen mainly as key blockers. The applied methodology for the Stakeholder Analysis and the evaluation of social-biophysical interdependencies carried out in this article can be seen as an encouraging example for other experts in natural sciences to learn and use these methods developed in social sciences. Major difficulties and some recommendations of applying this method in the practice by non-experts are discussed.

  17. A fully synthetic human Fab antibody library based on fixed VH/VL framework pairings with favorable biophysical properties. (United States)

    Tiller, Thomas; Schuster, Ingrid; Deppe, Dorothée; Siegers, Katja; Strohner, Ralf; Herrmann, Tanja; Berenguer, Marion; Poujol, Dominique; Stehle, Jennifer; Stark, Yvonne; Heßling, Martin; Daubert, Daniela; Felderer, Karin; Kaden, Stefan; Kölln, Johanna; Enzelberger, Markus; Urlinger, Stefanie


    This report describes the design, generation and testing of Ylanthia, a fully synthetic human Fab antibody library with 1.3E+11 clones. Ylanthia comprises 36 fixed immunoglobulin (Ig) variable heavy (VH)/variable light (VL) chain pairs, which cover a broad range of canonical complementarity-determining region (CDR) structures. The variable Ig heavy and Ig light (VH/VL) chain pairs were selected for biophysical characteristics favorable to manufacturing and development. The selection process included multiple parameters, e.g., assessment of protein expression yield, thermal stability and aggregation propensity in fragment antigen binding (Fab) and IgG1 formats, and relative Fab display rate on phage. The framework regions are fixed and the diversified CDRs were designed based on a systematic analysis of a large set of rearranged human antibody sequences. Care was taken to minimize the occurrence of potential posttranslational modification sites within the CDRs. Phage selection was performed against various antigens and unique antibodies with excellent biophysical properties were isolated. Our results confirm that quality can be built into an antibody library by prudent selection of unmodified, fully human VH/VL pairs as scaffolds.

  18. Biophysical and structural characterization of a folded core domain within the proregion of growth and differentiation factor-5. (United States)

    Thieme, Tino; Patzschke, Rica; Job, Florian; Liebold, Jens; Seemann, Petra; Lilie, Hauke; Balbach, Jochen; Schwarz, Elisabeth


    The structure and function(s) of the very large proregions of the transforming growth factor-β structure family are known in only a few cases. The proregion of growth and differentiation factor (GDF)5 comprises 354 residues. GDF5 therefore belongs to the group of those growth factors with the largest proregions. Here, we report a biophysical analysis of the proform (proGDF5) and the separate proregion. In the absence of the mature part, the proregion folds reversibly to form a monomeric polypeptide that is stabilized by an intramolecular disulfide bond. In the context of the mature part, i.e. in proGDF5, the proregion shows increased thermodynamic stability and contains a higher proportion of secondary structural elements than in its isolated form. A subdomain within the proregion represents a well-folded structure as monitored via biophysical analysis and NMR spectroscopy. Furthermore, two point mutations that are associated with skeletal malformations lead to reduced thermodynamic stability, which is interpreted on the basis of a homology model with the structure of the related latency-associated peptide, representing the proregion of transforming growth factor-β1.


    Directory of Open Access Journals (Sweden)

    Vikram Kumar*, Angshu Bandyopadhyay and Vikram Sharma


    Full Text Available Plants have been used in traditional medicine for several thousand years. India is perhaps the largest producer of medicinal herbs and is rightly called the “Botanical garden of the World”. Murraya koenigii Linn. commonly known as Meethi neem, belongs to the family Rutaceae. The curry tree is native to India and it is found almost everywhere in the Indian subcontinent excluding the higher levels of Himalayas. The effect of Murraya koenigii leaves aqueous extract on biophysical and biochemical parameters of wound were studied by dead space wound model in diabetic hyperlipidemic rats. In dead space wound model, animals treated with Murraya koenigii (oral administration of variable dosage level 200mg/kg, 300mg/kg and 400mg/kg leaves aqueous extract showed significant increase in Wet & Dry granulations tissue weight (biophysical parameter and hydroxyprolin content (biochemical parameter when compared to the diabetic hyperlipidemic control group rats. In this study, very significant (p<0.001 result was found with 300mg/kg dose level because the effect was dose dependent up to 300mg equivalent of extract. The results suggested that aqueous extract of Murraya koenigii possess significant wound healing potential in diabetic hyperlipidemic rats. Further studies may reveal the exact mechanisms of action responsible for the wound healing activity of Murraya koenigii leaves aqueous extract in diabetic hyperlipidemic condition.

  20. Quantitative Analysis of the Trends Exhibited by the Three Interdisciplinary Biological Sciences: Biophysics, Bioinformatics, and Systems Biology. (United States)

    Kang, Jonghoon; Park, Seyeon; Venkat, Aarya; Gopinath, Adarsh


    New interdisciplinary biological sciences like bioinformatics, biophysics, and systems biology have become increasingly relevant in modern science. Many papers have suggested the importance of adding these subjects, particularly bioinformatics, to an undergraduate curriculum; however, most of their assertions have relied on qualitative arguments. In this paper, we will show our metadata analysis of a scientific literature database (PubMed) that quantitatively describes the importance of the subjects of bioinformatics, systems biology, and biophysics as compared with a well-established interdisciplinary subject, biochemistry. Specifically, we found that the development of each subject assessed by its publication volume was well described by a set of simple nonlinear equations, allowing us to characterize them quantitatively. Bioinformatics, which had the highest ratio of publications produced, was predicted to grow between 77% and 93% by 2025 according to the model. Due to the large number of publications produced in bioinformatics, which nearly matches the number published in biochemistry, it can be inferred that bioinformatics is almost equal in significance to biochemistry. Based on our analysis, we suggest that bioinformatics be added to the standard biology undergraduate curriculum. Adding this course to an undergraduate curriculum will better prepare students for future research in biology.

  1. Stakeholder Analysis and Social-Biophysical Interdependencies for Common Pool Resource Management: La Brava Wetland (Argentina) as a Case Study (United States)

    Romanelli, Asunción; Massone, Héctor E.; Escalante, Alicia H.


    This article gives an account of the implementation of a stakeholder analysis framework at La Brava Wetland Basin, Argentina, in a common-pool resource (CPR) management context. Firstly, the context in which the stakeholder framework was implemented is described. Secondly, a four-step methodology is applied: (1) stakeholder identification, (2) stakeholder differentiation-categorization, (3) investigation of stakeholders' relationships, and (4) analysis of social-biophysical interdependencies. This methodology classifies stakeholders according to their level of influence on the system and their potential in the conservation of natural resources. The main influential stakeholders are La Brava Village residents and tourism-related entrepreneurs who are empowered to make the more important decisions within the planning process of the ecosystem. While these key players are seen as facilitators of change, there are other groups (residents of the inner basin and fishermen) which are seen mainly as key blockers. The applied methodology for the Stakeholder Analysis and the evaluation of social-biophysical interdependencies carried out in this article can be seen as an encouraging example for other experts in natural sciences to learn and use these methods developed in social sciences. Major difficulties and some recommendations of applying this method in the practice by non-experts are discussed.

  2. Principles and biophysical applications of single particle super-localization and rotational tracking

    Energy Technology Data Exchange (ETDEWEB)

    Gu, Yan [Iowa State Univ., Ames, IA (United States)


    While conventional Single Particle Tracking (SPT) techniques acquire 2D or 3D trajectories of particle probes, we have developed Single Particle Orientation and Rotational Tracking (SPORT) techniques to extract orientation and rotational information. Combined with DIC microscopy, the SPORT technique has been applied in biophysical studies, including membrane diffusion and intracellular transport. The rotational dynamics of nanoparticle vectors on live cell membranes was recorded and its influence on the fate of these nanoparticle vectors was elucidated. The rotational motions of gold nanorods with various surface modifiers were tracked continuously at a temporal resolution of 5 ms under a DIC microscope. We found that the rotational behaviors of gold nanorod vectors are strongly related to their surface charge, specific surface functional groups, and the availability of receptors on cell membranes. The study of rotational Brownian motion of nanoparticles on cell membranes will lead to a better understanding of the mechanisms of drug delivery and provide guidance in designing surface modification strategies for drug delivery vectors under various circumstances. To characterize the rotation mode of surface functionalized gold nanorods on cell membranes, the SPORT technique is combined with the correlation analysis of the bright and dark DIC intensities. The unique capabilities of visualizing and understanding rotational motions of functionalized nanoparticles on live cell membranes allow us to correlate rotational and translational dynamics in unprecedented detail and provide new insights for complex membrane processes, including electrostatic interactions, ligand-receptor binding, and lateral (confined and hopping) diffusion of membrane receptors. Surface-functionalized nanoparticles interact with the membrane in fundamentally different ways and exhibit distinct rotational modes. The early events of particle-membrane approach and attachment are directly visualized

  3. A New Concept of Soil Line Retrieval from Landsat 8 Images for Estimating Plant Biophysical Parameters

    Directory of Open Access Journals (Sweden)

    Nima Ahmadian


    Full Text Available Extraction of vegetation information from remotely sensed images has remained a long-term challenge due to the influence of soil background. To reduce this effect, the slope and intercept of the soil line (SL should be known to calculate SL-related vegetation indices (VIs. These VIs can be used to estimate the biophysical parameters of agricultural crops. However, it is a difficult task to retrieve the SL parameters under the vegetation canopy. A feasible method for retrieving these parameters involves extracting the bottom boundary line in two-dimensional spectral spaces (i.e., red and near-infrared bands. In this study, the slope and intercept of the SL was extracted from Landsat 8 OLI images of a test site in northeastern Germany. Different statistical methods, including the Red-NIRmin method, quantile regression method (using a floating tau with the smallest p-value, and a new approach proposed in this paper using a fixed quantile tau known as the diffuse non-interceptance (DIFN value, were applied to retrieve the SL parameters. The DIFN value describes the amount of light visible below the canopy that reaches the soil surface. Therefore, this value can be used as a threshold for retrieving the bottom soil line. The simulated SLs were compared with actual ones extracted from ground truth data, as recorded by a handheld spectrometer, and were also compared with the SL retrieved from bare soil pixels of the Landsat 8 image collected after harvest. Subsequently, the SL parameters were used to separately estimate the dry biomasses of winter wheat (Triticum aestivum L., barley (Hordeum vulgare L., and canola (Brassica napus L. at the local and field scales using different SL-related vegetation indices. The SL can be retrieved more accurately at the local scale compared with the field scale, and its simulation can be critical in the field due to significant differences from the actual SL. Moreover, the slope and intercept of the simulated SLs

  4. New tools to study biophysical properties of single molecules and single cells

    Directory of Open Access Journals (Sweden)

    Márcio S. Rocha


    Full Text Available We present a review on two new tools to study biophysical properties of single molecules and single cells. A laser incident through a high numerical aperture microscope objective can trap small dielectric particles near the focus. This arrangement is named optical tweezers. This technique has the advantage to permit manipulation of a single individual object. We use optical tweezers to measure the entropic elasticity of a single DNA molecule and its interaction with the drug Psoralen. Optical tweezers are also used to hold a kidney cell MDCK away from the substrate to allow precise volume measurements of this single cell during an osmotic shock. This procedure allows us to obtain information about membrane water permeability and regulatory volume increase. Defocusing microscopy is a recent technique invented in our laboratory, which allows the observation of transparent objects, by simply defocusing the microscope in a controlled way. Our physical model of a defocused microscope shows that the image contrast observed in this case is proportional to the defocus distance and to the curvature of the transparent object. Defocusing microscopy is very useful to study motility and mechanical properties of cells. We show here the application of defocusing microscopy to measurements of macrophage surface fluctuations and their influence on phagocytosis.Apresentamos uma revisão de duas novas técnicas para estudar propriedades biofísicas de moléculas únicas e células únicas. Um laser incidindo em uma objetiva de microscópio de grande abertura numérica é capaz de aprisionar pequenas partículas dielétricas na região próxima ao foco. Este aparato é chamado de pinça óptica. Esta técnica tem a grande vantagem de permitir a manipulação de um objeto individual. Usamos a pinça óptica para medir a elasticidade entrópica de uma molécula única de DNA em sua interação com o fármaco Psoralen. A pinça óptica também é usada para segurar

  5. Principles and biophysical applications of single particle super-localization and rotational tracking (United States)

    Gu, Yan

    While conventional Single Particle Tracking (SPT) techniques acquire 2D or 3D trajectories of particle probes, we have developed Single Particle Orientation and Rotational Tracking (SPORT) techniques to extract orientation and rotational information. Combined with DIC microscopy, the SPORT technique has been applied in biophysical studies, including membrane diffusion and intracellular transport. The rotational dynamics of nanoparticle vectors on live cell membranes was recorded and its influence on the fate of these nanoparticle vectors was elucidated. The rotational motions of gold nanorods with various surface modifiers were tracked continuously at a temporal resolution of 5 ms under a DIC microscope. We found that the rotational behaviors of gold nanorod vectors are strongly related to their surface charge, specific surface functional groups, and the availability of receptors on cell membranes. The study of rotational Brownian motion of nanoparticles on cell membranes will lead to a better understanding of the mechanisms of drug delivery and provide guidance in designing surface modification strategies for drug delivery vectors under various circumstances. To characterize the rotation mode of surface functionalized gold nanorods on cell membranes, the SPORT technique is combined with the correlation analysis of the bright and dark DIC intensities. The unique capabilities of visualizing and understanding rotational motions of functionalized nanoparticles on live cell membranes allow us to correlate rotational and translational dynamics in unprecedented detail and provide new insights for complex membrane processes, including electrostatic interactions, ligand-receptor binding, and lateral (confined and hopping) diffusion of membrane receptors. Surface-functionalized nanoparticles interact with the membrane in fundamentally different ways and exhibit distinct rotational modes. The early events of particle-membrane approach and attachment are directly visualized

  6. Principles and biophysical applications of single particle super-localization and rotational tracking

    Energy Technology Data Exchange (ETDEWEB)

    Gu, Yan [Iowa State Univ., Ames, IA (United States)


    While conventional Single Particle Tracking (SPT) techniques acquire 2D or 3D trajectories of particle probes, we have developed Single Particle Orientation and Rotational Tracking (SPORT) techniques to extract orientation and rotational information. Combined with DIC microscopy, the SPORT technique has been applied in biophysical studies, including membrane diffusion and intracellular transport. The rotational dynamics of nanoparticle vectors on live cell membranes was recorded and its influence on the fate of these nanoparticle vectors was elucidated. The rotational motions of gold nanorods with various surface modifiers were tracked continuously at a temporal resolution of 5 ms under a DIC microscope. We found that the rotational behaviors of gold nanorod vectors are strongly related to their surface charge, specific surface functional groups, and the availability of receptors on cell membranes. The study of rotational Brownian motion of nanoparticles on cell membranes will lead to a better understanding of the mechanisms of drug delivery and provide guidance in designing surface modification strategies for drug delivery vectors under various circumstances. To characterize the rotation mode of surface functionalized gold nanorods on cell membranes, the SPORT technique is combined with the correlation analysis of the bright and dark DIC intensities. The unique capabilities of visualizing and understanding rotational motions of functionalized nanoparticles on live cell membranes allow us to correlate rotational and translational dynamics in unprecedented detail and provide new insights for complex membrane processes, including electrostatic interactions, ligand-receptor binding, and lateral (confined and hopping) diffusion of membrane receptors. Surface-functionalized nanoparticles interact with the membrane in fundamentally different ways and exhibit distinct rotational modes. The early events of particle-membrane approach and attachment are directly visualized

  7. Anti-pulmonary fibrotic activity of salvianolic acid B was screened by a novel method based on the cyto-biophysical properties. (United States)

    Liu, Miao; Zheng, Mingjing; Xu, Hanying; Liu, Lianqing; Li, Yanchun; Xiao, Wei; Li, Jianchun; Ma, Enlong

    Various methods have been used to evaluate anti-fibrotic activity of drugs. However, most of them are complicated, labor-intensive and lack of efficiency. This study was intended to develop a rapid method for anti-fibrotic drugs screening based on biophysical properties. A549 cells in vitro were stimulated with transforming growth factor-β1 (TGF-β1), and fibrogenesis was confirmed by conventional immunological assays. Meanwhile, the alterations of cyto-biophysical properties including morphology, roughness and stiffness were measured utilizing atomic force microscopy (AFM). It was found that fibrogenesis was accompanied with changes of cellular biophysical properties. TGF-β1-stimulated A549 cells became remarkably longer, rougher and stiffer than the control. Then, the effect of N-acetyl-L-cysteine (NAC) as a positive drug on ameliorating fibrogenesis in TGF-β1-stimulated A549 cells was verified respectively by immunological and biophysical markers. The result of Principal Component Analysis showed that stiffness was a leading index among all biophysical markers during fibrogenesis. Salvianolic acid B (SalB), a natural anti-oxidant, was detected by AFM to protect TGF-β1-stimulated A549 cells against stiffening. Then, SalB treatment was provided in preventive mode on a rat model of bleomycin (BLM) -induced pulmonary fibrosis. The results showed that SalB treatment significantly ameliorated BLM-induced histological alterations, blocked collagen accumulations and reduced α-SMA expression in lung tissues. All these results revealed the anti-pulmonary fibrotic activity of SalB. Detection of cyto-biophysical properties were therefore recommended as a rapid method for anti-pulmonary fibrotic drugs screening.

  8. Digital soil mapping for the support of delineation of Areas Facing Natural Constraints defined by common European biophysical criteria (United States)

    Pásztor, László; Bakacsi, Zsófia; Laborczi, Annamária; Takács, Katalin; Szatmári, Gábor; Tóth, Tibor; Szabó, József


    One of the main objectives of the EU's Common Agricultural Policy is to encourage maintaining agricultural production in Areas Facing Natural Constraints (ANC) in order to sustain agricultural production and use natural resources, in such a way to secure both stable production and income to farmers and to protect the environment. ANC assignment has both ecological and severe economical aspects. Recently the delimitation of ANCs is suggested to be carried out by using common biophysical diagnostic criteria on low soil productivity and poor climate conditions all over Europe. The criterion system was elaborated and has been repeatedly upgraded by JRC. The operational implementation is under member state competence. This process requires application of available soil databases and proper thematic and spatial inference methods. In our paper we present the inferences applied for the latest identification and delineation of areas with low soil productivity in Hungary according to JRC biophysical criteria related to soil: limited soil drainage, texture and stoniness (coarse texture, heavy clay, vertic properties), shallow rooting depth, chemical properties (salinity, sodicity, low pH). The compilation of target specific maps were based on the available legacy and recently collected data. In the present work three different data sources were used. The most relevant available data were queried from the datasets for each mapped criterion for either direct application or for the compilation a suitable, synthetic (non-measured) parameter. In some cases the values of the target variable originated from only one, in other cases from more databases. The reference dataset used in the mapping process was set up after substantial statistical analysis and filtering. It consisted of the values of the target variable attributed to the finally selected georeferenced locations. For spatial inference regression kriging was applied. Accuracy assessment was carried out by Leave One Out

  9. Superimposing various biophysical and social scales in a rapidly changing rural area (SW Niger) (United States)

    Leduc, Christian; Massuel, Sylvain; Favreau, Guillaume; Cappelaere, Bernard; Leblanc, Marc; Bachir, Salifou; Ousmane, Boureïma


    In SW Niger, close to Niamey, a detailed hydrological survey has been developed for the last 20 years (international experiments HAPEX-SAHEL and later AMMA), investigating the distribution of water in atmosphere, surface, soil and aquifers. It covers an area of about 10 000 km2, with a series of imbricated scales of instrumentation, in time and space. This dense long term field observation led to many major scientific results. Among them, one of the most original and paradoxical is the continuous rise of the water table, even during the severe droughts of the 1970s and 1980s (about 3 m in the last 30 years). In spite of a large apparent homogeneity of the biophysical environment throughout the region, numerous heterogeneities exist at different scales, complicating the hydrological analysis. On the surface, the hydrological system was, ~6000 years ago, a structured drainage network leading to the Niger River. It was later broken into much smaller elements by aeolian dunes deposited during arid episodes and the study area now appears as a juxtaposition of hundreds of small endorheic catchments (most often 1 to 20 km2) where the surface runoff finally ends in temporary ponds. During most violent rainy events, erosion can be locally very severe and modify durably the size of the catchment and the local hydrology. Conversely, during smaller rainy events, surface runoff may never reach the ponds because it infiltrates in more permeable zones at mid-slope. The actual surface area of the catchment contributing to the surface runoff thus varies considerably with time. Because of their great number, only a few catchments are instrumented and extrapolation of measurements to ungauged catchments is an additional difficulty. Most of water temporarily stored in ponds infiltrates and recharges groundwater. The Continental Terminal (CT) aquifer system is made of three independent layers, of which the upper one (CT3) is only considered here. The CT aquifer systems is a

  10. Molecular dynamics simulations and docking enable to explore the biophysical factors controlling the yields of engineered nanobodies (United States)

    Soler, Miguel A.; de Marco, Ario; Fortuna, Sara


    Nanobodies (VHHs) have proved to be valuable substitutes of conventional antibodies for molecular recognition. Their small size represents a precious advantage for rational mutagenesis based on modelling. Here we address the problem of predicting how Camelidae nanobody sequences can tolerate mutations by developing a simulation protocol based on all-atom molecular dynamics and whole-molecule docking. The method was tested on two sets of nanobodies characterized experimentally for their biophysical features. One set contained point mutations introduced to humanize a wild type sequence, in the second the CDRs were swapped between single-domain frameworks with Camelidae and human hallmarks. The method resulted in accurate scoring approaches to predict experimental yields and enabled to identify the structural modifications induced by mutations. This work is a promising tool for the in silico development of single-domain antibodies and opens the opportunity to customize single functional domains of larger macromolecules. PMID:27721441

  11. A New Biophysical Metric for Interrogating the Information Content in Human Genome Sequence Variation: Proof of Concept

    CERN Document Server

    Lindesay, James; Ricks-Santi, Luisel; Hercules, William; Kurian, Philip; Dunston, Georgia M


    Various studies have shown an association between single nucleotide polymorphisms (SNPs) and common disease. We hypothesize that information encoded in the structure of SNP haploblock variation illumines molecular pathways and cellular mechanisms involved in the regulation of host adaptation to the environment. We developed and utilized the normalized information content (NIC), a novel metric based on SNP haploblock variation. We found that all SNP haploblocks with statistically low information content contained putative transcription factor binding sites and microRNA motifs. We were able to translate a biophysical, mathematical measure of common variants into a deeper understanding of the life sciences through analysis of biochemical patterns associated with SNP haploblock variation. We submit that this new metric, NIC, may be useful in decoding the functional significance of common variation in the human genome and in analyzing the regulation of molecular pathways involved in host adaptation to environmenta...

  12. Molecular dynamics simulations and docking enable to explore the biophysical factors controlling the yields of engineered nanobodies (United States)

    Soler, Miguel A.; De Marco, Ario; Fortuna, Sara


    Nanobodies (VHHs) have proved to be valuable substitutes of conventional antibodies for molecular recognition. Their small size represents a precious advantage for rational mutagenesis based on modelling. Here we address the problem of predicting how Camelidae nanobody sequences can tolerate mutations by developing a simulation protocol based on all-atom molecular dynamics and whole-molecule docking. The method was tested on two sets of nanobodies characterized experimentally for their biophysical features. One set contained point mutations introduced to humanize a wild type sequence, in the second the CDRs were swapped between single-domain frameworks with Camelidae and human hallmarks. The method resulted in accurate scoring approaches to predict experimental yields and enabled to identify the structural modifications induced by mutations. This work is a promising tool for the in silico development of single-domain antibodies and opens the opportunity to customize single functional domains of larger macromolecules.

  13. Biophysical-and socioeconomic aspects of land degradation in the Guadalentin (SE-Spain): towards understanding and effective soil conservation

    Energy Technology Data Exchange (ETDEWEB)

    Vente, J. de; Sole-Benet, A.; Boix-Fayos, C.; Nainggolan, D.; Romero-Diaz, A.


    Desertification and land degradation have been widely studied in the Guadalentin basin (SE Spain) through various national and international research projects. Most important identified degradation types are due to soil erosion, soil surface crusting, aridity, soil organic matter decline and salinisation. On the one hand, political and socioeconomic drivers have caused important land use and management changes, which have formed an important driver for further land degradation. On the other hand, soil conservation practice were initiated by the government and by individual land users, although there is very limited knowledge on their effectiveness. the objective of this work is to provide and overview of previous studies that addressed land degradation in the Guadalentin and to present an integrated synthesis of the main biophysical and socioeconomic factors identifies in these studies as being responsible for land degradation, with a focus on feasible soil conservation strategies. (Author) 18 refs.

  14. Lipid phase behavior studied with a quartz crystal microbalance: A technique for biophysical studies with applications in screening (United States)

    Peschel, Astrid; Langhoff, Arne; Uhl, Eva; Dathathreyan, Aruna; Haindl, Susanne; Johannsmann, Diethelm; Reviakine, Ilya


    Quartz crystal microbalance (QCM) is emerging as a versatile tool for studying lipid phase behavior. The technique is attractive for fundamental biophysical studies as well applications because of its simplicity, flexibility, and ability to work with very small amounts of material crucial for biomedical studies. Further progress hinges on the understanding of the mechanism, by which a surface-acoustic technique such as QCM, senses lipid phase changes. Here, we use a custom-built instrument with improved sensitivity to investigate phase behavior in solid-supported lipid systems of different geometries (adsorbed liposomes and bilayers). We show that we can detect a model anesthetic (ethanol) through its effect on the lipid phase behavior. Further, through the analysis of the overtone dependence of the phase transition parameters, we show that hydrodynamic effects are important in the case of adsorbed liposomes, and viscoelasticity is significant in supported bilayers, while layer thickness changes make up the strongest contribution in both systems.

  15. Alteration of membrane lipid biophysical properties and resistance of human lung adenocarcinoma A549 cells to cisplatin

    Institute of Scientific and Technical Information of China (English)


    Alterations of membrane lipid biophysical properties of sensitiveA549 and resistant A549/DDP cells to the Cis-dichlorodiammine platinum (Cisplatin) were performed by measurements of fluorescence and flow cytometry approaches using fluorescence dyes of DPH, N-AS and Merocyanine 540 (MC 540) respectively. Fatty acids of membrane lipid of the two cell lines were analyzed by gas chromatography. The results indicated clearly that fluorescence polarization (P) of the DPH probe is 0.169 for the sensitive A549 cell and 0.194 for the resistant A549/DDP cells. Statistical analysis showed significant difference between the two cell lines. The polarizations of 2-AS and 7-AS which reflect the fluidity of surface and middle of lipid bilayer are 0.134 and 0.144 for the sensitive A549 cells as well as 0.171 and 0.178 for the resistant A549/DDP cells respectively, but there is no significant difference of the polarization of 12-AS between the two cell lines. This shows that altera-tions of the membrane fluidity of both cells were mainly located on the surface and middle of the lipid bilayer. In addition, the packing density of phospholipid molecules in the membrane of the two cell lines detected by MC540 probe indicated that lipid packing of A549 cell membranes was looser than that of the A549/DDP cells. And unsaturation degree of plasma membrane fatty acids of the A549/DDP cells was also lower than that of A549 cells. Taken together, it was proposed that the al-teration of membrane lipid biophysical state may be involved in the resistance of A549/DDP cells to cisplatin.

  16. Genotype-induced changes in biophysical properties of frontal cortex lipid raft from APP/PS1 transgenic mice

    Directory of Open Access Journals (Sweden)

    Mario L Diaz


    Full Text Available Alterations in the lipid composition of lipid rafts have been demonstrated both in human brain and transgenic mouse models, and it has been postulated that aberrant lipid composition in lipid rafts is partly responsible for neuronal degeneration. In order to assess the impact of lipid changes on lipid raft functional properties, we have aimed at determining relevant physicochemical modifications in lipid rafts purified from frontal cortex of wild type (WT and APP/PS1 double transgenic mice. By means of steady-state fluorescence anisotropy analyses using two lipid soluble fluorescent probes, TMA-DPH (1-[(4-trimethyl-aminophenyl]-6-phenyl-1,3,5-hexatriene and DPH (1,6-diphenyl-1,3,5-hexatriene, we demonstrate that cortical lipid rafts from WT and APP/PS1 animals exhibit different biophysical behaviours, depending on genotype but also on age. Thus, aged APP/PS1 animals exhibited slightly more liquid-ordered lipid rafts than WT counterparts. Membrane microviscosity napp analyses demonstrate that WT lipid rafts are more fluid than APP/PS1 animals of similar age, both at the aqueous interface and hydrophobic core of the membrane. napp in APP/PS1 animals was higher for DPH than for TMA-DPH under similar experimental conditions, indicating that the internal core of the membrane is more viscous than the raft membrane at the aqueous interface. The most dramatic changes in biophysical properties of lipid rafts were observed when membrane cholesterol was depleted with methyl-beta-cyclodextrin. Overall, our results indicate that APP/PS1 genotype strongly affects physicochemical properties of lipid raft. Such alterations appear not to be homogeneous across the raft membrane axis, but rather are more prominent at the membrane plane. These changes correlate with aberrant proportions of sphingomyelin, cholesterol and saturated fatty acids, as well as polyunsaturated fatty acids, measured in lipid rafts from frontal cortex in this familial model of

  17. Interaction of carbonylcyanide p-trifluoromethoxyphenylhydrazone (FCCP) with lipid membrane systems: a biophysical approach with relevance to mitochondrial uncoupling. (United States)

    Monteiro, João P; Martins, André F; Lúcio, Marlene; Reis, Salette; Geraldes, Carlos F G C; Oliveira, Paulo J; Jurado, Amália S


    FCCP (carbonylcyanide p-trifluoromethoxyphenylhydrazone), a classical uncoupler of mitochondrial oxidative phosphorylation, is used in this study as a model to clarify how interactions of uncouplers with membrane lipid bilayers may influence membrane biophysics and their protonophoric activity itself. In order to disclose putative effects that may be important when considering using uncouplers for pharmacological purposes, an extensive characterization of FCCP membrane lipid interactions using accurate biophysical approaches and simple model lipid systems was carried out. Differential scanning calorimetry studies showed that FCCP molecules disturb lipid bilayers and favor lateral phase separation in mixed lipid systems. (31)P NMR assays indicated that FCCP alters the curvature elastic properties of membrane models containing non-bilayer lipids, favoring lamellar/H(II) transition, probably by alleviation of hydrocarbon-packing constraints in the inverted hexagonal phase. Taking advantage of FCCP quenching effects on the fluorescent probes DPH (1,6-diphenyl-1,3,5-hexatriene) and DPH-PA (3-(p-(6-phenyl)-1,3,5-hexatrienyl)phenylpropionic acid), it is demonstrated that FCCP distributes across the bilayer thickness in both a single and a ternary lipid system mimicking the inner mitochondrial membrane. This behavior is consistent with the ability of the compound to migrate through the thickness of the inner mitochondrial membrane, an event required for its protonophoric activity. Finally, the study of the membrane fluidity in different lipid systems, as reported by the rotational correlation time (θ) of DPH or DPH-PA, showed that the extension at which FCCP disturbs membrane properties associated with the dynamics and the order of lipid molecules depends on the lipid composition of the model lipid system assayed.

  18. The Biophysical Characterisation and SAXS Analysis of Human NLRP1 Uncover a New Level of Complexity of NLR Proteins (United States)

    Martino, Luigi; Holland, Louise; Christodoulou, Evangelos; Kunzelmann, Simone; Esposito, Diego


    NOD-like receptors represent an important class of germline-encoded pattern recognition receptors that play key roles in the regulation of inflammatory signalling pathways. They function as danger sensors and initiate inflammatory responses and the production of cytokines. Since NLR malfunction results in chronic inflammation and auto-immune diseases, there is a great interest in understanding how they work on a molecular level. To date, a lot of insight into the biological functions of NLRs is available but biophysical and structural studies have been hampered by the difficulty to produce soluble and stable recombinant NLR proteins. NLRP1 is an inflammasome forming NLR that is believed to be activated by binding to MDP and induces activation of caspase 1. Here, we report the identification of a soluble fragment of NLRP1 that contains the NACHT oligomerization domain and the putative MDP-sensing LRR domain. We describe the biophysical and biochemical characterization of this construct and a SEC-SAXS analysis that allowed the calculation of a low resolution molecular envelope. Our data indicate that the protein is constitutively bound to ATP with a negligible ability to hydrolyse the triphosphate nucleotide and that it adopts a monomeric extended conformation that is reminiscent of the structure adopted by NLRC4 in the inflammasome complex. Furthermore, we show that the presence of MDP is not sufficient to promote self-oligomerization of the NACHT-LRR fragment suggesting that MDP may either bind to regions outside the NACHT-LRR module or that it may not be the natural ligand of NLRP1. Taken together, our data suggest that the NLRP1 mechanism of action differs from that recently reported for other NLRs. PMID:27727326

  19. Synthesis, biological, and biophysical studies of DAG-indololactones designed as selective activators of RasGRP. (United States)

    Garcia, Lia C; Donadío, Lucia Gandolfi; Mann, Ella; Kolusheva, Sofiya; Kedei, Noemi; Lewin, Nancy E; Hill, Colin S; Kelsey, Jessica S; Yang, Jing; Esch, Timothy E; Santos, Marina; Peach, Megan L; Kelley, James A; Blumberg, Peter M; Jelinek, Raz; Marquez, Victor E; Comin, Maria J


    The development of selective agents capable of discriminating between protein kinase C (PKC) isoforms and other diacylglycerol (DAG)-responsive C1 domain-containing proteins represents an important challenge. Recent studies have highlighted the role that Ras guanine nucleotide-releasing protein (RasGRP) isoforms play both in immune responses as well as in the development of prostate cancer and melanoma, suggesting that the discovery of selective ligands could have potential therapeutic value. Thus far, the N-methyl-substituted indololactone 1 is the agonist with the highest reported potency and selectivity for RasGRP relative to PKC. Here we present the synthesis, binding studies, cellular assays and biophysical analysis of interactions with model membranes of a family of regioisomers of 1 (compounds 2-5) that differ in the position of the linkage between the indole ring and the lactone moiety. These structural variations were studied to explore the interaction of the active complex (C1 domain-ligand) with cellular membranes, which is believed to be an important factor for selectivity in the activation of DAG-responsive C1 domain containing signaling proteins. All compounds were potent and selective activators of RasGRP when compared to PKCα with selectivities ranging from 6 to 65 fold. However, the parent compound 1 was appreciably more selective than any of the other isomers. In intact cells, modest differences in the patterns of translocation of the C1 domain targets were observed. Biophysical studies using giant vesicles as model membranes did show substantial differences in terms of molecular interactions impacting lipid organization, dynamics and membrane insertion. However, these differences did not yield correspondingly large changes in patterns of biological response, at least for the parameters examined.

  20. The combined influence of substrate elasticity and ligand density on the viability and biophysical properties of hematopoietic stem and progenitor cells. (United States)

    Choi, Ji S; Harley, Brendan A C


    Hematopoietic stem cells (HSCs) are adult stem cells with the capacity to give rise to all blood and immune cells in the body. HSCs are housed in a specialized microenvironment known as the stem cell niche, which provides intrinsic and extrinsic signals to regulate HSC fate: quiescence, self-renewal, differentiation, mobilization, homing, and apoptosis. These niches provide a complex, three dimensional (3D) microenvironment consisting of cells, the extracellular matrix (ECM), and ECM-bound or soluble biomolecules that provides cellular, structural, and molecular signals that regulate HSC fate decisions. In this study, we examined the decoupled effects of substrate elasticity, construct dimensionality, and ligand concentration on the biophysical properties of primary hematopoietic stem and progenitor cells (HSPCs) using homologous series of two and three dimensional microenvironments. Microenvironments were chosen to span the range of biophysical environments presented physiologically within the bone marrow, ranging from soft marrow and adipose tissue (cell membranes (1-3 kPa), to developing osteoid (>30 kPa). We additionally investigated the influence of collagen ligand density on HSPC biophysical parameters and compared these behaviors to those observed in HSPCs grown in culture on stiff glass substrates. This work suggests the potential for substrate stiffness and ligand density to directly affect the biophysical properties of primary hematopoietic stem and progenitor cells at the single cell level and that these parameters may be critical design criteria for the development of artificial HSC niches.

  1. Immunogenicity of Recombinant Human Interferon Beta-1b in Immune-Tolerant Transgenic Mice Corresponds with the Biophysical Characteristics of Aggregates

    NARCIS (Netherlands)

    Haji Abdolvahab, Mohadeseh; Fazeli, Ahmad; Halim, Andhyk; Sediq, Ahmad S; Fazeli, Mohammad Reza; Schellekens, Huub


    Determining to what extent biophysical characteristics of aggregates affect immunogenicity of therapeutic interferon beta-1b. Three recombinant human interferon beta-1b (rhIFNβ-1b) samples with different levels of aggregates generated by copper oxidation, thermal stress, or left untreated, as well a

  2. Deciphering the Biophysical Effects of Oxidizing Sulfur-Containing Amino Acids in Interferon-beta-1a using MS and HDX-MS (United States)

    Houde, Damian J.; Bou-Assaf, George M.; Berkowitz, Steven A.


    Introduction of a chemical change to one or more amino acids in a protein's polypeptide chain can result in various effects on its higher-order structure (HOS) and biophysical behavior (or properties). These effects range from no detectable change to significant structural or conformational alteration that can greatly affect the protein's biophysical properties and its resulting biological function. The ability to reliably detect the absence or presence of such changes is essential to understanding the structure-function relationship in a protein and in the successful commercial development of protein-based drugs (biopharmaceuticals). In this paper, we focus our attention on the latter by specifically elucidating the impact of oxidation on the HOS, structural dynamics, and biophysical properties of interferon beta-1a (IFNβ-1a). Oxidation is a common biochemical modification that occurs in many biopharmaceuticals, specifically in two naturally-occurring sulfur-containing amino acids, methionine and cysteine. To carry out this work, we used combinations of hydrogen peroxide and pH to differentially oxidize IFNβ-1a (to focus on only methionine oxidation versus methionine and cysteine oxidation). We then employed several analytical and biophysical techniques to acquire information about the differential impact of these two oxidation scenarios on IFNβ-1a. In particular, the use of MS-based techniques, especially HDX-MS, play a dominant role in revealing the differential effects.

  3. Biophysical analysis of bacterial and viral systems. A shock tube study of bio-aerosols and a correlated AFM/nanosims investigation of vaccinia virus

    Energy Technology Data Exchange (ETDEWEB)

    Gates, Sean Damien [Stanford Univ., CA (United States)


    The work presented herein is concerned with the development of biophysical methodology designed to address pertinent questions regarding the behavior and structure of select pathogenic agents. Two distinct studies are documented: a shock tube analysis of endospore-laden bio-aerosols and a correlated AFM/NanoSIMS study of the structure of vaccinia virus.

  4. Arrhythmogenic Biophysical Phenotype for SCN5A Mutation S1787N Depends upon Splice Variant Background and Intracellular Acidosis.

    Directory of Open Access Journals (Sweden)

    Rou-Mu Hu

    Full Text Available SCN5A is a susceptibility gene for type 3 long QT syndrome, Brugada syndrome, and sudden infant death syndrome. INa dysfunction from mutated SCN5A can depend upon the splice variant background in which it is expressed and also upon environmental factors such as acidosis. S1787N was reported previously as a LQT3-associated mutation and has also been observed in 1 of 295 healthy white controls. Here, we determined the in vitro biophysical phenotype of SCN5A-S1787N in an effort to further assess its possible pathogenicity.We engineered S1787N in the two most common alternatively spliced SCN5A isoforms, the major isoform lacking a glutamine at position 1077 (Q1077del and the minor isoform containing Q1077, and expressed these two engineered constructs in HEK293 cells for electrophysiological study. Macroscopic voltage-gated INa was measured 24 hours after transfection with standard whole-cell patch clamp techniques. We applied intracellular solutions with pH7.4 or pH6.7. S1787N in the Q1077 background had WT-like INa including peak INa density, activation and inactivation parameters, and late INa amplitude in both pH 7.4 and pH 6.7. However, with S1787N in the Q1077del background, the percentages of INa late/peak were increased by 2.1 fold in pH 7.4 and by 2.9 fold in pH 6.7 when compared to WT.The LQT3-like biophysical phenotype for S1787N depends on both the SCN5A splice variant and on the intracellular pH. These findings provide further evidence that the splice variant and environmental factors affect the molecular phenotype of cardiac SCN5A-encoded sodium channel (Nav1.5, has implications for the clinical phenotype, and may provide insight into acidosis-induced arrhythmia mechanisms.

  5. Activity and biophysical inhibition resistance of a novel synthetic lung surfactant containing Super-Mini-B DATK peptide

    Directory of Open Access Journals (Sweden)

    Robert H. Notter


    Full Text Available Background/objectives. This study examines the surface activity, resistance to biophysical inhibition, and pulmonary efficacy of a synthetic lung surfactant containing glycerophospholipids combined with Super Mini-B (S-MB DATK, a novel and stable molecular mimic of lung surfactant protein (SP-B. The objective of the work is to test whether S-MB DATK synthetic surfactant has favorable biophysical and physiological activity for future use in treating surfactant deficiency or dysfunction in lung disease or injury.Methods. The structure of S-MB DATK peptide was analyzed by homology modeling and by FTIR spectroscopy. The in vitro surface activity and inhibition resistance of synthetic S-MB DATK surfactant was assessed in the presence and absence of albumin, lysophosphatidylcholine (lyso-PC, and free fatty acids (palmitoleic and oleic acid. Adsorption and dynamic surface tension lowering were measured with a stirred subphase dish apparatus and a pulsating bubble surfactometer (20 cycles/min, 50% area compression, 37 °C. In vivo pulmonary activity of S-MB DATK surfactant was measured in ventilated rabbits with surfactant deficiency/dysfunction induced by repeated lung lavages that resulted in arterial PO2 values <100 mmHg.Results. S-MB DATK surfactant had very high surface activity in all assessments. The preparation adsorbed rapidly to surface pressures of 46–48 mN/m at 37 °C (low equilibrium surface tensions of 22–24 mN/m, and reduced surface tension to <1 mN/m under dynamic compression on the pulsating bubble surfactometer. S-MB DATK surfactant showed a significant ability to resist inhibition by serum albumin, C16:0 lyso-PC, and free fatty acids, but surfactant inhibition was mitigated by increasing surfactant concentration. S-MB DATK synthetic surfactant quickly improved arterial oxygenation and lung compliance after intratracheal instillation to ventilated rabbits with severe surfactant deficiency.Conclusions. S-MB DATK is an active mimic

  6. Evaluation of Uterine Biophysical Profile and to Assess its Role in Predicting Conception among Unexplained Primary Infertility Patients

    Directory of Open Access Journals (Sweden)

    Pooja Gupta


    Full Text Available Introduction: Infertility is a devastating disease which affects its victims at a very basic level the ability to reproduce. This can be divisive to the couples involved, their relatives and friends. The influence of infertility can be immense. There are a lot of medical and social consequences of infertility and the psychological sequelae are one of them. Affected patients and their families suffer from loss of esteem, disappointment and depression. Considering the immense effect of infertility on the life of not only the affected couples but also on their families and relatives the present study was conducted with following objective. Objective: To evaluate the Uterine Biophysical Profile and to assess its role in predicting the conception outcome in spontaneous cycles in patients with unexplained primary infertility. Material &Methods: A prospective observational study was conducted in the Department of Obstetrics and Gynaecology, U.P. Rural Institute of Medical Sciences & Research, Saifaion 55 women with unexplained primary infertility after standard diagnostic work up. Ultrasound (TVS measurement of all patients was performed in their midcycle of spontaneous cycle. The Uterine Biophysical Profile (UBP i.e. certain sonographic qualities of the uterus were noted during the normal mid-cycle of these patients. These included 7 parameters: Endometrial thickness in greatest AP dimension of 7 mm or greater (full-thickness measurement, a layered ("5 line" appearance to the endometrium, myometrial contractions causing a wave like motion of the endometrium, homogeneous myometrial echogenicity, uterine artery blood flow (as measured by PI, less than 3.0, blood flow within zone 3 using color doppler technique, myometrial blood flow seen on gray-scale examination. The Uterine Scoring System for Reproduction ("USSR" was used to evaluate the total score. Results: Among 55 unexplained primary infertility patients 24 i.e. 43.63% conceived by serial

  7. An iterative strategy combining biophysical criteria and duration hidden Markov models for structural predictions of Chlamydia trachomatis σ66 promoters

    Directory of Open Access Journals (Sweden)

    Ojcius David M


    Full Text Available Abstract Background Promoter identification is a first step in the quest to explain gene regulation in bacteria. It has been demonstrated that the initiation of bacterial transcription depends upon the stability and topology of DNA in the promoter region as well as the binding affinity between the RNA polymerase σ-factor and promoter. However, promoter prediction algorithms to date have not explicitly used an ensemble of these factors as predictors. In addition, most promoter models have been trained on data from Escherichia coli. Although it has been shown that transcriptional mechanisms are similar among various bacteria, it is quite possible that the differences between Escherichia coli and Chlamydia trachomatis are large enough to recommend an organism-specific modeling effort. Results Here we present an iterative stochastic model building procedure that combines such biophysical metrics as DNA stability, curvature, twist and stress-induced DNA duplex destabilization along with duration hidden Markov model parameters to model Chlamydia trachomatis σ66 promoters from 29 experimentally verified sequences. Initially, iterative duration hidden Markov modeling of the training set sequences provides a scoring algorithm for Chlamydia trachomatis RNA polymerase σ66/DNA binding. Subsequently, an iterative application of Stepwise Binary Logistic Regression selects multiple promoter predictors and deletes/replaces training set sequences to determine an optimal training set. The resulting model predicts the final training set with a high degree of accuracy and provides insights into the structure of the promoter region. Model based genome-wide predictions are provided so that optimal promoter candidates can be experimentally evaluated, and refined models developed. Co-predictions with three other algorithms are also supplied to enhance reliability. Conclusion This strategy and resulting model support the conjecture that DNA biophysical properties

  8. Fluorescence quantum yield measurements of fluorescent proteins: a laboratory experiment for a biochemistry or molecular biophysics laboratory course. (United States)

    Wall, Kathryn P; Dillon, Rebecca; Knowles, Michelle K


    Fluorescent proteins are commonly used in cell biology to assess where proteins are within a cell as a function of time and provide insight into intracellular protein function. However, the usefulness of a fluorescent protein depends directly on the quantum yield. The quantum yield relates the efficiency at which a fluorescent molecule converts absorbed photons into emitted photons and it is necessary to know for assessing what fluorescent protein is the most appropriate for a particular application. In this work, we have designed an upper-level, biochemistry laboratory experiment where students measure the fluorescence quantum yields of fluorescent proteins relative to a standard organic dye. Four fluorescent protein variants, enhanced cyan fluorescent protein (ECFP), enhanced green fluorescent protein (EGFP), mCitrine, and mCherry, were used, however the methods described are useful for the characterization of any fluorescent protein or could be expanded to fluorescent quantum yield measurements of organic dye molecules. The laboratory is designed as a guided inquiry project and takes two, 4 hr laboratory periods. During the first day students design the experiment by selecting the excitation wavelength, choosing the standard, and determining the concentration needed for the quantum yield experiment that takes place in the second laboratory period. Overall, this laboratory provides students with a guided inquiry learning experience and introduces concepts of fluorescence biophysics into a biochemistry laboratory curriculum.

  9. DNA binding and apoptotic induction ability of harmalol in HepG2: Biophysical and biochemical approaches. (United States)

    Sarkar, Sarita; Bhattacharjee, Paromita; Bhadra, Kakali


    Harmalol administration caused remarkable reduction in proliferation of HepG2 cells with GI50 of 14.2 μM, without showing much cytotoxicity in embryonic liver cell line, WRL-68. Data from circular dichroism (CD) and differential scanning calorimetric (DSC) analysis of harmalol-CT DNA complex shows conformational changes with prominent CD perturbation and stabilization of CT DNA by 8 °C. Binding constant and stoichiometry was calculated using the above biophysical techniques. The Scatchard plot constructed from CD data showed cooperative binding, from which the cooperative binding affinity (K'ω) of 4.65 ± 0.7 × 10(5) M(-1), and n value of 4.16 were deduced. The binding parameter obtained from DSC melting data was in good agreement with the above CD data. Furthermore, dose dependent apoptotic induction ability of harmalol was studied in HepG2 cells using different biochemical assays. Generation of ROS, DNA damage, changes in cellular external and ultramorphology, alteration of membrane, formation of comet tail, decreased mitochondrial membrane potential and a significant increase in Sub Go/G1 population made the cancer cell, HepG2, prone to apoptosis. Up regulation of p53 and caspase 3 further indicated the apoptotic role of harmalol.

  10. Biophysical and Structural Studies on the Capsid Protein of the Human Immunodeficiency Virus Type 1: A New Drug Target?

    Directory of Open Access Journals (Sweden)

    José L. Neira


    Full Text Available AIDS affects 30 million people worldwide and is one of the deadliest epidemics in human history. It is caused by a retrovirus, HIV, whose mature capsid (enclosing the RNA with other proteins is formed by the assembly of several hundred copies of a protein, CA*. The C-terminal domain of such protein, CAC, is a driving force in virus assembly and the connections in the mature capsid lattice indicate that CAC joins through homodimerization of the CA hexamers. In the first part of this work, I shall review the biophysical studies carried out with the dimeric wild-type CAC protein and a mutant monomeric variant. The results open new venues for the development of drugs able to interact either with the dimeric species, hampering its assembly, or with the monomeric species, obstructing its folding. In the second part of this review, I shall describe the structures of complexes of CAC with small molecules able to weaken its dimerization. Furthermore, interactions with other proteins and lipids are also described. The whole set of results suggests that much of the surface of CAC does not accommodate binding per se, but rather binding sites in the protein are predefined, i.e., there are “hot” spots for binding in CAC (whatever be the molecule to bind. These “hot” residues involve most of the dimerization interface (an α-helix of the CAC wild-type protein, but also polypeptide patches at the other helices.

  11. Biophysical controls on interannual variability in ecosystem-scale CO2 and CH4 exchange in a California rice paddy (United States)

    Knox, Sara Helen; Matthes, Jaclyn Hatala; Sturtevant, Cove; Oikawa, Patricia Y.; Verfaillie, Joseph; Baldocchi, Dennis


    We present 6.5 years of eddy covariance measurements of fluxes of methane (FCH4) and carbon dioxide (FCO2) from a flooded rice paddy in Northern California, USA. A pronounced warming trend throughout the study associated with drought and record high temperatures strongly influenced carbon (C) budgets and provided insights into biophysical controls of FCO2 and FCH4. Wavelet analysis indicated that photosynthesis (gross ecosystem production, GEP) induced the diel pattern in FCH4, but soil temperature (Ts) modulated its amplitude. Forward stepwise linear models and neural networking modeling were used to assess the variables regulating seasonal FCH4. As expected due to their competence in modeling nonlinear relationships, neural network models explained considerably more of the variance in daily average FCH4 than linear models. During the growing season, GEP and water levels typically explained most of the variance in daily average FCH4. However, Ts explained much of the interannual variability in annual and growing season CH4 sums. Higher Ts also increased the annual and growing season ratio of FCH4 to GEP. The observation that the FCH4 to GEP ratio scales predictably with Ts may help improve global estimates of FCH4 from rice agriculture. Additionally, Ts strongly influenced ecosystem respiration, resulting in large interannual variability in the net C budget at the paddy, emphasizing the need for long-term measurements particularly under changing climatic conditions.

  12. Construct design, biophysical, and biochemical characterization of the fusion core from mouse hepatitis virus (a coronavirus) spike protein. (United States)

    Xu, Yanhui; Cole, David K; Lou, Zhiyong; Liu, Yiwei; Qin, Lan; Li, Xu; Bai, Zhihong; Yuan, Fang; Rao, Zihe; Gao, George F


    Membrane fusion between virus and host cells is the key step for enveloped virus entry and is mediated by the viral envelope fusion protein. In murine coronavirus, mouse hepatitis virus (MHV), the spike (S) protein mediates this process. Recently, the formation of anti-parallel 6-helix bundle of the MHV S protein heptad repeat (HR) regions (HR1 and HR2) has been confirmed, implying coronavirus has a class I fusion protein. This bundle is also called fusion core. To facilitate the solution of the crystal structure of this fusion core, we deployed an Escherichia coli in vitro expression system to express the HR1 and HR2 regions linked together by a flexible linker as a single chain (named 2-helix). This 2-helix polypeptide subsequently assembled into a typical 6-helix bundle. This bundle has been analyzed by a series of biophysical and biochemical techniques and confirmed that the design technique can be used for coronavirus as we successfully used for members of paramyxoviruses.

  13. Rational design, biophysical and biological characterization of site-specific antibody-tubulysin conjugates with improved stability, efficacy and pharmacokinetics. (United States)

    Thompson, Pamela; Fleming, Ryan; Bezabeh, Binyam; Huang, Fengying; Mao, Shenlan; Chen, Cui; Harper, Jay; Zhong, Haihong; Gao, Xizhe; Yu, Xiang-Qing; Hinrichs, Mary Jane; Reed, Molly; Kamal, Adeela; Strout, Patrick; Cho, Song; Woods, Rob; Hollingsworth, Robert E; Dixit, Rakesh; Wu, Herren; Gao, Changshou; Dimasi, Nazzareno


    Antibody-drug conjugates (ADCs) are among the most promising empowered biologics for cancer treatment. ADCs are commonly prepared by chemical conjugation of small molecule cytotoxic anti-cancer drugs to antibodies through either lysine side chains or cysteine thiols generated by the reduction of interchain disulfide bonds. Both methods yield heterogeneous conjugates with complex biophysical properties and suboptimal serum stability, efficacy, and pharmacokinetics. To limit the complexity of cysteine-based ADCs, we have engineered and characterized in vitro and in vivo antibody cysteine variants that allow precise control of both site of conjugation and drug load per antibody molecule. We demonstrate that the chemically-defined cysteine-engineered antibody-tubulysin conjugates have improved ex vivo and in vivo stability, efficacy, and pharmacokinetics when compared to conventional cysteine-based ADCs with similar drug-to-antibody ratios. In addition, to limit the non-target FcγRs mediated uptake of the ADCs by cells of the innate immune system, which may result in off-target toxicities, the ADCs have been engineered to lack Fc-receptor binding. The strategies described herein are broadly applicable to any full-length IgG or Fc-based ADC and have been incorporated into an ADC that is in phase I clinical development.

  14. A Biophysical Model of CRISPR/Cas9 Activity for Rational Design of Genome Editing and Gene Regulation (United States)

    Farasat, Iman; Salis, Howard M.


    The ability to precisely modify genomes and regulate specific genes will greatly accelerate several medical and engineering applications. The CRISPR/Cas9 (Type II) system binds and cuts DNA using guide RNAs, though the variables that control its on-target and off-target activity remain poorly characterized. Here, we develop and parameterize a system-wide biophysical model of Cas9-based genome editing and gene regulation to predict how changing guide RNA sequences, DNA superhelical densities, Cas9 and crRNA expression levels, organisms and growth conditions, and experimental conditions collectively control the dynamics of dCas9-based binding and Cas9-based cleavage at all DNA sites with both canonical and non-canonical PAMs. We combine statistical thermodynamics and kinetics to model Cas9:crRNA complex formation, diffusion, site selection, reversible R-loop formation, and cleavage, using large amounts of structural, biochemical, expression, and next-generation sequencing data to determine kinetic parameters and develop free energy models. Our results identify DNA supercoiling as a novel mechanism controlling Cas9 binding. Using the model, we predict Cas9 off-target binding frequencies across the lambdaphage and human genomes, and explain why Cas9’s off-target activity can be so high. With this improved understanding, we propose several rules for designing experiments for minimizing off-target activity. We also discuss the implications for engineering dCas9-based genetic circuits. PMID:26824432


    Monfredi, Oliver; Lyashkov, Alexey E; Johnsen, Anne-Berit; Inada, Shin; Schneider, Heiko; Wang, Ruoxi; Nirmalan, Mahesh; Wisloff, Ulrik; Maltsev, Victor A; Lakatta, Edward G; Zhang, Henggui; Boyett, Mark R


    Heart rate variability (beat-to-beat changes in the RR interval) has attracted considerable attention over the last 30+ years (PubMed currently lists >17,000 publications). Clinically, a decrease in heart rate variability is correlated to higher morbidity and mortality in diverse conditions, from heart disease to foetal distress. It is usually attributed to fluctuation in cardiac autonomic nerve activity. We calculated heart rate variability parameters from a variety of cardiac preparations (including humans, living animals, Langendorff-perfused heart and single sinoatrial nodal cell) in diverse species, combining this with data from previously published papers. We show that regardless of conditions, there is a universal exponential decay-like relationship between heart rate variability and heart rate. Using two biophysical models, we develop a theory for this, and confirm that heart rate variability is primarily dependent on heart rate and cannot be used in any simple way to assess autonomic nerve activity to the heart. We suggest that the correlation between a change in heart rate variability and altered morbidity and mortality is substantially attributable to the concurrent change in heart rate. This calls for re-evaluation of the findings from many papers that have not adjusted properly or at all for heart rate differences when comparing heart rate variability in multiple circumstances. PMID:25225208

  16. [A new method of identifying a systems based on the minimal quadratic discrepancy criterion for biophysics problems]. (United States)

    Karnaukhov, A V; Karnaukhova, E V


    A wide range of biophysical systems are described by nonlinear dynamic models mathematically presented as a set of ordinary differential equations in the Cauchy explicit form: [formula: see text] Fij(X1(t),..,XN(t),t), (i = 1,...,N, j = 1,...,M), where Fij (X1(t), ..., XN(t), t) is a set of basis functions satisfying the Lipschitz condition. We investigate the problem of evaluation of model constants aij (the system identification) using experimental data about the time dependence of the dynamic parameters of the system Xi(t). A new method of system identification for the class of similar nonlinear dynamic models is proposed. It is shown that the problem of identifying an initial nonlinear model can be reduced to the solution of a system of linear equations for the matrix of the dynamic model constants [aj]i. It is proposed to determine the set of dynamic model constants aij using the criterion of minimal quadratic discrepancy for the time dependence of the set of dynamic parameters Xi(t). An important special case of the nonlinear model, the quadratic model, is considered. Test problems of identification using this method are presented for two nonlinear systems: the Van der Pol type multiparametric nonlinear oscillator and the strange attractor of Ressler, a widely known example of dynamic systems showing the stochastic behavior.

  17. Putting technology and societal dynamics within a biophysical perspective: Is more of the same a sustainable perspective?

    CERN Document Server

    CERN. Geneva


    The wealth of a nation, as recognized in the past by Adam Smith and others, is its resource base, not its Gross National Product. "A tank of gasoline drives a car the same distance regardless of what people are willing to pay for it" (Odum, 1994). Until recently, neoclassical economics has been unsuitable for understanding the role of the biophysical support provided at no cost by the environment to the development of economic processes. In the distant past when populations were small and the extent of human use of the environment was negligible compared to the size of the environment, wealth consisted of a nation?s forests, soils, fisheries and the water and sunlight falling on its landscape. As the fossil fuels increased in amount and came to dominate the energetic base of economies, they allowed the exploitation of mineral resources, which synergistically increased the use of already scarce fossil fuels and in the long run diminished the importance of renewable resources. Our activities a...

  18. Agricultural Yield Trends in Malawi: Utilizing Remote Sensing to Observe Crop Productivity and Sensitivity to Biophysical and Social Drivers (United States)

    Peter, B.


    The primary objective of this research is to distinguish primary and secondary trends in the spatiotemporal variability of agricultural productivity in Malawi. The assessment was performed by analyzing the Net Primary Productivity (NPP) product derived from NASA MODIS satellite imagery and by drawing comparisons between individual land areas and the country-wide statistics. The data were categorized by placing each individual land area into one of six categories: low, average, or high productivity, and whether or not they were resilient or sensitive to biophysical and/or social production drivers. In order to mitigate productivity interference from forest and other land cover types, a custom agricultural land use was developed. Five land cover datasets, including FAO, GLC, IFPRI, GlobCover, and MODIS were combined to minimize errors of commission. Model assessment occurred via field work in Malawi. Approximately 200 sites were visited across nearly the entire extent of the country. Cropland and land cover were assessed via visual inspection, true color/near-infrared photography, and on-site interviews with farmers and extension officers to inquire about productivity and limiting factors for yield. Additionally, we present a continental scale application of the model to demonstrate its performance across scales.

  19. Effects of biophysical constraints, climate and phylogeny on forest shrub allometries along an altitudinal gradient in Northeast China (United States)

    Sun, Han; Wang, Xiangping; Fan, Yanwen; Liu, Chao; Wu, Peng; Li, Qiaoyan; Yin, Weilun


    Whether there is a general allometry law across plant species with different sizes and under different environment has long been controversial and shrubs are particularly useful to examine these questions. Here we sampled 939 individuals from 50 forest shrub species along a large altitudinal gradient. We tested several allometry models with four relationships simultaneously (between stem diameter, height, leaf, stem and aboveground biomass), including geometric, elastic and stress similarity, and metabolic scaling theory’s predictions on small plants (MSTs) and trees (MSTt). We also tested if allometric exponents change markedly with climate and phylogeny. The predicted exponents of MSTt, elastic similarity and stress similarity (models for trees) were not supported by our data, while MSTs and geometric similarity gained more support, suggesting the finite size effect is more important for shrub allometries than being a woody plant. The influence of climate and phylogeny on allometric exponents were not significant or very weak, again suggesting strong biophysical constraints on shrub allometries. Our results reveal clear differences of shrub allometries from previous findings on trees (e.g. much weaker climatic and phylogenic control). Comparisons of herbs, shrubs and trees along a same climatic gradient are needed for better understanding of plant allometries. PMID:28266604

  20. Matching Social and Biophysical Scales in Extensive Livestock Production as a Basis for Adaptation to Global Change (United States)

    Sayre, N. F.; Bestelmeyer, B.


    Global livestock production is heterogeneous, and its benefits and costs vary widely across global contexts. Extensive grazing lands (or rangelands) constitute the vast majority of the land dedicated to livestock production globally, but they are relatively minor contributors to livestock-related environmental impacts. Indeed, the greatest potential for environmental damage in these lands lies in their potential for conversion to other uses, including agriculture, mining, energy production and urban development. Managing such conversion requires improving the sustainability of livestock production in the face of fragmentation, ecological and economic marginality and climate change. We present research from Mongolia and the United States demonstrating methods of improving outcomes on rangelands by improving the fit between the scales of social and biophysical processes. Especially in arid and semi-arid settings, rangelands exhibit highly variable productivity over space and time and non-linear or threshold dynamics in vegetation; climate change is projected to exacerbate these challenges and, in some cases, diminish overall productivity. Policy and governance frameworks that enable landscape-scale management and administration enable range livestock producers to adapt to these conditions. Similarly, livestock breeds that have evolved to withstand climate and vegetation change improve producers' prospects in the face of increasing variability and declining productivity. A focus on the relationships among primary production, animal production, spatial connectivity, and scale must underpin adaptation strategies in rangelands.

  1. Comparing the Local Climate Change and its Effects on Physiological Aspects and Yield of Ramie Cultivated in Different Biophysical Environments

    Directory of Open Access Journals (Sweden)

    M. Subandi


    Full Text Available Three experiments in three different biophysical environments were conducted in Jatinangor, Sumedang District, Jatitujuh. Majalengka District and Bandung District of West Java Province, Indonesia. The experiment were conducted to evaluate the environments, seasons, manure, nitrogen and potassium effect on the physiological aspects and yield of ramie plant (Boehmerianivea L. Gaud.The locations diverse at different elevation, rainfall type and soil type and atmospheric regimes. The experiments passed the years 2000-2001. The experiment in Sumedang regency was continued with two other experiments in 2007, and experiment in Bandung district was conducted in 2014.The field experiments design used in all the locations were randomized block design arranged in factorial pattern with two factors and two replications. Climatic analysis is done by comparing the atmospheric data of 2000-2001 and the data of 2002-2007 and the data of 2014. Assumed that all the local atmospheric data are atmospheric data under influence of climatic global change. Results of the experiments were: Jatitujuh region is not suitable for ramie cultivation. Dosage of waterw3=35%-40% of Field Capacity affecting sufficient growth on plant.The minimum dosage at which plant survive to produce yield is representing the most efficient input of production.Water supply for ramie plant could be designed to the most efficient volume to maintain the need of metabolism.

  2. On learning time delays between the spikes from different input neurons in a biophysical model of a pyramidal neuron. (United States)

    Koutsou, Achilleas; Bugmann, Guido; Christodoulou, Chris


    Biological systems are able to recognise temporal sequences of stimuli or compute in the temporal domain. In this paper we are exploring whether a biophysical model of a pyramidal neuron can detect and learn systematic time delays between the spikes from different input neurons. In particular, we investigate whether it is possible to reinforce pairs of synapses separated by a dendritic propagation time delay corresponding to the arrival time difference of two spikes from two different input neurons. We examine two subthreshold learning approaches where the first relies on the backpropagation of EPSPs (excitatory postsynaptic potentials) and the second on the backpropagation of a somatic action potential, whose production is supported by a learning-enabling background current. The first approach does not provide a learning signal that sufficiently differentiates between synapses at different locations, while in the second approach, somatic spikes do not provide a reliable signal distinguishing arrival time differences of the order of the dendritic propagation time. It appears that the firing of pyramidal neurons shows little sensitivity to heterosynaptic spike arrival time differences of several milliseconds. This neuron is therefore unlikely to be able to learn to detect such differences.

  3. Biophysical and biological characterization of intraoral multilayer membranes as potential carriers: A new drug delivery system for dentistry. (United States)

    Silva, Mariana Dos Santos; Neto, Natalino Lourenço; da Costa, Silgia Aparecida; da Costa, Sirlene Maria; Oliveira, Thais Marchini; Oliveira, Rodrigo Cardoso de; Machado, Maria Aparecida Andrade Moreira


    The current study developed through layer-by-layer deposition a multilayer membrane for intraoral drug delivery and analyzed the biochemical, functional, and biological properties of this membrane. For that purpose, we designed a three-layer chlorhexidine-incorporated membrane composed by pure chitosan and alginate. The biochemical, functional, and biological properties were analyzed by the following tests: degradation in saliva medium; controlled drug release; water absorption, mass loss; pH analysis; and biocompatibility through fibroblast cell viability by MTT assay. All tests were conducted at three different periods (24, 48 and 72hours). The results demonstrated that hybrid membranes composed by alginate and chitosan with glycerol had greater water absorption and mass loss in buffer solution and in artificial saliva. The controlled drug release test revealed that the hybrid membrane exhibited greater drug release (0.075%). All chlorhexidine-incorporated membranes reduced the cell viability, and chitosan membranes with and without glycerol did not interfere with fibroblast viability. The biochemical and biophysical characteristics of the designed membranes and the findings of cell viability tests indicate great potential for application in Dentistry.

  4. Structural and Biophysical Analysis of BST-2/Tetherin Ectodomains Reveals an Evolutionary Conserved Design to Inhibit Virus Release

    Energy Technology Data Exchange (ETDEWEB)

    Swiecki, M.; Allaire, M.; Scheaffer, S.; Fremont, D.H.;


    BST-2/tetherin is a host antiviral molecule that functions to potently inhibit the release of enveloped viruses from infected cells. In return, viruses have evolved antagonists to this activity. BST-2 traps budding virions by using two separate membrane-anchoring regions that simultaneously incorporate into the host and viral membranes. Here, we detailed the structural and biophysical properties of the full-length BST-2 ectodomain, which spans the two membrane anchors. The 1.6-{angstrom} crystal structure of the complete mouse BST-2 ectodomain reveals an {approx}145-{angstrom} parallel dimer in an extended {alpha}-helix conformation that predominantly forms a coiled coil bridged by three intermolecular disulfides that are required for stability. Sequence analysis in the context of the structure revealed an evolutionarily conserved design that destabilizes the coiled coil, resulting in a labile superstructure, as evidenced by solution x-ray scattering displaying bent conformations spanning 150 and 180 {angstrom} for the mouse and human BST-2 ectodomains, respectively. Additionally, crystal packing analysis revealed possible curvature-sensing tetrameric structures that may aid in proper placement of BST-2 during the genesis of viral progeny. Overall, this extended coiled-coil structure with inherent plasticity is undoubtedly necessary to accommodate the dynamics of viral budding while ensuring separation of the anchors.

  5. Structural and biophysical analysis of BST-2/tetherin ectodomains reveals an evolutionary conserved design to inhibit virus release. (United States)

    Swiecki, Melissa; Scheaffer, Suzanne M; Allaire, Marc; Fremont, Daved H; Colonna, Marco; Brett, Tom J


    BST-2/tetherin is a host antiviral molecule that functions to potently inhibit the release of enveloped viruses from infected cells. In return, viruses have evolved antagonists to this activity. BST-2 traps budding virions by using two separate membrane-anchoring regions that simultaneously incorporate into the host and viral membranes. Here, we detailed the structural and biophysical properties of the full-length BST-2 ectodomain, which spans the two membrane anchors. The 1.6-Å crystal structure of the complete mouse BST-2 ectodomain reveals an ∼145-Å parallel dimer in an extended α-helix conformation that predominantly forms a coiled coil bridged by three intermolecular disulfides that are required for stability. Sequence analysis in the context of the structure revealed an evolutionarily conserved design that destabilizes the coiled coil, resulting in a labile superstructure, as evidenced by solution x-ray scattering displaying bent conformations spanning 150 and 180 Å for the mouse and human BST-2 ectodomains, respectively. Additionally, crystal packing analysis revealed possible curvature-sensing tetrameric structures that may aid in proper placement of BST-2 during the genesis of viral progeny. Overall, this extended coiled-coil structure with inherent plasticity is undoubtedly necessary to accommodate the dynamics of viral budding while ensuring separation of the anchors.

  6. Environmental change in the mid-Boteti area of north-central Botswana: Biophysical processes and human perceptions (United States)

    Ringrose, Susan; Chanda, Raban; Nkambwe, Musisi; Sefe, Francis


    Increased interest in environmental change issues has led researchers to consider more integrated approaches to change dynamics. This paper examines change in terms of land degradation in north-central Botswana from both biophysical and human perspectives. Although seasonal and periodic droughts were prevalent, analysis of rainfall data over the past 70 years revealed no downward trend. However, indicators of declining productivity such as soil erosion, loss of vegetation cover, and a declining groundwater table were amply evident. The GIS analysis of remotely sensed data has shown that complete vegetation recovery after drought is not taking place, particularly in the south-central part of the study area. These areas contained the highest human and livestock population densities. The local people acknowledged facing increasing resource depletion and indicated drought as the main cause. Pressures on available resources, particularly during drought periods, appeared to have impeded the regenerative capacity of the natural vegetation cover, thereby inducing land degradation. This situation may not easily be rectified because of widespread poverty and inappropriate local perceptions of the solutions. Both of these hinder the adoption of sustainable land management.

  7. Biophysical characterization and membrane intera