WorldWideScience

Sample records for biomasa utilizando cfd

  1. Experimental numerical study utilizing CFD in a stratified gasifier operating with biomass; Estudio numerico experimental de un gasificador estratificado que opera con biomasa, utilizando CFD

    Energy Technology Data Exchange (ETDEWEB)

    Rogel Ramirez, Alejandro

    2007-07-01

    The central idea behind this work is the developing of a numeric-experimental model, useful to optimize the biomass stratified gasifier design. Firstly, model validation will be carried up by comparison with reference experimental data available. This study describes a 1-D + 2-D numerical model used to simulate the gasification of pine wood pellets in a stratified downdraft gasifier whereby Eulerian conservation equations are solved for particle and gas phase components, velocities and specific enthalpies. The model takes into account the biomass particle process such as heating up, drying, primary pyrolysis of biomass, secondary pyrolysis of tar, homogeneous reactions and heterogeneous combustion/gasification reactions, and particle size change. This CFD model can be used to predict temperature profiles, gas composition, producer gas lower heating value, and carbon conversion efficiency, and the reactor performance when operating parameters and feed properties are changed. The standard {kappa}-{epsilon} and RNG {kappa}-{epsilon} models were used to simulate the turbulent flow conditions. [Spanish] La idea central del presente trabajo es el desarrollo de un modelo numerico- experimental, para optimizar el diseno de gasificadores estratificados de biomasa. Primeramente, el modelo sera validado utilizando datos experimentales disponibles en la literatura. Este estudio describe un modelo numerico 1-D+2-D, utilizado para simular la gasificacion de 'pelets' de madera de pino en un gasificador estratificado de flujos paralelos, en el que se resuelven ecuaciones de conservacion Eulerianas para los componentes de la fase gaseosa, la fase solida, velocidades y entalpias especificas. El modelo considera procesos como: calentamiento, secado de la biomasa, pirolisis primaria de la madera, pirolisis secundaria de los alquitranes, reacciones homogeneas, reacciones heterogeneas de combustion/gasificacion y cambio en el tamano de la particula. Este modelo CFD puede ser

  2. CFD modelling of an open core downdraft moving bed biomass gasifier; Modelado de un gasificador estratificado de lecho movil de biomasa, utilizando CFD

    Energy Technology Data Exchange (ETDEWEB)

    Rogel-Ramirez, A [Universidad Nacional Autonoma de Mexico, Mexico, D.F. (Mexico)]. E-mail: ARogelR@iingen.unam.mx

    2008-10-15

    This paper contains the description of a bidimensional Computational Fluid Dynamics (CFD), model Developer to simulate the flow and reaction in a stratified downdraft biomass gasifier, whereby Eulerian conservation equations are solved for particle and gas phase components, velocities and specific enthalpies. The model is based on the PHOENICS package and represents a tool which can be used in gasifier analysis and design. Contributions of chemical kinetics and the mixing rate using the EBU approach are considered in the gas phase global homogeneous reactions. The harmonic blending of chemical kinetics and mass transfer effects, determine the global heterogeneous reactions between char and O{sub 2}, CO{sub 2} and H{sub 2}O. The turbulence effect in the gas phase is accounted by the standard {kappa}-{epsilon} approach. The model provides information of the producer gas composition, velocities and temperature at the outlet, and allows different operating parameters and feed properties to be changed. Finally, a comparison with experimental data available in literature was done, which showed satisfactory agreement from a qualitative point of view, though further validation is required. [Spanish] Este estudio describe un modelo numerico bidimensional, basado en Dinamica de Fluidos Computacional (CFD), desarrollado para simular el flujo y las reacciones que ocurren en un gasificador estratificado de flujos paralelos, en el que se resuelven ecuaciones de conservacion Eulerianas para los componentes de la fase gaseosa, la fase solida, velocidades y entalpias especificas. El modelo esta basado en el codigo PHOENICS y representa una herramienta que puede ser utilizada en el analisis y diseno de gasificadores. En las reacciones globales homogeneas se consideran las contribuciones de la cinetica quimica y la rapidez de mezclado, usando el modelo Eddy Brake-UP (EBU). La medida harmonica de la cinetica quimica y la transferencia de masa, determinan las velocidades globales de

  3. Optimización del rendimiento de un propulsor marino y biomimético utilizando cfd

    OpenAIRE

    Rodríguez Vidal, Carlos Gervasio; Rodríguez García, Juan de Dios

    2014-01-01

    El propósito de este artículo es emplear un procedimiento de CFD (Mecánica de Fluidos Computacional) para optimizar un propulsor marino de inspiración biológica. Este propulsor está basado en un panel ondulante, que imita el movimiento de una aleta de pez, dicho modelo numérico se ha empleado para analizar la hidrodinámica y mejorar el rendimiento, de igual manera la forma de la cola ha sido estudiada como un mecanismo para generar mayores beneficios . Se han analizado tres formas de aleta: r...

  4. Biomasa en Chile

    OpenAIRE

    Nilsson Cifuentes, Gabriel; Rodríguez Monroy, Carlos

    2012-01-01

    El artículo presenta el desarrollo de la biomasa en Chile, dentro del complejo marco energético existente en el país, el cual, aún no logra potenciar e incentivar el desarrollo de energías renovables y depende fuertemente de los combustibles fósiles, acrecentando el riesgo latente de sufrir una crisis energética, en el mediano plazo, producto de la paulatina incorporación de nuevas centrales generadoras de energías, que satisfagan la creciente demanda energética pronosticada. Este ar...

  5. Flow prediction and heat transfer in a cooling square duch of a gas turbine blade using CFD; Predicciones de flujo y transferencia de calor en un conductor de alabe enfriado de turbina de gas utilizando CFD

    Energy Technology Data Exchange (ETDEWEB)

    Urquiza B, Gustavo [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico); Sierra E, Fernando [Universidad Nacional Autonoma de Mexico, Mexico D.F. (Mexico); Kubiak S, Janusz; Campos A, Rafael [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)

    2003-10-15

    A numerical investigation has been conducted to study the turbulent flow and the heat transfer in a blade turbine coolant passage involving a 180 degrees turn. The study provides a comparison test for two turbulence models. The numerical solution was conducted employing two models for turbulence, the renormalization Group Theory (RNG) and the Reynolds Stress Model (RSM), using a refined grid to model with detail the recirculating flow. Computations are performed with a commercial finite volume code which solves three dimensional, incompressible, Navier-Stokes and Energy equations. At the passage turn, significant secondary flows are present, formed by a pair of symmetrical vortices. Results have been compared against published experimental data for Re = 53 000. Very good agreement is achieved for the prediction of the local static pressure distribution along the passage. A strong effect of rotation has been observed mainly in the flow field as described in detail in the paper. [Spanish] En este trabajo se presenta una investigacion numerica para estudiar el flujo turbulento y la transferencia de calor en un conducto de enfriamiento de un alabes de turbina de gas con giro de 180 grados. El estudio proporciona una comparacion de resultados para dos modelos de turbulencia. La solucion numerica emplea dos modelos de turbulencia: el modelo de esfuerzos de Reynolds (RSM) y el modelo de la teoria del grupo de renormalizacion (RNG), utilizando una malla refinada para modelar con detalle el flujo de recirculacion. Los calculos fueron realizados con un codigo comercial de volumenes finitos el cual resuelve las ecuaciones tridimensionales de Navier-Stoke y de energia para flujo incompresible. En la seccion de giro del conductor, aparecen flujos secundarios significativos, formados por un par de celulas simetricas. Los resultados han sido comparados contra datos experimentales de la literatura para Re = 53 000. se obtuvo un buen acuerdo para la prediccion de la distribucion de

  6. Estudio de la logística de una planta de biomasa para abastecer de energía térmica a la Universidad de Valladolid.

    OpenAIRE

    González Iturralde, Ana

    2014-01-01

    El presente proyecto estudia el vector logístico de la instalación de una central térmica y una red de calor (District heating) utilizando una de las energías “verdes” que el Gobierno ha estado fomentando los últimos años: la biomasa. Esta planta, alimentada con distintos tipos de biomasa, va a dar servicio térmico a 31 edificios de la zona norte del municipio de Valladolid, pertenecientes tanto a la Universidad de Valladolid (UVa), al Ayuntamiento y a la Junta de Castilla y Le...

  7. Selección de una levadura para la producción de biomasa: crecimiento en suero de queso

    Directory of Open Access Journals (Sweden)

    Wendy Zumbado-Rivera

    2006-01-01

    Full Text Available El presente proyecto se realizó con el objetivo de recomendar una especie de levadura para la producción de biomasa, utilizando como sustrato el suero de leche del proceso de elaboración de queso blanco tipo Turrialba. Se compararon las especies Kluyveromyces marxianus, Candida kefyr y Saccharomyces cerevisiae por medio de su crecimiento en un sistema de fermentación por lotes. Se determinó el tiempo de fermentación, la productividad total y el contenido de proteína de la biomasa. Al comparar la variación en el tiempo según la levadura utilizada, se obtuvo diferencias significativas (p ≤ 0,05. Las levaduras K. marxianus y C. kefyr presentaron un tiempo de 19 y 18 horas, respectivamente y S. cerevisiae, un tiempo de 24 horas. Con respecto a la productividad total de biomasa, la especie K. marxianus presentó un valor de 0,22 g/lxh, resultando significativamente diferente (p ≤ 0,05 a las especies C. kefyr y S. cerevisiae, para las cuales se obtuvieron productividades de 0,14 y 0,13 g/lxh. La variación en el contenido de proteína de acuerdo con la levadura utilizada no resultó significativo (p ≥ 0,05. Para la especie K. marxianus se obtuvo un contenido de proteína de 32%, 34% para C. kefyr y 35% para S. cerevisiae. Se seleccionó la especie de levadura Kluyveromyces marxianus para la producción de proteína unicelular, por presentar un menor tiempo de fermentación, mayor productividad e igual contenido proteico de la biomasa que las otras levaduras, además de facilidades de utilización

  8. RELACIÓN BIOMASA DE RAÍZ/BIOMASA TOTAL DE SOJA (Glycine max EN DOS SISTEMAS DE LABRANZA

    Directory of Open Access Journals (Sweden)

    Mónica Beatriz Barrios

    2014-06-01

    Full Text Available La soja es el principal cultivo en Argentina debido a su adaptación a los suelos, la incorporación de tecnología con el empleo de la siembra directa y el precio del mercado internacional. Las propiedades físicas, químicas y biológicas de cada suelo se ven modificadas por el tipo de sistema de laboreo empleado. El entorno generado por la labranza altera el crecimiento y el equilibrio funcional de los cultivos herbáceos. En el año 2006, se instaló un ensayo en el Partido de Ezeiza (Pampa Ondulada, con el objetivo de evaluar los efectos del sistema de laboreo en el equilibrio funcional entre biomasa de raíces/biomasa total en soja (Glycine max durante la campaña 2012/2013. Se utilizó un diseño de bloques completos al azar con dos tratamientos que consistieron en: labranza convencional (LC y siembra directa (SD, con cuatro repeticiones. Se midió: peso de biomasa aérea, área foliar, rendimiento en grano, peso de raíces de 0-10 y 10-20 cm de profundidad, y se calculó biomasa total y la relación biomasa de raíces/biomasa total. El peso de raíces se determinó con el método del cilindro, el área foliar con el paquete estadístico Iproplus y el rendimiento con el cuadrado de corte. Los datos obtenidos fueron sometidos a análisis de varianza y las medias de los tratamientos fueron comparadas según Tukey (P < 0.05. El efecto del sistema de labranza generó diferentes respuestas en función de la variable evaluada y la fecha de muestreo. LC resultó significativamente superior (P < 0.05 respecto a SD en biomasa total y biomasa aérea en las etapas fenológicas R3 y R5; biomasa de raíces en R1 y R3; IAF en R2, R3 y R5. El rendimiento en grano fue mayor en LC respecto de SD, sin embargo el sistema de labranza no afectó la relación biomasa de raíz/biomasa total.

  9. Enriquecimiento de biomasa de levadura con micronutrientes esenciales

    OpenAIRE

    2008-01-01

    Se estudian las potencialidades de enriquecimiento de la biomasa de levaduras GRAS a partir de medios de cultivo ricos en micronutrientes de interés, básicamente, cromo y selenio. La levadura tiene la propiedad de incorporar a su biomasa cantidades elevadas de componentes del medio aún cuando no se utilicen metabólicamente. Las dietas diarias actuales, incluso en los países desarrollados, son regularmente deficitarias en Se y Cr, elementos esenciales para el comportamiento metabólico estable....

  10. ESTUDIO CINÉTICO DEL PROCESO DE DEVOLATILIZACIÓN DE BIOMASA LIGNOCELULÓSICA MEDIANTE ANÁLISIS TERMOGRAVIMÉTRICO PARA TAMAÑOS DE PARTÍCULA DE 2 A 19 mm

    Directory of Open Access Journals (Sweden)

    ANDRÉS MELGAR

    2008-01-01

    Full Text Available Con el objetivo de proporcionar herramientas que mejoren el diseño de los sistemas de gasificación/combustión de biomasa, y los modelos cinético-químicos de dichos procesos, se presenta un estudio de la cinética química asociada al proceso de devolatilización de biomasa mediante pruebas de termogravimetría utilizando tamaños de partícula que varían de 2 a 19 mm, y tasas de calentamiento de 10, 15 y 20 K/min. El desarrollo de este trabajo se justifica debido a que no hay resultados disponibles en la bibliografía que estudien tamaños superiores a 1 mm. Mediante el ajuste de los puntos experimentales utilizando un modelo de primer orden se determinan los parámetros de las constantes cinéticas (forma de Arrhenius. El estudio muestra que la energía de activación es directamente proporcional a la tasa de calentamiento y al tamaño de partícula, se comprueba que el proceso de descomposición térmica de la biomasa se da a temperaturas más altas con el aumento del tamaño de las partículas, debido a la importancia que toman los procesos de transferencia calor y masa. Los parámetros cinéticos calculados pueden ser utilizados en los modelos dimensionales del proceso de gasificación-combustión de biomasa, considerando el tamaño de las partículas intrínseco en la cinética.

  11. Proyecto de una central eléctrica de biomasa

    OpenAIRE

    Valentín Botija, Sergio

    2011-01-01

    El presente Proyecto de fin de carrera pretende dar una respuesta técnica a la necesidad de abastecimiento e independencia energética mediante una solución basada en las energías renovables y en combustibles vegetales, en concreto aquella basada en la biomasa; así como profundizar en el conocimiento de las mismas y realizar un estudio de viabilidad de estas técnicas en una zona determinada de Castilla-La Mancha. De modo, que mediante este PFC se trata de analizar la viabilidad técnica y econó...

  12. Enriquecimiento de biomasa de levadura con micronutrientes esenciales

    Directory of Open Access Journals (Sweden)

    Miguel A. Otero

    2008-01-01

    Full Text Available Se estudian las potencialidades de enriquecimiento de la biomasa de levaduras GRAS a partir de medios de cultivo ricos en micronutrientes de interés, básicamente, cromo y selenio. La levadura tiene la propiedad de incorporar a su biomasa cantidades elevadas de componentes del medio aún cuando no se utilicen metabólicamente. Las dietas diarias actuales, incluso en los países desarrollados, son regularmente deficitarias en Se y Cr, elementos esenciales para el comportamiento metabólico estable. El Cr es un componente del Factor de Tolerancia a la Glucosa (GTF que facilita las funciones de la insulina. Por medio de las técnicas del batch incrementado se puede llegar a concentraciones de Cr y Se de hasta 1000 ppm. Los productos puede ser empleado en la prevención y profilaxis de la Diabetes mellitus, en su variante senil, en tanto que el Se juega un rol antioxidante primordial.

  13. BIOMASA EN PLANTACIONES DE Eucalyptus viminalis Labill. DE LA PROVINCIA DE BUENOS AIRES, ARGENTINA

    Directory of Open Access Journals (Sweden)

    Paula Ferrere

    2008-01-01

    Full Text Available El presente trabajo se desarrolló en el oeste de la provincia de Buenos Aires, Argentina con el objetivo de ajustar funciones de biomasa de árboles individuales y determinar la biomasa en diferentes compartimientos de la planta y el sotobosque. Se identificaron rodales de Eucalyptus viminalis Labill. cuyas edades oscilaron entre 4 y 14 años. Se apearon 21 árboles con diámetros entre 9,2 y 32,5 cm. Se desarrollaron regresiones simples y múltiples y se estimó el volumen, la biomasa en ramas, hojas y fuste. Las ecuaciones de volumen de mejor comportamiento son basadas en modelos lineales en su forma normal, y el modelo más adecuado fue el que incorporó al d2 (R2 = 0,92. Para la estimación de la biomasa en hojas, ramas, copa y fuste se recomienda los modelos ln-ln que consideran el d y h o solo el d. El componente de la biomasa en hojas presentó una estimación más débil. La distribución de la biomasa en los individuos sigue el patrón de desarrollo que se encuentra en la bibliografía. La proporción de la biomasa en la copa disminuye con la edad, contrariamente a lo sucedido con el fuste.

  14. PARTICIÓN DE LA BIOMASA AÉREA EN TRES ESPECIES ARBÓREAS TROPICALES

    OpenAIRE

    Martín Aquino-Ramírez; Alejandro Velázquez-Martínez; Juan F. Castellanos-Bolaños; Héctor De los Santos-Posadas; Jorge D. Etchevers-Barra

    2015-01-01

    El conocimiento de los almacenes de carbono en bosques es fundamental para generar inventarios de este elemento cercanos a la realidad. Para ello es necesario tener estimaciones de la biomasa de los árboles. Las ecuaciones alométricas permiten estimar la biomasa y su distribución en ecosistemas forestales. El objetivo del presente estudio fue desarrollar ecuaciones para estimar la biomasa aérea total y de los componentes estructurales, en árboles de la región fisiográfica de la Sierra M...

  15. Efectos de vinazas sobre bacterias rizosféricas y en la actividad-CO2 y biomasa-C microbiana de un suelo Pachic Haplustoll

    Directory of Open Access Journals (Sweden)

    Miriam Rosero G

    2013-04-01

    Full Text Available En condiciones de casa de malla de la Universidad Nacional de Colombia sede Palmira se estudió los efectos de la aplicación de vinaza, un subproducto de la industria de alcohol carburante, sobre las bacterias rizosféricas Pseudomonas fluorescens y Bacillus subtilis promotoras de crecimiento, la actividad-CO2, biomasa microbiana-C y el cociente metabólico-qCO2 en un suelo Pachic Haplustoll y su relación con el rendimiento de habichuela (Phaseolus vulgaris L.. Se utilizó un diseño completamente al azar con siete tratamientos y cinco repeticiones. Los tratamientos se seleccionaron con base en los requerimientos de K del cultivo (150 kg/ha K2O utilizando como fuentes KCl y vinaza solos y en mezclas. Los tratamientos evaluados y la época de muestreo influyeron (P < 0.05 en la actividad y biomasa microbiana. Los menores valores de estas variables se presentaron en la época de floración del cultivo cuando la demanda de nutrientes es alta. La mezcla en partes iguales de vinaza y KCl favorece la mayor producción de habichuela sin afectar la actividad microbiana; el cociente metabólico indicó estabilidad del sistema en el tiempo y las bacterias rizosféricas presentaron el mejor crecimiento en la mezcla 75% de potasio como vinaza y 25% como KCl.

  16. CFD and Ventilation Research

    DEFF Research Database (Denmark)

    Li, Y.; Nielsen, Peter V.

    2011-01-01

    There has been a rapid growth of scientific literature on the application of computational fluid dynamics (CFD) in the research of ventilation and indoor air science. With a 1000–10,000 times increase in computer hardware capability in the past 20 years, CFD has become an integral part of scienti......There has been a rapid growth of scientific literature on the application of computational fluid dynamics (CFD) in the research of ventilation and indoor air science. With a 1000–10,000 times increase in computer hardware capability in the past 20 years, CFD has become an integral part...... of scientific research and engineering development of complex air distribution and ventilation systems in buildings. This review discusses the major and specific challenges of CFD in terms of turbulence modelling, numerical approximation, and boundary conditions relevant to building ventilation. We emphasize...... analysis in ventilation research, rather it has become an increasingly important partner....

  17. Estudio cinético del proceso de devolatilización de biomasa lignocelulósica mediante análisis termogravimétrico para tamaños de partícula de 2 a 19 mm

    OpenAIRE

    ANDRÉS MELGAR; DAVID BORGE; Juan F. Pérez

    2008-01-01

    Con el objetivo de proporcionar herramientas que mejoren el diseño de los sistemas de gasificación/combustión de biomasa, y los modelos cinético-químicos de dichos procesos, se presenta un estudio de la cinética química asociada al proceso de devolatilización de biomasa mediante pruebas de termogravimetría utilizando tamaños de partícula que varían de 2 a 19 mm, y tasas de calentamiento de 10, 15 y 20 K/min. El desarrollo de este trabajo se justifica debido a que no hay resultados disponibles...

  18. Calefaccion centralizada por biomasa, Cuéllar

    Directory of Open Access Journals (Sweden)

    Verdú Pérez, Jesús

    2001-10-01

    Full Text Available A plant of municipal central heating feeded with residual biomass, has been created in Cuéllar (Segovia, Spain, in order to demostrate its technical viability and to make more confortable the life of village inhabitants. Those residual biomass used as combustible, comes from the pine seeds, the key industry in the area. The calorific energy generated by combustion of those pine seeds, serves to heat the water to be send later through different pipes crossing the village. So, heating services and sanitary hot water are used according to the moment of the year. The study of the operative plant, allow us to discern the more adecuated operation parameters. reaching a total thermical yield of 60%. So its technical and economical viability concerning other traditional combustibles, its big environmental contribution to the production of energy, in addition to the social advantages -1ike the creation of new working jobs and the development of alternative activities in agricultura1 and forest areas- have contributed to present this plant as a model to be extended to other areas with potential biomass.Con el fin de demostrar su viabilidad técnica y económica y dar servicio a los habitantes de la localidad, se ha instalado en Cuéllar (Segovia, España, una planta de calefacción municipal alimentada con biomasa residual. Como combustible utiliza los residuos biomásicos procedentes de la industria piñonera de la zona. La energía calorífica generada por el proceso de combustión de éstos, calienta agua que es distribuida a través de un circuito de tuberías aisladas a través de la ciudad. Se proporcionan así los servicios de calefacción y agua caliente sanitaria según la época del año. El estudio de la operación de la planta, ha permitido caracterizar los parámetros de funcionamiento más adecuados. habiéndose obtenido un rendimiento térmico total de la instalación del 60%. quedando justificada su viabilidad técnica y econ

  19. LA BIOMASA DE LOS CULTIVOS EN EL AGROECOSISTEMA. SUS BENEFICIOS AGROECOLÓGICOS

    Directory of Open Access Journals (Sweden)

    Anirebis Martínez Romero

    2014-01-01

    Full Text Available La biomasa es el resultado de la transformación de la energía solar en energía química. El hombre a través de la historia la ha utilizado no solo para su alimentación sino también para la alimentación de sus animales. Los avances de la ciencia promovieron el desarrollo agrario basado en la revolución verde, la cual solo promueve la producción de alimentos ya sea de uso humano o animal, marginando la importancia de la biomasa como enriquecedor del recurso suelo al disponerse de los insumos necesarios para sustituir su fertilidad natural. En la actualidad la producción y conservación de la biomasa de cualquier cultivo cobra una importancia trascendente; porque ello contribuye, además, a la protección medioambiental a través de la captura de carbono. El presente trabajo tuvo como objetivo demostrar la importancia que proporciona la biomasa generalmente no alimenticia para los humanos, a fin de emplearla no solo como alimento animal, sino también como enriquecedora del recurso natural suelo. Las investigaciones realizadas en Cuba sobre el tema es pobre, aun cuando en la actualidad resulta de gran importancia encontrar variantes que permitan profundizar en la producción de biomasa en su relación con el medio ambiente. Finalmente se exponen los resultados preliminares sobre producción de biomasa a partir de la agrobiodiversidad presente en los escenarios productivos, a la vez que se reflexiona sobre la importancia del tema para futuras investigaciones.

  20. Implantación central de biomasa forestal y aprovechamiento de las masas forestales

    OpenAIRE

    Amengual Romaní, Carmen; Triguero Gil, Álvaro

    2013-01-01

    Se estudia la implantación de una central de biomasa en Cataluña, como alternativa energética renovable. Se trata de una instalación industrial diseñada para generar energía a partir de recursos biológicos. Aunque esta sea una tecnología en vías de desarrollo, las perspectivas de futuro son prometedoras. En la primera parte del proyecto, estudiaremos en profundidad el concepto de biomasa, incluyendo una recopilación de datos sobre los tipos que existen, las formas de conversión en energía,...

  1. Modelación cinética de pirólisis de biomasa

    OpenAIRE

    Monroy Peña, Camilo Antonio

    2013-01-01

    La pirolisis de biomasa es un proceso de conversión termoquímica de importancia industrial y ecológica. Por tanto se requiere encontrar un modelo cinético de pirolisis de biomasa que permita un adecuado modelamiento, diseño, optimización y operación de reactores industriales. En el presente trabajo se realizó un estudio de la descomposición térmica de cuesco de palma y de sus componentes separados vía enzimática, para no afectar las características estructurares y químicas de l...

  2. MODELOS PREDICTIVOS DE BIOMASA AÉREA DE Eucalyptus grandis PARA EL NORESTE DE ARGENTINA

    Directory of Open Access Journals (Sweden)

    Rosa Angela Winck

    2015-01-01

    Full Text Available Diferentes intereses industriales, energéticos y ambientales han motivado el análisis de las distintas posibilidades de aprovechamiento de la biomasa forestal, este tema está adquiriendo un creciente protagonismo, por lo que la cuantificación de la biomasa aérea de estos sistemas forestales constituye un primer paso fundamental e ineludible. El objetivo de este trabajo fue desarrollar modelos que permitan estimar la biomasa de los diferentes compartimentos aéreos de Eucalyptus grandis . Para ello se emplearon datos de 41 árboles provenientes de rodales de diferentes edades, entre 4 y 32 años, ubicados en la región NE de Argentina. Se tomaron 23 individuos ubicados en la Zona Norte y Alta de Misiones (zona 1 y 18 en el Sur de Misiones y NE de Corrientes (zona 2. Se determinó la biomasa de hojas, ramas menores a 5 cm, ramas mayores a 5 cm, total de ramas, fuste y biomasa total del árbol. Para el ajuste de modelos se tomaron diversas variables independientes, el diámetro a la altura de pecho (dap, la altura total del árbol (h, el producto (dap 2 *h y la variable “ dummy” (zona. Para el caso de la biomasa de ramas y de hojas, debido a que no se lograron resultados satisfactorios con el empleo de estas variables, se examinaron modelos que adicionaban índice de sitio, factor de espaciamiento, diámetro en la base de la copa verde (dbcv, altura hasta la base de la copa verde (hbcv, longitud de copa verde (lcv, el área transversal de albura en la base de copa verde (g Alb bcv y diferentes combinaciones de estas variables. Los modelos fueron seleccionados en base al coeficiente de determinación y el error cuadrático medio. Para la biomasa de ramas menores a 5 cm, ramas mayores a 5 cm, total de ramas, fuste y total, los mejores modelos fueron los que incorporaron como variables regresoras, el diámetro a la altura de pecho, la altura total del árbol y la variable “ dummy” (zona. Para la biomasa de hojas, las variables, edad,

  3. Estudio cinético de una fermentación alcohólica utilizando miel de abejas como sustrato

    OpenAIRE

    José Ángel Gómez; Hader Iván Castaño; Mario Arias

    2011-01-01

    El artículo describe un estudio cinético de una fermentación alcohólica utilizando miel de abejas como sustrato; para este efecto se realizaron nueve fermentaciones en proceso discontinuo con un volumen, de 10 L, siguiendo el comportamiento de las concentraciones de sustrato, biomasa y producto en el tiempo. Se evaluó la conveniencia de factores como la agitación y la adición de nutrientes, además, se observa el efecto de las concentraciones iniciales de sustrato e inocula y el tipo de miel....

  4. Estudio cinético de una fermentación alcohólica utilizando miel de abejas como sustrato

    Directory of Open Access Journals (Sweden)

    José Ángel Gómez

    2011-06-01

    Full Text Available El artículo describe un estudio cinético de una fermentación alcohólica utilizando miel de abejas como sustrato; para este efecto se realizaron nueve fermentaciones en proceso discontinuo con un volumen, de 10 L, siguiendo el comportamiento de las concentraciones de sustrato, biomasa y producto en el tiempo. Se evaluó la conveniencia de factores como la agitación y la adición de nutrientes, además, se observa el efecto de las concentraciones iniciales de sustrato e inocula y el tipo de miel.

  5. Biomasa y densidad de dos especies de pastos marinos en el sur de Quintana Roo, México

    OpenAIRE

    2015-01-01

    La biomasa y productividad de una comunidad de pastos marinos es útil para determinar el estado ecológico de la costa. Se comparó la biomasa foliar y la densidad de vainas en praderas de Thalassia testudinum Banks & Sol. ex K. D . Koenig, en dos ambientes de la costa del Caribe mexicano eN= 6 cuadrantes/sitio) en Noviembre de 1998. Los valores de vainas y biomasa foliar fueron más bajos en la pradera asociada al manglar, que en la pradera establecida en una laguna arrecifal. Esto probablement...

  6. Interactive CFD simulations

    OpenAIRE

    Duque Lombana, Juan Fernando

    2007-01-01

    This project is about the development of an implementable Interactive Computer Fluid Dynamics methodology -- The range of this work begins with an overview of the current status of computational fluid dynamics simulation software and methodologies, continues with an introduction to what interactive and interactivity mean, develops an all original interactive CFD methodology to follow for the solution of fluid scenarios and finally, the description of the implementation of an interactive solve...

  7. Influencia de la proporción agua de mar y bicarbonato en la producción de biomasa de Spirulina sp. con iluminación de diodo emisor de luz

    Directory of Open Access Journals (Sweden)

    Víctor Vasquez-Villalobos

    2014-01-01

    Full Text Available Se estudió la influencia de las variables proporción agua de mar (% y concentración de bicarbonato en laproducción de biomasa deSpirulinasp., utilizándose un Diseño Compuesto Central Rotacional (DCCR paraevaluar las regiones óptimas de producción de biomasa (φ, fase de adaptación (λ velocidad específica decrecimiento (μ y tiempo de generación (G, empleándose en cada ensayo el modelo matemático de Gompertz.Se obtuvo el mayor valor de biomasa (φ log N/N0: 0,928 a las168,8 horas en un medio de cultivo con pH de8,8±0,1; a temperatura de 25ºC; con salinidad de 1,2% y 1,6g/L de bicarbonato. El menor valor de φ fue de0,45±0,01; obtenidocoincidentemente en las repeticiones del punto central, utilizando una salinidad de 0,7% y3,0g/L de bicarbonato en un medio con pH de 9,1±0,4 a 25ºC; lo que demuestra la importancia de la salinidadaportada por volumen de agua de mar en relación al bicarbonato, en la producción de biomasa deSpirulina. Lailuminación fue de 2,7±1,2 klx, proporcionada por un Diodo Emisor de Luz Blanca (DELB por 12 horascontinuas y con una inyección de 0,86±0,09 L/s de aire por fotobiorreactor de 200 mL de capacidad.Solamente los valores de φ se ajustaron adecuadamente a la Superficie de Respuesta con un R2de 0,99 para unmodelo matemático cuadrático y p<0,05, con un error absoluto medio de 2,4%.

  8. Evaluación de dos métodos para la estimación de biomasa arbórea a través de datos Landsat TM en Jusnajab La Laguna, Chiapas, México: estudio de caso

    Directory of Open Access Journals (Sweden)

    Jorge Escandón Calderón

    1999-01-01

    Full Text Available Se evaluaron dos métodos para estimar biomasa arbórea con apoyo en sensores remotos (LANDSAT TM. El primer método se realizó con base en una clasificación supervisada multiespectral con seis bandas Se utilizaron tipos de vegetación identificados a partir de la composición de biomasa de ¡os géneros dominantes y de la altura promedio estimada del dosel, habiéndose distinguido ocho clases de vegetación. Se obtuvo una biomasa total de 1 073 x 10 3t (902 x 10 3t a 1 220 x 10 3t En el segundo método se utilizaron índices diferenciados de vegetación (NDVI de las bandas TM4/TM3; TM4/TM5 y TM4/TM7. Se aplicó un modelo de regresión que relaciona la biomasa promedio con los valores digitales (VD de los NDVI. El modelo exponencial fue el de mejor ajuste para los tres NDVl con una p 0.01. Los valores de los NVDl fueron TM4/ TM3. R2=0 611, TM4/TM5. R2=0.671 y TM4/TM7: R2=0.676. La biomasa total estimada con cada NDVI fue de 1 164 x 10 3t (490 x 10 3t a 2 409 x 10 3t para TM4/TM3; de 515x10 3t (331 x 10 3 t a 757 x 1 0 3 t p a r a TM/TM5 y d e 726 x 1 0 3 t ( 3 9 8 x 1 0 3 t a 1 210 x 10 3t para TM4/TM7. El resultado de la biomasa total calculada por el método de clasificación multiespectral, comparado con los valores estimados por el método de ordenamiento exponencial, mostró mayor similitud con el valor máximo del NDVl que relaciona las bandas TM4/TM7 (de mayor ajuste estadístico y con el valor promedio del NDVl TM4/TM3 (de menor ajuste estadístico. Utilizando el NDVl TM4/TM5, todos los valores de biomasa resultaron más bajos. De este estudio se concluye que es posible asociar razonablemente la biomasa de vegetación arbolada de pino-encino y reservorios de carbono con los índices de vegetación. A través del uso de sensores remotos se podrían predecir cambios de biomasa en escalas temporales y espaciales.

  9. Enfermedad pulmonar obstructiva crónica por exposición al humo de biomasa

    Directory of Open Access Journals (Sweden)

    Matías Lopez

    Full Text Available En este artículo se discute la relación existente entre la enfermedad pulmonar obstructiva crónica (EPOC y el humo de biomasa. Más de la mitad de la población utiliza biomasa como combustible principal, sobre todo en áreas rurales y en países en vías de desarrollo donde su uso llega hasta el 80%. La inhalación del humo de biomasa crea un estado inflamatorio crónico, que se acompaña de una activación de metaloproteinasas y una reducción de la movilidad mucociliar. Esto podría explicar la gran asociación existente entre la exposición a biomasa y EPOC, revelada por estudios observacionales y epidemiológicos provenientes de países en vías de desarrollo y de países desarrollados. En esta revisión exploramos también las diferencias entre la EPOC causada por tabaco y por biomasa, y encontramos que, a pesar de las diferencias fisiopatológicas, la mayoría de las características clínicas, calidad de vida y mortalidad fueron parecidas. En los últimos diez años se han realizado intervenciones para disminuir la exposición a biomasa mediante el uso de cocinas mejoradas y combustibles limpios, sin embargo, estas estrategias todavía no han sido exitosas debido a su incapacidad para reducir los niveles de contaminación a niveles recomendados por la Organización Mundial de la Salud, y por su falta de uso. Por lo tanto, hay una necesidad urgente de ensayos de campo aleatorios, cuidadosamente realizados, para determinar la verdadera gama de reducciones de contaminación potencialmente alcanzables, la probabilidad de su uso y los beneficios a largo plazo en la reducción de la gran carga mundial de EPOC

  10. Productividad y biomasa fitoperifítica en los Lagos Tarapoto y Yahuarcaca, Amazonas, Colombia Productividad y biomasa fitoperifítica en los lagos Yahuarcaca y Tarapoto (Amazonas - Colombia

    Directory of Open Access Journals (Sweden)

    Duque Escobar Santiago R.

    2000-06-01

    Full Text Available In the littoral zone, near of the matrix the macrophytes, main for Paspalum spp the lake Yahuarcaca and Tarapoto; the floodplain of the Amazon River-Colombia, through were designed system of artificial substratum, using slips and rods we quantify the productivity primary phytoperiphyton for clorophyl a, through method espectrophotometric and the biomass for ash free dry weight; in three periods hidrology low water, filling water and high water; for two, four and eigh day the colonization; four deep levels and radial position the substratum. The factors that has mayor effect over the primary productivity and the biomass phytoperiphytic are the hidrobiology periods, the colonization of the substratum and deep. The productivity and biomass from the lake is reationship with the mineralization of the water, with the tramsportation of nutrients of afluents, macrophytes, the flood forest, decomposition and the recirculation of nutrients in the water column.En la zona litorial, cerca de la matriz de macrófitas conformadas principalmente por Paspalum spp de los lagos Yahuarcaca y Tarapoto, del plano de inundación del Río Amazonas-Colombia, mediante el diseño de un sistema de substratos artificiales, utilizando láminas portaobjetos y tubos de vidrio, se cuantificó la productividad primaria fitoperifítica por clorofila a, mediante el método espectrofotométrico y la biomasa por peso seco libre de cenizas (PSLC, en tres períodos hidrológicos, aguas bajas, ascenso y altas o desborde; a los 2, 4 y 8 días de colonización; cuatro niveles de profundidad (cada 10

  11. Modelos matemáticos y experimentales sobre el secado de biomasa

    Directory of Open Access Journals (Sweden)

    Jorge Armando Villalba Vidales

    2015-01-01

    Full Text Available El secado de biomasa como proceso previo a la combustión se ha convertido en la actualidad en un factor decisivo para mejorar la eficiencia de dichos procesos en los sectores industrial y residencial. Debido a la creciente importancia de este proceso, los investigadores han desarrollado una gran cantidad de modelos, tanto teóricos como experimentales, que buscan predecir la cinética de secado de diferentes tipos de biomasa. Si bien se han logrado grandes avances en el desarrollo de modelos, aún no existe un modelo unificado que permita predecir los perfiles de temperatura y humedad para diversos materiales. Dichas dificultades se generan fundamentalmente por la amplia diversidad de biomateriales y las grandes diferencias entre los procesos existentes. El propósito de este artículo es brindar una panorámica sobre el estado del arte relativo a modelos, tanto matemáticos como experimentales, utilizados en la actualidad para simular procesos de secado de la biomasa. Asimismo, proponer los elementos fundamentales que deberá poseer un modelo de secado unificado.

  12. SDI CFD MODELING ANALYSIS

    Energy Technology Data Exchange (ETDEWEB)

    Lee, S.

    2011-05-05

    The Savannah River Remediation (SRR) Organization requested that Savannah River National Laboratory (SRNL) develop a Computational Fluid Dynamics (CFD) method to mix and blend the miscible contents of the blend tanks to ensure the contents are properly blended before they are transferred from the blend tank; such as, Tank 50H, to the Salt Waste Processing Facility (SWPF) feed tank. The work described here consists of two modeling areas. They are the mixing modeling analysis during miscible liquid blending operation, and the flow pattern analysis during transfer operation of the blended liquid. The transient CFD governing equations consisting of three momentum equations, one mass balance, two turbulence transport equations for kinetic energy and dissipation rate, and one species transport were solved by an iterative technique until the species concentrations of tank fluid were in equilibrium. The steady-state flow solutions for the entire tank fluid were used for flow pattern analysis, for velocity scaling analysis, and the initial conditions for transient blending calculations. A series of the modeling calculations were performed to estimate the blending times for various jet flow conditions, and to investigate the impact of the cooling coils on the blending time of the tank contents. The modeling results were benchmarked against the pilot scale test results. All of the flow and mixing models were performed with the nozzles installed at the mid-elevation, and parallel to the tank wall. From the CFD modeling calculations, the main results are summarized as follows: (1) The benchmark analyses for the CFD flow velocity and blending models demonstrate their consistency with Engineering Development Laboratory (EDL) and literature test results in terms of local velocity measurements and experimental observations. Thus, an application of the established criterion to SRS full scale tank will provide a better, physically-based estimate of the required mixing time, and

  13. Dicty_cDB: CFD712 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD7-A/CFD712Q.Seq.d/ Representative seq. ID CFD71...2F (Link to Original site) Representative DNA sequence >CFD712 (CFD712Q) /CSM/CF/CFD7-A/CFD712Q.Seq.d/ AAAAA

  14. Efecto de nutrientes sobre la producción de biomasa del hongo medicinal Ganoderma lucidum

    Directory of Open Access Journals (Sweden)

    Ana María Torres López

    2011-04-01

    Full Text Available  Effect of nutrients in the biomass production of the medicinal mushroom Ganoderma lucidum Título corto: Efecto de nutrientes sobre la producción de G. lucidumResumen El hongo Ganoderma lucidum, en los constituyentes de su biomasa, tiene compuestos con propiedades benéficas para la salud; es por esto que el conocimiento de las condiciones nutricionales adecuadas para su crecimiento permitirá su producción industrial y a bajo costo. En este trabajo se evaluó a nivel de matraz el efecto de la relación C/N, y la presencia de diferentes fuentes de carbono, nitrógeno y micronutrientes sobre la producción de biomasa. Empleando glucosa y peptona como fuentes de carbono y nitrógeno, respectivamente, se encontró una relación C/N óptima de 16,7:1 para la cual la máxima producción de biomasa fue de 25 g/L. Manteniendo esta relación C/N, y sustituyendo la glucosa por lactosa o harina de cebada y la peptona por extracto de levadura, la producción de biomasa se incrementó a 35 g/L. En presencia de harina de cebada la adición al medio de cultivo de sales de Mg y K, y de tiamina, no generó un mayor incremento en la producción de biomasa. La producción de biomasa de G. lucidum se ve favorecida por la presencia en el medio de cultivo de relaciones C/N cercanas a las reportadas conforme a la composición típica de los hongos, así como por la presencia de sustratos complejos como la harina de cebada que le aportan además de la fuente de carbono micronutrientes necesarios para su desarrollo. Palabras clave: harina de cebada, relación C/N, micronutrientes, fuentes de carbono, fuentes de nitrógeno.  AbstractGanoderma lucidum fungus has some biomass components with beneficial health properties. The knowledge about its nutritionals requirements for growing will favor its industrial production at lower cost. In this work, the effect of C/N ratio, the presence of different carbon, nitrogen and micronutrients sources, on fungal biomass

  15. Cuantificación de ácidos grasos a partir de biomasa microalgal

    Directory of Open Access Journals (Sweden)

    García Sánchez, J. L.

    1993-12-01

    Full Text Available Long chain polyunsaturated fatty acids are focusing the interest of researchers as long as analytical techniques are being improved. The Lepage and Roy direct transesterification method is being widely used to measure fatty acid content of microalgae which are proposed as potential sources of these products. In this paper, the physical state of the biomass to be analyzed is studied. Comparison has been stated between lyophilized biomass and wet biomass just harvested. Furthermore, the amount of sample and the number of methyl ester extractions have also been studied. From the statistical analysis carried out, wet biomass to fatty acid determination and the adequate range of sample are proposed. Three methyl ester extractions improve the resolution of GC analysis.

    El interés creciente por los ácidos grasos poliinsaturados de cadena larga viene favorecido por la mejora de las técnicas de análisis. La metodología de transesterificación directa propuesta por Lepage y Roy está siendo ampliamente utilizada para la determinación del contenido en ácidos grasos de microalgas, consideradas como potenciales fuentes de estos productos. En el presente trabajo, se analiza la influencia del estado físico de la biomasa analizada, seca, normalmente por liofilización, o húmeda recién cosechada del cultivo. Asimismo, se analiza el efecto de la cantidad de biomasa empleada y del número de extracciones de los esteres metílicos obtenidos. Del estudio estadístico realizado se pone de manifiesto la importancia del estado físico de la muestra, aconsejándose el uso de biomasa directamente obtenida del cultivo. Se proponen los intervalos de cantidad de biomasa para metilación, así como la conveniencia de realizar tres extracciones previas a la inyección en el cromatógrafo, que favorece la resolución del análisis.

  16. La biomasa en la producción de electricidad en España

    Directory of Open Access Journals (Sweden)

    Espejo Marín, Cayetano

    2005-06-01

    Full Text Available The generation of electricity using biomass began in Spain in the mid-1990s. In this paper, we examine the combustible products used in the generation of this type of electricity, the legal framework protecting its production, the evolution of the installed power and its territorial distribution, the environmental impact of biomass as a renewable energy, the energy policy supporting this technology and the problems for the development of biomass as a energy source in Spain.

    [es] La producción de electricidad con biomasa comienza su desarrollo en España a mediados de los años noventa. En este artículo se analizan los productos combustibles de biomasa destinados a la generación de electricidad, el marco legal que protege esta producción, la evolución de la potencia instalada y su distribución territorial, el impacto ambiental de la biomasa como energía renovable, la política energética de apoyo a esta tecnología, y los problemas para el desarrollo de la biomasa como fuente energética en España. [fr] La biomasse dans la production d´électricité en Espagne. La production d'électricité avec biomasse commence son développement en Espagne vers le milieu des années quatre-vingt-dix. Dans cet article nous analysons les produits combustibles de biomasse destines à engendrer de l'électricité, le cadre légal qui protégé cette production, l'évolution de la puissance installée, la répercussion de l'environnement de la biomasse comme énergie renouvelable, la politique énergétique de soutien à cette technologie et les problèmes pour le développement de la biomasse comme source énergétique en Espagne.

  17. Valorización de Biomasa de origen vegetal mediante procesos térmicos y termoquímicos.

    OpenAIRE

    López González, Diego

    2013-01-01

    En particular, esta Tesis Doctoral tiene como objetivo la evaluación de los principales procesos de conversión termoquímica de biomasa, principalmente pirólisis, combustión y gasificación, mediante el sistema experimental de termobalanza acoplada a un espectrómetro de masas. Adicionalmente, se estudió la degradación de fluidos de intercambio de calor en su aplicación en plantas termosolares de concentración. Los procesos de conversión termoquímica de biomasa son los procesos más interesan...

  18. Reserva de carbono en biomasa forestal y suelos minerales en el Parque Nacional Malinche (México)

    OpenAIRE

    María Eugenia Valdez Pérez; Gandhi González Guerrero; Rafael Morales Ibarra; Rut Yadira Bolaños Suárez

    2016-01-01

    Las áreas naturales protegidas representan una de las estrategias para la mitigación del cambio climático. El objetivo de esta investigación consistió en estimar el contenido de carbono en biomasa forestal en suelos minerales y calcular las pérdidas de carbono por cambios de uso del suelo en el Parque Nacional Malinche (PNM). La superficie de bosque del PNM es de 17.496,34 ha y almacena 1.544.377,66 mg en bosque y 4.148.985,97 mg en suelos. Para estimar el contenido de biomasa forestal se apl...

  19. Avances en el modelado de la combustión de biomasa en spouted bed cónico

    OpenAIRE

    Saldarriaga Elorza, Juan Fernando

    2016-01-01

    290 p. En aras del desarrollo de un modelo riguroso para la combustión de biomasa vegetal en lecho en surtidor, en este Trabajo se ha avanzado en cuatro pilares fundamentales cuya implementación en el futuro permitirá desarrollar una herramienta que simule el comportamiento en la cámara de combustión de distintas formas de biomasa vegetal. Esta herramienta facilitará la labor de diseño de futuras plantas y permitirá evaluar y adaptar el funcionamiento de las mismas a cada alimentación, lo ...

  20. Método basado en teledetección para estimar la emisión de gases efecto invernadero por quema de biomasa A remote sensing method to estimate greenhouse gas emissions from biomass burning

    Directory of Open Access Journals (Sweden)

    Jesús Adolfo Anaya Acevedo

    2011-01-01

    Full Text Available La quema de biomasa es una fuente importante de gases efecto invernadero en países en vías de desarrollo. En Colombia, el cambio de uso del suelo, la silvicultura y el sector agropecuario superan el 50% de las emisiones totales de efecto invernadero. El fuego se utiliza con frecuencia como un mecanismo para cambiar el uso del suelo. Los Llanos orientales y la Amazonía colombiana están sometidos todos los años a la quema de biomasa, especialmente entre enero y marzo. Los estudios en la distribución espacial y temporal de las emisiones son importantes de cara a los informes en el ámbito nacional. Este artículo de revisión describe el método para hacer estas estimaciones utilizando teledetección y algunos de los resultados disponibles para Colombia.Biomass burning is a major source of greenhouse gas emissions in developing countries. In Colombia, land use change, forestry and agriculture are responsible for more than 50% of the total greenhouse gas emissions. Fire is commonly used as a mechanism for land use change. In Colombia the Llanos Orientales and the Amazonia are subject to biomass burning every year during the dry season, especially from January to March. Studies of the spatial and temporal distribution of emissions are required for emissions report at a national level. The goal of this state of the art article is to describe a method to estimate emissions with a remote sensing approach and to present some of the variables already measured in Colombia.

  1. Dicty_cDB: CFD139 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD139 (Link to dictyBase) - - - Contig-U13855-1 CFD139Z (Link... to Original site) - - CFD139Z 648 - - - - Show CFD139 Library CF (Link to library) Clone ID CFD139 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD1-B/CFD139Q.Seq.d/ Representative seq. ID CFD13...9Z (Link to Original site) Representative DNA sequence >CFD139 (CFD139Q) /CSM/CF/CFD1-B/CFD139Q.Seq.d/ XXXXX... Score E Sequences producing significant alignments: (bits) Value CFD139 (CFD139Q) /CSM/CF/CFD1-B/CFD139Q.Se

  2. CFD analysis of turbopump volutes

    Science.gov (United States)

    Ascoli, Edward P.; Chan, Daniel C.; Darian, Armen; Hsu, Wayne W.; Tran, Ken

    1993-07-01

    An effort is underway to develop a procedure for the regular use of CFD analysis in the design of turbopump volutes. Airflow data to be taken at NASA Marshall will be used to validate the CFD code and overall procedure. Initial focus has been on preprocessing (geometry creation, translation, and grid generation). Volute geometries have been acquired electronically and imported into the CATIA CAD system and RAGGS (Rockwell Automated Grid Generation System) via the IGES standard. An initial grid topology has been identified and grids have been constructed for turbine inlet and discharge volutes. For CFD analysis of volutes to be used regularly, a procedure must be defined to meet engineering design needs in a timely manner. Thus, a compromise must be established between making geometric approximations, the selection of grid topologies, and possible CFD code enhancements. While the initial grid developed approximated the volute tongue with a zero thickness, final computations should more accurately account for the geometry in this region. Additionally, grid topologies will be explored to minimize skewness and high aspect ratio cells that can affect solution accuracy and slow code convergence. Finally, as appropriate, code modifications will be made to allow for new grid topologies in an effort to expedite the overall CFD analysis process.

  3. Hidrodinámica y Combustión de Biomasa Vegetal Residual en Spouted Bed Cónico

    OpenAIRE

    Achutegui Narbona, Aitor

    2014-01-01

    En este trabajo se ha analizado la fluidodinámica de diferentes biomasas en spouted bed ademas de la combustión de algunas de ellas. La fluidodínamica también se ha efectuado con diferentes dispositivos internos

  4. CFD Simulations of Soap Separation; CFD-simulering av avsaapning

    Energy Technology Data Exchange (ETDEWEB)

    Birkestad, Per

    2010-07-01

    A part of Vaermeforsk, the 'Skogsindustriella programmet', has identified the possibility to increase the production of tall oil, and hence the competitiveness, in Swedish pulp mills through an increase in the efficiency of the soap separation tanks. Currently, soap is extracted from the black liquor through a sedimentation process where the less dense soap rise to the top of the liquor tank where it is removed through a over-flow ducting at the top of the tank. Vaermeforsk seeks a better understanding of the detailed flow and the separation mechanisms within the liquor tanks and has initiated a study of computational fluid dynamics (CFD) of the tanks. The aim of the study has been threefold; To develop CFD-methods for use in the study of soap separation processes, to investigate the detailed flow within two Swedish liquor tanks and one North American soap skimmer and lastly to develop new design rules for use in future designs of soap separation tanks. The project shows that CFD is a useful tool for the investigation of black liquor and soap flow within a soap separation tank. The CFD simulations of three existing liquor tanks show that the previously used design-rules based on surface loads are inadequate as the actual flow velocities within the tanks are two orders of magnitude larger than those previously used as reference (the surface load). The CFD simulations also show that the black liquor flow, and hence the soap separation, is very sensitive to density variations on the black liquor inlet and temperature variations as small as 1 deg C can significantly affect the liquor flow.

  5. Programación por metas Energía alternativa mediante biomasa.

    Directory of Open Access Journals (Sweden)

    Guerrero Casas, Flor María

    2003-01-01

    Full Text Available En este trabajo se presenta un modelo multicriterio de localización de centrales de generación de energía eléctrica mediante biomasa. Los objetivos considerados son: (1 minimizar el coste total de la operación, (2 maximizar la producción de electricidad obtenida, (3 maximizar la distancia entre plantas, (4 maximizar la aceptación social y (5 establecer las plantas o ampliaciones en aquellos lugares donde exista una mayor predisposición por parte de las administraciones locales. Finalmente, se concluye con una aplicación práctica mediante programación por metas ponderadas para la región andaluza, considerando los residuos procedentes del olivar como fuente de energía.

  6. COMPONENŢA AMINOACIZILOR DIN BIOMASA ALGEI CIANOFITE NOSTOC GELATINOSUM (SCHOUSB ELENK.

    Directory of Open Access Journals (Sweden)

    Sergiu DOBROJAN

    2016-02-01

    Full Text Available În articol este analizată componenţa aminoacizilor din biomasa algei cianofite Nostoc gelatinosum (Schousb Elenk. colectate de pe mediul nutritiv Drew. Din grupa aminoacizilor esenţiali în biomasa algei Nostoc gelatinosum (Schousb Elenk. se conţine în cantităţi majore leucina (2,142±0,06 mg/100 mg, treonina (1,188±0,02 mg/100 mg şi valina (1,085±0,03 mg/100 mg. Din aminoacizii neesenţiali predomină acidul aspartic (4,523±0,11 mg/100 mg şi acidul glutamic (2,774±0,07 mg/100 mg. Alga Nostoc gelatinosum (Schousb Elenk. are un conţinut bogat de aminoacizi şi poate servi ca sursă pentru vaste domenii de aplicare.THE AMINO ACIDS COMPOSITION OF THE BLUE-GREEN ALGANOSTOC GELATINOSUM (SCHOUSB ELENKThis article presents the amino acid content of the blue-green alga Nostoc gelatinosum (Schousb Elenk. collected from the Drew nutritive medium. From the essential amino group in Nostoc gelatinosum (Schousb Elenk. biomass, major amounts are contained leucine (2,142 ± 0,06 mg/100 mg, threonine (1,188 ± 0,02 mg/100 mg and valine (1,085 ± 0,03 mg/100 mg. From nonessential amino acids predominates aspartic acid (4,523 ± 0,11 mg/100 mg and glutamic acid (2,774 ± 0.07 mg/100 mg. The alga Nostoc gelatinosum (Schousb Elenk. has a high content of amino acids and can serve as a source for vast areas of application. 

  7. Dicty_cDB: CFD190 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD190 (Link to dictyBase) - G00190 DDB0231328 Contig-U14182-1 CFD1...90P (Link to Original site) CFD190F 642 CFD190Z 594 CFD190P 1236 - - Show CFD190 Library CF (Link to library) Clone ID CFD1...Contig-U14182-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD1-D/CFD1...90Q.Seq.d/ Representative seq. ID CFD190P (Link to Original site) Representative DNA sequence >CFD190 (CFD190Q) /CSM/CF/CFD1...-D/CFD190Q.Seq.d/ ATAAATTAAAAAAAAATGAATAAAGAAATTTTTAATTCAAAATTATTTGAAAAATTAGAT AAAGATA

  8. Estimación de biomasa en herbáceas a partir de datos hiperespectrales, regresión PLS y la transformación continuum removal

    Directory of Open Access Journals (Sweden)

    M. Marabel-García

    2014-12-01

    Full Text Available El objetivo del estudio fue comparar los resultados de dos métodos para la estimación de la biomasa aérea a partir de datos de espectroradiometría de campo: (i regresión por mínimos cuadrados parciales (Partial Least Squares Regression, PLSR y (ii regresión lineal utilizando los índices Profundidad del Mínimo (Maximum Band Depth, MBD y Área Sobre el Mínimo (Area Over the Minimum, AOM como descriptores. En ambos casos se llevó a cabo una previa transformación de los espectros mediante Continuum Removal (CR. Como los resultados empleando PLS (R2=0,920, RMSE=3,622 g/m2 fueron muy similares a los obtenidos con los índices (para AOM: R2=0,915, RMSE=3,615 g/m2, recomendamos los índices derivados del CR puesto que su interpretación es más sencilla que la del PLSR. 

  9. Progress in application of CFD techniques

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Computational Fluid Dynamics (CFD) is an important branch of fluid mechanics, and will continue to play great roles on the design of aerospace vehicles, explora- tion of new concept vehicles and new aerodynamic technology. This paper will present the progress of CFD from point of view of engineering application in recent years at CARDC, including the software integration, grid technique, speeding up of convergence, unsteady fluid computation,etc., and also give some engineering application examples of CFD at CARDC.

  10. Opstilling af ventilationsarmaturer i CFD-beregninger

    DEFF Research Database (Denmark)

    Nielsen, Peter V.

    2009-01-01

    Opstilling af armaturer i CFD-beregninger er et område, hvor ventilationsbranchen skal tilføre CFD-metoderne en specialviden, som ikke på forhånd er indlagt i programmerne. I artiklen bringes nogle eksempler på specificering af en indblæsningsåbning......Opstilling af armaturer i CFD-beregninger er et område, hvor ventilationsbranchen skal tilføre CFD-metoderne en specialviden, som ikke på forhånd er indlagt i programmerne. I artiklen bringes nogle eksempler på specificering af en indblæsningsåbning...

  11. CFD lends the government a hand

    Science.gov (United States)

    Lekoudis, Spiro; Singleton, Robert E.; Mehta, Unmeel B.

    1992-02-01

    The present survey of important and novel CFD applications being developed and implemented by U.S. Government contractors gives attention to naval vessel flow-modeling, Army ballistic and rotary wing aerodynamics, and NASA hypersonic vehicle related applications of CFD. CFD-generated knowledge of numerical algorithms, fluid motion, and supercomputer use is being incorporated into such additional areas as computational electromagnetics and acoustics. Attention is presently given to CFD methods' development status in such fields as submarine boundary layers, hypersonic kinetic energy projectile shock structures, helicopter main rotor tip flows, and National Aerospace Plane aerothermodynamics.

  12. CFD Script for Rapid TPS Damage Assessment

    Science.gov (United States)

    McCloud, Peter

    2013-01-01

    This grid generation script creates unstructured CFD grids for rapid thermal protection system (TPS) damage aeroheating assessments. The existing manual solution is cumbersome, open to errors, and slow. The invention takes a large-scale geometry grid and its large-scale CFD solution, and creates a unstructured patch grid that models the TPS damage. The flow field boundary condition for the patch grid is then interpolated from the large-scale CFD solution. It speeds up the generation of CFD grids and solutions in the modeling of TPS damages and their aeroheating assessment. This process was successfully utilized during STS-134.

  13. ESTUDIOS TOXICOLOGICOS COMO HERRAMIENTA PARA EVALUAR EL DESEMPENO DE UN REACTOR ANAEROBIO DE BIOMASA INMOVILIZADA

    Directory of Open Access Journals (Sweden)

    TATIANA RODRIGUEZ CHAPARRO

    2010-01-01

    Full Text Available Los efluentes de la Industria de Papel y Celulosa son usualmente tóxicos y mutagénicos. Esa característica se deriva principalmente por la presencia de compuestos xenobióticos formados durante el proceso. Los parámetros globales para el análisis de la calidad del agua como, demanda química de oxigeno, carbón orgánico total, entre otros, no permiten identificar si el potencial toxicológico es remediado después de los tratamientos. El objetivo de este trabajo fue evaluar el desempeño de un reactor anaerobio horizontal de biomasa inmovilizada (RAHBI tratando un efluente real de blanqueamiento de celulosa Kraft, por medio de ensayos de toxicidad (Daphnia similis Ceriodaphnia silvestrii , mutagenicidad y citotoxicidad (Allium cepa L. . Los resultados mostraron alta sensibilidad de todos los organismos estudiados y buena capacidad del reactor anaerobio para remover compuestos que ejercen efectos tóxicos y mutagénicos. Los bioensayos estudiados representan una alternativa interesante para el análisis de la calidad del agua y para la evaluación del desempeño de tratamientos.

  14. Obtención de etanol a partir de biomasa lignocelulósica

    Directory of Open Access Journals (Sweden)

    Mabel Viñals-Verde

    2012-01-01

    Full Text Available Se muestra el estado de la literatura en cuanto a la obtención de etanol a partir de hidrolizados lignocelulósicos, una alternativa muy estudiada en la actualidad en el mundo con vistas a disminuir el costo del etanol combustible. Se reportan los materiales lignocelulósicos que están en estudio siendo el bagazo de caña de azúcar y los derivados del maíz los más utilizados. Se presentan los métodos de pre-tratamiento, purificación del hidrolizado, fraccionamiento de la celulosa, obtención de microorganismos geneticamente modificados y producción a nivel de planta piloto e industrial. Los métodos de pretratamiento por explosión por vapor y de purificación por "overliming" son los más estudiados con resultados satisfactorios. Entre los métodos de fraccionamiento de la celulosa, la sacarificación y fermentación simultáneas (SSF se reporta como el proceso más novedoso y eficiente para la obtención de etanol a partir de biomasa aunque a nivel de planta piloto e industrial se continúa trabajando con el sistema de hidrólisis ácida. Se muestran algunos resultados obtenidos con microorganismos genéticamente modificados como la levadura Saccharomyces y la bacteria Escherichia coli.

  15. Perspectivas del potencial energético de la biomasa en el marco global y latinoamericano

    Directory of Open Access Journals (Sweden)

    Julián Rodrigo Quintero González

    2015-06-01

    Full Text Available El calentamiento global y los cambios climáticos que éste conlleva han fomentado desde hace algunos años la exploración de otros tipos de obtención energética para disminuir el uso del combustible fósil, siendo éste último uno de los principales causantes de dicho problema ambiental. El presente artículo expone algunas investigaciones recientes sobre la bioenergía u obtención de energía a partir de biomasa, considerada como energía limpia. Se abarcan temáticas como la bioenergía y sus posibilidades desde el punto de vista energético, teniendo en cuenta las expectativas de producción según su potencial o productividad energética, además del aporte que este tipo de tecnología hace a la disminución de la huella ecológica.

  16. Distribución de la biomasa y densidad de raíces finas en una gradiente sucesional de bosques en la Zona Norte de Costa Rica

    OpenAIRE

    Jiménez-Rodríguez, César; Instituto Tecnológico de Costa Rica, Escuela de Ingeniería Forestal; Cartago, Costa Rica; Arias-Aguilar, Dagoberto; Instituto Tecnológico de Costa Rica, Escuela de Ingeniería Forestal; Cartago, Costa Rica

    2012-01-01

    En este estudio se evaluó la distribución de la biomasa radical, el índice de área radical (RAI) y la densidad longitudinal (RLD) de raíces finas (< 5 mm) en una gradiente sucesional de bosques húmedos tropicales en la zona de Florencia de San Carlos, Costa Rica. La variación de estos parámetros se evaluó en función de la profundidad del suelo y del estado sucesional.La biomasa radical, al igual que el RAI y el RLD, disminuyen conforme aumenta la profundidad en el perfil y coincide con los...

  17. Relaciones entre biomasa, tasa de crecimiento, respiración y respiración potencial en el crustáceo "Artemia salina"

    OpenAIRE

    Martínez, I. (Izaskun)

    2007-01-01

    Programa de Doctorado en Oceanografía [ES] El metabolismo respiratorio y la biomasa del zooplancton son parámetros clave para el entendimiento del flujo de energía, abundancia de la población, estructura de la comunidad, así como otras variables de comunidades planctónicas marinas. La actividad respiratoria del transporte de electrones del zooplancton (ETS) mide la respiración potencial (Ф) y es una aproximación para el consumo de oxígeno en la respiración y la biomasa. No e...

  18. Componentes químicos y biomasa de Ulva fasciata (Chlorophyta) en la costa Norte de la Ciudad de La Habana, Cuba

    OpenAIRE

    Mercedes Cano Mallo; Jhoana Díaz Larrea; Olga Valdés Iglesias; Isabel Bustio

    2007-01-01

    El objetivo de este trabajo fue determinar el porcentaje de los componentes químicos (proteínas, carbohidratos, fibra, lípidos, cenizas y la relación proteína:carbohidratos) y la biomasa de Ulva fasciata Delile (Chlorophyta), en un sector de la costa Norte de la Ciudad de La Habana entre los ríos Quibú y Jaimanitas. Se evaluó la variación espacial y temporal de los componentes entre mayo de 1998 y julio de 1999 y la biomasa entre febrero de 1999 y enero del 2001. Se escogieron para realizar l...

  19. Simulación en código Matlab de un reactor para la gasificación de biomasa en lecho fluidizado burbujeante

    OpenAIRE

    Tosina Fernández, Sergio

    2013-01-01

    Este proyecto simula un reactor unidimensional para la gasificación de biomasa supuesto en régimen estacionario, isotérmico y adiabático, con un esquema simplificado de reacciones, en el que se recogen la teoría hidrodinámica de las “Dos Fases” y distintas correlaciones y parámetros que proceden de ensayos y simulaciones de los últimos cincuenta años, aproximadamente. En los primeros capítulos del proyecto se sientan las bases y conceptos relacionados con la biomasa para una...

  20. Progress in application of CFD techniques

    Institute of Scientific and Technical Information of China (English)

    CHEN ZuoBin; JIANG Xiong; ZHOU Zhu; XIAO HanShan; HUANG Yong; MOU Bin; XIAO ZhongYun; LIU Gang; WANG YunTao

    2008-01-01

    Computational Fluid Dynamics (CFD) is an important branch of fluid mechanics,and will continue to play great roles on the design of aerospace vehicles,exploration of new concept vehicles and new aerodynamic technology.This paper will present the progress of CFD from point of view of engineering application in recent years at CARDC,including the software integration,grid technique,speeding up of convergence,unsteady fluid computation,etc.,and also give some engineering application examples of CFD at CARDC.

  1. CFD for wind and tidal offshore turbines

    CERN Document Server

    Montlaur, Adeline

    2015-01-01

    The book encompasses novel CFD techniques to compute offshore wind and tidal applications. Computational fluid dynamics (CFD) techniques are regarded as the main design tool to explore the new engineering challenges presented by offshore wind and tidal turbines for energy generation. The difficulty and costs of undertaking experimental tests in offshore environments have increased the interest in the field of CFD which is used to design appropriate turbines and blades, understand fluid flow physical phenomena associated with offshore environments, predict power production or characterise offshore environments, amongst other topics.

  2. Dicty_cDB: CFD603 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD603 (Link to dictyBase) - - - Contig-U16255-1 CFD603P (Link... to Original site) CFD603F 520 CFD603Z 188 CFD603P 708 - - Show CFD603 Library CF (Link to library) Clone ID CFD603 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16255-1 Original site URL http://dict...AAAAAAATAATAATAATAATTTAATAACTAATCATTAT sequence update 2001. 6. 1 Translated Amino Acid sequence QGTSGGTPGSCDKVNCPNGYICT...n*sl Frame C: QGTSGGTPGSCDKVNCPNGYICTIVNQLAVCVSPSSSSSSSSSTTGSHTTTGGSTTGSHT TTGGSTTGSHTTTGGSTTGSHTTTGGSTTGSHT

  3. CFD Studies on Biomass Thermochemical Conversion

    Directory of Open Access Journals (Sweden)

    Lifeng Yan

    2008-06-01

    Full Text Available Thermochemical conversion of biomass offers an efficient and economically process to provide gaseous, liquid and solid fuels and prepare chemicals derived from biomass. Computational fluid dynamic (CFD modeling applications on biomass thermochemical processes help to optimize the design and operation of thermochemical reactors. Recent progression in numerical techniques and computing efficacy has advanced CFD as a widely used approach to provide efficient design solutions in industry. This paper introduces the fundamentals involved in developing a CFD solution. Mathematical equations governing the fluid flow, heat and mass transfer and chemical reactions in thermochemical systems are described and sub-models for individual processes are presented. It provides a review of various applications of CFD in the biomass thermochemical process field.

  4. ARC Code TI: CFD Utility Software Library

    Data.gov (United States)

    National Aeronautics and Space Administration — The CFD Utility Software Library consists of nearly 30 libraries of Fortran 90 and 77 subroutines and almost 100 applications built on those libraries. Many of the...

  5. Generación eléctrica a partir de biomasa en una destilería diversificada

    Directory of Open Access Journals (Sweden)

    Pedro A. Rodríguez

    2007-01-01

    Full Text Available La instalación de una destilería de etanol diversificada, como una vía de generación de energía renovable integrada a la producción de alimentos, muestra relevantes ventajas en comparación con las destilerías tradicionales. En particular, para el caso de una planta de producción de etanol de este tipo, de 1200 hL/d, la generación de electricidad, con la biomasa que esta industria genera, alcanza el valor de 15,92 MW de potencia eléctrica excedente para el Sistema Electroenergético Nacional. Constituye un polo de desarrollo económico, social y estratégico, atendiendo al concepto de autosustentación dado por el Protocolo de Kyoto. El concepto de diversificación alcanza a todo el sector productivo. En las destilerías tradicionales la diversificación es incipiente. La biomasa constituye una de las principales fuentes de generación de energía limpia y barata, pasando de ser un subproducto, a un eslabón fundamental del proceso productivo.

  6. Reserva de carbono en biomasa forestal y suelos minerales en el Parque Nacional Malinche (México

    Directory of Open Access Journals (Sweden)

    María Eugenia Valdez Pérez

    2016-01-01

    Full Text Available Las áreas naturales protegidas representan una de las estrategias para la mitigación del cambio climático. El objetivo de esta investigación consistió en estimar el contenido de carbono en biomasa forestal en suelos minerales y calcular las pérdidas de carbono por cambios de uso del suelo en el Parque Nacional Malinche (PNM. La superficie de bosque del PNM es de 17.496,34 ha y almacena 1.544.377,66 mg en bosque y 4.148.985,97 mg en suelos. Para estimar el contenido de biomasa forestal se aplicaron ecuaciones alométricas y se trabajó con la cartografía del Instituto Nacional de Estadística y Geografía (INEGI en el análisis espacio-temporal de los cambios de uso de suelo. Para el carbono en suelos se aplicaron los valores del Panel Intergubernamental de Cambio Climático (IPCC.

  7. Caracterización química de biomasa y su relación con el poder calorífico

    OpenAIRE

    Álvarez Rodríguez, Ana

    2013-01-01

    Caracterización química, por el método tradicional de extracción, de 9 biomasas lignocelulósicas procedentes de cultivos de vid y olivo y estudio de su relación con el poder calorífico superior.

  8. CFD Simulation On CFBC Boiler

    Directory of Open Access Journals (Sweden)

    Amol S. Kinkar

    2015-02-01

    Full Text Available Abstract Heavy industrialization amp modernization of society demands in increasing of power cause to research amp develop new technology amp efficient utilization of existing power units. Variety of sources are available for power generation such as conventional sources like thermal hydro nuclear and renewable sources like wind tidal biomass geothermal amp solar. Out of these most common amp economical way for producing the power is by thermal power stations. Various industrial boilers plays an important role to complete the power generation cycle such as CFBC Circulating Fluidized Bed Combustion FBC Fluidized Bed Combustion AFBC Atmospheric Fluidized Bed Combustion Boiler CO Boiler RG amp WHR Boiler Waster heat recovery Boiler. This paper is intended to comprehensively give an account of knowledge related to refractory amp its failure in CFBC boiler with due effect of flue gas flow during operation on refractory by using latest technology of CAD Computer aided Design amp CAE Computer aided Engineering. By conceptual application of these technology the full scale model is able to analyze in regards the flow of flue gas amp bed material flow inside the CFBC loop via CFD Computational Fluid Dynamics software. The results obtained are helpful to understand the impact of gas amp particles on refractory in different areas amp also helped to choose suitable refractory material in different regions.

  9. ON NUMERICAL TECHNIQUES IN CFD

    Institute of Scientific and Technical Information of China (English)

    Zhuang Fenggan

    2000-01-01

    Numerical techniques play an important role in CFD. Some of them are reviewed in this paper. The necessity of using high order difference scheme is demonstrated for the study of high Reynolds number viscous flow. Physical guide lines are provided for the construction of these high order schemes. To avoid unduly ad hoc treatment in the boundary region the use of compact scheme is recommended because it has a small stencil size compared with the traditional finite difference scheme. Besides preliminary Fourier analysis shows the compact scheme can also yield better space resolution which makes it more suitable to study flow with multiscales e.g. turbulence. Other approaches such as perturbation method and finite spectral method are also emphasized. Typical numerical simulations were carried out. The first deals with Euler equations to show its capabilities to capture flow discontinuity.The second deals with Navier-Stokes equations studying the evolution of a mixing layer, the pertinent structures at different times are shown. Asymmetric break down occurs and also the appearance of small vortices.

  10. Influencia de la aplicación de vinaza en actividad y biomasa microbiana en un Entic Dystropept y un Fluventic haplustoll del Valle del Cauca, Colombia

    Directory of Open Access Journals (Sweden)

    Sandra Patricia Montenegro Gómez

    2009-01-01

    Full Text Available Con la aplicación de vinaza, residuo de la producción de alcohol carburante a partir de la caña de azúcar, se evaluó el efecto sobre la actividad y biomasa microbiana del suelo y el suministro de K+ al cultivo de maíz dulce (Zea Mays en un Entic Dystropept y un Fluventic Haplustoll del Valle del Cauca, Colombia. Se utilizó un diseño completamente al azar con cuatro tratamientos y cinco repeticiones: T1 (100% requerimiento de K+ con KCl, T2 (100% requerimiento de K+ con vinaza, T3 (50% requerimiento de K+ con KCl +50% con vinaza y T4 (25% requerimiento de K+ con KCl +75% con vinaza. Se estimó biomasa microbiana por el método de fumigación-extracción. Se realizó análisis de varianza, prueba de comparación de medias, regresiones y correlaciones (SAS. Se presentaron diferencias significativas en la actividad y biomasa microbiana por época de muestreo y entre los diferentes muestreos; al final del cultivo el Entic Dystropept presentó el contenido más alto de biomasa microbiana-C en el T2, mientras que en el Fluventic Haplustoll fue en el T1. El menor qCO2 fue para el T2 del Entic Distropept y T1 del Fluventic Haplustoll, estos tratamientos presentaron mayor acumulación de biomasa en cada suelo respectivamente T2 (30 450 kg ha-1 y T1 (21 015.6 kg ha-1.

  11. Empleo de la relación residuo producto para la estimación de biomasa cañera potencial. Caso de estudio

    Directory of Open Access Journals (Sweden)

    Lizet Rodríguez-Machín

    2014-01-01

    Full Text Available El panorama energético de la biomasa va tomando un mayor auge ante el vaticinado agotamiento de los combustibles fósiles, el impacto ambiental que representa y la seguridad energética asociada. El presente trabajo se desarrolla en la Unidad Empresarial de Base (UEB Héctor Rodríguez. Esta unidad emplea el bagazo obtenido en el proceso industrial de producción de azúcar para la generación de calor y de electricidad sin estimar adecuadamente su potencial. El propósito de esta investigación es aplicar las ecuaciones matemáticas para la estimación de la biomasa herbácea potencial al caso de la biomasa cañera (bagazo y conocer su disponibilidad con fines energéticos. Se aplicó el método de evaluación con relación residuo producto (RRP, el valor calculado está dentro del rango de los reportados en la literatura, pero fue preciso emplear el RRP calculado para el país por ser este más representativo que el calculado para la UEB. Se estimó que la biomasa potencial en central azucarero entre 2007 y 2012 fue de 98 856 t de bagazo. El potencial bruto máximo fue de 3 222 MW-h/día, lo cual permite establecer el límite superior a alcanzar en cuanto a potencial de biomasa se refiere en el proceso industrial pero no tiene en cuenta la totalidad de la caña producida en el proceso agrícola.

  12. Variación anual de la biomasa de Nymphoides fallax Ornduff (Menyanthaceae en la Laguna de Tecocomulco, Hidalgo, México

    Directory of Open Access Journals (Sweden)

    Agustin Quiroz-Flores

    2015-07-01

    Full Text Available Durante un ciclo anual se cuantificó la variación en la estratifi cación vertical de la biomasa deNymphoides fallaxy se analizaron las variables físicas y químicas del agua y sedimentos de la laguna de Tecocomulco, Hidalgo. La producción anual neta de N. fallax fue de 3 070.1 g PS m2. En el mes de junio la biomasa alcanzó su máximo (958.4 g PS m2 . La contribución de biomasa foliar de N. fallax a la proporción total de biomasa representa el 10%, la de peciolos alcanza el 40% y la contribución de biomasa subterránea equivale en ocasiones a más del 50%. El nivel de fósforo en los sedimentos se encuentra por arriba de la cantidad necesaria para sostener la producción vegetal (= 0.04%. Por los resultados obtenidos en este estudio, se puede señalar que en aquellas zonas ribereñas de la laguna en donde los agricultores han construido bordos, se propicia que durante la época de lluvias la columna de agua cambie bruscamente sus dimensiones pasando de 10 cm hasta alcanzar los 75 cm de profundidad y se eleven los niveles de fósforo en agua y sedimentos, lo que a su vez induce queNymphoides fallaxse vea estresada, y en un caso extremo, temporalmente sea sustituida por aquellas especies mejor adaptadas a las nuevas condiciones físicas y químicas del medio.

  13. Factores del manejo para estabilizar la producción de biomasa con leguminosas en el trópico

    Directory of Open Access Journals (Sweden)

    T. E. Ruiz

    2006-01-01

    Full Text Available Este material tiene como objetivo abundar acerca de aquellos factores del manejo que conduzcan a estabilizar la producción de biomasa en sistemas ganaderos en el trópico. Es obvio que los sistemas mejorados y bien manejados de pasturas de gramíneas y leguminosas, en cualquiera de sus alternativas, son opciones para lograr la sostenibilidad. Una concepción más amplia y profunda es la relativa a los estudios de pasturas mixtas; éstos, deben tener un enfoque más biológico por lo que, además de considerar el ambiente en el cual se desarrollan y crecen, hay que incluir la forma en que los componentes vegetales se manifiestan en las especies implicadas del agroecosistema. Aquí no podemos olvidar el efecto del animal. Los problemas asociados con la persistencia se reconocen cada vez más como una preocupación real. Los diversos factores que controlan la permanencia de las especies forrajeras se agrupan en aquellos que pueden ser manejados y controlados por el productor, así como en los que éste no puede intervenir. Es por ello que las producciones animales y de otro tipo, derivados de estos sistemas, varían positivamente en el tiempo, en la medida en que se va consolidando la relación suelo /planta /animal. De esta correspondencia no puede quedar excluido el papel interactuante y modificador del hombre con los elementos antes señalados. La producción de biomasa es una actividad multidisciplinaria; de ahí que el éxito de su funcionamiento esté condicionado al conocimiento de las interacciones entre sus componentes, así como entre éstos y el medio ambiente, lo cual permitirá la generación de estrategias de manejo acordes con la ecología que conduzcan a mejorar la productividad y la sostenibilidad del agroecosistema. Por tanto, la producción de biomasa constituye un elemento determinante en el éxito y la eficiencia de los sistemas con leguminosas.

  14. Revisión sobre la corrosión de tubos sobrecalentadores en plantas de biomasa

    Directory of Open Access Journals (Sweden)

    Berlanga-Labari, C.

    2006-08-01

    Full Text Available The design of new biomass-fired power plants with increased steam temperature raises concerns of high-temperature corrosion. The high potassium and chlorine contents in many biomasses, specially in wheat straw, are potentially harmful elements with regard to corrosion. Chlorine may cause accelerated corrosion resulting in increased oxidation, metal wastage, internal attack, void formations, and loose non-adherent scales. The most severe corrosion problems in biomass-fired systems are expected to occur due to Cl-rich deposits formed on superheater tubes. In the first part of this revision the corrosion mechanism proposed are described in function of the conditions and compounds involved. The second part is focused on the behaviour of the materials tested so far in the boiler and in the laboratory. First the traditional commercial alloys are studied and secondly the new alloys and the coatings

    En el diseño de plantas de biomasa es muy importante tener en cuenta la temperatura del vapor para no tener problemas de corrosión. Esto, es debido al alto contenido de potasio y cloro que tienen la mayoría de los biocombustibles y, en especial, la paja de cereal. El objetivo de esta revisión es condensar el conocimiento actual sobre la corrosión de los sobrecalentadores a altas temperaturas provocada por compuestos clorados en plantas de biomasa. El cloro puede causar corrosión acelerada debido a la pérdida de metal del sobrecalentador, ataque interno y formación de capas de óxidos no adherentes. Los problemas de corrosión más severos en una caldera de biomasa se producen en los depósitos formados sobre los tubos sobrecalentadores. En la primera parte de esta revisión, se describen los mecanismos de corrosión propuestos en función de las condiciones de trabajo predominantes en la caldera. La segunda parte, se centra en revisar los estudios realizados para comprobar el comportamiento de los materiales mediante ensayos realizados en la

  15. TANK48 CFD MODELING ANALYSIS

    Energy Technology Data Exchange (ETDEWEB)

    Lee, S.

    2011-05-17

    The process of recovering the waste in storage tanks at the Savannah River Site (SRS) typically requires mixing the contents of the tank to ensure uniformity of the discharge stream. Mixing is accomplished with one to four dual-nozzle slurry pumps located within the tank liquid. For the work, a Tank 48 simulation model with a maximum of four slurry pumps in operation has been developed to estimate flow patterns for efficient solid mixing. The modeling calculations were performed by using two modeling approaches. One approach is a single-phase Computational Fluid Dynamics (CFD) model to evaluate the flow patterns and qualitative mixing behaviors for a range of different modeling conditions since the model was previously benchmarked against the test results. The other is a two-phase CFD model to estimate solid concentrations in a quantitative way by solving the Eulerian governing equations for the continuous fluid and discrete solid phases over the entire fluid domain of Tank 48. The two-phase results should be considered as the preliminary scoping calculations since the model was not validated against the test results yet. A series of sensitivity calculations for different numbers of pumps and operating conditions has been performed to provide operational guidance for solids suspension and mixing in the tank. In the analysis, the pump was assumed to be stationary. Major solid obstructions including the pump housing, the pump columns, and the 82 inch central support column were included. The steady state and three-dimensional analyses with a two-equation turbulence model were performed with FLUENT{trademark} for the single-phase approach and CFX for the two-phase approach. Recommended operational guidance was developed assuming that local fluid velocity can be used as a measure of sludge suspension and spatial mixing under single-phase tank model. For quantitative analysis, a two-phase fluid-solid model was developed for the same modeling conditions as the single

  16. Gas explosion prediction using CFD models

    Energy Technology Data Exchange (ETDEWEB)

    Niemann-Delius, C.; Okafor, E. [RWTH Aachen Univ. (Germany); Buhrow, C. [TU Bergakademie Freiberg Univ. (Germany)

    2006-07-15

    A number of CFD models are currently available to model gaseous explosions in complex geometries. Some of these tools allow the representation of complex environments within hydrocarbon production plants. In certain explosion scenarios, a correction is usually made for the presence of buildings and other complexities by using crude approximations to obtain realistic estimates of explosion behaviour as can be found when predicting the strength of blast waves resulting from initial explosions. With the advance of computational technology, and greater availability of computing power, computational fluid dynamics (CFD) tools are becoming increasingly available for solving such a wide range of explosion problems. A CFD-based explosion code - FLACS can, for instance, be confidently used to understand the impact of blast overpressures in a plant environment consisting of obstacles such as buildings, structures, and pipes. With its porosity concept representing geometry details smaller than the grid, FLACS can represent geometry well, even when using coarse grid resolutions. The performance of FLACS has been evaluated using a wide range of field data. In the present paper, the concept of computational fluid dynamics (CFD) and its application to gas explosion prediction is presented. Furthermore, the predictive capabilities of CFD-based gaseous explosion simulators are demonstrated using FLACS. Details about the FLACS-code, some extensions made to FLACS, model validation exercises, application, and some results from blast load prediction within an industrial facility are presented. (orig.)

  17. Gallinaza: Un residual avícola como fuente alternativa de nutrientes para producción de biomasa microalgal

    Directory of Open Access Journals (Sweden)

    Rosales Loaiza Nestor Luis

    2007-07-01

    Full Text Available La gallinaza puede ser usada como una fuente alternativa de nutrientes para el cultivo de microalgas, proveyendo de biomasa microalgal utilizable como producto final. El objetivo de este trabajo fue evaluar el efecto de la fracción soluble de gallinaza (FSG a tres diferentes concentraciones (6, 18 y 36% sobre el crecimiento, la producción de pigmentos y proteínas de la microalga marina Chroomonas sp. y de la microalga de agua dulce Chlorella sorokiniana. La FSG no biodegradada mostró un efecto letal sobre el crecimiento de ambas microalgas. La FSG tratada aeróbicamente mejoró el crecimiento de Chroomonas sp. a 18% con 131,37 ±13,66 x106 cel mL-1, y a 36% para C. sorokiniana de 228,64 ±4,90 x106 cel mL-1 (p

  18. IMPLEMENTACION DE PROCESOS DE CO-COMBUSTION DE CARBON Y BIOMASA EN CHILE: ESTUDIO DE FACTIBILIDAD TECNICA Y ECONOMICA

    OpenAIRE

    GARCIA CARMONA, XIMENA ANDREA

    2009-01-01

    Se ha estudiado la co-combustión de carbón con biomasa como alternativa para la generación de electricidad en Chile. El trabajo fue abordado desde dos ámbitos: a) el del diagnóstico, estudio y análisis (fase analítica) y b) el ámbito de la experimentación (fase tecnológica). Como resultados del primer enfoque, se presentan los estudios realizados, que incluyen una prospección completa de la situación actual chilena en cuanto a termogeneración eléctrica a partir de carbón. A partir...

  19. Valorización energética de la biomasa : aplicación en industrias del sector agroalimentario

    OpenAIRE

    García Morales, José Luis; Romero, L. I.; Sales, D.

    2008-01-01

    La utilización de la biomasa proveniente del sector agroalimentario como una fuente de energía renovable es de gran interés en la actualidad. Ésta puede generar energía, a través de procesos tanto termoquímicos como bioquímicos, susceptible de utilizarse en forma de calor, energía mecánica o electricidad, y en diferentes estados de agregación: sólida, líquida o gas. La Digestión Anaerobia de vertidos de destilerías vínicas es un ejemplo idóneo de los procesos bioquímicos de conversión de l...

  20. Gasificaton Transport: A Multiphase CFD Approach & Measurements

    Energy Technology Data Exchange (ETDEWEB)

    Dimitri Gidaspow; Veeraya Jiradilok; Mayank Kashyap; Benjapon Chalermsinsuwan

    2009-02-14

    The objective of this project was to develop predictive theories for the dispersion and mass transfer coefficients and to measure them in the turbulent fluidization regime, using existing facilities. A second objective was to use our multiphase CFD tools to suggest optimized gasifier designs consistent with aims of Future Gen. We have shown that the kinetic theory based CFD codes correctly compute: (1) Dispersion coefficients; and (2) Mass transfer coefficients. Hence, the kinetic theory based CFD codes can be used for fluidized bed reactor design without any such inputs. We have also suggested a new energy efficient method of gasifying coal and producing electricity using a molten carbonate fuel cell. The principal product of this new scheme is carbon dioxide which can be converted into useful products such as marble, as is done very slowly in nature. We believe this scheme is a lot better than the canceled FutureGen, since the carbon dioxide is safely sequestered.

  1. Coarse Grid CFD for underresolved simulation

    Science.gov (United States)

    Class, Andreas G.; Viellieber, Mathias O.; Himmel, Steffen R.

    2010-11-01

    CFD simulation of the complete reactor core of a nuclear power plant requires exceedingly huge computational resources so that this crude power approach has not been pursued yet. The traditional approach is 1D subchannel analysis employing calibrated transport models. Coarse grid CFD is an attractive alternative technique based on strongly under-resolved CFD and the inviscid Euler equations. Obviously, using inviscid equations and coarse grids does not resolve all the physics requiring additional volumetric source terms modelling viscosity and other sub-grid effects. The source terms are implemented via correlations derived from fully resolved representative simulations which can be tabulated or computed on the fly. The technique is demonstrated for a Carnot diffusor and a wire-wrap fuel assembly [1]. [4pt] [1] Himmel, S.R. phd thesis, Stuttgart University, Germany 2009, http://bibliothek.fzk.de/zb/berichte/FZKA7468.pdf

  2. Asynchronous Parallelization of a CFD Solver

    Directory of Open Access Journals (Sweden)

    Daniel S. Abdi

    2015-01-01

    Full Text Available A Navier-Stokes equations solver is parallelized to run on a cluster of computers using the domain decomposition method. Two approaches of communication and computation are investigated, namely, synchronous and asynchronous methods. Asynchronous communication between subdomains is not commonly used in CFD codes; however, it has a potential to alleviate scaling bottlenecks incurred due to processors having to wait for each other at designated synchronization points. A common way to avoid this idle time is to overlap asynchronous communication with computation. For this to work, however, there must be something useful and independent a processor can do while waiting for messages to arrive. We investigate an alternative approach of computation, namely, conducting asynchronous iterations to improve local subdomain solution while communication is in progress. An in-house CFD code is parallelized using message passing interface (MPI, and scalability tests are conducted that suggest asynchronous iterations are a viable way of parallelizing CFD code.

  3. Arbitrary Shape Deformation in CFD Design

    Science.gov (United States)

    Landon, Mark; Perry, Ernest

    2014-01-01

    Sculptor(R) is a commercially available software tool, based on an Arbitrary Shape Design (ASD), which allows the user to perform shape optimization for computational fluid dynamics (CFD) design. The developed software tool provides important advances in the state-of-the-art of automatic CFD shape deformations and optimization software. CFD is an analysis tool that is used by engineering designers to help gain a greater understanding of the fluid flow phenomena involved in the components being designed. The next step in the engineering design process is to then modify, the design to improve the components' performance. This step has traditionally been performed manually via trial and error. Two major problems that have, in the past, hindered the development of an automated CFD shape optimization are (1) inadequate shape parameterization algorithms, and (2) inadequate algorithms for CFD grid modification. The ASD that has been developed as part of the Sculptor(R) software tool is a major advancement in solving these two issues. First, the ASD allows the CFD designer to freely create his own shape parameters, thereby eliminating the restriction of only being able to use the CAD model parameters. Then, the software performs a smooth volumetric deformation, which eliminates the extremely costly process of having to remesh the grid for every shape change (which is how this process had previously been achieved). Sculptor(R) can be used to optimize shapes for aerodynamic and structural design of spacecraft, aircraft, watercraft, ducts, and other objects that affect and are affected by flows of fluids and heat. Sculptor(R) makes it possible to perform, in real time, a design change that would manually take hours or days if remeshing were needed.

  4. CFD Computations on Multi-GPU Configurations.

    Science.gov (United States)

    Menon, Sandeep; Perot, Blair

    2007-11-01

    Programmable graphics processors have shown favorable potential for use in practical CFD simulations -- often delivering a speed-up factor between 3 to 5 times over conventional CPUs. In recent times, most PCs are supplied with the option of installing multiple GPUs on a single motherboard, thereby providing the option of a parallel GPU configuration in a shared-memory paradigm. We demonstrate our implementation of an unstructured CFD solver using a set up which is configured to run two GPUs in parallel, and discuss its performance details.

  5. Tip studies using CFD and comparison with tip loss models

    DEFF Research Database (Denmark)

    Hansen, Martin Otto Laver; Johansen, J.

    2004-01-01

    The flow past a rotating LM8.2 blade equipped with two different tips are computed using CFD. The different tip flows are analysed and a comparison with two different tip loss models is made. Keywords: tip flow, aerodynamics, CFD......The flow past a rotating LM8.2 blade equipped with two different tips are computed using CFD. The different tip flows are analysed and a comparison with two different tip loss models is made. Keywords: tip flow, aerodynamics, CFD...

  6. Improved Stiff ODE Solvers for Combustion CFD

    Science.gov (United States)

    Imren, A.; Haworth, D. C.

    2016-11-01

    Increasingly large chemical mechanisms are needed to predict autoignition, heat release and pollutant emissions in computational fluid dynamics (CFD) simulations of in-cylinder processes in compression-ignition engines and other applications. Calculation of chemical source terms usually dominates the computational effort, and several strategies have been proposed to reduce the high computational cost associated with realistic chemistry in CFD. Central to most strategies is a stiff ordinary differential equation (ODE) solver to compute the change in composition due to chemical reactions over a computational time step. Most work to date on stiff ODE solvers for computational combustion has focused on backward differential formula (BDF) methods, and has not explicitly considered the implications of how the stiff ODE solver couples with the CFD algorithm. In this work, a fresh look at stiff ODE solvers is taken that includes how the solver is integrated into a turbulent combustion CFD code, and the advantages of extrapolation-based solvers in this regard are demonstrated. Benefits in CPU time and accuracy are demonstrated for homogeneous systems and compression-ignition engines, for chemical mechanisms that range in size from fewer than 50 to more than 7,000 species.

  7. CFD Simulation of Annular Centrifugal Extractors

    Directory of Open Access Journals (Sweden)

    S. Vedantam

    2012-01-01

    Full Text Available Annular centrifugal extractors (ACE, also called annular centrifugal contactors offer several advantages over the other conventional process equipment such as low hold-up, high process throughput, low residence time, low solvent inventory and high turn down ratio. The equipment provides a very high value of mass transfer coefficient and interfacial area in the annular zone because of the high level of power consumption per unit volume and separation inside the rotor due to the high g of centrifugal field. For the development of rational and reliable design procedures, it is important to understand the flow patterns in the mixer and settler zones. Computational Fluid Dynamics (CFD has played a major role in the constant evolution and improvements of this device. During the past thirty years, a large number of investigators have undertaken CFD simulations. All these publications have been carefully and critically analyzed and a coherent picture of the present status has been presented in this review paper. Initially, review of the single phase studies in the annular region has been presented, followed by the separator region. In continuation, the two-phase CFD simulations involving liquid-liquid and gas-liquid flow in the annular as well as separator regions have been reviewed. Suggestions have been made for the future work for bridging the existing knowledge gaps. In particular, emphasis has been given to the application of CFD simulations for the design of this equipment.

  8. Improved interpretation and validation of CFD predictions

    DEFF Research Database (Denmark)

    Popiolek, Z.; Melikov, Arsen Krikor

    2004-01-01

    The mean velocity in rooms predicted by CFD simulations based on RANS equations differs from the mean (in time) magnitude of the velocity, i.e. the mean speed, in rooms measured by low velocity thermal anemometers with omnidirectional sensor. This discrepancy results in incorrect thermal comfort ...

  9. Perspective: Selected benchmarks from commercial CFD codes

    Energy Technology Data Exchange (ETDEWEB)

    Freitas, C.J. [Southwest Research Inst., San Antonio, TX (United States). Computational Mechanics Section

    1995-06-01

    This paper summarizes the results of a series of five benchmark simulations which were completed using commercial Computational Fluid Dynamics (CFD) codes. These simulations were performed by the vendors themselves, and then reported by them in ASME`s CFD Triathlon Forum and CFD Biathlon Forum. The first group of benchmarks consisted of three laminar flow problems. These were the steady, two-dimensional flow over a backward-facing step, the low Reynolds number flow around a circular cylinder, and the unsteady three-dimensional flow in a shear-driven cubical cavity. The second group of benchmarks consisted of two turbulent flow problems. These were the two-dimensional flow around a square cylinder with periodic separated flow phenomena, and the stead, three-dimensional flow in a 180-degree square bend. All simulation results were evaluated against existing experimental data nd thereby satisfied item 10 of the Journal`s policy statement for numerical accuracy. The objective of this exercise was to provide the engineering and scientific community with a common reference point for the evaluation of commercial CFD codes.

  10. CFD modeling of pharmaceutical isolators with experimental verification of airflow.

    Science.gov (United States)

    Nayan, N; Akay, H U; Walsh, M R; Bell, W V; Troyer, G L; Dukes, R E; Mohan, P

    2007-01-01

    Computational fluid dynamics (CFD) models have been developed to predict the airflow in a transfer isolator using a commercial CFD code. In order to assess the ability of the CFD approach in predicting the flow inside an isolator, hot wire anemometry measurements and a novel experimental flow visualization technique consisting of helium-filled glycerin bubbles were used. The results obtained have been shown to agree well with the experiments and show that CFD can be used to model barrier systems and isolators with practical fidelity. This indicates that CFD can and should be used to support the design, testing, and operation of barrier systems and isolators.

  11. Determinación de la biomasa en procesos biológicos.II Métodos aplicados al tratamiento biológico de aguas residuales

    OpenAIRE

    Arnáiz Franco, Carmen; Isac Oria, Laura; Lebrato Martínez, Julián

    2000-01-01

    Artículo original escaneado para el Repositorio (archivo delegado) La concentración y la actividad de la biomasa son dos parámetros de gran importancia para el diseño y control de los procesos biológicos. En la depuración biológica de aguas residuales, la determinación del peso seco es una medida muy usada para la caracterización de la biomasa. Sin embargo, este parámetro no es suficiente para describir la actividad bilológica. Son necesarios, por tanto, otros métodos analíticos para una m...

  12. Identificación del mecanismo de solvatación de biomasa lignocelulósica con líquidos iónicos

    OpenAIRE

    Acosta Zamora, Edison Andres

    2014-01-01

    Se realizo un estudio sobre la reacción de solvatación y recuperación de polímeros estructurales de biomasa lignocelulósica con líquido iónico cloruro de 1-butil-3 metil-imidazolio. Se utilizo raquis de plátano como biomasa, la cual fue caracterizada mediante protocolos NREL y mediante un diseño factorial se evalúo los factores más influyentes del proceso y las mejores condiciones de temperatura, tiempo de reacción y carga de sólidos para la recuperación de celulosa, hemicelulosa y lignina, l...

  13. Optimización mediante técnicas de teoría gris de la combustión de biomasa en un drop furnace

    OpenAIRE

    Arce Fariña, Maria Elena

    2013-01-01

    El creciente desarrollo que ha experimentado el mercado de la biomasa conlleva que la investigación (I+D) se enfoque en la selección de las condiciones óptimas de combustión de los biocombustibles. La complejidad del proceso de combustión de biomasa, en el que existen parámetros divergentes, hace necesario el uso de métodos de análisis avanzados. Así, en esta investigación se propone un nuevo método multi-objetivo de selección de condiciones óptimas de combustión, basado en la combinación del...

  14. Evaluación del mezclado mediante transporte de trazadores en reactores de flujo oscilatorio utilizando CFD

    OpenAIRE

    Cano Asís, José Antonio

    2014-01-01

    El objetivo general del Proyecto Final de Carrera es desarrollar una simulación numérica que permita estudiar el proceso de mezclado en un reactor de flujo oscilatorio (Oscillatory Baffled Reactor, OBR), sin necesidad de desarrollar un prototipo y probarlo en banco de ensayos. El estudio se centra en el problema fluido-mecánico del flujo oscilatorio, sin abordar el problema térmico. La metodología de simulación consistirá en: • Desarrollo y mallado de las geometrías a simular con Gambit. S...

  15. Recent Efforts for Credible CFD Simulations in China

    Directory of Open Access Journals (Sweden)

    Li Li

    2011-01-01

    Full Text Available In this paper some recent efforts for credible computational fluid dynamics (CFD simulations in China are reviewed. The most important effort is that, following similar activities in the West such as ECARP and AIAA Drag Prediction Workshops, a series of workshops on credible CFD simulations had been initiated. These workshops were with ambitions to assess the status of CFD in China. Another major effort is an ongoing project to establish a software platform for studying the credibility of CFD solvers and performing credible CFD simulations. The platform, named WiseCFD, was designed to implement a seamless CFD process and to circumvent tedious repeating manual operations. It had also been a powerful job manager for CFD with capabilities to support plug and play (PnP solver integration as well as distributed or parallel computations. Some future work on WiseCFD was proposed, and also envisioned was how WiseCFD and the European QNET-CFD Knowledge Base can benefit mutually.

  16. Control adaptable utilizando Redes Neuronales Artificiales Polinomiales

    Directory of Open Access Journals (Sweden)

    E. Gómez

    2000-01-01

    Full Text Available Existen en la literatura de Control Adaptable, diferentes procedimientos en los que es posible identificar un sistema lineal. El problema fundamental es que una cantidad importante de fenómenos de la vida real son de tipo no lineal y no es tan sencillo el modelar este tipo de dinámicas. En este trabajo se presenta una forma de identificar sistemas no lineales utilizando las propiedades de las Redes Neuronales Artificiales y las técnicas de Algoritmo Genético en la optimización de su arquitectura. Adicionalmente se presenta una técnica novedosa de control adaptable para cancelar la dinámica no lineal del sistema y colocar los polos en el punto de operación deseado. Se presenta el comportamiento del algoritmo para el caso lineal yno lineal y finalmente se analiza la importancia teórica y operacional de estas técnicas.

  17. OBTENCIÓN DE UNA BEBIDA FERMENTADA A PARTIR DE SUERO DE QUESO UTILIZANDO CÉLULAS INMOVILIZADAS DE KLUYVEROMYCES MARXIANUS

    Directory of Open Access Journals (Sweden)

    Rocío Cóndor G.

    2014-06-01

    Full Text Available El presente estudio tuvo como objetivo principal optimizar la tecnología de producción de una bebida fermentada de suero de queso, utilizando Kluyveromyces marxianus e inmovilización de células. En el biorreactor de lecho empacado, se obtuvo el mayor rendimiento (11,46±0,81 oGL con un flujo de 140-150 mL. h-1, una biomasa inmovilizada de 10% (v/v, una relación de columna de 1:12 (diámetro: longitud, tamaño de perlas de 3 mm de diámetro, adición de metabisulfito de sodio (100 pg. mL-1 y células inmovilizadas con 2% (p/v de alginato. Luego de optimizado todos los parámetros de fermentación en el biorreactor, la bebida alcohólica fue sometida a inactivación a 70 oC por 5 minutos (tratamiento térmico y clarificación con tierra de diatomeas (11 kg. M-2. Finalmente, la bebida alcohólica fue evaluada en almacenamiento por 6 meses, durante este período se le hicieron evaluaciones fisicoquímicas, microbiológicas y sensoriales. Se determinó por Escala Hedónica y Ranking que la bebida alcohólica de suero tiene aceptabilidad.

  18. Influencia de la aplicación de vinaza en actividad y biomasa microbiana en un Entic Dystropept y un Fluventic haplustoll del Valle del Cauca, Colombia

    Directory of Open Access Journals (Sweden)

    Bonilla Correa Carmen Rosa

    2009-03-01

    Full Text Available Con la aplicación de vinaza, residuo de la producción de alcohol carburante a partir de la caña de azúcar, se evaluó el efecto sobre la actividad y biomasa microbiana del suelo y el suministro de K+ al cultivo de maíz dulce (Zea Mays en un Entic Dystropept y un Fluventic Haplustoll del Valle del Cauca, Colombia. Se utilizó un diseño completamente al azar con cuatro tratamientos y cinco repeticiones: T1 (100% requerimiento de K+ con KCl, T2 (100% requerimiento de K+ con vinaza, T3 (50% requerimiento de K+ con KCl +50% con vinaza y T4 (25% requerimiento de K+ con KCl +75% con vinaza. Se estimó biomasa microbiana por el método de fumigación-extracción. Se realizó análisis de varianza, prueba de comparación de medias, regresiones y correlaciones (SAS. Se presentaron diferencias significativas en la actividad y biomasa microbiana por época de muestreo y entre los diferentes muestreos; al final del cultivo el Entic Dystropept presentó el contenido más alto de biomasa microbiana-C en el T2, mientras que en el Fluventic Haplustoll fue en el T1. El menor qCO2 fue para el T2 del Entic Distropept y T1 del Fluventic Haplustoll, estos tratamientos presentaron mayor acumulación de biomasa en cada suelo respectivamente T2 (30 450 kg ha-1 y T1 (21 015.6 kg ha-1.

  19. Prediction of Wing Downwash Using CFD

    Directory of Open Access Journals (Sweden)

    Mohammed MAHDI

    2015-06-01

    Full Text Available Wing downwash study and estimation of downwash effect on the tail plane is an important task during the aircraft design process, although a lot of papers and works has been done, but the experimental work is the most important, the progress in CFD simulation has reached to the point it is able to reduce the number of runs in the wind tunnel. In this work CFD has been utilized to calculate the downwash angle and downwash gradient with respect to the angle of attack over a high aspect ratio of a typical UAV. The results of the simulation shall be used in the estimation and calculation of the longitudinal static stability analysis of the UAV.

  20. CFD simulations of the MEXICO rotor

    DEFF Research Database (Denmark)

    Bechmann, Andreas; Sørensen, Niels N.; Zahle, Frederik

    2011-01-01

    The wake behind a wind turbine model is investigated using Computational Fluid Dynamics (CFD), and results are compared with measurements. The turbine investigated is the three‐bladed test rotor (D = 4.5 m) used in the Model Experiments in Controlled Conditions (MEXICO) wind tunnel experiment....... During the MEXICO experiment, particle image velocimetry measurements of the induction upstream and downstream of the rotor were performed for different operating conditions, giving a unique dataset to verify theoretical models and CFD models. The present paper first describes the efforts in reproducing...... the experimental results using the Reynold‐Averaged Navier‐Stokes method. Second, three‐dimensional airfoil characteristics are extracted that allow simulations with simpler wake models. Copyright © 2011 John Wiley & Sons, Ltd....

  1. CFD Simulation on Ethylene Furnace Reactor Tubes

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Different mathematical models for ethylene furnace reactor tubes were reviewed. On the basis of these models a new mathematical simulation approach for reactor tubes based on computational fluid dynamics (CFD) technique was presented. This approach took the flow, heat transfer, mass transfer and thermal cracking reactions in the reactor tubes into consideration. The coupled reactor model was solved with the SIMPLE algorithm. Some detailed information about the flow field, temperature field and concentration distribution in the reactor tubes was obtained, revealing the basic characteristics of the hydrodynamic phenomena and reaction behavior in the reactor tubes. The CFD approach provides the necessary information for conclusive decisions regarding the production optimization, the design and improvement of reactor tubes, and the new techniques implementation.

  2. Aircraft Design Analysis, CFD And Manufacturing

    Directory of Open Access Journals (Sweden)

    Haifa El-Sadi

    2016-09-01

    Full Text Available Aircraft design, manufacturing and CFD analysis as part of aerodynamic course, the students achieve sizing from a conceptual sketch, select the airfoil geometry and the tail geometry, calculate thrust to weight ratio and wing loading, use initial sizing and calculate the aerodynamic forces. The students design their aircraft based on the geometrical dimensions resulted from the calculations and use the model to build a prototype, test it in wind tunnel and achieve CFD analysis to be compared with the experimental results. The theory of aerodynamic is taught and applied as a project based. In this paper, the design process, aircraft manufacturing and CFD analysis are presented to show the effect of project based on student’s learning of aerodynamic course. This project based learning has improved and accelerated students understanding of aerodynamic concepts and involved students in a constructive exploration. The analysis of the aircraft resulted in a study that revolved around the lift and drag generation of this particular aircraft. As to determine the lift and drag forces generated by this plane, a model was created in Solidworks a 3-D model-rendering program. After this model was created it was 3-D printed in a reduced scale, and subjected to wind tunnel testing. The results from the wind tunnel lab experiment were recorded. For accuracy, the same 3-D model was then simulated using CFD simulation software within Solidworks and compared with the results from the wind tunnel test. The values derived from both the simulation and the wind tunnel tests were then compared with the theoretical calculations for further proof of accuracy.

  3. Static load balancing for CFD distributed simulations

    Energy Technology Data Exchange (ETDEWEB)

    Chronopoulos, A T; Grosu, D; Wissink, A; Benche, M

    2001-01-26

    The cost/performance ratio of networks of workstations has been constantly improving. This trend is expected to continue in the near future. The aggregate peak rate of such systems often matches or exceeds the peak rate offered by the fastest parallel computers. This has motivated research towards using a network of computers, interconnected via a fast network (cluster system) or a simple Local Area Network (LAN) (distributed system), for high performance concurrent computations. Some of the important research issues arise such as (1) Optimal problem partitioning and virtual interconnection topology mapping; (2) Optimal execution scheduling and load balancing. CFD codes have been efficiently implemented on homogeneous parallel systems in the past. In particular, the helicopter aerodynamics CFD code TURNS has been implemented with MPI on the IBM SP with parallel relaxation and Krylov iterative methods used in place of more traditional recursive algorithms to enhance performance. In this implementation the space domain is divided into equal subdomain which are mapped to the processors. We consider the implementation of TURNS on a LAN of heterogeneous workstations. In order to deal with the problem of load balancing due to the different processor speeds we propose a suboptimal algorithm of dividing the space domain into unequal subdomains and assign them to the different computers. The algorithm can apply to other CFD applications. We used our algorithm to schedule TURNS on a network of workstations and obtained significantly better results.

  4. Computational System For Rapid CFD Analysis In Engineering

    Science.gov (United States)

    Barson, Steven L.; Ascoli, Edward P.; Decroix, Michelle E.; Sindir, Munir M.

    1995-01-01

    Computational system comprising modular hardware and software sub-systems developed to accelerate and facilitate use of techniques of computational fluid dynamics (CFD) in engineering environment. Addresses integration of all aspects of CFD analysis process, including definition of hardware surfaces, generation of computational grids, CFD flow solution, and postprocessing. Incorporates interfaces for integration of all hardware and software tools needed to perform complete CFD analysis. Includes tools for efficient definition of flow geometry, generation of computational grids, computation of flows on grids, and postprocessing of flow data. System accepts geometric input from any of three basic sources: computer-aided design (CAD), computer-aided engineering (CAE), or definition by user.

  5. CFD analysis of a rocket exhaust diffuser

    Science.gov (United States)

    Bose, Tarit K.; Thanawala, R. H.; Annamalai, K.

    1992-11-01

    The nature of the complex shock structure responsible for the pressure recovery phenomenon in supersonic diffusers is investigated by means of a theoretical CFD analysis using a newly developed computer program for Navier-Stokes solution of an ejector system, and the Prandtl mixing length to model the turbulent boundary layer. The pressure recovery characteristics of an ejector diffuser system was studied for various geometric and flow conditions. A comparison of the results with those of pressure measurements along the diffuser length in an experimental facility showed discrepancies, which are attributed to the boundary conditions imposed.

  6. Estimación de Iluminación en un Fotobiorreactor Productor de Biomasa a Partir de Microalgas

    Directory of Open Access Journals (Sweden)

    Carlos Francisco González Hernández

    2014-01-01

    Full Text Available En el presente trabajo se realizó el análisis de iluminación artificial para un fotobiorreactor productor de biomasa a partir de microalgas, el cual fue diseñado previamente con fines en aplicación para la producción de biocombustibles. En el análisis, se utilizó como herramienta la técnica de contornos o también conocida como método de superficie de respuesta, para lo cual se establecieron 132 puntos de intensidad luminosa distribuidos de forma simétrica a diferentes alturas del contenedor. Se realizaron dos bioensayos uno con la iluminación en la parte inferior del recipiente usando Diodos Emisores de Luz (LED’s, por sus siglas en inglés y el otro adicionando 3 lámparas fluorescentes más, situadas periféricamente a la mitad de la altura total del fotobiorreactor. Los resultados de las mediciones muestran una mejoría en el sistema de iluminac ión que favorece la reproducción continua de las microalgas, cuando se utilizó la combinación de luz emitida por LED’s y por lámparas fluorescentes. Esta combinación de sistemas de iluminación generó las condiciones para poder realizar las funciones metabólicas de las microalgas, quienes necesitan en promedio 2500 lx de forma homogénea.

  7. Secuestro de carbono en la biomasa aérea de un sistema agrosilvopastoril de Cocos nucifera, Leucaena leucocephala Var. Cunningham y Pennisetum purpureum Cuba CT-115

    OpenAIRE

    J. M. Anguiano; Aguirre, J.; Palma, J.M. (José Manuel)

    2013-01-01

    Con el objetivo de estimar el secuestro de carbono en la biomasa aérea de un sistema agrosilvopastoril (sasp) compuesto por cocotero (Cocos nucifera), Leucaena leucocephala Var. Cunningham sembrada en alta densidad y Pennisetum purpureum Cuba CT-115, se llevó a cabo un estudio en un suelo con textura franco arcillo- arenosa. Se utilizó un diseño en bloques al azar con arreglo en parcelas divididas con cuatro tratamientos 0, 40, 60 y 80 mil árboles de leucaena ha-1 y tres repeticiones; la eval...

  8. EVALUACIÓN DE LA BIOMASA Y MANEJO DE Lemna gibba (LENTEJA DE AGUA) EN LA BAHÍA INTERIOR DEL LAGO TITICACA, PUNO

    OpenAIRE

    Canales-Gutiérrez, Ángel; Facultad de Ciencias Biológicas UNA PUNO (Perú).

    2010-01-01

    Uno de los mayores problemas que enfrenta la ciudad de Puno es la presencia de la lenteja de agua (Lemna gibba) en la bahía interior del Lago Titicaca, debido al proceso de eutrofización que sufre a causa del mal tratamiento de las aguas residuales de la ciudad de Puno. Muchas de las estrategias planteadas hasta ahora no han dado resultados positivos en la reducción de la biomasa de Lemna gibba, debido a que estos planes están direccionados a la exterminación de este organismo. En lugar de el...

  9. NUEVAS PERSPECTIVAS PARA EL ESTUDIO DE LA ASIGNACIÓN DE BIOMASA Y SU RELACIÓN CON EL FUNCIONAMIENTO DE PLANTAS EN ECOSISTEMAS NEOTROPICALES

    Directory of Open Access Journals (Sweden)

    IVÁN DARÍO CAMARGO RODRÍGUEZ

    2006-01-01

    Full Text Available Cómo responden las plantas a la variabilidad en la disponibilidad de los recursos abióticos, es un tema central en estudios de fisiología ecológica. Varios modelos de partición óptima han sugerido un balance funcional en la biomasa asignada al vástago y la raíz con la siguiente predicción: "las plantas cambiarían su asignación de biomasa hacia el vástago si la ganancia de carbono de la parte aérea de la planta es afectada por un nivel bajo de recursos sobre el suelo, tal como luz o CO2. Igualmente, las plantas cambiarían su asignación hacia la raíz si el nivel de los recursos del suelo es bajo, tal como nutrientes y agua". Estos cambios en la asignación pueden ser con- siderados como adaptativos, ya que permiten a la planta capturar más de aquel recurso que limita fuertemente su crecimiento. En este trabajo, discutimos algunos esquemas metodológicos que a través de la descripción y análisis de la asignación de biomasa pretenden probar dicha predicción. Enfatizamos que la conclusión extraída en contra o a favor de la predicción se fundamenta en la interpretación del término plasticidad, conllevando recientemente al uso de metodologías que sugieren que la predicción no se cumple en respuesta a la disponibilidad de algunos recursos. Proponemos la utilización de un protocolo de investigación para estudiar los patrones de asignación de biomasa y sugerimos una metodología para cuantificar la plasticidad de diferentes genotipos desde un punto de vista discreto.

  10. Estudio de la oxidación a elevada temperatura de ocho aleaciones en atmósferas de combustión de biomasa

    Directory of Open Access Journals (Sweden)

    Berlanga-Labari, C.

    2008-08-01

    Full Text Available The combustion of biomass, especially wheat straw, generates very corrosive media particularly near the superheater tubes. Chlorine is known to be the main corrosive agent in biomass-fired plants. This paper focuses on the study of the corrosivity of such environments composed of gases and ashes, at high temperature, on eight commercial alloys with different chromium and nickel contents. These have been: AISI 347 CG (1.4550, AISI 347 FG(1.4550, AISI 316LN (1.4910, ESSHETE 1250 (1.4982, AC 66 (1.4877, X20CrMoV12:1 (1.4922 and AISI 347 coated with Inconel 625 and Inconel 686. Corrosion tests in the boiler have been performed during 8.000 h and 15.000 h at temperatures between 500 °C y 550 °C in the biomass plant of Sangüesa (Navarra, Spain. Experimental results showed an unacceptable behaviour far the martensitic steel, acceptable far the austenitics and good far the inconels. The appearance of the corrosion attack was also investigated to obtain understanding of the corrosion mechanism. The corrosion mechanism by molten salts has been rejected. The active oxidation corrosion mechanism has been proposed as the most probable in order to interpretate the corrosion behaviour of these materials in these environments.

    La combustión de biomasa, especialmente de paja de cereal, genera un ambiente muy corrosivo, particularmente, cerca de los tubos sobrecalentadores. El cloro es el principal agente corrosivo en las plantas de biomasa. Este trabajo se centra en comprobar el comportamiento de ocho aleaciones comerciales en una ambiente de combustión de biomasa. Los materiales estudiados han sido las siguientes: AISI 347 CG (1.4550, AISI 347 FG (1.4550, AISI 316LN (1.4910, ESSHETE 1250 (1.4982, AC 66 (1.4877, X20CrMoV12:1 (1.4922 y AISI 347 recubiertos con Inconel 625 e Inconel 686. Los ensayos se han realizado en la caldera de la planta de biomasa de Sangüesa (Navarra, España durante 8.000 y 15.000 h a una temperatura de 500-550 °C. Los

  11. Crecimiento, Abundancia Y Biomasa De Poecilia reticulata En El Lago Urbano Del Parque Tezozomoc De La Ciudad De México

    OpenAIRE

    2006-01-01

    Los lagos urbanos tienen importancia estética, recreativa, cultural y biológica por albergar organismos generalmente alóctonos, como aves, reptiles, insectos y peces, en particular poecilidos, los cuales son muy tolerantes y se reproducen con facilidad. Por lo anterior, el objetivo de este trabajo fue: determinar la variación en la abundancia y biomasa de Poecilia reticulata en el lago del parque Tezozomoc, así como obtener la ecuación de crecimiento. Se realizaron muestreos mensuales de juli...

  12. LA BIOMASA COMO ALTERNATIVA AL PETRÓLEO PARA LA OBTENCIÓN DE PRODUCTOS QUÍMICOS: ACETONA Y ETANOL COMO MOLÉCULAS PLATAFORMA

    OpenAIRE

    Jorge Quesada; Laura Faba; Eva Díaz; Salvador Ordóñez

    2014-01-01

    En este trabajo se pretende reflejar el potencial de la biomasa como materia prima para la obtención de productos químicos de elevado valor añadido, integrando su viabilidad económica y técnica dentro del concepto de biorefinería. Considerando el gran número de trabajos existentes acerca de la obtención de biocombustibles, se hace hincapié en el aprovechamiento de los subproductos de estos procesos, abordando la transformación de dos de las moléculas plataforma de mayor proyección: el etanol ...

  13. PRODUCCIÓN DE PROTEÍNA Y BIOMASA PROBIÓTICA DE Lactobacillus casei LIOFILIZADAS A PARTIR DE SUERO DE LECHE DE CABRA

    OpenAIRE

    E. J. Aguirre-Ezkauriatza; Ramírez-Medrano, A.; Aguilar-Yáñez, J. M.; M. M. Álvarez

    2009-01-01

    En este trabajo se documenta la factibilidad técnica de obtención de dos productos de valor agregado a partir de suero de leche de cabra: (a) proteína liofilizada y (b) biomasa probiótica liofilizada de Lactobacillus casei. Se presentan resultados de experimentos de ultrafiltración de suero de leche de cabra (SLC), del cual se retiene proteína con una alta relación proteína/lactosa. En su forma liofilizada, esta proteína presentó características de solubilidad superiores a productos comercial...

  14. Estudio teórico de la combustión de pellets de biomasa procedente de la caña de azúcar

    OpenAIRE

    David Verdecia Torres; Idalberto Macías Socarrás; Benjamín Gabriel Gaskins Espinosa

    2012-01-01

    En el siguiente trabajo se examina la cinética química de la combustión de pellets de biomasa cañera, se obtiene el tiempo de combustión en función de la etapa controlante del proceso de combustión según el modelo de núcleo sin reaccionar, además se realiza un diseño de experimento para determinar los modelos matemáticos teóricos para modelar el proceso de combustión.

  15. Modelling of Air Flow trough a Slatted Floor by CFD

    DEFF Research Database (Denmark)

    Svidt, Kjeld; Bjerg, Bjarne; Morsing, Svend;

    In this paper two different CFD-approaches are investigated to model the airflow through a slatted floor. Experiments are carried out in a full-scale test room. The computer simulations are carried out with the CFD-code FLOVENT, which solves the time-averaged Navier-Stokes equations by use of the k...

  16. CFD computations of the second round of MEXICO rotor measurements

    DEFF Research Database (Denmark)

    Sørensen, Niels N.; Zahle, Frederik; Boorsma, K.

    2016-01-01

    A comparison, between selected wind tunnel data from the NEW MEXICO measuring campaign and CFD computations are shown. The present work, documents that a state of the art CFD code, including a laminar turbulent transition model, can provide good agreement with experimental data. Good agreement...

  17. State of the art in CFD pre- and postprocessing

    Science.gov (United States)

    Vembe, B. E.; Hansen, E. W. M.

    1994-06-01

    Computational fluid dynamics (CFD) is a generic name for a wide range of numerical techniques that are used for obtaining solutions to the governing equations of thermo-fluid dynamics with or without chemical reactions. The report presents to the state of the art in pre- and postprocessing for CFD codes, both commercial and in-house SINTEF-NTH codes. The objectives of advanced CFD systems are discussed and the techniques for pre- and postprocessing are reviewed. The user friendliness of CFD codes, in general, are highlighted. A common definition of a user friendly computer program is one that is easy to learn, efficient, easy to remember, and satisfactory to use. Most of today's commercial CFD codes could benefit from an enhanced interface. It is desirable to develop standard data formats for input and output of CFD codes and direct-manipulation user interfaces are desirable in CFD applications. Largest potential for improvements of CFD codes and for users is in geometry modeling and grid generation.

  18. Caracterización de la distribución de la biomasa y densidad de raíces finas en un gradiente sucesional de bosques en la Zona Norte de Costa Rica.

    OpenAIRE

    Jiménez-Rodríguez, César

    2004-01-01

    Informe Final de Proyecto de Investigación. En este estudio se evaluó la distribución de la biomasa radical, el índice de área radical (RAI) y la densidad longitudinal (RLD) de raíces finas (< 5 mm) en una gradiente sucesional de bosques húmedos tropicales en la zona de Florencia de San Carlos, Costa Rica. La variación de estos parámetros se evaluaron en función de la profundidad del suelo y del estado sucesional. La biomasa radical al igual que el RAI y el RLD disminuyen conforme aumenta ...

  19. METC CFD simulations of hot gas filtration

    Energy Technology Data Exchange (ETDEWEB)

    O`Brien, T.J.

    1995-06-01

    Computational Fluid Dynamic (CFD) simulations of the fluid/particle flow in several hot gas filtration vessels will be presented. These simulations have been useful in designing filtration vessels and in diagnosing problems with filter operation. The simulations were performed using the commercial code FLUENT and the METC-developed code MFIX. Simulations of the initial configuration of the Karhula facility indicated that the dirty gas flow over the filter assemblage was very non-uniform. The force of the dirty gas inlet flow was inducing a large circulation pattern that caused flow around the candles to be in opposite directions on opposite sides of the vessel. By introducing a system of baffles, a more uniform flow pattern was developed. This modification may have contributed to the success of the project. Several simulations of configurations proposed by Industrial Filter and Pump were performed, varying the position of the inlet. A detailed resolution of the geometry of the candles allowed determination of the flow between the individual candles. Recent simulations in support of the METC/CeraMem Cooperative Research and Development Agreement have analyzed the flow in the vessel during the cleaning back-pulse. Visualization of experiments at the CeraMem cold-flow facility provided confidence in the use of CFD. Extensive simulations were then performed to assist in the design of the hot test facility being built by Ahlstrom/Pyropower. These tests are intended to demonstrate the CeraMem technology.

  20. On spurious behavior of CFD simulations

    Energy Technology Data Exchange (ETDEWEB)

    Yee, H.C. [National Aeronautics and Space Administration, Moffett Field, CA (United States). Ames Research Center; Torczynski, J.R. [Sandia National Labs., Albuquerque, NM (United States); Morton, S.A.; Visbal, M.R. [Wright Lab., Wright-Patterson AFB, OH (United States); Sweby, P.K. [Univ. of Reading (United Kingdom)

    1997-05-01

    Spurious behavior in underresolved grids and/or semi-implicit temporal discretizations for four computational fluid dynamics (CFD) simulations are studied. The numerical simulations consist of (a) a 1-D chemically relaxed nonequilibrium model, (b) the direct numerical simulation (DNS) of 2-D incompressible flow over a backward facing step, (c) a loosely-coupled approach for a 2-D fluid-structure interaction, and (d) a 3-D compressible unsteady flow simulation of vortex breakdown in delta wings. Using knowledge from dynamical systems theory, various types of spurious behaviors that are numerical artifacts were systematically identified. These studies revealed the various possible dangers of misinterpreting numerical simulation of realistic complex flows that are constrained by the available computing power. In large scale computations underresolved grids, semi-implicit procedures, loosely-coupled implicit procedures, and insufficiently long time integration in DNS are most often unavoidable. Consequently, care must be taken in both computation and in interpretation of the numerical data. The results presented confirm the important role that dynamical systems theory can play in the understanding of the nonlinear behavior of numerical algorithms and in aiding the identification of the sources of numerical uncertainties in CFD.

  1. Qualification of CFD-models for multiphase flows

    Energy Technology Data Exchange (ETDEWEB)

    Lucas, Dirk [Helmholtz-Zentrum Dresden-Rossendorf e.V., Dresden (Germany)

    2016-05-15

    While Computational Fluid Dynamics (CFD) is already an accepted industrial tool for single phase flows it is not yet mature for two-phase flows. For this reason the qualification of CFD for reactor safety relevant applications which involve multiphase flows is a present topic of research. At the CFD division of Helmholtz-Zentrum Dresden-Rossendorf (HZDR) hereby beside an application-oriented model development and validation also more generic investigations are done. Thus, the baseline model strategy aims on the consolidation of the CFD-modelling for multiphase to enable reliable predictions for well-defined flow pattern in future. In addition the recently developed GENTOP-concept broadens the range of applicability of CFD. Different flow morphologies including transitions between them can be considered in frame of this concept.

  2. CFD Simulation of Liquid Rocket Engine Injectors

    Science.gov (United States)

    Farmer, Richard; Cheng, Gary; Chen, Yen-Sen; Garcia, Roberto (Technical Monitor)

    2001-01-01

    Detailed design issues associated with liquid rocket engine injectors and combustion chamber operation require CFD methodology which simulates highly three-dimensional, turbulent, vaporizing, and combusting flows. The primary utility of such simulations involves predicting multi-dimensional effects caused by specific injector configurations. SECA, Inc. and Engineering Sciences, Inc. have been developing appropriate computational methodology for NASA/MSFC for the past decade. CFD tools and computers have improved dramatically during this time period; however, the physical submodels used in these analyses must still remain relatively simple in order to produce useful results. Simulations of clustered coaxial and impinger injector elements for hydrogen and hydrocarbon fuels, which account for real fluid properties, is the immediate goal of this research. The spray combustion codes are based on the FDNS CFD code' and are structured to represent homogeneous and heterogeneous spray combustion. The homogeneous spray model treats the flow as a continuum of multi-phase, multicomponent fluids which move without thermal or velocity lags between the phases. Two heterogeneous models were developed: (1) a volume-of-fluid (VOF) model which represents the liquid core of coaxial or impinger jets and their atomization and vaporization, and (2) a Blob model which represents the injected streams as a cloud of droplets the size of the injector orifice which subsequently exhibit particle interaction, vaporization, and combustion. All of these spray models are computationally intensive, but this is unavoidable to accurately account for the complex physics and combustion which is to be predicted, Work is currently in progress to parallelize these codes to improve their computational efficiency. These spray combustion codes were used to simulate the three test cases which are the subject of the 2nd International Workshop on-Rocket Combustion Modeling. Such test cases are considered by

  3. A supportive architecture for CFD-based design optimisation

    Science.gov (United States)

    Li, Ni; Su, Zeya; Bi, Zhuming; Tian, Chao; Ren, Zhiming; Gong, Guanghong

    2014-03-01

    Multi-disciplinary design optimisation (MDO) is one of critical methodologies to the implementation of enterprise systems (ES). MDO requiring the analysis of fluid dynamics raises a special challenge due to its extremely intensive computation. The rapid development of computational fluid dynamic (CFD) technique has caused a rise of its applications in various fields. Especially for the exterior designs of vehicles, CFD has become one of the three main design tools comparable to analytical approaches and wind tunnel experiments. CFD-based design optimisation is an effective way to achieve the desired performance under the given constraints. However, due to the complexity of CFD, integrating with CFD analysis in an intelligent optimisation algorithm is not straightforward. It is a challenge to solve a CFD-based design problem, which is usually with high dimensions, and multiple objectives and constraints. It is desirable to have an integrated architecture for CFD-based design optimisation. However, our review on existing works has found that very few researchers have studied on the assistive tools to facilitate CFD-based design optimisation. In the paper, a multi-layer architecture and a general procedure are proposed to integrate different CFD toolsets with intelligent optimisation algorithms, parallel computing technique and other techniques for efficient computation. In the proposed architecture, the integration is performed either at the code level or data level to fully utilise the capabilities of different assistive tools. Two intelligent algorithms are developed and embedded with parallel computing. These algorithms, together with the supportive architecture, lay a solid foundation for various applications of CFD-based design optimisation. To illustrate the effectiveness of the proposed architecture and algorithms, the case studies on aerodynamic shape design of a hypersonic cruising vehicle are provided, and the result has shown that the proposed architecture

  4. Evaluación del cultivo de la dorada ( Brycon moorei sinuensis en jaulas flotantes utilizando cuatro alimentos concentrados.

    Directory of Open Access Journals (Sweden)

    Robinsón Rosado

    2003-12-01

    Full Text Available El presente estudio se inició el 30 de septiembre del2000 con el cultivo de Dorada (Brycon mooreisinuensis en jaulas flotantes en el reservorio de laGranja Piscícola Tamarindo (El Espinal, Colombia,utilizando cuatro alimentos concentrados durante 180días. Se determinó el crecimiento mediante laganancia en longitud, ganancia en peso, tasa decrecimiento específico, sobre-vivencia final, biomasatotal, factor de condición, factor de conversiónalimenticia. Se sembraron 816 juveniles con longitudpromedio de 17.8 cm y peso promedio de 78.9 g,divididos en cuatro tratamientos con densidad desiembra de 25 peces/cm3 y tres réplicas cada uno.Las dietas balanceadas (proteína bruta y la cantidadde energía (Kcal/Kg suministrada fueron: Tratamiento1: 20% y 2637; tratamiento 2: 32% y 3127;tratamiento 3: 28% y 2852; y tratamiento 4: 24% y2751, respectivamente. El diseño experimental fuecompletamente aleatorio y se aplicó la técnica deanálisis de varianza a los datos biométricos yparámetros físico-químicos. Como prueba designificancia se usó la prueba de Tukey-Kramer con95% de confiabilidad. El modelo matemático de VIONBERTALANFY y la transformación de FOR-WALFORDfueron válidos para el ajuste de las curvas decrecimiento en longitud, peso y la relación longitud– peso. Se puede afirmar que la Dorada consumiólas dietas de origen vegetal de igual manera que lasde origen animal, sin embargo la dieta del 28% deproteína bruta (tratamiento 3 muestra los mejoresresultados, sin diferencias significativas entretratamientos (p > 0.05. De acuerdo con la literaturacitada no hay investigaciones que muestren losrequerimientos nutricionales óptimos para laalimentación de esta especie. En todos los trabajosanteriores, la ganancia de peso diaria fue baja, peromejores que las obtenidas en esta investigación.Mientras que el rendimiento en biomasa fue mayorque los reportados para cultivo en tierra, para todoslos tratamientos en este estudio fue muy bajo.

  5. CFD Validation for Propulsion System Components (la Validation CFD des organes des propulseurs)

    Science.gov (United States)

    1998-05-01

    et al (1995), Suder and Celestina (1996) and Hatliaway et al (1993). Laser data were acquired only at flow rates of m I mchokt = 0.98 and 0.925...Denton (1996) has given a good global analysis of the flow in this compressor. Chima (1996b) and Suder and Celestina (1996) analysed the tip...and Suder and Celestina (1996) have presented some detailed CFD results for the flow in this region. Detailed experimental results and analysis have

  6. Consideraciones sobre la producción de etanol a partir de la biomasa lignocelulósica

    Directory of Open Access Journals (Sweden)

    José C. Villar

    2008-01-01

    Full Text Available En los últimos años, como consecuencia del aumento de los precios del petróleo y las exigencias ecológicas, ha crecido el interés por la producción de bioetanol como combustible de vehículos automotores. En Brasil y EEUU, los principales productores, se estima una producción por cada país en el 2006 de alrededor de los 19 mil millones de litros. Brasil planea aumentar la producción hasta 26.5 mil millones en el 2016 mientras que para esa misma fecha EEUU pretende alcanzar los 45,4 mil millones de litros. Las materias primas más empleadas son maíz y caña de azúcar. Sería de interés incluir entre éstas a la biomasa lignocelulósica que se obtiene como subproductos agrícolas y forestales (pajas de cereales, bagazo, aserrín y virutas de madera que no son aptos para el consumo humano y por su composición química son susceptibles de ser sacarificados por hidrólisis química o enzimática. Se analizan críticamente las posibles vías para desarrollar la producción de alcohol a partir de estos materiales, en especial la vía química, cuya perspectiva de éxito se encuentra estrechamente vinculada al desarrollo de reactores continuos. De esta manera, se pueden intensificar las condiciones de reacción que permitan incrementar la productividad del proceso, mediante la obtención de los máximos rendimientos de azúcares con el empleo de los menores volúmenes del equipamiento, sin descuidar la disminución de la concentración de sustancias inhibidoras de la fermentación en el sistema.

  7. CFD Applications in Energy and Environment Sectors: Volume 1

    Directory of Open Access Journals (Sweden)

    Maher A.R. Sadiq Al-Baghdadi and Hashim R. Abdol Hamid

    2012-01-01

    Full Text Available Chapter 1: Simulation and Modelling of Oxygen Coal Combustion with Flue Gas Recirculation. Chaouki Ghenai Chapter 2: The Choice of the Best Air Distribution Concept in Air-Conditioned Auditorium by Means of CFD Numerical Prediction. Barbara Lipska, Piotr Koper Chapter 3: CFD Applications in Natural Ventilation of Buildings and Air Quality Dispersion. N. Nikolopoulos, A. Nikolopoulos, I. Papadakis, K.-S. P. Nikas Chapter 4: CFD Modeling of Air Pollutant Transport and Dispersion. Labovský Juraj, Jelemenský Ľudovít Chapter 5: CFD Modeling of Multiphase Flow in Environmental Engineering. Masroor Mohajerani, Mehrab Mehrvar, Farhad Ein-Mozaffari Chapter 6: CFD Study on the Roles of Trees on Airflow and Pollutant Dispersion within Urban Street Canyons. Salim Mohamed Salim, Andrew Chan, Riccardo Buccolieri, Silvana Di Sabatino Chapter 7: Energy Efficiency and Air Quality in Hospitals Design. Essam E. Khalil Chapter 8: Application of CFD in Pulverized Fuel Combustion. M. Tayyeb Javed, Tahira Sultana Chapter 9: A Heat Transfer Model For Fluids Based on Cellular Automaton Application to an Air Conditioning of A Building. Andrés Saiz Martínez Chapter 10: CFD Application in Power Plants. Essam E. Khalil Chapter 11: Analysis and Computation of the Heat Charge/Discharge Behavior in Packed Bed Thermal Storage Systems. Pei-Wen Li, Jon Van Lew, Wafaa Karaki, Cho Lik Chan, Jake Stephens

  8. Hybrid CFD/CAA Modeling for Liftoff Acoustic Predictions

    Science.gov (United States)

    Strutzenberg, Louise L.; Liever, Peter A.

    2011-01-01

    This paper presents development efforts at the NASA Marshall Space flight Center to establish a hybrid Computational Fluid Dynamics and Computational Aero-Acoustics (CFD/CAA) simulation system for launch vehicle liftoff acoustics environment analysis. Acoustic prediction engineering tools based on empirical jet acoustic strength and directivity models or scaled historical measurements are of limited value in efforts to proactively design and optimize launch vehicles and launch facility configurations for liftoff acoustics. CFD based modeling approaches are now able to capture the important details of vehicle specific plume flow environment, identifY the noise generation sources, and allow assessment of the influence of launch pad geometric details and sound mitigation measures such as water injection. However, CFD methodologies are numerically too dissipative to accurately capture the propagation of the acoustic waves in the large CFD models. The hybrid CFD/CAA approach combines the high-fidelity CFD analysis capable of identifYing the acoustic sources with a fast and efficient Boundary Element Method (BEM) that accurately propagates the acoustic field from the source locations. The BEM approach was chosen for its ability to properly account for reflections and scattering of acoustic waves from launch pad structures. The paper will present an overview of the technology components of the CFD/CAA framework and discuss plans for demonstration and validation against test data.

  9. The Role of CFD in Undergraduate Fluid Mechanics Education

    Science.gov (United States)

    Cimbala, John

    2006-11-01

    Instruction of undergraduate fluid mechanics is greatly enhanced through integration of computational fluid dynamics (CFD) into fluid mechanics courses and labs. Specifically, students are able to visualize fluid flows with CFD and are better able to understand those flows by performing parametric studies. At Penn State, CFD has been carefully integrated into our introductory junior-level fluid mechanics course, yet displaces only about one class period. The key is to show demonstrations and assign homework that use CFD as a tool that helps students learn the basic concepts of fluid mechanics. The application of CFD (grid generation, boundary conditions, etc.), rather than numerical algorithms, is stressed. This is done through use of short, pre-defined templates for FlowLab, a student-friendly analysis and visualization package created by Fluent, Inc. The textbook by Cengel and Cimbala (McGraw-Hill 2006) contains 46 end-of-chapter homework problems that are used in conjunction with 42 FlowLab templates. Each exercise has been designed with two major learning objectives in mind: (1) enhance student understanding of a specific fluid mechanics concept, and (2) introduce the student to a specific capability and/or limitation of CFD through hands-on practice. More templates are being developed that emphasize the first objective. The flow of fluid between two concentric rotating cylinders is a good example of a problem that is solved approximately, analytically, and with CFD, and the results are compared to enhance learning.

  10. The role of computational fluid dynamics (CFD) in hair science.

    Science.gov (United States)

    Spicka, Peter; Grald, Eric

    2004-01-01

    The use of computational fluid dynamics (CFD) as a virtual prototyping tool is widespread in the consumer packaged goods industry. CFD refers to the calculation on a computer of the velocity, pressure, and temperature and chemical species concentrations within a flowing liquid or gas. Because the performance of manufacturing equipment and product designs can be simulated on the computer, the benefit of using CFD is significant time and cost savings when compared to traditional physical testing methods. CFD has been used to design, scale-up and troubleshoot mixing tanks, spray dryers, heat exchangers and other process equipment. Recently, computer models of the capillary wicking process inside fibrous structures have been added to CFD software. These models have been used to gain a better understanding of the absorbent performance of diapers and feminine protection products. The same models can also be used to represent the movement of shampoo, conditioner, colorants and other products through the hair and scalp. In this paper, we provide an introduction to CFD and show some examples of its application to the manufacture of consumer products. We also provide sonic examples to show the potential of CFD for understanding the performance of products applied to the hair and scalp.

  11. Comparison of NTF Experimental Data with CFD Predictions from the Third AIAA CFD Drag Prediction Workshop

    Science.gov (United States)

    Vassberg, John C.; Tinoco, Edward N.; Mani, Mori; Levy, David; Zickuhr, Tom; Mavriplis, Dimitri J.; Wahls, Richard A.; Morrison, Joseph H.; Brodersen, Olaf P.; Eisfeld, Bernhard; Murayama, Mitsuhiro

    2008-01-01

    Recently acquired experimental data for the DLR-F6 wing-body transonic transport con figuration from the National Transonic Facility (NTF) are compared with the database of computational fluid dynamics (CFD) predictions generated for the Third AIAA CFD Drag Prediction Workshop (DPW-III). The NTF data were collected after the DPW-III, which was conducted with blind test cases. These data include both absolute drag levels and increments associated with this wing-body geometry. The baseline DLR-F6 wing-body geometry is also augmented with a side-of-body fairing which eliminates the flow separation in this juncture region. A comparison between computed and experimentally observed sizes of the side-of-body flow-separation bubble is included. The CFD results for the drag polars and separation bubble sizes are computed on grids which represent current engineering best practices for drag predictions. In addition to these data, a more rigorous attempt to predict absolute drag at the design point is provided. Here, a series of three grid densities are utilized to establish an asymptotic trend of computed drag with respect to grid convergence. This trend is then extrapolated to estimate a grid-converged absolute drag level.

  12. Reducing numerical costs for core wide nuclear reactor CFD simulations by the Coarse-Grid-CFD

    Science.gov (United States)

    Viellieber, Mathias; Class, Andreas G.

    2013-11-01

    Traditionally complete nuclear reactor core simulations are performed with subchannel analysis codes, that rely on experimental and empirical input. The Coarse-Grid-CFD (CGCFD) intends to replace the experimental or empirical input with CFD data. The reactor core consists of repetitive flow patterns, allowing the general approach of creating a parametrized model for one segment and composing many of those to obtain the entire reactor simulation. The method is based on a detailed and well-resolved CFD simulation of one representative segment. From this simulation we extract so-called parametrized volumetric forces which close, an otherwise strongly under resolved, coarsely-meshed model of a complete reactor setup. While the formulation so far accounts for forces created internally in the fluid others e.g. obstruction and flow deviation through spacers and wire wraps, still need to be accounted for if the geometric details are not represented in the coarse mesh. These are modelled with an Anisotropic Porosity Formulation (APF). This work focuses on the application of the CGCFD to a complete reactor core setup and the accomplishment of the parametrization of the volumetric forces.

  13. CFD Analysis of Passive Autocatalytic Recombiner

    Directory of Open Access Journals (Sweden)

    B. Gera

    2011-01-01

    Full Text Available In water-cooled nuclear power reactors, significant quantities of hydrogen could be produced following a postulated loss-of-coolant accident (LOCA along with nonavailability of emergency core cooling system (ECCS. Passive autocatalytic recombiners (PAR are implemented in the containment of water-cooled power reactors to mitigate the risk of hydrogen combustion. In the presence of hydrogen with available oxygen, a catalytic reaction occurs spontaneously at the catalyst surfaces below conventional ignition concentration limits and temperature and even in presence of steam. Heat of reaction produces natural convection flow through the enclosure and promotes mixing in the containment. For the assessment of the PAR performance in terms of maximum temperature of catalyst surface and outlet hydrogen concentration an in-house 3D CFD model has been developed. The code has been used to study the mechanism of catalytic recombination and has been tested for two literature-quoted experiments.

  14. CFD research, parallel computation and aerodynamic optimization

    Science.gov (United States)

    Ryan, James S.

    1995-01-01

    Over five years of research in Computational Fluid Dynamics and its applications are covered in this report. Using CFD as an established tool, aerodynamic optimization on parallel architectures is explored. The objective of this work is to provide better tools to vehicle designers. Submarine design requires accurate force and moment calculations in flow with thick boundary layers and large separated vortices. Low noise production is critical, so flow into the propulsor region must be predicted accurately. The High Speed Civil Transport (HSCT) has been the subject of recent work. This vehicle is to be a passenger vehicle with the capability of cutting overseas flight times by more than half. A successful design must surpass the performance of comparable planes. Fuel economy, other operational costs, environmental impact, and range must all be improved substantially. For all these reasons, improved design tools are required, and these tools must eventually integrate optimization, external aerodynamics, propulsion, structures, heat transfer and other disciplines.

  15. CFD modeling of the IRIS pressurizer dynamic

    Energy Technology Data Exchange (ETDEWEB)

    Sanz, Ronny R.; Montesinos, Maria E.; Garcia, Carlos; Bueno, Elizabeth D.; Mazaira, Leorlen R., E-mail: rsanz@instec.cu, E-mail: mmontesi@instec.cu, E-mail: cgh@instec.cu, E-mail: leored1984@gmail.com [Instituto Superior de Tecnologias y Ciencias Aplicadas (InSTEC), La Habana (Cuba); Bezerra, Jair L.; Lira, Carlos A.B. Oliveira, E-mail: jair.lima@ufpe.br, E-mail: cabol@ufpe.br [Universida Federal de Pernambuco (UFPE), Recife, PE (Brazil). Dept. de Energia Nuclear

    2015-07-01

    Integral layout of nuclear reactor IRIS makes possible the elimination of the spray system, which is usually used to mitigate in-surge transient and also help to Boron homogenization. The study of transients with deficiencies in the Boron homogenization in this technology is very important, because they can cause disturbances in the reactor power and insert a strong reactivity in the core. The detailed knowledge of the behavior of multiphase multicomponent flows is challenging due to the complex phenomena and interactions at the interface. In this context, the CFD modeling is employed in the design of equipment in the nuclear industry as it allows predicting accidents or predicting their performance in dissimilar applications. The aim of the present research is to model the IRIS pressurizer's dynamic using the commercial CFD code CFX. A symmetric tri dimensional model equivalent to 1/8 of the total geometry was adopted to reduce mesh size and minimize processing time. The model considers the coexistence of four phases and also takes into account the heat losses. The relationships for interfacial mass, energy, and momentum transport are programmed and incorporated into CFX. Moreover, two subdomains and several additional variables are defined to monitoring the boron dilution sequences and condensation-evaporation rates in different control volumes. For transient states a non - equilibrium stratification in the pressurizer is considered. This paper discusses the model developed and the behavior of the system for representative transients sequences. The results of analyzed transients of IRIS can be applied to the design of pressurizer internal structures and components. (author)

  16. CFD Analysis of Core Bypass Phenomena

    Energy Technology Data Exchange (ETDEWEB)

    Richard W. Johnson; Hiroyuki Sato; Richard R. Schultz

    2009-11-01

    The U.S. Department of Energy is exploring the potential for the VHTR which will be either of a prismatic or a pebble-bed type. One important design consideration for the reactor core of a prismatic VHTR is coolant bypass flow which occurs in the interstitial regions between fuel blocks. Such gaps are an inherent presence in the reactor core because of tolerances in manufacturing the blocks and the inexact nature of their installation. Furthermore, the geometry of the graphite blocks changes over the lifetime of the reactor because of thermal expansion and irradiation damage. The existence of the gaps induces a flow bias in the fuel blocks and results in unexpected increase of maximum fuel temperature. Traditionally, simplified methods such as flow network calculations employing experimental correlations are used to estimate flow and temperature distributions in the core design. However, the distribution of temperature in the fuel pins and graphite blocks as well as coolant outlet temperatures are strongly coupled with the local heat generation rate within fuel blocks which is not uniformly distributed in the core. Hence, it is crucial to establish mechanistic based methods which can be applied to the reactor core thermal hydraulic design and safety analysis. Computational Fluid Dynamics (CFD) codes, which have a capability of local physics based simulation, are widely used in various industrial fields. This study investigates core bypass flow phenomena with the assistance of commercial CFD codes and establishes a baseline for evaluation methods. A one-twelfth sector of the hexagonal block surface is modeled and extruded down to whole core length of 10.704m. The computational domain is divided vertically with an upper reflector, a fuel section and a lower reflector. Each side of the one-twelfth grid can be set as a symmetry boundary

  17. CFD Analysis of Core Bypass Phenomena

    Energy Technology Data Exchange (ETDEWEB)

    Richard W. Johnson; Hiroyuki Sato; Richard R. Schultz

    2010-03-01

    The U.S. Department of Energy is exploring the potential for the VHTR which will be either of a prismatic or a pebble-bed type. One important design consideration for the reactor core of a prismatic VHTR is coolant bypass flow which occurs in the interstitial regions between fuel blocks. Such gaps are an inherent presence in the reactor core because of tolerances in manufacturing the blocks and the inexact nature of their installation. Furthermore, the geometry of the graphite blocks changes over the lifetime of the reactor because of thermal expansion and irradiation damage. The existence of the gaps induces a flow bias in the fuel blocks and results in unexpected increase of maximum fuel temperature. Traditionally, simplified methods such as flow network calculations employing experimental correlations are used to estimate flow and temperature distributions in the core design. However, the distribution of temperature in the fuel pins and graphite blocks as well as coolant outlet temperatures are strongly coupled with the local heat generation rate within fuel blocks which is not uniformly distributed in the core. Hence, it is crucial to establish mechanistic based methods which can be applied to the reactor core thermal hydraulic design and safety analysis. Computational Fluid Dynamics (CFD) codes, which have a capability of local physics based simulation, are widely used in various industrial fields. This study investigates core bypass flow phenomena with the assistance of commercial CFD codes and establishes a baseline for evaluation methods. A one-twelfth sector of the hexagonal block surface is modeled and extruded down to whole core length of 10.704m. The computational domain is divided vertically with an upper reflector, a fuel section and a lower reflector. Each side of the sector grid can be set as a symmetry boundary

  18. Bonneville Project: CFD of the Spillway Tailrace

    Energy Technology Data Exchange (ETDEWEB)

    Rakowski, Cynthia L.; Serkowski, John A.; Richmond, Marshall C.; Romero Gomez, Pedro DJ

    2012-11-19

    US Army Corps of Engineers, Portland District (CENWP) operates the Bonneville Lock and Dam Project on the Columbia River. High spill flows that occurred during 2011 moved a large volume of rock from downstream of the spillway apron to the stilling basin and apron. Although 400 cubic yards of rocks were removed from the stilling basin, there are still large volumes of rock downstream of the apron that could, under certain flow conditions, move upstream into the stilling basin. CENWP is investigating operational changes that could be implemented to minimize future movement of rock into the stilling basin. A key analysis tool to develop these operational changes is a computational fluid dynamics (CFD) model of the spillway. A free-surface CFD model of the Bonneville spillway tailrace was developed and applied for four flow scenarios. These scenarios looked at the impact of flow volume and flow distribution on tailrace hydraulics. The simulation results showed that areas of upstream flow existed near the river bed downstream of the apron, on the apron, and within the stilling basin for all flows. For spill flows of 300 kcfs, the cross-stream and downstream extent of the recirculation zones along Cascade and Bradford Island was very dependent on the spill pattern. The center-loaded pattern had much larger recirculation zones than the flat or bi-modal pattern. The lower flow (200 kcfs) with a flat pattern had a very large recirculation zone that extended half way across the channel near the river bed. A single flow scenario (300 kcfs of flow in a relatively flat spill pattern) was further interrogated using Lagrangian particle tracking. The tracked particles (with size and mass) showed the upstream movement of sediments onto the concrete apron and against the vertical wall between the apron and the stilling basin from seed locations downstream of the apron and on the apron.

  19. CFD Modeling of Water Flow through Sudden Contraction and Expansion in a Horizontal Pipe

    Science.gov (United States)

    Kaushik, V. V. R.; Ghosh, S.; Das, G.; Das, P. K.

    2011-01-01

    This paper deals with the use of commercial CFD software in teaching graduate level computational fluid dynamics. FLUENT 6.3.26 was chosen as the CFD software to teach students the entire CFD process in a single course. The course objective is to help students to learn CFD, use it in some practical problems and analyze as well as validate the…

  20. Applications of CFD in Hydraulics and River Engineering

    Science.gov (United States)

    Nguyen, Van Thinh; Nestmann, Franz

    2004-02-01

    In this paper, various applications and developments of CFD technology in hydraulics and river engineering are presented. Numerical studies of three-dimensional turbulent flow fields in open channels and rivers are carried out by CFD packages such as the finite element code FIDAP and finite volume code COMET. Meshing procedures are implemented by GAMBIT or CFD-GEOM. To calculate the position of the free surface two methods are applied, free surface tracking and volume-of-fluid, and some comparisons of these methods are discussed.

  1. Applications of CFD in hydraulics and river engineering

    Energy Technology Data Exchange (ETDEWEB)

    Nguyen, V.T.; Nestmann, F. [Univ. of Karlsruhe, Civil Engineering, Karlsruhe (Germany)]. E-mail: ge27@rz.uni-karlsruhe.de; Franz.Nestmann@iwk.uni-karlsruhe.de

    2002-07-01

    In this paper various applications and developments of CFD technology in hydraulics and river engineering are presented. Numerical studies of three dimensional turbulent flow fields in open channels and rivers are carried out by CFD packages such as finite element FIDAP of Fluent and finite volume COMET of ICCM (Institute of Computational Continuum Mechanics GmbH). Meshing procedures are implemented by GAMBIT (Fluent) or CFD-GEOM (CFDRC). Especially, to calculate the position of the free surface both methods, free surface tracking and Volume-Of-Fluid (VOF), are applied. (author)

  2. Wind Loads on Ships and Offshore Structures Estimated by CFD

    DEFF Research Database (Denmark)

    Aage, Christian; Hvid, S.L.; Hughes, P.H.;

    1997-01-01

    on a seagoing ferry and on a semisubmersible offshore platform have been estimated by CFD. The results have been compared with wind tunnel model tests and, for the ferry, a few full-scale measurements, and good agreement is obtained. The CFD method offers the possibility of a computational estimate of scale...... effects related to wind tunnel model testing. An example of such an estimate on the ferry is discussed. Due to the time involved in generating the computational mesh and in computing the solution, the CFD method is not at the moment economically competitive to routine wind tunnel model testing....

  3. MODELLING MANTLE TANKS FOR SDHW SYSTEMS USING PIV AND CFD

    DEFF Research Database (Denmark)

    Shah, Louise Jivan; Morrison, G.L.; Behnia, Masud

    1999-01-01

    Characteristics of vertical mantle heat exchanger tanks for SDHW systems have been investigated experimentally and theoretically using particle image velocimetry (PIV) and CFD modelling. A glass model of a mantle heat exchanger tank was constructed so that the flow distribution in the mantle could...... be studied using the PIV test facility. Two transient three-dimensional CFD-models of the glass model mantle tank were developed using the CFD-programmes CFX and FLUENT.The experimental results illustrate that the mantle flow structure in the mantle is complicated and the distribution of flow in the mantle...

  4. CFD Simulation of the NREL Phase VI Rotor

    CERN Document Server

    Song, Yang

    2014-01-01

    The simulation of the turbulent and potentially separating flow around a rotating, twisted, and tapered airfoil is a challenging task for CFD simulations. This paper describes CFD simulations of the NREL Phase VI turbine that was experimentally characterized in the 24.4m x 36.6m NREL/NASA Ames wind tunnel (Hand et al., 2001). All computations in this article are performed on the experimental base configuration of 0o yaw angle, 3o tip pitch angle, and a rotation rate of 72 rpm. The significance of specific mesh resolution regions to the accuracy of the CFD prediction is discussed. The ability of CFD to capture bulk quantities, such as the shaft torque, and the detailed flow characteristics, such as the surface pressure distributions, are explored for different inlet wind speeds. Finally, the significant three-dimensionality of the boundary layer flow is demonstrated.

  5. Correlation of Puma airloads: Evaluation of CFD prediction methods

    Science.gov (United States)

    Strawn, Roger C.; Desopper, Andre; Miller, Judith; Jones, Alan

    1989-01-01

    A cooperative program was undertaken by research organizations in England, France, Australia and the U.S. to study the capabilities of computational fluid dynamics codes (CFD) to predict the aerodynamic loading on helicopter rotor blades. The program goal is to compare predictions with experimental data for flight tests of a research Puma helicopter with rectangular and swept tip blades. Two topics are studied. First, computed results from three CFD codes are compared for flight test cases where all three codes use the same partial inflow-angle boundary conditions. Second, one of the CFD codes (FPR) is iteratively coupled with the CAMRAD/JA helicopter performance code. These results are compared with experimental data and with an uncoupled CAMRAD/JA solution. The influence of flow field unsteadiness is found to play an important role in the blade aerodynamics. Alternate boundary conditions are suggested in order to properly model this unsteadiness in the CFD codes.

  6. Correlation of Puma airfoils - Evaluation of CFD prediction methods

    Science.gov (United States)

    Strawn, Roger C.; Desopper, Andre; Miller, Judith; Jones, Alan

    1989-01-01

    A cooperative program was undertaken by research organizations in England, France, Australia and the U.S. to study the capabilities of computational fluid dynamics codes (CFD) to predict the aerodynamic loading on helicopter rotor blades. The program goal is to compare predictions with experimental data for flight tests of a research Puma helicopter with rectangular and swept tip blades. Two topics are studied. First, computed results from three CFD codes are compared for flight test cases where all three codes use the same partial inflow-angle boundary conditions. Second, one of the CFD codes (FPR) is iteratively coupled with the CAMRAD/JA heilcopter performance code. These results are compared with experimental data and with an uncoupled CAMRAD/JA solution. The influence of flow field unsteadiness is found to play an important role in the blade aerodynamics. Alternate boundary conditions are suggested in order to properly model this unsteadiness in the CFD codes.

  7. Recent Updates to the CFD General Notation System (CGNS)

    Science.gov (United States)

    Rumsey, Christopher L.; Wedan, Bruce; Hauser, Thomas; Poinot, Marc

    2012-01-01

    The CFD General Notation System (CGNS) - a general, portable, and extensible standard for the storage and retrieval of computational fluid dynamics (CFD) analysis data has been in existence for more than a decade (Version 1.0 was released in May 1998). Both structured and unstructured CFD data are covered by the standard, and CGNS can be easily extended to cover any sort of data imaginable, while retaining backward compatibility with existing CGNS data files and software. Although originally designed for CFD, it is readily extendable to any field of computational analysis. In early 2011, CGNS Version 3.1 was released, which added significant capabilities. This paper describes these recent enhancements and highlights the continued usefulness of the CGNS methodology.

  8. Experimental and CFD investigation of gas phase freeboard combustion

    DEFF Research Database (Denmark)

    Andersen, Jimmy

    treatment. The aim of this project is to provide validation data for Computational Fluid Dynamic (CFD) models relevant for grate firing combustion conditions. CFD modeling is a mathematical tool capable of predicting fluid flow, mixing and chemical reaction with thermal conversion and transport. Prediction...... of pollutant formation, which occurs in small concentrations with little impact on the general combustion process is in this work predicted by a post-processing step, making it less computationally expensive. A reactor was constructed to simulate the conditions in the freeboard of a grate fired boiler......-NO formation during grate firing biomass combustion conditions. The experimental results are in this work compared to CFD modeling. The modeling results show, that the CFD model captured the main features of the combustion process and flow patterns. The application of more advanced chemical reaction mechanisms...

  9. On development of CFD platform for blade rows

    OpenAIRE

    Nishizawa, Toshio; Nozaki, Osamu; Nakamura, Takashi; Fukuda, Masahiro; Kato, Akifumi; Sukemura, Shuniti; Kawasaki, Takuji; 西澤 敏雄; 野崎 理; 中村 孝; 福田 正大; 加藤 昭史; 助村 俊一; 川崎 琢治

    2000-01-01

    The present paper shows a CFD (Computational Fluid Dynamics) platform for blade rows, which realize efficient engineering environment for aerodynamic designers of turbomachine for aircraft engines, ships and electric power plants. The platform consists of PCs, WSs (Workstations) and supercomputers on network. It provides graphic user interfaces on these computers to control the CFD programs, so that the designers can operate very easily their tasks such as generating the computational grids, ...

  10. A computational design system for rapid CFD analysis

    Science.gov (United States)

    Ascoli, E. P.; Barson, S. L.; Decroix, M. E.; Sindir, Munir M.

    1992-01-01

    A computation design system (CDS) is described in which these tools are integrated in a modular fashion. This CDS ties together four key areas of computational analysis: description of geometry; grid generation; computational codes; and postprocessing. Integration of improved computational fluid dynamics (CFD) analysis tools through integration with the CDS has made a significant positive impact in the use of CFD for engineering design problems. Complex geometries are now analyzed on a frequent basis and with greater ease.

  11. Case studies from the REHVA CFD guide book

    DEFF Research Database (Denmark)

    Nielsen, Peter V.

    2008-01-01

    This paper presents CFD predictions which are used at different levels, from the evaluation of an idea to the design of a system, or for the analysing work on an existing building.......This paper presents CFD predictions which are used at different levels, from the evaluation of an idea to the design of a system, or for the analysing work on an existing building....

  12. Optimización del medio de cultivo QBP para la producción de biomasa del consorcio BIOYAF

    Directory of Open Access Journals (Sweden)

    Yaima Barrios San Martín

    2014-06-01

    Full Text Available Título en inglés: Optimization of culture media QBP to the production of biomass of consortium BIOYAF Título corto: Optimización de un medio de cultivoResumen: La optimización de los medios de cultivo con fines industriales en la mayoría de los casos ha sido efectuada mediante procedimientos empíricos de ensayo y error. Empleando diversos métodos estadísticos es probable que el medio de cultivo original pueda ser optimizado, en muchos casos es posible obtener un medio que no solo sea más productivo, sino de menor o igual costo que el original. Se optimizó el medio de cultivo QBP para el crecimiento de las cepas del consorcio bacteriano BIOYAF capaz de degradar hidrocarburos del petróleo, empleando un Diseño de Factor Categórico Individual para determinar el tiempo de trabajo, un Diseño Factorial (24 para determinar los rangos de trabajo de concentración de los nutrientes y un Diseño de Superficie de Respuesta para optimizar las concentraciones. Las variables de respuesta de evaluación de los experimentos fueron masa húmeda, masa (UDO, conteo de viables, conductividad, pH y tensión superficial. El tiempo óptimo para el crecimiento de las cepas del consorcio BIOYAF es de seis horas. El medio de cultivo QBP con concentraciones óptimas de fosfato de amonio (3,19 g.l-1, sulfato de magnesio (0,04 g.l-1, levadura (3,77 g.l-1 y sacarosa (47,89 g.l-1 permite que la producción de biomasa aumente de 1,540 UDO a 3,082 UDO.Palabras clave: superficie de respuesta, consorcio bacteriano, crecimiento óptimo.Abstract: The optimization of culture media with industrial purposes, in most cases, has been made through empirical trial and error procedures. Using different statistical methods original culture media can be optimized, in many cases, it is possible to obtain a more productive media, at the same cost as the original one. The culture media QBP was optimized for the growth of the bacterial consortium BIOYAF, which can degrade

  13. Desarrollo de una tecnología para la producción a pequeña escala de la biomasa del hongo ostra (Pleurotus ostreatus)

    OpenAIRE

    2014-01-01

    En este trabajo se presenta el diseño tecnológico de una planta para la producción a pequeña escala de biomasa del hongo ostra (Pleurotus ostreatus) donde se introduce la modelaicón matemática en la etapa de fermentación. Se seleccionó la cepa ceba-gliie-po-010106 de P. ostreatus, asilada de la Sierra Norte ecuatoriana, la que presenta una velocidad promedio de crecimiento igual a 0.584 mm/h en un medio rico. El residuo de fréjol aportó los mejores resultados, con una bioconversión promedio d...

  14. HIDRÓLISIS ÁCIDA DE CELULOSA Y BIOMASA LIGNOCELULÓSICA ASISTIDA CON LÍQUIDOS IÓNICOS

    OpenAIRE

    Silvia Morales de la Rosa

    2015-01-01

    Los procesos de hidrólisis de biomasa lignocelulósica suelen utilizar enzimas para romper las moléculas de polisacáridos y producir azucares. Junto con la optimización y mejora de los procesos de hidrólisis enzimática, existe también gran interés en el desarrollo de vías alternativas de transformación mediante procesos de hidrólisis química. Uno de los cuellos de botella más importantes de comercialización de bioetanol lignocelulósico es el descubrimiento de una hidrólisis rentable de la celu...

  15. Modelado y simulación del proceso de pirolisis rápida de biomasa en un reactor de lecho fluidizado

    OpenAIRE

    Blanco Leal, Luz Adriana

    2014-01-01

    Resumen: En este trabajo se desarrolló un modelo matemático de base fenomenológica para el proceso de pirólisis rápida de biomasa en lecho fluidizado burbujeante. El modelo fue desarrollado en estado transitorio, es unidimensional y está basado en la teoría de las dos fases. Se empleó un mecanismo de reacción semi-global en dos etapas considerando la formación primaria de productos y las reacciones secundarias de los vapores. Además, se plantearon balances de población para la distribución d...

  16. CFD analysis of a ball check microvalve

    Science.gov (United States)

    Cǎlimǎnescu, Ioan; Dumitrache, Constantin L.; Grigorescu, Lucian

    2015-02-01

    The microvalves with balls as seen before are used in many applications and their behaviour in terms of fluid dynamics mainly at their opening time (when as demonstrated the ball is bouncing up and down altering the flow parameters) is of a paramount importance. The present study is focused on a micro check ball valve circulating a fluid air-like (with the same constant proprieties). The CFD model is taking into account a transitory zone of functioning from zero time when the pressure inside a "tank" is reaching the opening pressure of the valve, to the final step 0.05 seconds when the ball is stabilizing after bouncing up and down. The geometry of the valve with dimensions in μm is given below (the model is comprising a "slice" of 5 μm thickness extracted from the entire valve. In this paper by using advanced numeric techniques, the behavior of the valve in its transitory opening stage was studied with credible and useful results for further optimisation studies.

  17. A CFD analysis of controlled flutter phenomenon

    Directory of Open Access Journals (Sweden)

    Thirusangu Velmurugan

    2016-01-01

    Full Text Available In the present study, the concept of aero elastic wind energy generator is utilized wind turbines and it applied to produce electricity at low wind speeds. Flutter is the mechanism of dynamic instability in which the energy can be extracted from the wind. This energy might possibly transform into electric power. A straight rectangular wing with single degree of freedom at stalling angle is employed to do suitable work for producing power. A computational model of aero elastic wind energy generator is developed by using ICEM CFD and the flow analysis is carried out at different speeds for the prediction of co-efficient of power for the proposed device. Further a small model is experimentally fabricated and tested in a wind tunnel with different velocities using non-linear theory to predict the power co-efficient of a model. The test results from experiment are compared with the computational results. Thus it is evident that the correlated results are accurate within the acceptable range. The input from the flow analysis is used for structural analysis in ANSYS. The frequency, amplitude of oscillation and phase response of the proposed system can be obtained and it compared with the numerical values from MATLAB simulation of the same system to ensure for obtaining sustained oscillation which is capable of producing power. The flutter mechanism is having the advantage of producing power at very low velocity, eventhough low efficiency.

  18. CFD and FEM modeling of PPOOLEX experiments

    Energy Technology Data Exchange (ETDEWEB)

    Paettikangas, T.; Niemi, J.; Timperi, A. (VTT Technical Research Centre of Finland (Finland))

    2011-01-15

    Large-break LOCA experiment performed with the PPOOLEX experimental facility is analysed with CFD calculations. Simulation of the first 100 seconds of the experiment is performed by using the Euler-Euler two-phase model of FLUENT 6.3. In wall condensation, the condensing water forms a film layer on the wall surface, which is modelled by mass transfer from the gas phase to the liquid water phase in the near-wall grid cell. The direct-contact condensation in the wetwell is modelled with simple correlations. The wall condensation and direct-contact condensation models are implemented with user-defined functions in FLUENT. Fluid-Structure Interaction (FSI) calculations of the PPOOLEX experiments and of a realistic BWR containment are also presented. Two-way coupled FSI calculations of the experiments have been numerically unstable with explicit coupling. A linear perturbation method is therefore used for preventing the numerical instability. The method is first validated against numerical data and against the PPOOLEX experiments. Preliminary FSI calculations are then performed for a realistic BWR containment by modeling a sector of the containment and one blowdown pipe. For the BWR containment, one- and two-way coupled calculations as well as calculations with LPM are carried out. (Author)

  19. Axisymmetric Afterbody Test Case for CFD Validation

    Science.gov (United States)

    Disotell, Kevin; Rumsey, Christopher

    2016-11-01

    As simulation complexity increases, the corresponding need for systematic, high-fidelity validation data sets continues to be important to advance physics-based CFD models. To this end, a parametric body of revolution is proposed as an experimental platform to support a wide validation domain for turbulent boundary layers outside the current bounds of DNS. Recognizing the challenges of detailed flow exploration on complex 3-D geometries, an analytically-defined body of revolution is pursued as a tractable, state-of-the-art measurement case for complex turbulent flows having extra rates of strain. The central feature of the concept based upon work by Presz Jr. & Pitkin is an interchangeable afterbody which can be tailored to distort a turbulent boundary layer in various ways, with incoming properties controlled by the forebody. An introduction to the test case design and overview of recent progress focused on smooth-body, turbulent separation physics are presented. Supported by appointment to NASA Postdoctoral Program, administered by Universities Space Research Association.

  20. Efecto de la depuración en la biomasa del caracol Pomacea patula [Baker, 1922] usando el índice de condición

    Directory of Open Access Journals (Sweden)

    M. García-Ulloa

    2006-01-01

    Full Text Available La depuración de organismos acuáticos en cultivo es una práctica común. El tiempo de exposición de los animales al agua tratada es uno de los factores más importantes para su eficiencia, pudiendo afectar su biomasa. Se evaluó el efecto de la depuración en adultos de Pomacea patula mediante la aplicación del índice de condición (IC, bajo condiciones de laboratorio. Caracoles adultos obtenidos en cultivo se mantuvieron en peceras (Grupo 1 expuestos a un flujo de agua constante, tratada con radiación ultravioleta y limpieza diaria y en condiciones normales de mantenimiento (Grupo 2, con 5 réplicas por grupo. Se obtuvo el peso húmedo y longitud total individualmente, al inicio y después de una depuración de 10 días. El valor promedio del coeficiente de correlación (animales iniciales y de los Grupos 1 y 2 fue mayor a 0.90. El IC entre el valor inicial (771.81 ± 40.41 y los Grupos 1 y 2 (763.527 ± 25.24 y 765.465 ± 38.59, respectivamente, no mostró diferencias significativas (P > 0.05 al final del experimento. Los resultados sugieren que el proceso de depuración usado no afectó la biomasa de adultos de P. patula. El IC se mostró como una herramienta práctica de evaluación sin considerar la diferencia inicial de tallas de caracoles adultos

  1. Efecto de lixiviados del raquis de plátano sobre la actividad y biomasa microbiana en floración y cosecha del tomate

    Directory of Open Access Journals (Sweden)

    Muñoz V. Rosa Elvira

    2005-03-01

    Full Text Available Se utilizaron cinco tratamientos: el testigo (T0 y cuatro concentraciones de lixiviados (T1= 100%, T2= 75%, T3= 50% y T4= 25% aplicados 15, 30 y 60 días después del trasplante. La actividad microbiana se determinó con la metodología del CAB y la biomasa microbiana con el método de fumigación-extracción. En la actividad microbiana se encontraron diferencias significativas entre los tratamientos, presentando la aplicación del lixiviado a la menor concentración (25% la mayor actividad (56.76 mgCO2g suelo-1. La actividad fue mayor en floración en todos los tratamientos. Para biomasa microbiana no se presentaron diferencias significativas entre los tratamientos ni entre épocas. ABSTRACT The effect of leaching from rachis on soil microbial biomass and activity during tomato flowering and harvesting period. Field trail comprised five treatments of different leaching concentrations (T0= test, T1= 100%, T2= 75%, T3=50%, and T4=25% sprinkled on soil 15, 30 and 60 days after tomato transplanting. Microbial activity was measured with CAB method and microbial biomass was recorded with fumigation - extraction method. The average microbial activity with sprinking of 25% of leaching was higher (56.76 mgCO2g suelo-1. No significant difference in order to treatments and periods in microbial biomass were observed. These observations showed leaching sprinkling in low concentration influence en microbial activity for the conditions of this experiment. Key words: Soil biology, biomass, leaching, Lycopersicum sculentun.

  2. Análisis Exergético de la Gasificación de Biomasa Exergy Analysis of Biomass Gasification

    Directory of Open Access Journals (Sweden)

    Jorge M Mendoza

    2012-01-01

    Full Text Available El objetivo de este estudio fue realizar el análisis exergético de la gasificación de biomasa residual con la finalidad de obtener energía útil. Se desarrolló un modelo para la gasificación de biomasa basado en el equilibrio químico de las reacciones. Este modelo permite predecir la evolución de la composición del gas de síntesis en función de la temperatura, las presiones y la composición elemental de los residuos del proceso de extracción de aceite de palma y orujo de lavado de uva (hidrogeno, oxigeno, carbono y nitrógeno, como también hacer un análisis exergético. Se encontró que independiente del agente gasificante, la concentración de monóxido de carbono e hidrógeno tienden a incrementar significativamente a altas presiones y elevadas temperaturas. Además, se muestra que la eficiencia exergética incrementa con la temperatura y disminuye con el aumento de la relación aire/combustible.This paper shows the exergy analysis applied to the gasification process of residual biomass with the purpose of obtaining useful energy. A model for the biomass gasification based on chemical equilibrium of the reactions is proposed. The model allows predicting the syngas composition as a function of temperature, pressure and ultimate analysis of palm oil and grapevine pruning waste (determining hydrogen, oxygen, carbon and nitrogen. It was found that the carbon monoxide and hydrogen concentration significantly increase at high pressure and temperature independently of the gasifying agent. Furthermore, it was also noticed that the exergy efficiency increases as temperature increases, and decreases as the relative fuel/air ratio increases.

  3. The Dalles Dam, Columbia River: Spillway Improvement CFD Study

    Energy Technology Data Exchange (ETDEWEB)

    Cook, Chris B.; Richmond, Marshall C.; Serkowski, John A.

    2006-06-01

    This report documents development of computational fluid dynamics (CFD) models that were applied to The Dalles spillway for the US Army Corps of Engineers, Portland District. The models have been successfully validated against physical models and prototype data, and are suitable to support biological research and operations management. The CFD models have been proven to provide reliable information in the turbulent high-velocity flow field downstream of the spillway face that is typically difficult to monitor in the prototype. In addition, CFD data provides hydraulic information throughout the solution domain that can be easily extracted from archived simulations for later use if necessary. This project is part of an ongoing program at the Portland District to improve spillway survival conditions for juvenile salmon at The Dalles. Biological data collected at The Dalles spillway have shown that for the original spillway configuration juvenile salmon passage survival is lower than desired. Therefore, the Portland District is seeking to identify operational and/or structural changes that might be implemented to improve fish passage survival. Pacific Northwest National Laboratory (PNNL) went through a sequence of steps to develop a CFD model of The Dalles spillway and tailrace. The first step was to identify a preferred CFD modeling package. In the case of The Dalles spillway, Flow-3D was as selected because of its ability to simulate the turbulent free-surface flows that occur downstream of each spilling bay. The second step in development of The Dalles CFD model was to assemble bathymetric datasets and structural drawings sufficient to describe the dam (powerhouse, non-overflow dam, spillway, fish ladder entrances, etc.) and tailrace. These datasets are documented in this report as are various 3-D graphical representations of The Dalles spillway and tailrace. The performance of the CFD model was then validated for several cases as the third step. The validated model

  4. A new CFD modeling method for flow blockage accident investigations

    Energy Technology Data Exchange (ETDEWEB)

    Fan, Wenyuan, E-mail: fanwy@mail.ustc.edu.cn; Peng, Changhong, E-mail: pengch@ustc.edu.cn; Chen, Yangli, E-mail: chenyl@mail.ustc.edu.cn; Guo, Yun, E-mail: guoyun79@ustc.edu.cn

    2016-07-15

    Highlights: • Porous-jump treatment is applied to CFD simulation on flow blockages. • Porous-jump treatment predicts consistent results with direct CFD treatment. • Relap5 predicts abnormal flow rate profiles in MTR SFA blockage scenario. • Relap5 fails to simulate annular heat flux in blockage case of annular assembly. • Porous-jump treatment provides reasonable and generalized CFD results. - Abstract: Inlet flow blockages in both flat and annular plate-type fuel assemblies are simulated by (Computational Fluid Dynamics) CFD and system analysis methods, with blockage ratio ranging from 60 to 90%. For all the blockage scenarios, mass flow rate of the blocked channel drops dramatically as blockage ratio increases, while mass flow rates of non-blocked channels are almost steady. As a result of over-simplifications, the system code fails to capture details of mass flow rate profiles of non-blocked channels and power redistribution of fuel plates. In order to acquire generalized CFD results, a new blockage modeling method is developed by using the porous-jump condition. For comparisons, direct CFD simulations are conducted toward postulated blockages. For the porous-jump treatment, conservative flow and heat transfer conditions are predicted for the blocked channel, while consistent predictions are obtained for non-blocked channels. Besides, flow fields in the blocked channel, asymmetric power redistributions of fuel plates, and complex heat transfer phenomena in annular fuel assembly are obtained and discussed. The present study indicates that the porous-jump condition is a reasonable blockage modeling method, which predicts generalized CFD results for flow blockages.

  5. The Ranque-Hilsch effect: CFD modeling

    Energy Technology Data Exchange (ETDEWEB)

    Bezprozvannykh, V.; Mottl, H. [DYCOR Technologies, Edmonton, Alberta (Canada)]. E-mail: vlad.bez@dycor.com; hank.mottl@dycor.com

    2003-07-01

    The phenomenon of noticeable temperature distribution in confined steady rotating gas flows is referred as Ranque-Hilsch effect. The simple counter-flow Ranque-Hilsch tube consists of a long hollow cylinder with tangential nozzles at one end for injecting compressed gas. Rotating gas escapes the tube through two outlets - a central orifice diaphragm placed near the injection nozzle plane (cold stream) and a ring-shaped peripheral outlet placed at the opposite end of the tube (hot stream). The flow is essentially three-dimensional, turbulent, compressible, and spinning such that any theoretical simplifications are questionable, if at all possible. Fluent suite of software was applied at Dycor Technologies, Canada to the task of numerical simulation of the Ranque-Hilsch effect that is part of Dycor's program of fundamental and applied research. The behavior of two types of fluids in the Ranque-Hilsch tube was investigated - air and water. Three-dimensional continuity, momentum, and energy equations were solved for incompressible and compressible flows for water and air cases correspondingly. The Reynolds stress turbulence model was originally applied to close the Reynolds-averaged Navier-Stokes equations. The visualization of the velocity and temperature fields inside the vortex tube helped to understand the details of fluid flow. It was shown that CFD approach is applicable for simulating Ranque-Hilsch effect. It was found that various levels of complexity in turbulence modeling are suitable for vortex tube analysis. No vortex effect was observed for incompressible flow. The dependence of vortex tube cooling ability on initial gas pressure was investigated. Numerical simulation data are consistent with available experimental results. (author)

  6. CFD model of an aerating hydrofoil

    Science.gov (United States)

    Scott, D.; Sabourin, M.; Beaulieu, S.; Papillon, B.; Ellis, C.

    2014-03-01

    Improving water quality in the tailrace below hydroelectric dams has become a priority in many river systems. In warm climates, water drawn by the turbine from deep in a reservoir can be deficient in dissolved oxygen (DO), a critical element in maintaining a healthy aquatic ecosystem. Many different solutions have been proposed in order to increase the DO levels in turbine discharge, including: turbine aeration systems (adding air to the water through either the turbine hub, the periphery or through distributed aeration in the runner blades); bubble diffusers in the reservoir or in the tailrace; aerating weirs downstream of the dams; and surface water pumps in the reservoir near the dam. There is a significant potential to increase the effectiveness of these solutions by improving the way that oxygen is introduced into the water; better distributions of bubbles will result in better oxygen transfer. In the present study, a two-phase Computational Fluid Dynamics model has been formulated using a commercial code to study the distribution of air downstream of a simple aerating hydrofoil. The two-phase model uses the Eulerian-Eulerian approach. Appropriate relations are used to model the interphase forces, including the Grace drag force model, the Favre averaged drag force and the Sato enhanced eddy viscosity. The model is validated using experimental results obtained in the water tunnel at the University of Minnesota's Saint Anthony Falls Laboratory. Results are obtained for water velocities between 5 and 10 m/s, air flow rates between 0.5 and 1.5 sL/min and for angles of attack between 0° and -8°. The results of this study show that the CFD model provides a good qualitative comparison to the experimental results by well predicting the wake location at the different flow rates and angles of attack used.

  7. REFRIGERAÇÃO UTILIZANDO PASTILHAS DE EFEITO PELTIER

    OpenAIRE

    Antonio Luiz P. S. Campos; Aécio Vinícius Amorim Farias; Jainne Daniele F. S. Fernandes; Alailson de Freitas Braz; Machado, Ludmila Sayonara S. X.; Edfranklin de Souza Pimentel

    2010-01-01

    Pastilhas de Peltier são dispositivos baseados no efeito Peltier e são aplicadas para produzir efeito refrigerador ou aquecedor. Este trabalho aborda conceitos envolvidos na fabricação e funcionamento desses dispositivos tais como: histórico do efeito Peltier e desenvolvimento de placas de efeito Peltier. É feito um estudo de eficiência da refrigeração de água utilizando uma placa de efeito Peltier existente no Campus Natal – Zona Norte. Para isso, é implementada uma estrutura de refrigeração...

  8. Un administrador de procesamiento distribuido utilizando Windows Sockets

    OpenAIRE

    Naiouf, Marcelo; De Giusti, Armando Eduardo; Chaer, R.; Fonseca, A.

    1996-01-01

    Se presenta un administrador de procesamiento distribuido utilizando Windows Sockets, que permite la comunicación y distribución de tareas entre máquinas de una red, para la ejecución de algoritmos paralelos. La plataforma del sistema es una red en al cual la única restricción es que las estaciones estén ejecutando Windows. El soporte de comunicaciones se realiza a través de una librería que permite utilizar canales de comunicación sobre la red administrando la señalización mediante el env...

  9. CFD based extraction column design-Chances and challenges

    Institute of Scientific and Technical Information of China (English)

    Mark W Hlawitschka; Menwer M Attarakih; Samer S Alzyod; Hans-Jrg Bart

    2016-01-01

    This paper shows that one-dimensional (1-D) [and three-dimensional (3-D) computational fluid dynamics (CFD)] simulations can replace the state-of-the-art usage of pseudo-homogeneous dispersion or back mixing models. This is based on standardized lab-scale cel experiments for the determination of droplet rise, breakage, coalescence and mass transfer parameters in addition to a limited number of additional mini-plant experiments with original fluids. Alternatively, the hydrodynamic parameters can also be derived using more sophisticated 3-D CFD simulations. Computational 1-D modeling served as a basis to replace pilot-plant experiments in any column geometry. The combination of 3-D CFD simulations with droplet population balance models (DPBM) increased the accuracy of the hydrodynamic simulations and gave information about the local droplet size. The high computational costs can be reduced by open source CFD codes when using a flexible mesh generation. First combined simulations using a three way coupled CFD/DPBM/mass-transfer solver pave the way for a safer design of industrial-sized columns, where no correlations are available.

  10. A new methodology for the CFD uncertainty analysis

    Institute of Scientific and Technical Information of China (English)

    YAO Zhen-qiu; SHEN Hong-cui; GAO Hui

    2013-01-01

    With respect to the measurement uncertainty,this paper discusses the definition,the sources,the classification and the expressions of the CFD uncertainty.Based on the orthogonal design and the statistics inference theory,a new verification and validation method and the related procedures in the CFD simulation are developed.With the method,two examples of the CFD verification and validation are studied for the drag coefficient and the nominal wake fraction,and the calculation factors and their interactions which would significantly affect the simulation results are obtained.Moreover,the sizes of all uncertainty components resulting from the controlled and un-controlled calculation factors are determined,and the optimal combination of the calculation factors is obtained by an effect estimation in the orthogonal experiment design.It is shown that the new method can be used for the verification in the CFD uncertainty analysis,and can reasonably and definitely judge the credibility of the simulative result.As for CFD simulation of the drag coefficient and the nominal wake fraction,the results predicted can be validated.Although there is still some difference between the simulation results and the experiment results,its approximate level and credibility can be accepted.

  11. Validation of CFD simulation for flat plate solar energy collector

    Energy Technology Data Exchange (ETDEWEB)

    Selmi, Mohamed; Al-Khawaja, Mohammed J.; Marafia, Abdulhamid [Department of Mechanical Engineering, University of Qatar, P.O. Box 2713, Doha, State of Qatar (Qatar)

    2008-03-15

    The problem of flat plate solar energy collector with water flow is simulated and analyzed using computational fluid dynamics (CFD) software. The considered case includes the CFD modeling of solar irradiation and the modes of mixed convection and radiation heat transfer between tube surface, glass cover, side walls, and insulating base of the collector as well as the mixed convective heat transfer in the circulating water inside the tube and conduction between the base and tube material. The collector performance, after obtaining 3-D temperature distribution over the volume of the body of the collector, was studied with and without circulating water flow. An experimental model was built and experiments were performed to validate the CFD model. The outlet temperature of water is compared with experimental results and there is a good agreement. (author)

  12. Study of tip loss corrections using CFD rotor computations

    DEFF Research Database (Denmark)

    Shen, Wen Zhong; Zhu, Wei Jun; Sørensen, Jens Nørkær

    2014-01-01

    Tip loss correction is known to play an important role for engineering prediction of wind turbine performance. There are two different types of tip loss corrections: tip corrections on momentum theory and tip corrections on airfoil data. In this paper, we study the latter using detailed CFD...... computations for wind turbines with sharp tip. Using the technique of determination of angle of attack and the CFD results for a NordTank 500 kW rotor, airfoil data are extracted and a new tip loss function on airfoil data is derived. To validate, BEM computations with the new tip loss function are carried out...... and compared with CFD results for the NordTank 500 kW turbine and the NREL 5 MW turbine. Comparisons show that BEM with the new tip loss function can predict correctly the loading near the blade tip....

  13. Adaptive Distributed Data Structure Management for Parallel CFD Applications

    KAUST Repository

    Frisch, Jerome

    2013-09-01

    Computational fluid dynamics (CFD) simulations require a lot of computing resources in terms of CPU time and memory in order to compute with a reasonable physical accuracy. If only uniformly refined domains are applied, the amount of computing cells is growing rather fast if a certain small resolution is physically required. This can be remedied by applying adaptively refined grids. Unfortunately, due to the adaptive refinement procedures, errors are introduced which have to be taken into account. This paper is focussing on implementation details of the applied adaptive data structure management and a qualitative analysis of the introduced errors by analysing a Poisson problem on the given data structure, which has to be solved in every time step of a CFD analysis. Furthermore an adaptive CFD benchmark example is computed, showing the benefits of an adaptive refinement as well as measurements of parallel data distribution and performance. © 2013 IEEE.

  14. FDNS CFD Code Benchmark for RBCC Ejector Mode Operation

    Science.gov (United States)

    Holt, James B.; Ruf, Joe

    1999-01-01

    Computational Fluid Dynamics (CFD) analysis results are compared with benchmark quality test data from the Propulsion Engineering Research Center's (PERC) Rocket Based Combined Cycle (RBCC) experiments to verify fluid dynamic code and application procedures. RBCC engine flowpath development will rely on CFD applications to capture the multi-dimensional fluid dynamic interactions and to quantify their effect on the RBCC system performance. Therefore, the accuracy of these CFD codes must be determined through detailed comparisons with test data. The PERC experiments build upon the well-known 1968 rocket-ejector experiments of Odegaard and Stroup by employing advanced optical and laser based diagnostics to evaluate mixing and secondary combustion. The Finite Difference Navier Stokes (FDNS) code was used to model the fluid dynamics of the PERC RBCC ejector mode configuration. Analyses were performed for both Diffusion and Afterburning (DAB) and Simultaneous Mixing and Combustion (SMC) test conditions. Results from both the 2D and the 3D models are presented.

  15. CFD analysis of ejector in a combined ejector cooling system

    Energy Technology Data Exchange (ETDEWEB)

    Rusly, E.; Aye, Lu [International Technologies Centre (IDTC), Department of Civil and Environmental Engineering, The University of Melbourne, Melbourne, Vic. 3010 (Australia); Charters, W.W.S.; Ooi, A. [Department of Mechanical and Manufacturing Engineering, The University of Melbourne, Melbourne, Vic. 3010 (Australia)

    2005-11-01

    One-dimensional ejector analyses often use coefficients derived from experimental data for a set of operating conditions with limited functionality. In this study, several ejector designs were modelled using finite volume CFD techniques to resolve the flow dynamics in the ejectors. The CFD results were validated with available experimental data. Flow field analyses and predictions of ejector performance outside the experimental range were also carried out. During validation, data from CFD predicted the entrainment ratios with greater accuracy on definite area ratios, although no shock was recorded in the ejector. Predictions outside the experimental range-at operating conditions in a combined ejector-vapour compression system-and flow conditions resulting from ejector geometry variations are discussed. It is found that the maximum entrainment ratio happens in the ejector just before a shock occurs and that the position of the nozzle is an important ejector design parameter. (author)

  16. Introducing CFD in the optical simulation of linear Fresnel collectors

    Science.gov (United States)

    Moghimi, M. A.; Rungasamy, A.; Craig, K. J.; Meyer, J. P.

    2016-05-01

    This paper seeks to determine whether the Finite Volume method within a commercially available Computational Fluid Dynamics (CFD) solver (ANSYS Fluent) can model radiation with comparable accuracy to a Monte Carlo ray-tracing software package (SolTrace). A detailed investigation was performed into modeling techniques that can be used to significantly reduce the optical errors traditionally associated with CFD modeling of radiation false scattering and ray effect using a simple optical test case. The strategies formulated in the first part of this paper were used to model a variety of Linear Fresnel Collector Concentrating Solar Power Plants. This paper shows that commercial CFD packages yield accurate results for line focusing concentrating solar applications and simple geometries, validating its use in an integrated environment where both optical and thermal performance of these plants can be simulated and optimized.

  17. Statistical Analysis of CFD Solutions from the 6th AIAA CFD Drag Prediction Workshop

    Science.gov (United States)

    Derlaga, Joseph M.; Morrison, Joseph H.

    2017-01-01

    A graphical framework is used for statistical analysis of the results from an extensive N- version test of a collection of Reynolds-averaged Navier-Stokes computational uid dynam- ics codes. The solutions were obtained by code developers and users from North America, Europe, Asia, and South America using both common and custom grid sequencees as well as multiple turbulence models for the June 2016 6th AIAA CFD Drag Prediction Workshop sponsored by the AIAA Applied Aerodynamics Technical Committee. The aerodynamic con guration for this workshop was the Common Research Model subsonic transport wing- body previously used for both the 4th and 5th Drag Prediction Workshops. This work continues the statistical analysis begun in the earlier workshops and compares the results from the grid convergence study of the most recent workshop with previous workshops.

  18. Bioadsorción de Cromo (VI en Solución Acuosa por la Biomasa Celular de Cryptococcus neoformans y Helminthosporium sp Biosorption of Chromium (VI from Aqueous Solutions by Fungal Biomass of Cryptococcus neoformans and Helminthosporium sp

    Directory of Open Access Journals (Sweden)

    I. Acosta

    2005-01-01

    Full Text Available Se determinó la bioadsorción de Cromo (VI en solución por la biomasa celular de la levadura capsulada Cryptococcus neoformans y del hongo micelial Helminthosporium sp, por el método colorimétrico de la difenilcarbazida. La biomasa de C. neoformans fue más eficiente en la remoción de Cromo (VI en solución (98% que la de Helminthosporium sp (65%. La mayor bioadsorción para C. neoformans fue a pH=2.0 +/- 0.2, mientras que para Helminthosporium sp fue a pH=4.0 +/- 0.2, ambas a 28oC durante 24 horas con 0.2 mg/L de biomasa celular. Se concluye que las biomasas fúngicas remueven eficientemente Cromo (VI en solución y pueden utilizarse para descontaminar nichos acuáticos contaminados con este metal.A determination was made on the biosorption of dissolved Chromium (VI using cellular biomass of the encapsulated yeast Cryptococcus neoformans and the mycelial fungus Helminthosporium sp. using a diphenylcarbazide colorimetric method. The C. neoformans biomass was more efficient in removing Chromium (VI from solution (98% than the Helminthosporium sp. (65%. The highest biosorption for C. neoformans was at pH 2.0 + 0.02, while for Helminthosporium sp this occurred at pH 4.0 + 0.2 , both at 28°C for 24 h employing 0.2 mg/L of cellular biomass. It is concluded that the fungal biomasses efficiently removed Chromium (VI from solution and could be used for decontamination of aquatic habitats polluted with this metal.

  19. Aprovechamiento de Biomasa Peletizada en el Sector Ladrillero en Bogotá-Colombia: Análisis Energético y Ambiental Use of Pelleted Biomass in the Brick Industry in Bogota-Colombia: Energy and Environmental Analysis

    Directory of Open Access Journals (Sweden)

    César A García-Ubaque

    2013-01-01

    Full Text Available En este estudio se compara el desempeño energético y ambiental del uso de combustibles a partir de dos tipos de biomasas peletizadas: residuos de madera, provenientes de podas y residuos de la producción de muebles, principalmente aserrín. La biomasa proveniente de residuos de madera es uno de los materiales más adecuados para utilizar como combustible alternativo. El sector ladrillero tiene una gran demanda energética para sus procesos de secado y cocción y el uso de combustibles alternativos a partir de biomasa permite obtener reducciones importantes en emisiones atmosféricas y no afecta las condiciones técnicas del proceso de producción de ladrillos. La biomasa con mejor desempeño, tanto en las variables energéticas como ambientales evaluadas, fue el aserrín.This study compared the energy and environmental performance of fuels from two types of pelleted biomass: wood waste from pruning and waste from furniture production, mainly sawdust. Wood residues biomass is one of the most suitable materials for using as an alternative fuel. The brick manufacture sector has a high energy demand for its drying and firing processes and the use of alternative fuels from biomass allows significant reductions in emissions and does not affect the technical conditions of the process of brick production. The biomass with better performance was sawdust, which presented the optimum energy and environmental variables.

  20. The role of CFD computer analyses in hydrogen safety management

    Energy Technology Data Exchange (ETDEWEB)

    Komen, Ed M.J.; Visser, Dirk C.; Roelofs, Ferry [Nuclear Research and Consultancy Group (NRG), Petten (Netherlands); Te Lintelo, Jos G.T. [N.V. Elekticiteits-Productiemaatschappij Zuid-Nederland EPZ, Borssele (Netherlands)

    2015-11-15

    The risks of hydrogen release and combustion during a severe accident in a light water reactor have attracted considerable attention after the Fukushima accident in Japan. Reliable computer analyses are needed for the optimal design of hydrogen mitigation systems. In the last decade, significant progress has been made in the development, validation, and application of more detailed, three-dimensional Computational Fluid Dynamics (CFD) simulations for hydrogen safety analyses. The validation status and reliability of CFD code simulations will be illustrated by validation analyses performed for experiments executed in the PANDA, THAI, and ENACCEF facilities.

  1. Performance Study and CFD Predictions of a Ducted Fan System

    Science.gov (United States)

    Abrego, Anita I.; Chang, I-Chung; Bulaga, Robert W.; Rutkowski, Michael (Technical Monitor)

    2002-01-01

    An experimental investigation was completed in the NASA Ames 7 by 10-Foot Wind Tunnel to study the performance characteristics of a ducted fan. The goal of this effort is to study the effect of ducted fan geometry and utilize Computational Fluid Dynamics (CFD) analysis to provide a baseline for correlation. A 38-inch diameter, 10-inch chord duct with a five-bladed fixed-pitch fan was tested. Duct performance data were obtained in hover, vertical climb, and forward flight test conditions. This paper will present a description of the test, duct performance results and correlation with CFD predictions.

  2. Experimental and CFD analysis of nozzle position of subsonic ejector

    Institute of Scientific and Technical Information of China (English)

    Xilai ZHANG; Shiping JIN; Suyi HUANG; Guoqing TIAN

    2009-01-01

    The influence of nozzle position on the performance of an ejector was analyzed qualitatively with free jet flow model. Experimental investigations and computational fluid dynamics (CFD) analysis of the nozzle position of the subsonic ejector were also conducted. The results show that there is an optimum nozzle position for the ejector. The ejecting coefficient reaches its maximum when the nozzle is positioned at the optimum and decreases when deviating. Moreover, the nozzle position of an ejector is not a fixed value, but is influenced greatly by the flow parameters. Considering the complexity of the ejector, CFD is reckoned as a useful tool in the design of ejectors.

  3. Rapid Euler CFD for High-Performance Aircraft Design

    Science.gov (United States)

    Charlton, Eric F.

    2004-01-01

    The goal here was to present one approach to rapid CFD for S&C using an unstructured inviscid method, in order to eventually assess S&C properties as early in the design process as possible. Specific results are presented regarding time, accuracy (as compared to a baseline wind tunnel database) and simplicity for the user. For COMSAC, it s more important to talk about the "specifications" required by Advanced Design and S&C, as well as how the CFD results can be combined for envelope evaluation.

  4. NASA and CFD - Making investments for the future

    Science.gov (United States)

    Hessenius, Kristin A.; Richardson, P. F.

    1992-01-01

    From a NASA perspective, CFD is a new tool for fluid flow simulation and prediction with virtually none of the inherent limitations of other ground-based simulation techniques. A primary goal of NASA's CFD research program is to develop efficient and accurate computational techniques for utilization in the design and analysis of aerospace vehicles. The program in algorithm development has systematically progressed through the hierarchy of engineering simplifications of the Navier-Stokes equations, starting with the inviscid formulations such as transonic small disturbance, full potential, and Euler.

  5. Fifty years of CFD for room air distribution

    DEFF Research Database (Denmark)

    Nielsen, Peter Vilhelm

    2015-01-01

    Computational fluid dynamics (CFD) was first introduced in the ventilation industry in the 1970s. CFD has been increasingly used since then, as testified by the number of peer-reviewed articles, which was less than 10 per year in the 1990s, and which is now 60 to 70 per year. This article discusses......, and to addressing situations with more steady-state solutions. The article finishes with a number of different case studies such as design of air supply openings, smoke management in buildings, cross-infection risks from the exhalation of particles and calculation of people moving in a room. The use of benchmark...

  6. Three-dimensional flow calculations of axial compressors and turbines using CFD techniques.

    OpenAIRE

    Jesuino Takachi Tomita

    2009-01-01

    With the advent of powerful computer hardware, Computational Fluid Dynamics (CFD) has been vastly used by researches and scientists to investigate flow behavior and its properties. The cost of CFD simulation is very small compared to the experimental arsenal as test facilities and wind-tunnels. In the last years many CFD commercial packages were developed and some of them possess prominence in industry and academia. However, some specific CFD calculations are particular cases and sometimes ne...

  7. Cambios en el porcentaje de sodio intercambiable (PSI y la relación de absorción de sodio (RAS de un suelo y su influencia en la actividad y biomasa microbiana

    Directory of Open Access Journals (Sweden)

    Torrente Trujillo Armando

    2011-03-01

    Full Text Available

    Con el objetivo de evaluar los cambios en el PSI, la RAS y su influencia en la actividad y  biomasa  microbiana  del suelo,  se aplicaron  diversas  concentraciones  de vinaza  como enmienda procedente de la industria de alcohol carburante, sobre un suelo afectado por sodicidad con severas limitaciones en las condiciones físicas, químicas y biológicas. Se aplicó un diseño en bloques completos al azar que incluye cuatro tratamientos y tres repeticiones, y muestreos de suelo al inicio y final del proceso a tres profundidades (0-20, 20-40 y 40-60 cm, cuyas variables de respuesta a medir fueron  la respiración, C- biomasa microbiana, MO%, pH, CIC, CE, RAS y PSI. La actividad biológica (CO2 y el C-biomasa microbiana mostraron

    incrementos significativos en el rango ideal para el establecimento del cultivo de caña.

  8. Cambios en el porcentaje de sodio intercambiable (PSI y la relación de absorción de sodio (RAS de un suelo y su influencia en la actividad y biomasa microbiana

    Directory of Open Access Journals (Sweden)

    Cesar A Gasca

    2011-01-01

    Full Text Available Con el objetivo de evaluar los cambios en el PSI, la RAS y su influencia en la actividad y biomasa microbiana del suelo, se aplicaron diversas concentraciones de vinaza como enmienda procedente de la industria de alcohol carburante, sobre un suelo afectado por sodicidad con severas limitaciones en las condiciones físicas, químicas y biológicas. Se aplicó un diseño en bloques completos al azar que incluye cuatro tratamientos y tres repeticiones, y muestreos de suelo al inicio y final del proceso a tres profundidades (0-20, 20-40 y 40-60 cm, cuyas variables de respuesta a medir fueron la respiración, C- biomasa microbiana, MO%, pH, CIC, CE, RAS y PSI. La actividad biológica (CO2 y el C-biomasa microbiana mostraron incrementos significativos en el rango ideal para el establecimento del cultivo de caña.

  9. Equation for estimating tree biomass in tropical forests of Costa Rica Ecuación para estimar la biomasa arbórea en los bosques tropicales de Costa Rica

    Directory of Open Access Journals (Sweden)

    Shu Wei-Chou

    2013-06-01

    methodological approach to estimate forest biomass, which is very useful to support decision-making on carbon storage in tropical forests. Biomass determination in the field in future plots is going to help the calibration of this approach to estimate biomass stored in tropical forests.Una de las medidas más relevantes para la mitigación del cambio climático es la conservación y regeneración del bosque en nuestros países.  La cantidad de carbono que se almacena en la biomasa arbórea pasa a ser una medida relevante para la política pública. El presente trabajo analiza la asociación que tienen algunas variables dasométricas, fácilmente medibles, asociadas a la biomasa, con el propósito de estimarla indirectamente, dado que la medición directa de la biomasa arbórea es un trabajo complejo y tiene un costo muy elevado.  El objetivo general del estudio fue hacer un análisis del comportamiento de las variables dasométricas fácilmente medibles para predecir biomasa arbórea con datos de dos bosques tropicales de Costa Rica, con el propósito de analizar su posible aplicación generalizada en los bosques tropicales de todo el país. Mediante una revisión bibliográfica, se determinaron cuatro posibles modelos que estiman biomasa en bosques tropicales. Se evaluaron 907 árboles con diámetro a la altura de pecho (dap mayor a 10 cm en dos bosques tropicales de Costa Rica (Parque Nacional Corcovado en el suroeste y Fila Carbón en el sureste, vertiente del Caribe, generando una estimación de biomasa lo más precisa posible. Se realizó un análisis de las variables de los árboles (densidad específica de la madera, altura total y dap y su biomasa, con el fin de desarrollar el modelo que facilitara la predicción de esta. El modelo final utiliza como variables independientes el dap y la densidad.  Con el dap se da el hecho de que existe una alta correlación con la altura total, la cual es muy difícil de obtener en el campo, de modo que se decidió no utilizarla. La

  10. Efecto de fertilización nitrogenada en la producción de biomasa y calidad de aceite esencial en Lippia alba (Miller, Pronto alivio.

    Directory of Open Access Journals (Sweden)

    Sánchez O. M.

    2004-04-01

    Full Text Available En el Campo Experimental de la Universidad Nacional de Colombia sede Palmira (CEUNP se realizó un ensayo para evaluar el efecto de la fertilización nitrogenada, aplicando dos fuentes (gallinaza y urea en dos niveles (50 y 100 kg/ha de nitrógeno y dos frecuencias de corte (dos y cuatro meses. En el lote experimental se situaron 15 parcelas, en un diseño de bloques completos al azar, con cinco tratamientos y tres repeticiones. Para el análisis de la información se utilizó el programa estadístico SAS. El máximo rendimiento de biomasa y aceites esenciales se obtuvo con la aplicación de 100 kg/ha de nitrógeno en forma de urea y la frecuencia de corte cada dos meses. Los niveles de extracción de Lippia alba en nitrógeno variaron entre 79.7 y 128.5; fósforo entre 24.5 y 30.5; potasio entre 114.6 y 138.8 y calcio entre 100 y 150 kg/ha. El aceite esencial estuvo compuesto mayoritariamente por carvona y limoneno. Palabras claves: Fertilización nitrogenada, Lippia alba, Rendimientos biomasa, aceites esenciales, pronto alivio. ABSTRACT Nitrogenous fertilization effects in the Lippia alba production and quality. In the Experimental Center of the National University of Colombia-Palmira (CEUNP a experiment was realized to evaluate the effect of the nitrogenous fertilization, using two sources (gallinaza and urea at two levels (50 and 100 kg/ha of nitrogen and two cutting frequencies (each two and four months. In the experimental area 15 plots were planted, in a randomized Complete Blocks design random (RCBD with five treatments and three repetitions to measure the following variables: production of fresh matter, content of dry matter, nutrients extraction and content of essential oils. The analysis of variance used the statistical program SAS. The maximum yield of biomass and essential was obtained oils combining the fertilization with 100 kg/ha of nitrogen as urea and the cutting frequency every of two months. The levels of nutrients

  11. Efecto de la concentración de linóculo y la melaza como suplemento de la vinaza de destilería para la producción de biomasa de Candida utilis nativa

    Directory of Open Access Journals (Sweden)

    Lady Cajo

    2011-01-01

    Full Text Available La vinaza es un residuo de las destilerías de alcohol, rico en materia orgánica y sales minerales, cuyo aprovechamiento está limitado y finalmente es vertido al alcantarillado, ocasionando contaminación, no obstante, puede constituir un sustrato par a la producción de biomasa de levaduras, utilizadas en la alimentación animal. En la presente investigación se determinó el efecto de la concentración del inóculo y la melaza como suplemento de la vinaza, para la producción de biomasa de Candida utilis nativa. Las levaduras se aislaron de panca de Zea mays L. “maíz” en agar Sabouraud glucosado, identificando el 40.23 % como C. utilis. Luego, se cultivaron en vinaza con 30 g/L de melaza, a 28 ºC, durante 24 horas, se pesó la biomasa y se seleccionó C. utilis MKJ12, debido a que alcanzó el mayor valor de 7.667 g/L. Esta levadura en concentraciones de 25, 50 y 75 mL/L de inóculo se cultivó en biorreactores tipo tanque, en lote discontinuo, conteniendo 300 mL de vinaza con 10, 30, y 50 g/L de melaza, con flujo de aire descendente (1vvm, y una incubación a 28 ºC, durante 20 horas. Con 50 mL/L de inóculo y 50 g/L de melaza se determinó el menor tiempo de generación (2.88 h y los mayores valores en el número de generaciones (6.95, tasa específica de crecimien to (0.35 h - 1 , peso de biomasa (11.78 g/L y proteína (40.15 %. Se demostró la factibilidad de la producción de biomasa de C. utilis con 5 mL/L de inóculo en vinaza suplementada con melaza.

  12. Planeamento de uma estrada utilizando CCS Candy - Caso de estudo

    OpenAIRE

    Oliveira, Sara Maria de

    2013-01-01

    O tema desta dissertação foi escolhido tendo em consideração a crescente necessidade de planeamento de empreitadas de construção de estradas, sendo um dos objetivos desta dissertação o de oferecer uma visão global do processo de planeamento da construção de uma estrada, focado apenas no fator tempo, recorrendo a ferramentas informáticas e utilizando um caso de estudo de uma estrada real e já construída. Inicialmente, faz-se uma breve descrição dos métodos de planeamento mais aplicados em p...

  13. REFRIGERAÇÃO UTILIZANDO PASTILHAS DE EFEITO PELTIER

    Directory of Open Access Journals (Sweden)

    Antonio Luiz P. S. Campos

    2010-06-01

    Full Text Available Pastilhas de Peltier são dispositivos baseados no efeito Peltier e são aplicadas para produzir efeito refrigerador ou aquecedor. Este trabalho aborda conceitos envolvidos na fabricação e funcionamento desses dispositivos tais como: histórico do efeito Peltier e desenvolvimento de placas de efeito Peltier. É feito um estudo de eficiência da refrigeração de água utilizando uma placa de efeito Peltier existente no Campus Natal – Zona Norte. Para isso, é implementada uma estrutura de refrigeração de água e são feitas medições para determinar a eficiência de sistema. Por fim, são apresentadas conclusões sobre o estudo desenvolvido.

  14. CFD evaluation of an advanced thrust vector control concept

    Science.gov (United States)

    Tiarn, Weihnurng; Cavalleri, Robert

    1990-01-01

    A potential concept that can offer an alternate method for thrust vector control of the Space Shuttle Solid Rocket Booster is the use of a cylindrical probe that is inserted (on demand) through the wall of the rocket nozzle. This Probe Thrust Vector Control (PTVC) concept is an alternate to that of a gimbaled nozzle or a Liquid Injection Thrust Vector (LITVC) system. The viability of the PTVC concept can be assessed either experimentally and/or with the use of CFD. A purely experimental assessment can be time consuming and expensive, whereas a CFD assessment can be very time- and cost-effective. Two key requirements of the proposed concept are PTVC vectoring performance and the active cooling requirements for the probe to maintain its thermal and structural integrity. An active thermal cooling method is the injection of coolant around the pheriphery of the probe. How much coolant is required and how this coolant distributes itself in the flow field is of major concern. The objective of the work reported here is the use of CFD to answer these question and in the design of test hardware to substantiate the results of the CFD predictions.

  15. Introducing CFD in Introductory Undergraduate Fluid Mechanics Courses

    Science.gov (United States)

    Cimbala, John M.

    2005-11-01

    Many instructors want to introduce CFD into their introductory junior-level fluid mechanics course, but cannot because it requires several hours of class time at the cost of displacement of other basic material. A simple but effective method is now available that has been used successfully at Penn State since Spring 2005. It requires minimal instructor preparation time and only about one class period. Namely, immediately after solving the Navier-Stokes equation analytically for simple flows such as Couette and Poiseuille flow, CFD is introduced as a modern tool for solving the same equations numerically. The application of CFD (grid generation, boundary conditions, etc.), rather than numerical algorithms, is stressed. Homework problems are then assigned using pre-defined templates for FlowLab, a student-friendly analysis and visualization package created by Fluent, Inc. The templates and exercises are designed to support and emphasize the theory and concepts taught in class and in the textbook. For example, the new textbook by Cengel and Cimbala (McGraw-Hill 2006) contains 46 end-of-chapter homework problems that are used in conjunction with 42 FlowLab templates. Each exercise has been designed with two major learning objectives in mind: (1) enhance student understanding of a specific fluid mechanics concept, and (2) introduce the student to a specific capability and/or limitation of CFD through hands-on practice.

  16. Computational Fluid Dynamics (CFD) Technology Programme 1995- 1999

    Energy Technology Data Exchange (ETDEWEB)

    Haekkinen, R.J.; Hirsch, C.; Krause, E.; Kytoemaa, H.K. [eds.

    1997-12-31

    The report is a mid-term evaluation of the Computational Fluid Dynamics (CFD) Technology Programme started by Technology Development Centre Finland (TEKES) in 1995 as a five-year initiative to be concluded in 1999. The main goal of the programme is to increase the know-how and application of CFD in Finnish industry, to coordinate and thus provide a better basis for co-operation between national CFD activities and encouraging research laboratories and industry to establish co-operation with the international CFD community. The projects of the programme focus on the following areas: (1) studies of modeling the physics and dynamics of the behaviour of fluid material, (2) expressing the physical models in a numerical mode and developing a computer codes, (3) evaluating and testing current physical models and developing new ones, (4) developing new numerical algorithms, solvers, and pre- and post-processing software, and (5) applying the new computational tools to problems relevant to their ultimate industrial use. The report consists of two sections. The first considers issues concerning the whole programme and the second reviews each project

  17. Reproducible and replicable CFD: it's harder than you think

    CERN Document Server

    Mesnard, Olivier

    2016-01-01

    Completing a full replication study of our previously published findings on bluff-body aerodynamics was harder than we thought. Despite the fact that we have good reproducible-research practices, sharing our code and data openly. Here's what we learned from three years, four CFD codes and hundreds of runs.

  18. Correlations between art and CFD through colour and shape

    Science.gov (United States)

    König, Carola S.

    2011-03-01

    Victorian stained glass artists were among the first to link vibrant colour with strong abstract geometry. This link was further exploited by artists of the early 20th century. Here may be mentioned the works of designers and artists like Mackintosh and of well-known Bauhaus group members like Klee and Kandinsky. Computational fluid dynamics (CFD) and art, particularly abstract art, are undoubtedly intrinsically linked not only by colour, but also by shape as often both contain regular geometries like rectangles and triangles. The use of colour has a multitude of functions in both the pre- and post-processing stages in CFD. These are discussed with an emphasis on the representation of CFD results. Moreover, modelling of fluid dynamics should be seen as but one example of numerical modelling in general. It may be that such common features between these very different metiers are the reason why the numerical modellers amongst us seem to have a natural liking for colourful abstract art. This paper investigates the correlations between art and CFD and is written from the view points of both the professional engineer and the hobby artist.

  19. CFD simulation of coal and straw co-firing

    DEFF Research Database (Denmark)

    Junker, Helle; Hvid, Søren L.; Larsen, Ejvind;

    This paper presents the results of a major R&D program with the objective to develop CFD based tools to assess the impact of biomass co-firing in suspension fired pulverized coal power plants. The models have been developed through a series of Danish research projects with the overall objective t...

  20. Multi-CFD Timing Estimators for PET Block Detectors

    Energy Technology Data Exchange (ETDEWEB)

    Ullisch, Marcus G.; Moses, William W.

    2006-05-05

    In a conventional PET system with block detectors, a timing estimator is created by generating the analog sum of the signals from the four photomultiplier tubes (PMT) in a module and discriminating the sum with a single constant fraction discriminator (CFD). The differences in the propagation time between the PMTs in the module can potentially degrade the timing resolution of the module. While this degradation is probably too small to affect performance in conventional PET imaging, it may impact the timing inaccuracy for time-of-flight PET systems (which have higher timing resolution requirements). Using a separate CFD for each PMT would allow for propagation time differences to be removed through calibration and correction in software. In this paper we investigate and quantify the timing resolution achievable when the signal from each of the 4 PMTs is digitized by a separate CFD. Several methods are explored for both obtaining values for the propagation time differences between the PMTs and combining the four arrival times to form a single timing estimator. We find that the propagation time correction factors are best derived through an exhaustive search, and that the ''weighted average'' method provides the best timing estimator. Using these methods, the timing resolution achieved with 4 CFDs (1052 {+-} 82 ps) is equivalent to the timing resolution with the conventional single CFD setup (1067 {+-} 158 ps).

  1. CFD modelling of moisture interactions between air and constructions

    DEFF Research Database (Denmark)

    Mortensen, Lone Hedegaard; Woloszyn, Monika; Hohota, Raluca;

    2005-01-01

    There is a strong demand for accurate moisture modelling since moisture poses a risk for both the constructions and the indoor climate. Thus, in this investigation there is special focus on moisture modelling. The paper describes a new model based on a CFD tool that is enhanced to include both de...

  2. A CFD code comparison of wind turbine wakes

    DEFF Research Database (Denmark)

    Laan, van der, Paul Maarten; Storey, R. C.; Sørensen, Niels N.;

    2014-01-01

    A comparison is made between the EllipSys3D and SnS CFD codes. Both codes are used to perform Large-Eddy Simulations (LES) of single wind turbine wakes, using the actuator disk method. The comparison shows that both LES models predict similar velocity deficits and stream-wise Reynolds...

  3. CFD Vision 2030 Study: A Path to Revolutionary Computational Aerosciences

    Science.gov (United States)

    Slotnick, Jeffrey; Khodadoust, Abdollah; Alonso, Juan; Darmofal, David; Gropp, William; Lurie, Elizabeth; Mavriplis, Dimitri

    2014-01-01

    This report documents the results of a study to address the long range, strategic planning required by NASA's Revolutionary Computational Aerosciences (RCA) program in the area of computational fluid dynamics (CFD), including future software and hardware requirements for High Performance Computing (HPC). Specifically, the "Vision 2030" CFD study is to provide a knowledge-based forecast of the future computational capabilities required for turbulent, transitional, and reacting flow simulations across a broad Mach number regime, and to lay the foundation for the development of a future framework and/or environment where physics-based, accurate predictions of complex turbulent flows, including flow separation, can be accomplished routinely and efficiently in cooperation with other physics-based simulations to enable multi-physics analysis and design. Specific technical requirements from the aerospace industrial and scientific communities were obtained to determine critical capability gaps, anticipated technical challenges, and impediments to achieving the target CFD capability in 2030. A preliminary development plan and roadmap were created to help focus investments in technology development to help achieve the CFD vision in 2030.

  4. Fully consistent CFD methods for incompressible flow computations

    DEFF Research Database (Denmark)

    Kolmogorov, Dmitry; Shen, Wen Zhong; Sørensen, Niels N.;

    2014-01-01

    Nowadays collocated grid based CFD methods are one of the most e_cient tools for computations of the ows past wind turbines. To ensure the robustness of the methods they require special attention to the well-known problem of pressure-velocity coupling. Many commercial codes to ensure the pressure...

  5. CFD code comparison for 2D airfoil flows

    DEFF Research Database (Denmark)

    Sørensen, Niels N.; Méndez, B.; Muñoz, A.;

    2016-01-01

    The current paper presents the effort, in the EU AVATAR project, to establish the necessary requirements to obtain consistent lift over drag ratios among seven CFD codes. The flow around a 2D airfoil case is studied, for both transitional and fully turbulent conditions at Reynolds numbers of 3 × ...

  6. Efficient Cfd/csd Coupling Methods for Aeroelastic Applications

    Science.gov (United States)

    Chen, Long; Xu, Tianhao; Xie, Jing

    2016-06-01

    A fast aeroelastic numerical simulation method using CFD/CSD coupling are developed. Generally, aeroelastic numerical simulation costs much time and significant hardware resources with CFD/CSD coupling. In this paper, dynamic grid method, full implicit scheme, parallel technology and improved coupling method are researched for efficiency simulation. An improved Delaunay graph mapping method is proposed for efficient dynamic grid deform. Hybrid grid finite volume method is used to solve unsteady flow fields. The dual time stepping method based on parallel implicit scheme is used in temporal discretization for efficiency simulation. An approximate system of linear equations is solved by the GMRES algorithm with a LU-SGS preconditioner. This method leads to a significant increase in performance over the explicit and LU-SGS implicit methods. A modification of LU-SGS is proposed to improve the parallel performance. Parallel computing overs a very effective way to improve our productivity in doing CFD/CFD coupling analysis. Improved loose coupling method is an efficiency way over the loose coupling method and tight coupling method. 3D wing's aeroelastic phenomenon is simulated by solving Reynolds-averaged Navier-Stokes equations using improved loose coupling method. The flutter boundary is calculated and agrees well with experimental data. The transonic hole is very clear in numerical simulation results.

  7. CFD Simulations of Contaminant Transport between two Breathing Persons

    DEFF Research Database (Denmark)

    Bjørn, Erik; Nielsen, Peter V.

    Experiments have shown that exhalation from one person is able to penetrate the breathing zone of another person at a distance. Computational Fluid Dynamics (CFD) is used to investigate the dependency of the personal exposure on some physical parameters, namely: Pulmonary ventilation rate...

  8. CFD analysis of a diaphragm free-piston Stirling cryocooler

    Science.gov (United States)

    Caughley, Alan; Sellier, Mathieu; Gschwendtner, Michael; Tucker, Alan

    2016-10-01

    This paper presents a Computational Fluid Dynamics (CFD) analysis of a novel free-piston Stirling cryocooler that uses a pair of metal diaphragms to seal and suspend the displacer. The diaphragms allow the displacer to move without rubbing or moving seals. When coupled to a metal diaphragm pressure wave generator, the system produces a complete Stirling cryocooler with no rubbing parts in the working gas space. Initial modelling of this concept using the Sage modelling tool indicated the potential for a useful cryocooler. A proof-of-concept prototype was constructed and achieved cryogenic temperatures. A second prototype was designed and constructed using the experience gained from the first. The prototype produced 29 W of cooling at 77 K and reached a no-load temperature of 56 K. The diaphragm's large diameter and short stroke produces a significant radial component to the oscillating flow fields inside the cryocooler which were not modelled in the one-dimensional analysis tool Sage that was used to design the prototypes. Compared with standard pistons, the diaphragm geometry increases the gas-to-wall heat transfer due to the higher velocities and smaller hydraulic diameters. A Computational Fluid Dynamics (CFD) model of the cryocooler was constructed to understand the underlying fluid-dynamics and heat transfer mechanisms with the aim of further improving performance. The CFD modelling of the heat transfer in the radial flow fields created by the diaphragms shows the possibility of utilizing the flat geometry for heat transfer, reducing the need for, and the size of, expensive heat exchangers. This paper presents details of a CFD analysis used to model the flow and gas-to-wall heat transfer inside the second prototype cryocooler, including experimental validation of the CFD to produce a robust analysis.

  9. Secuestro de carbono en la biomasa aérea de un sistema agrosilvopastoril de Cocos nucifera, Leucaena leucocephala Var. Cunningham y Pennisetum purpureum Cuba CT-115

    Directory of Open Access Journals (Sweden)

    J. M. Anguiano

    2013-01-01

    Full Text Available Con el objetivo de estimar el secuestro de carbono en la biomasa aérea de un sistema agrosilvopastoril (sasp compuesto por cocotero (Cocos nucifera, Leucaena leucocephala Var. Cunningham sembrada en alta densidad y Pennisetum purpureum Cuba CT-115, se llevó a cabo un estudio en un suelo con textura franco arcillo- arenosa. Se utilizó un diseño en bloques al azar con arreglo en parcelas divididas con cuatro tratamientos 0, 40, 60 y 80 mil árboles de leucaena ha-1 y tres repeticiones; la evaluación duró desde su establecimiento hasta 340 días de edad. Los resultados muestran diferencia estadística (P<0.001 en el secuestro de carbono con 101.19d, 109.73c, 122.00b y 128.62a t C+ha-1año-1 para los sasp de 0, 40, 60 y 80 mil plantas de leucaena ha-1, respectivamente. El mayor aporte de secuestro de carbono lo realizó el cocotero que aportó del 60 al 80% del total del sasp y existió una relación inversa de secuestro de carbono de la gramínea al incrementar la densidad de la leguminosa. El tratamiento que incorpora la siembra en alta densidad de la leguminosa arbórea logró un mayor secuestro de carbono.

  10. LA BIOMASA COMO ALTERNATIVA AL PETRÓLEO PARA LA OBTENCIÓN DE PRODUCTOS QUÍMICOS: ACETONA Y ETANOL COMO MOLÉCULAS PLATAFORMA

    Directory of Open Access Journals (Sweden)

    Jorge Quesada

    2014-01-01

    Full Text Available En este trabajo se pretende reflejar el potencial de la biomasa como materia prima para la obtención de productos químicos de elevado valor añadido, integrando su viabilidad económica y técnica dentro del concepto de biorefinería. Considerando el gran número de trabajos existentes acerca de la obtención de biocombustibles, se hace hincapié en el aprovechamiento de los subproductos de estos procesos, abordando la transformación de dos de las moléculas plataforma de mayor proyección: el etanol y la acetona. Si bien gran parte de los procesos químicos que se exponen no son novedosos, la necesidad de sustituir el petróleo por una materia prima renovable ha impulsado de nuevo su estudio y la optimización de los parámetros que actualmente limitan su implantación en la industria, desarrollando nuevos catalizadores y estudiando la influencia de diferentes condiciones de reacción.

  11. Abundancia y biomasa de macroinvertebrados edáficos en la temporada lluviosa, en tres usos de la tierra, en los Andes colombianos

    Directory of Open Access Journals (Sweden)

    Pardo Luis C

    2006-03-01

    Full Text Available COMPENDIO los usos evaluados fueron pastizal, cafetal y bosque secundario (Vereda Villa del Rosario, Aprox. 3º 33' 16â€? Latitud Norte y 76º 36' 01â€? Longitud Oeste, altitud 1.500 a 1.820m., precipitación 960 a 1.050 mm/año, 19.8 a 21.2º C con la metodología TSBF. Se implementaron tres monolitos por uso y cada uno se subdividió en cuatro estratos (hojarasca, 0-10 cm, 10-20 cm, y 20-30 cm, las variables densidad y biomasa por parcela y estrato se examinaron a través de ANOVAS y Post-Anovas. En abundancia la supremacía fue de hormigas (25584 ejemplares, miriápodos (4808 ejemplares y lombrices (1984 ejemplares, la diferencia significativa la marcaron los miriápodos (F=4.84, P=0.014 asociados con bosque y cafetal con sombrío. En biomasa los grupos más importantes fueron miriápodos (701.05 g m-2, 58.71%, lombrices (90.64 g m-2; 7.59%, chisas (27.07 g m-2; 2.26% hor­migas (20.90 g m-2; 1.75% y arañas (15.71 g m-2 ; 1.31%, con diferencias significativas en hormigas (F=4.17, P=0.024 y arañas (F=3.43, P=0.4024; También hubo diferencias estadísticas significativas en la densidad y biomasa de macroinvertebrados y los estratos de los monolitos, los resultados indican que estos organismos expresan en su población y biomasa respuestas ambientales asociadas más con la estructura del agroecosistema que con la variación química, física o microbiológica del hábitat; se recomienda discriminar taxonómicamente los grupos funcionales y ampliar los muestreos a la temporada seca. Palabras clave: uso del suelo, macroinvertebrados edáficos, densidad, abundancia, agroecosistemas, Andes colombianos. ABSTRACT Abundance and biomass of soil macroinvertabrates during the rainy season in three land use systems in the Colombian Andes. Using the TSBF methodology, three land use systems—pastures, coffee plantation, and secondary forest— were evaluated in the rural community of Villa del Rosario, located in the

  12. EFECTO DEL ÁCIDO SALICÍLICO EN EL CRECIMIENTO DE LA RAÍZ Y BIOMASA TOTAL DE PLÁNTULAS DE TRIGO

    Directory of Open Access Journals (Sweden)

    Cesar J. Tucuch Haas

    2015-03-01

    Full Text Available Se reportan los resultados de dos experimentos independientes para evaluar el efecto del ácido salicílico (AS en plántulas de trigo (Triticum aestivum L.. Las plántulas de ambos experimentos se germinaron y crecieron en agrolita contenida en tubos de PVC y en condiciones de cielo abierto bajo un diseño experimental completamente al azar con 8 repeticiones por tratamiento, las plántulas se asperjaron durante 5 días con 1 y 0.1 µM de AS o agua como control. Diez días después fueron cosechadas y realizadas las mediciones. Los resultados señalan que el AS favoreció significativamente el peso fresco de la raíz, así como la altura y el peso fresco de la biomasa total, en comparación con el control. El mejor tratamiento para estimular el crecimiento de plántulas de trigo fue el de 1µM de AS.

  13. Diesel engine injection simulation using the CFD software Fluent; Einspritzungssimulationen von Dieselmotoren mit der CFD-Software Fluent

    Energy Technology Data Exchange (ETDEWEB)

    Braun, M.; Wachter, E.M. [Fluent Deutschland GmbH, Darmstadt (Germany); Boemer, A. [DEUTZ AG, Koeln (Germany); Waidmann, W. [Fachhochschule Aalen (Germany)

    2007-07-01

    The commercial CFD Software FLUENT offers a variety of models and sub-models to simulate and predict the spray injection usually applied in IC-Engines. The following article provides an overview of FLUENT spray and particle flow modeling, and a validation case for high-pressure diesel spray. (orig.)

  14. Thermal hydraulic simulations, error estimation and parameter sensitivity studies in Drekar::CFD

    Energy Technology Data Exchange (ETDEWEB)

    Smith, Thomas Michael; Shadid, John N; Pawlowski, Roger P; Cyr, Eric C; Wildey, Timothy Michael

    2014-01-01

    This report describes work directed towards completion of the Thermal Hydraulics Methods (THM) CFD Level 3 Milestone THM.CFD.P7.05 for the Consortium for Advanced Simulation of Light Water Reactors (CASL) Nuclear Hub effort. The focus of this milestone was to demonstrate the thermal hydraulics and adjoint based error estimation and parameter sensitivity capabilities in the CFD code called Drekar::CFD. This milestone builds upon the capabilities demonstrated in three earlier milestones; THM.CFD.P4.02 [12], completed March, 31, 2012, THM.CFD.P5.01 [15] completed June 30, 2012 and THM.CFD.P5.01 [11] completed on October 31, 2012.

  15. Estudi amb CFD d'un ventilador radial

    OpenAIRE

    Cusac Carreras, Aïda

    2014-01-01

    Diferents anàlisis amb CFD (Dinàmica de fluids computacional) s’han realitzat per tal d’estudiar la interacció entre el rotor i l’estator d’una bomba centrífuga. Les diferents simulacions numèriques s’han portat a terme amb el programa de CFD Ansys Fluent. La bomba centrífuga es basa en el cas de la bomba centrífuga que va presentar Combès en un dels seminaris de l’ERCOFTAC (European Research Community On Flow Turbulence and Combustion) l’any 1999 a Aussois [1]. Les dimensions i caracterís...

  16. CFD Simulations of Joint Urban Atmospheric Dispersion Field Study

    Energy Technology Data Exchange (ETDEWEB)

    Lee, R; Humphreys III, T; Chan, S

    2004-06-17

    The application of Computational Fluid Dynamics (CFD) to the understanding of urban wind flow and dispersion processes has gained increasing attention over recent years. While many of the simpler dispersion models are based on a set of prescribed meteorology to calculate dispersion, the CFD approach has the ability of coupling the wind field to dispersion processes. This has distinct advantages when very detailed results are required, such as for the case where the releases occur around buildings and within urban areas. CFD also has great flexibility as a testbed for turbulence models, which has important implications for atmospheric dispersion problems. In the spring of 2003, a series of dispersion field experiments (Joint Urban 2003) were conducted at Oklahoma City (Allwine, et. al, 2004). These experiments were complimentary to the URBAN 2000 field studies at Salt Lake City (Shinn, et. al, 2000) in that they will provide a second set of comprehensive field data for evaluation of CFD as well as for other dispersion models. In contrast to the URBAN 2000 experiments that were conducted entirely at night, these new field studies took place during both daytime and nighttime thus including the possibility of convective as well as stable atmospheric conditions. Initially several CFD modeling studies were performed to provide guidance for the experimental team in the selection of release sites and in the deployment of wind and concentration sensors. Also, while meteorological and concentration measurements were taken over the greater Oklahoma City urban area, our CFD calculations were focused on the near field of the release point. The proximity of the source to a large commercial building and to the neighboring buildings several of which have multistories, present a significant challenge even for CFD calculations involving grid resolutions as fine as 1 meter. A total of 10 Intensive Observations Periods (IOP's) were conducted within the 2003 field experiments. SF6

  17. CFD Application in Implantable Rotary Blood Pump Design and Validation

    Institute of Scientific and Technical Information of China (English)

    YI Qian

    2004-01-01

    Implantable rotary blood pump (IRBP) has been promoted to the stage of clinical trial. This paper introduces a unique IRBP without a shaft. Instead of using thrombogenic pivots or power-drawing magnetic suspension, impeller is supported hydrodynamically when rotating, by lubrication flows in the thin spaces between itself and the pump body. To this end, the flow is very difficult to be measured using usual laboratory equipments. Therefore, computational fluid dynamics (CFD) has been applied as an important tool in the IRBP design and its validation procedure. Several CFD results such as pump performance improvement, unsteady hydraulic dynamic analysis, biocapability prediction, validation and verification (V&V), and flow visualization have been performed.

  18. CFD Application in Implantable Rotary Blood Pump Design and Validation

    Institute of Scientific and Technical Information of China (English)

    YIQian

    2004-01-01

    Implantable rotary blood pump (IRBP) has been promoted to the stage of clinical trial. This paper introduces a unique IRBP without a.shaft. Instead of using thrombogenic pivots or power-drawing magnetic suspension, impeller is supported hydrodynamically when rotating, by lubrication flows in the thin spaces between itself and the pump body. To this end, the flow is very difficult to be measured using usual laboratory equipments. Therefore, computational fluid dynamics (CFD) has been applied as an important tool in the IRBP design and its validation procedure. Several CFD results such as pump performance improvement, unsteady hydraulic dynamic analysis, biocapability prediction, validation and verification (V&V), and flow visualization have been performed.

  19. Moisture content evaluation of biomass using CFD approach

    Directory of Open Access Journals (Sweden)

    Thomas Bartzanas

    2012-10-01

    Full Text Available In grass conservation systems, drying in the field is an essential process upon which the quality and quantity of the material to be conserved is dependent on. In this study a Computational Fluid Dynamics (CFD model, previously validated, was used to assess qualitatively and quantitatively the field drying process of cut grass under different weather conditions and structural specifications of the grass. The use of the CFD model depicts the climate heterogeneity in the grass area with a special focus on moisture distribution, influence of the weather conditions, in order to create the possibility of applying the model as a decision support tool for an enhanced treatment of the grass after cutting.

  20. Experimental and CFD investigation of gas phase freeboard combustion

    DEFF Research Database (Denmark)

    Andersen, Jimmy

    treatment. The aim of this project is to provide validation data for Computational Fluid Dynamic (CFD) models relevant for grate firing combustion conditions. CFD modeling is a mathematical tool capable of predicting fluid flow, mixing and chemical reaction with thermal conversion and transport. Prediction......, but under well-defined conditions. Comprehensive experimental data for velocity field, temperatures, and gas composition are obtained from a 50 kW axisymmetric non-swirling natural gas fired combustion setup under two different settings. Ammonia is added to the combustion setup in order to simulate fuel...... of pollutant formation, which occurs in small concentrations with little impact on the general combustion process is in this work predicted by a post-processing step, making it less computationally expensive. A reactor was constructed to simulate the conditions in the freeboard of a grate fired boiler...

  1. Gasification CFD Modeling for Advanced Power Plant Simulations

    Energy Technology Data Exchange (ETDEWEB)

    Zitney, S.E.; Guenther, C.P.

    2005-09-01

    In this paper we have described recent progress on developing CFD models for two commercial-scale gasifiers, including a two-stage, coal slurry-fed, oxygen-blown, pressurized, entrained-flow gasifier and a scaled-up design of the PSDF transport gasifier. Also highlighted was NETL’s Advanced Process Engineering Co-Simulator for coupling high-fidelity equipment models with process simulation for the design, analysis, and optimization of advanced power plants. Using APECS, we have coupled the entrained-flow gasifier CFD model into a coal-fired, gasification-based FutureGen power and hydrogen production plant. The results for the FutureGen co-simulation illustrate how the APECS technology can help engineers better understand and optimize gasifier fluid dynamics and related phenomena that impact overall power plant performance.

  2. Modeling and verification of hemispherical solar still using ANSYS CFD

    Energy Technology Data Exchange (ETDEWEB)

    Panchal, Hitesh N. [KSV University, Gujarat Power Engineering and Research Institute, Mehsana (India); Shah, P.K. [Silver Oak College of Engineering and Technology, Ahmedabad, Gujarat (India)

    2013-07-01

    In every efficient solar still design, water temperature, vapor temperature and distillate output, and difference between water temperature and inner glass cover temperatures are very important. Here, two dimensional three phase model of hemispherical solar still is made for evaporation as well as condensation process in ANSYS CFD. Simulation results like water temperature, vapor temperature, distillate output compared with actual experimental results of climate conditions of Mehsana (latitude of 23° 59’ and longitude of 72° 38) of hemispherical solar still. Water temperature and distillate output were good agreement with actual experimental results. Study shows that ANSYS-CFD is very powerful as well as efficient tool for design, comparison purpose of hemispherical solar still.

  3. Considering value of information when using CFD in design

    Energy Technology Data Exchange (ETDEWEB)

    Misra, John Satprim [Iowa State Univ., Ames, IA (United States)

    2009-01-01

    This thesis presents an approach to find lower resolution CFD models that can accurately lead a designer to a correct decision at a lower computational cost. High-fidelity CFD models often contain too much information and come at a higher computational cost, limiting the designs a designer can test and how much optimization can be performed on the design. Lower model resolution is commonly used to reduce computational time. However there are no clear guidelines on how much model accuracy is required. Instead experience and intuition are used to select an appropriate lower resolution model. This thesis presents an alternative to this ad hoc method by considering the added value of the addition information provided by increasing accurate and more computationally expensive models.

  4. Cassiopee: a CFD pre-and post-processing tool

    OpenAIRE

    Benoit, C.; Péron, S.; Landier, S.

    2015-01-01

    This paper presents an overview of the capabilities of a new open-source pre-and post-processing tool for Computational Fluid Dynamics simulations, called Cassiopee. Its architecture, which is basically a set of Python modules, and the handled data, which is based on CGNS standard, are described. Some examples of workflows that can be built with Cassiopee functions are provided. Finally, some applications of Cassiopee functions to realistic CFD configurations are briefly presented.

  5. Validation of NEPTUNE-CFD on ULPU-V experiments

    Energy Technology Data Exchange (ETDEWEB)

    Jamet, Mathieu, E-mail: mathieu.jamet@edf.fr; Lavieville, Jerome; Atkhen, Kresna; Mechitoua, Namane

    2015-11-15

    In-vessel retention (IVR) of molten corium through external cooling of the reactor pressure vessel is one possible means of severe accident mitigation for a class of nuclear power plants. The aim is to successfully terminate the progression of a core melt within the reactor vessel. The probability of success depends on the efficacy of the cooling strategy; hence one of the key aspects of an IVR demonstration relates to the heat removal capability through the vessel wall by convection and boiling in the external water flow. This is only possible if the in-vessel thermal loading is lower than the local critical heat flux expected along the outer wall of the vessel, which is in turn highly dependent on the flow characteristics between the vessel and the insulator. The NEPTUNE-CFD multiphase flow solver is used to obtain a better understanding at local scale of the thermal hydraulics involved in this situation. The validation of the NEPTUNE-CFD code on the ULPU-V facility experiments carried out at the University of California Santa Barbara is presented as a first attempt of using CFD codes at EDF to address such an issue. Two types of computation are performed. On the one hand, a steady state algorithm is used to compute natural circulation flow rates and differential pressures and, on the other, a transient algorithm computation reveals the oscillatory nature of the pressure data recorded in the ULPU facility. Several dominant frequencies are highlighted. In both cases, the CFD simulations reproduce reasonably well the experimental data for these quantities.

  6. Aerodynamic investigation of winglets on wind turbine blades using CFD

    OpenAIRE

    Johansen, Jeppe; Sørensen, Niels N.

    2006-01-01

    The present report describes the numerical investigation of the aerodynamics around a wind turbine blade with a winglet using Computational Fluid Dynamics, CFD. Five winglets were investigated with different twist distribution and camber. Four of themwere pointing towards the pressure side (upstream) and one was pointing towards the suction side (downstream). Additionally, a rectangular modification of the original blade tip was designed with the same planform area as the blades with winglets...

  7. Flow simulations using particles - Bridging Computer Graphics and CFD

    OpenAIRE

    Koumoutsakos, Petros; Cottet, Georges-Henri; Rossinelli, Diego

    2008-01-01

    International audience; The simulation of fluid flows using particles is becoming increasingly popular in Computer Graphics (CG). The grid-free character of particles, the flexibility in handling complex flow configurations and the possibility to obtain visually realistic results with a small number of computational elements are some of the main reasons for the success of these methods. In the Computational Fluid Dynamics (CFD) community, the realization that by periodically regularizing the ...

  8. Computational Fluid Dynamics (CFD) Research Branch Technical Briefs

    Science.gov (United States)

    1993-06-09

    models 13 Stability Analysis of a Combined Couette - Poiseuille , Two-Fluid Flow Lt John J. Nelson Interdisciplinary and Applied CFD Section Research...analysis and weakly non- tortion of the mean flow , the rise of the second ,armonic linear analysis for a combined Couette - Poiseuille , two and growth...Stability Analysis of a Combined Couette -Poiseulle, Two-Fluid Flow . . I I Computational Aerodynamic Analysis of a Decoy Configuration ....... 15 Euler

  9. Intelligent Computational Systems. Opening Remarks: CFD Application Process Workshop

    Science.gov (United States)

    VanDalsem, William R.

    1994-01-01

    This discussion will include a short review of the challenges that must be overcome if computational physics technology is to have a larger impact on the design cycles of U.S. aerospace companies. Some of the potential solutions to these challenges may come from the information sciences fields. A few examples of potential computational physics/information sciences synergy will be presented, as motivation and inspiration for the Improving The CFD Applications Process Workshop.

  10. CFD Modeling in Development of Renewable Energy Applications

    Directory of Open Access Journals (Sweden)

    Maher A.R. Sadiq Al-Baghdadi

    2013-01-01

    Full Text Available Chapter 1: A Multi-fluid Model to Simulate Heat and Mass Transfer in a PEM Fuel Cell. Torsten Berning, Madeleine Odgaard, Søren K. Kær Chapter 2: CFD Modeling of a Planar Solid Oxide Fuel Cell (SOFC for Clean Power Generation. Meng Ni Chapter 3: Hydrodynamics and Hydropower in the New Paradigm for a Sustainable Engineering. Helena M. Ramos, Petra A. López-Jiménez Chapter 4: Opportunities for CFD in Ejector Solar Cooling. M. Dennis Chapter 5: Three Dimensional Modelling of Flow Field Around a Horizontal Axis Wind Turbine (HAWT. Chaouki Ghenai, Armen Sargsyan, Isam Janajreh Chapter 6: Scaling Rules for Hydrodynamics and Heat Transfer in Jetting Fluidized-Bed Biomass Gasifiers. K. Zhang, J. Chang, P. Pei, H. Chen, Y. Yang Chapter 7: Investigation of Low Reynolds Number Unsteady Flow around Airfoils in Pitching, Plunging and Flapping Motions. M.R. Amiralaei, H. Alighanbari, S.M. Hashemi Chapter 8: Justification of Computational Fluid Dynamics Simulation for Flat Plate Solar Energy Collector. Mohamed Selmi, Mohammed J. Al-Khawaja, Abdulhamid Marafia Chapter 9: Comparative Performance of a 3-Bladed Airfoil Chord H-Darrieus and a 3-Bladed Straight Chord H-Darrieus Turbines using CFD. R. Gupta, Agnimitra Biswas Chapter 10: Computational Fluid Dynamics for PEM Fuel Cell Modelling. A. Iranzo, F. Rosa Chapter 11: Analysis of the Performance of PEM Fuel Cells: Tutorial of Major Functional and Constructive Characteristics using CFD Analysis. P.J. Costa Branco, J.A. Dente Chapter 12: Application of Techniques of Computational Fluid Dynamics in the Design of Bipolar Plates for PEM Fuel Cells. A.P. Manso, F.F. Marzo, J. Barranco, M. Garmendia Mujika.

  11. EVALUACIÓN DEL CONTENIDO DE NUTRIENTES Y PRODUCCIÓN DE BIOMASA EN CEPAS DE LEVADURA COLOMBIANAS Y COMERCIALES EVALUATION OF THE NUTRIENT CONTENT AND BIOMASS PRODUCTION IN COLOMBIAN AND COMMERCIAL YEAST STRAINS

    Directory of Open Access Journals (Sweden)

    Nohora Patricia Manovacía Moreno

    2008-12-01

    Full Text Available En el presente estudio se evaluó la producción de biomasa, el contenido de algunos nutrientes (selenio, carbohidratos totales y proteína microbiana y el consumo de sustrato de cepas de levaduras comerciales y nativas pertenecientes al Banco de Germoplasma de la Nación Colombiana, manejado por la Corporación Colombiana de Investigación Agropecuaria, CORPOICA. Inicialmente se determinó el crecimiento de tres levaduras nativas seleccionadas al azar bajo diferentes condiciones de pH, temperatura y tiempo de fermentación usando un medio líquido de extracto de malta. Dentro de estas condiciones, las mejores respuestas se observaron a pH de 4,5, 25 °C y 24 horas de fermentación. Usando estas condiciones se evaluaron 100 accesiones de levaduras nativas y 4 comerciales por su producción de biomasa, contenido de selenio, carbohidratos totales y proteína microbiana y consumo de sustratos. De acuerdo con estas variables y un análisis de conglomerados fue posible agrupar las levaduras en grupos homogéneos. Hubo elevada variabilidad en la producción de biomasa entre las 104 cepas evaluadas, probablemente debido a la variabilidad biológica existente en la población estudiada. Los rendimientos de biomasa variaron entre 0,101 y 0,480 g de biomasa g-1 de azúcar consumido y las velocidades de producción de biomasa oscilaron entre 0,040 y 0,185 g L-1 h-1. El consumo promedio de nutrientes (g de nutrientes consumidos/ g de nutrientes disponibles fue de 91,6% en el caso de los carbohidratos y de 17,8% en el caso de la proteína. Se identificaron diez cepas de superior crecimiento y contenido de nutrientes, cuyo potencial prebiótico y probiótico será evaluado en futuros ensayos In vivo.In the present study biomass production and nutrient (selenium, total carbohydrate and microbial protein were evaluated in both commercial and native yeast isolates from the Colombian Germplasm Bank managed by the Colombian Corporation of Agricultural Research

  12. Lotus tenuis Seedling Establishment and Biomass Production in Flooding Pampa Grasslands (Buenos Aires , Argentina Establecimiento de Plántulas y Producción de Biomasa de Lotus tenuis en Pastizales de la Pampa Deprimida (Buenos Aires, Argentina

    Directory of Open Access Journals (Sweden)

    Osvaldo R Vignolio

    2011-03-01

    Full Text Available Biomass and plant density of Lotus tenuis Waldst. & Kit. ex Willd. have been reported in decreasing in grasslands and pastures. Our objective was to determine if L. tenuis biomass and plant density can be increased in grassland through seed addition. Two separated experiments under cattle grazing exclusion were conducted in three paddocks of a Flooding Pampa grassland. The first experiment was from autumn 2004 to autumn 2006 and the second from autumn 2005 to autumn 2007. Different L. tenuis seed additions (0, 57, 229, 917 and 1833 seeds m-² were broadcast into experimental plots. In the second experiment, besides seed additions there was a reseeding of approximately 900 seed m-² from seed rain produced by plants of grassland. Seed density explained the 81% and 19% of the variation in seedling density and L. tenuis biomass, respectively. Seedling emergence occurred mainly between autumn and early spring, while seedling mortality was mainly between late spring and early summer. Lotus tenuis adult plant density and biomass production increased with seed additions. Total biomass production in the plant community varied between 589.94 ± 26.89 and 1042.44 ± 54.39 g m-² yr-1 and the differences were principally attributed to precipitations. Lotus tenuis biomass contribution was of approximately 10%. The results suggest that L. tenuis seedling and plant establishment and biomass production can be increased through seed addition and/or seed rain through grazing exclusion during reproductive period.En pastizales y pasturas ha sido documentada la reducción de la densidad de plantas y de la biomasa de Lotus tenuis Waldst. & Kit. ex Willd. Nuestro objetivo fue determinar si su densidad de plantas y su producción de biomasa pueden ser incrementadas en un pastizal mediante la adición de semillas. Dos experimentos sin pastoreo fueron realizados en tres potreros de un pastizal de la Pampa Deprimida. El primer experimento fue realizado entre otoño 2004

  13. Computer Aided Grid Interface: An Interactive CFD Pre-Processor

    Science.gov (United States)

    Soni, Bharat K.

    1997-01-01

    NASA maintains an applications oriented computational fluid dynamics (CFD) efforts complementary to and in support of the aerodynamic-propulsion design and test activities. This is especially true at NASA/MSFC where the goal is to advance and optimize present and future liquid-fueled rocket engines. Numerical grid generation plays a significant role in the fluid flow simulations utilizing CFD. An overall goal of the current project was to develop a geometry-grid generation tool that will help engineers, scientists and CFD practitioners to analyze design problems involving complex geometries in a timely fashion. This goal is accomplished by developing the CAGI: Computer Aided Grid Interface system. The CAGI system is developed by integrating CAD/CAM (Computer Aided Design/Computer Aided Manufacturing) geometric system output and/or Initial Graphics Exchange Specification (IGES) files (including all the NASA-IGES entities), geometry manipulations and generations associated with grid constructions, and robust grid generation methodologies. This report describes the development process of the CAGI system.

  14. Study of indoor radon distribution using measurements and CFD modeling.

    Science.gov (United States)

    Chauhan, Neetika; Chauhan, R P; Joshi, M; Agarwal, T K; Aggarwal, Praveen; Sahoo, B K

    2014-10-01

    Measurement and/or prediction of indoor radon ((222)Rn) concentration are important due to the impact of radon on indoor air quality and consequent inhalation hazard. In recent times, computational fluid dynamics (CFD) based modeling has become the cost effective replacement of experimental methods for the prediction and visualization of indoor pollutant distribution. The aim of this study is to implement CFD based modeling for studying indoor radon gas distribution. This study focuses on comparison of experimentally measured and CFD modeling predicted spatial distribution of radon concentration for a model test room. The key inputs for simulation viz. radon exhalation rate and ventilation rate were measured as a part of this study. Validation experiments were performed by measuring radon concentration at different locations of test room using active (continuous radon monitor) and passive (pin-hole dosimeters) techniques. Modeling predictions have been found to be reasonably matching with the measurement results. The validated model can be used to understand and study factors affecting indoor radon distribution for more realistic indoor environment.

  15. CFD Extraction Tool for TecPlot From DPLR Solutions

    Science.gov (United States)

    Norman, David

    2013-01-01

    This invention is a TecPlot macro of a computer program in the TecPlot programming language that processes data from DPLR solutions in TecPlot format. DPLR (Data-Parallel Line Relaxation) is a NASA computational fluid dynamics (CFD) code, and TecPlot is a commercial CFD post-processing tool. The Tec- Plot data is in SI units (same as DPLR output). The invention converts the SI units into British units. The macro modifies the TecPlot data with unit conversions, and adds some extra calculations. After unit conversions, the macro cuts a slice, and adds vectors on the current plot for output format. The macro can also process surface solutions. Existing solutions use manual conversion and superposition. The conversion is complicated because it must be applied to a range of inter-related scalars and vectors to describe a 2D or 3D flow field. It processes the CFD solution to create superposition/comparison of scalars and vectors. The existing manual solution is cumbersome, open to errors, slow, and cannot be inserted into an automated process. This invention is quick and easy to use, and can be inserted into an automated data-processing algorithm.

  16. CFD and FEM Model of an Underwater Vehicle Propeller

    Directory of Open Access Journals (Sweden)

    Chruściel Tadeusz

    2014-10-01

    Full Text Available Within the framework of the project for design and optimization of the Remotely Operated Vehicle (ROV, research on its propulsion has been carried out. Te entire project was supported by CFD and FEM calculations taking into account the characteristics of the underwater vehicle. One of the tasks was to optimize the semi-open duct for horizontal propellers, which provided propulsion and controllability in horizontal plane. In order to create a measurable model of this task it was necessary to analyze numerical methodology of propeller design, along with the structure of a propellers with nozzles and contra-rotating propellers. It was confronted with theoretical solutions which included running of the analyzed propeller near an underwater vehicle. Also preliminary qualitative analyses of a simplified system with contra-rotating propellers and a semi-open duct were carried out. Te obtained results enabled to make a decision about the ROVs duct form. Te rapid prototyping SLS (Selective Laser Sintering method was used to fabricate a physical model of the propeller. As a consequence of this, it was necessary to verify the FEM model of the propeller, which based on the load obtained from the CFD model. Te article contains characteristics of the examined ROV, a theoretical basis of propeller design for the analyzed cases, and the results of CFD and FEM simulations.

  17. CFD simulation on performance of new type umbrella plate scrubber

    Institute of Scientific and Technical Information of China (English)

    LI Shan-hong; LI Cai-ting; ZENG Guang-ming; LI Si-min; WANG Fei; WANG Da-yong

    2008-01-01

    A new type of umbrella plate scrubber was developed to address the pollution due to the dust, dioxide sulfur and other harmful gases, which were emitted from coal-burning boilers. The performance of the new device was studied through computational fluid dynamics(CFD) simulation and experiment methods. Initial work included experimental measurement of inlet-velocity, and gas phase simulation using Reynolds stress model(RSM). After gas phase was converged, particles were injected from the inlet of the new device. Discrete phase model(DPM) was used for particle trajectories determination. The pressure drop and the collection efficiency of the new device were predicted through simulation. The simulation results show that the pressure drop of the new devices is 230-250 Pa and the efficiency is 84%-86%, with the inlet velocity equal to 10.6 m/s and the dust concentration ranging from 2 to 22 g/m3. The CFD simulation results of the new device show good agreement with experimental data. The relative error of the pressure drop and the efficiency is approximately 4% and 10% respectively. The results obtained both from the numerical simulation and from the experiment demonstrate that CFD simulation is an effective method for this type of study.

  18. The prediction of solute transport in surcharged manholes using CFD.

    Science.gov (United States)

    Lau, S D; Stovin, V R; Guymer, I

    2007-01-01

    Solute transport processes occur within a wide range of water engineering structures, and urban drainage engineers increasingly rely on modelling tools to represent the transport of dissolved materials. The models take as input representative travel time and dispersion characteristics for key system components, and these generally have to be identified via field or laboratory measurements. Computational Fluid Dynamics (CFD) has the potential to reveal the underlying hydraulic processes that control solute transport, and to provide a generic means of identifying relevant parameter values. This paper reports on a study that has been undertaken to evaluate the feasibility of utilising a CFD-based approach to modelling solute transport. Discrete phase modelling has been adopted, as this is computationally efficient and robust when compared with the time-dependent solution of the advection-dispersion equation. Simulation results are compared with published laboratory data characterising the dispersion effects of surcharged manholes, focusing specifically on an 800 mm diameter laboratory manhole for a flowrate of 0.002 m(3)/s and a range of surcharge depths. Preliminary indications are that the CFD results adequately replicate the measured downstream temporal concentration profiles, and that a threshold surcharge depth, corresponding to a change in hydraulic regime within the manhole, can also be identified.

  19. Integrating Multibody Simulation and CFD: toward Complex Multidisciplinary Design Optimization

    Science.gov (United States)

    Pieri, Stefano; Poloni, Carlo; Mühlmeier, Martin

    This paper describes the use of integrated multidisciplinary analysis and optimization of a race car model on a predefined circuit. The objective is the definition of the most efficient geometric configuration that can guarantee the lowest lap time. In order to carry out this study it has been necessary to interface the design optimization software modeFRONTIER with the following softwares: CATIA v5, a three dimensional CAD software, used for the definition of the parametric geometry; A.D.A.M.S./Motorsport, a multi-body dynamic simulation software; IcemCFD, a mesh generator, for the automatic generation of the CFD grid; CFX, a Navier-Stokes code, for the fluid-dynamic forces prediction. The process integration gives the possibility to compute, for each geometrical configuration, a set of aerodynamic coefficients that are then used in the multiboby simulation for the computation of the lap time. Finally an automatic optimization procedure is started and the lap-time minimized. The whole process is executed on a Linux cluster running CFD simulations in parallel.

  20. Measurements of a single pulse impinging jet. A CFD reference

    Directory of Open Access Journals (Sweden)

    Bovo Mirko

    2014-03-01

    Full Text Available This paper reports three sets of measurements of a single pulse impinging jet. The purpose is to serve as a reference for CFD validation. A gas injector generates a single pulse jet at Re ~90000. The jet impinges on a temperature controlled flat target at different angles (0º, 30º, 45º and 60º. The jet velocity field is measured with PIV. The evolution of the jet velocity profile in time is reported at two different locations (suitable as CFD inlet conditions. At the same locations also turbulence quantities are reported. The impingement wall temperature is measured with fast responding thermocouples and infrared camera. These give high time and space resolution respectively. Results are reported in a format suitable for comparison with CFD simulations. The results show that the heat transfer effects are highest for the jet impinging normally on the target. Target inclination has remarkable effects on the jet penetration rate and repeatability. Even small target inclinations result creates a preferential direction for the jet flow and cause a shift in the position of the stagnation region.

  1. CFD simulation research on residential indoor air quality.

    Science.gov (United States)

    Yang, Li; Ye, Miao; He, Bao-Jie

    2014-02-15

    Nowadays people are excessively depending on air conditioning to create a comfortable indoor environment, but it could cause some health problems in a long run. In this paper, wind velocity field, temperature field and air age field in a bedroom with wall-hanging air conditioning running in summer are analyzed by CFD numerical simulation technology. The results show that wall-hanging air conditioning system can undertake indoor heat load and conduct good indoor thermal comfort. In terms of wind velocity, air speed in activity area where people sit and stand is moderate, most of which cannot feel wind flow and meet the summer indoor wind comfort requirement. However, for air quality, there are local areas without ventilation and toxic gases not discharged in time. Therefore it is necessary to take effective measures to improve air quality. Compared with the traditional measurement method, CFD software has many advantages in simulating indoor environment, so it is hopeful for humans to create a more comfortable, healthy living environment by CFD in the future.

  2. A Scalable Infrastructure for Online Performance Analysis on CFD Application

    Institute of Scientific and Technical Information of China (English)

    HU Kai; DING Yi; ZHANG Xinyu; JIANG Shu

    2012-01-01

    The fast-growing demand of computational fluid dynamics (CFD) application for computing resources stimulates the development of high performance computing (HPC) and meanwhile raises new requirements for the technology of parallel application performance monitor and analysis.In response to large-scale and long-time running for the application of CFD,online and scalable performance analysis technology is required to optimize the parallel programs as well as to improve their operational efficiency.As a result,this research implements a scalable infrastructure for online performance analysis on CFD application with homogeneous or heterogeneous system.The infrastructure is part of the parallel application performance monitor and analysis system (PAPMAS) and is composed of two modules which are scalable data transmission module and data storage module.The paper analyzes and elaborates this infrastructure in detail with respect to its design and implementation.Furthermore,some experiments are carried out to verify the rationality and high efficiency of this infrastructure that could be adopted to meet the practical needs.

  3. A CFD model for pollutant dispersion in rivers

    Directory of Open Access Journals (Sweden)

    Modenesi K.

    2004-01-01

    Full Text Available Studies have shown that humankind will experience a water shortage in the coming decades. It is therefore paramount to develop new techniques and models with a view to minimizing the impact of pollution. It is important to predict the environmental impact of new emissions in rivers, especially during periods of drought. Computational fluid dynamics (CFD has proved to be an invaluable tool to develop models able to analyze in detail particle dispersion in rivers. However, since these models generate grids with thousands (even millions of points to evaluate velocities and concentrations, they still require powerful machines. In this context, this work contributes by presenting a new three-dimensional model based on CFD techniques specifically developed to be fast, providing a significant improvement in performance. It is able to generate predictions in a couple of hours for a one-thousand-meter long section of river using Pentium IV computers. Commercial CFD packages would require weeks to solve the same problem. Another innovation inb this work is that a half channel with a constant elliptical cross section represents the river, so the Navier Stokes equations were derived for the elliptical system. Experimental data were obtained from REPLAN (PETROBRAS refining unit on the Atibaia River in São Paulo, Brazil. The results show good agreement with experimental data.

  4. Toward a CFD-grade database addressing LWR containment phenomena

    Energy Technology Data Exchange (ETDEWEB)

    Paladino, Domenico, E-mail: domenico.paladino@psi.ch [Laboratory for Thermal-Hydraulics, Nuclear Energy and Safety Department, Paul Scherrer Institut, CH-5232 Villigen PSI (Switzerland); Andreani, Michele; Zboray, Robert; Dreier, Joerg [Laboratory for Thermal-Hydraulics, Nuclear Energy and Safety Department, Paul Scherrer Institut, CH-5232 Villigen PSI (Switzerland)

    2012-12-15

    Highlights: Black-Right-Pointing-Pointer The SETH-2 PANDA tests have supplied data with CFD-grade on plumes and jets at large-scale. Black-Right-Pointing-Pointer The PANDA tests have contributed to the understanding of phenomena with high safety relevance for LWRs. Black-Right-Pointing-Pointer The analytical activities related increased confidence in the use of various computational tools for safety analysis. - Abstract: The large-scale, multi-compartment PANDA facility (located at PSI in Switzerland) is one of the state-of-the-art facilities which is continuously upgraded to progressively match the requirements of CFD-grade experiments. Within the OECD/SETH projects, the PANDA facility has been used for the creation of an experimental database on basic containment phenomena e.g. gas mixing, transport, stratification, condensation. In the PANDA tests, these phenomena are driven by large scale plumes or jets. In the paper is presented a selection of the SETH PANDA experimental results. Examples of analytical activities performed at PSI using the GOTHIC, CFX-4 and CFX-5 codes will be used to illustrate how the spatial and temporal resolutions of the measurement grid in PANDA tests are adequate for CFD code (and advanced containment codes) assessment and validation purposes.

  5. CFD DPAL modeling for various schemes of flow configurations

    Science.gov (United States)

    Waichman, Karol; Barmashenko, Boris D.; Rosenwaks, Salman

    2014-10-01

    Comprehensive analysis of kinetic and fluid dynamic processes in flowing-gas diode pumped alkali lasers (DPALs) using two- and three-dimensional computational fluid dynamics (2D and 3D CFD) models is reported for Cs DPALs. The models take into account effects of temperature rise and losses of alkali atoms due to ionization. Various gas flow regimes and transverse and parallel flow-optics directions configurations are studied. Optimization of the Cs DPAL parameters, using 3D CFD modeling, shows that applying high flow velocity and narrowband pumping, maximum lasing power as high as 40 kW can be obtained at pump power of 80 kW for transverse flow configuration in a pumped volume of ~ 0.7 cm3. At high pump power the calculated laser power is higher for the transverse scheme than for the parallel scheme because of a more efficient heat convection from the beam volume in the transverse configuration. The CFD models are applied to experimental devices and the calculated results are in good agreement with the measurements.

  6. Biomasa microbiana y actividad ureasa del suelo en una pradera permanente pastoreada de Chile Soil microbial biomass and urease activity in a grazed permanent pasture from Chile

    Directory of Open Access Journals (Sweden)

    Pedro Antonio Núñez Ramos

    2012-12-01

    Full Text Available En los sistemas de pasturas; la productividad de la pradera puede estar influenciada por el manejo; debido a su impacto sobre los microorganismos del suelo y el reciclaje de nutrientes. El objetivo de este trabajo fue evaluar la biomasa microbiana (BM del suelo asociada al nitrógeno (BMN; carbono (BMC y la actividad ureasa (AU en una pradera permanente del sur de Chile. Entre la primavera de 2005 y el invierno de 2006 fueron evaluados dos sistemas de pastoreo: pastoreo intenso (PI; pastoreo suave (PS y un tratamiento control (C. El diseño fue en bloques al azar con tres repeticiones. En relación a los valores promedios medidos de las variables en pre y post pastoreo; se produjo un incremento en los contenidos de CB en un 21,8 y 8,6% para PI y PS; mientras que en el control fue sólo de 1,9%. Los contenidos de NB también fueron incrementados en un 16 y 19% para PI y PS; respectivamente en comparación con el control (4%. La actividad ureasa aumentó en 13 y 27% para PI y PS; respectivamente en comparación con el control (5%. El pastoreo; produce un flujo más alto de residuos orgánicos en el suelo; lo que estimula la actividad de la biomasa microbiana y; por tanto; aumentó la AU y los contenidos de CB y NB. Esto sugiere que; en los sistemas de pastoreo; se mejora la fertilidad biológica de los suelos y la disponibilidad de nutrientes.In pasture systems, management practices can affect pasture productivity differently due to their impact on soil microorganisms and nutrient cycling. The objective of this study was to evaluate the relationship between soil microbial biomass (MB nitrogen (MBN, carbon (MBC and urease activity (UA in a permanent pasture in southern Chile. Two grazing systems were evaluated between spring 2005 and winter 2006 : heavy grazing (HG, light grazing (LG and a control treatment (C. Treatments were arranged in a randomized block design with three replications. Concerning the average values of the variables measured at

  7. DESEMPEÑO PRODUCTIVO DE POLLOS DE ENGORDE SUPLEMENTADOS CON BIOMASA DE Saccharomyces cerevisiae DERIVADA DE LA FERMENTACIÓN DE RESIDUOS DE BANANO

    Directory of Open Access Journals (Sweden)

    N. M. Medina

    2014-01-01

    Full Text Available El objetivo de esta investigación fue evaluar el efecto de la inclusión de diferentes ni-veles de biomasa de levaduras, producidos al fermentar hidrolizados de residuos de laindustria bananera, sobre los parámetros zootécnicos de pollos de engorde, evaluandoademás el impacto económico de su uso en las dietas. Se utilizaron 210 pollos de en-gorde de un día de edad, distribuidos completamente al azar en cinco tratamientos,en una relación de seis réplicas por tratamiento y siete pollos por réplica. El periodoexperimental comprendió 42 días; el alimento y el agua se dispensaron a voluntad. Lasdietas experimentales fueron: T1- Control negativo sin levadura, T2- Control positivocon levadura comercial a razón de 1,5 kg ton-1de alimento, T3- Levadura experimentala razón de 0,5 kg ton-1de la dieta, T4-Levadura experimental a razón de 1,0 kg ton-1de la dieta y T5- Levadura experimental a razón de 1,5 kg ton-1de la dieta. Se observómayor consumo de acumulado alimento en el tratamiento 4 (1kg ton-1de levadura conrespecto a los demás tratamientos evaluados. No hubo diferencias significativas (P>0.05en las otras variables evaluadas en el estudio. Se constató beneficio económico con el usodel tratamiento 4 pues se obtuvieron mejores retornos (precio de venta del pollo – costode la alimentación que fueron mayores a los observados en los tratamientos 1, 2, 3 y 5en 153, 82, 62 y 161 pesos($ ave-1, respectivamente.

  8. BIOSORCIÓN DE Cd, Pb y Zn POR BIOMASA PRETRATADA DE ALGAS ROJAS, CÁSCARA DE NARANJA Y TUNA

    Directory of Open Access Journals (Sweden)

    Lissette Vizcaíno Mendoza

    2015-01-01

    Full Text Available Debido a su movilidad en los ecosistemas y a su toxicidad para las formas superiores de vida,los metales pesados Cd, Pb y Zn son priorizados como unos de los contaminantes inorgánicosmás importantes debido al alto riesgo que representan para el medio ambiente. Con el objeto dedisminuir su concentración se diseñó un sistema para evaluar su remoción empleando biomasade algas rojas, cáscaras de naranja (Citrus sp. y tuna guajira (Opuntia sp.. Se estudió la influenciadel pretratamiento y el empaquetamiento mediante ensayos tipo batch, en los que se emplearonsoluciones de sodio y calcio. Se obtuvo como resultado una mayor capacidad de sorción de lasalgas modificadas con NaOH 0.1 N y de la naranja y la tuna con modificación sucesiva con NaOH yCaCl20.2 M, y una afección poco significativa (≤1% del proceso de sorción al empacar la biomasael placas planas de tul poliéster. La eficiencia de remoción se determinó mediante un reactor deflujo continuo de columna fija con un volumen líquido de 400 mL, 75 g de biomasa y tiemposde retención promedio de 1 y 2 h. Los resultados mostraron una eficiencia similar de las tresbiomasas para remover Cd y Pb, con promedios superiores al 95%, mientras que el Zn se removiócon mejor eficiencia (62% al emplear tuna modificada como sorbente. Finalmente, el materialse calcinó a 700 °C con lo que se obtuvo una ceniza estable frente a soluciones ácidas, lo cualgarantiza la captura de los metales removidos.

  9. Trends in spatio-temporal distribution of Peruvian anchovy and other small pelagic fish biomass from 1966-2009 Tendencias espacio-temporales en la distribución de la biomasa de anchoveta peruana y de otros peces pelágicos pequenos entre 1966 y 2009

    Directory of Open Access Journals (Sweden)

    Mariano Gutiérrez

    2012-09-01

    de pequenos peces pelágicos de la región norte del Sistema de la Corriente de Humboldt (NHCS son el producto de la variación de forzantes ambientales en diferentes escalas de tiempo y espacio que influyen entre el ecosistema 'frío' costero y el oceánico 'cálido'. La información para estudiar estas fluctuaciones provienen mayormente de las pesquerías, y muestran que la anchoveta (Engraulis ringens incrementa su abundancia cuando la de sardina (Sardinops sagax declina y viceversa. Sin embargo, utilizando datos acústicos de biomasa latitudinal se muestra que otras especies como la caballa (Scomber japonicus y el jurel (Trachurus murphyi también siguen la misma tendencia opuesta a anchoveta, lo que en principio indica que los datos pesqueros disponibles no indican la verdadera dimensión del balance de abundancia entre especies. Utilizando diagramas de Hovmoller se analizan los cambios en la biomasa acústica latitudinal, capturas e influencia de eventos El Nino ocurridos entre 1966 y 2009 con el objetivo de describir: 1 cómo el patrón de distribución decadal de anchoveta se movió de sur a norte desde la década de 1960, 2 cómo se han producido cambios concomitantes en la abundancia latitudinal de otras especies tales como sardina, caballa y jurel antes, durante y después de eventos El Nino, y 3 cuál fue el efecto general de la sucesión de eventos El Nino sobre todas estas especies. Se concluye que: a cada evento El Nino ha tenido un efecto en la expansión o contracción de la distribución de especies pelágicas, con diferente gradiente latitudinal, y b El Nino 1997-98 no disparó sino aceleró la fase declinante de la abundancia de sardina, caballa y jurel al reducirse el tamano de su hábitat ideal debido a una expansión del hábitat costero que presentó además un acercamiento a la superficie del límite superior de la Zona Mínima de Oxígeno (MOZ. Las observaciones logradas con datos acústicos podrían ser tomadas en consideración para el

  10. Producción de biomasa verde y calidad de aceites esenciales de palmarosa (Cymbopogon martini Roxb. con aplicación de fertilizantes de síntesis y orgánicos

    Directory of Open Access Journals (Sweden)

    Javier Alberto Pinzón-Torres

    2014-12-01

    Full Text Available El uso de fertilizantes minerales en cultivos de Cymbopogon martini Roxb. (Palmarosa con el fin de incrementar la biomasa y el rendimiento de aceite esencial (AE es una práctica cada vez más frecuente. Este aceite es rico en geraniol y acetato de geranilo, moléculas con alto valor en las industrias de productos cosméticos y farmacéutica. Las plantas fueron obtenidas del Centro Nacional de Investigación Agroindustrial de Plantas Aromaticas y Medicinales de la Universidad Industrial de Santander (UIS (Cenivam (07° 08' 31.68"N, 73° 07' 06.14O; 988 m.s.n.m., Santander, Colombia. El objetivo del estudio fue evaluar la productividad de biomasa y analizar la calidad y el rendimiento de los aceites esenciales (AE de este cultivo con la aplicación de tres tipos de fertilizantes químico: Nutrimon® 14-14-14, NPK granulado (10% N, 14% P2O5 , 14% K2O, en dosis de 2, 4 y 6 g/planta, más un tratamiento con 400 g de un fertilizante orgánico,. Se utilizó un diseño de bloques completos al azar, con trece tratamientos y tres cosechas de tres plantas cada una como repeticiones. Los datos fueron sometidos a análisis de variancia con comparación de las medias por la prueba de Tukey a 5% de probabilidad. No se observaron correlaciones entre biomasa y rendimiento del AE en función del tipo del fertilizante aplicado, lo que sugirió que los tratamientos que incrementaron la producción de biomasa no necesariamente representaron mayor rendimiento del AE y viceversa. Se encontró que los fertilizantes orgánicos son ideales para este cultivo, ya que favorecieron rendimientos relativamente altos en aceite, con altos porcentajes de geraniol y acetato de geranilo.

  11. Abundancia y biomasa de organismos edáficos en tres usos del terreno en el altiplano de Pasto, Colombia Abundance and biomass of soil organisms in three land use systems in the high plateau of Pasto, Colombia

    Directory of Open Access Journals (Sweden)

    Jorge H. Castro P.

    Full Text Available La investigación se realizó en la vereda Cruz de Amarillo, municipio de Pasto (1º 7' norte y 77º 17´ oeste, 2.850 msnm, 12º C y humedad relativa del 83%. Se seleccionaron tres usos del terreno: praderas de Lollium multiflorum (ryegrass y Pennisetum clandestinum (kikuyo y un bosque secundario. En cada uno se trazó una línea recta y se tomaron ocho muestras, separadas 10 m, cada 15 días. El muestreo se hizo siguiendo la metodología del Tropical Soil Biology and Fertility Programe (TSBF. La fauna se recolectó manualmente y posteriormente se hizo el conteo y la valoración de la biomasa; los organismos se identificaron hasta nivel de familia y en algunos casos sólo hasta orden. También se determinó humedad gravimétrica, porosidad y contenido de materia orgánica. Los datos se analizaron de acuerdo con un diseño de bloques completos al azar. La pradera de L. multiflorum y el bosque secundario presentaron los mayores valores de abundancia de lombrices (5.648 y 4.864 ind m-2 y biomasa (141.3 y 670.7 g.p.f.m-2. En la pradera de P. clandestinum abundaron los ácaros (2.768 ind m-2 con una biomasa de 0.22 g. p. f m-2. En todos los usos del suelo la mayor abundancia de organismos y biomasa se presentó en la profundidad de 0 - 10 cm.At the county of Cruz de Amarillo, municipality of Pasto, Colombia , located al 2850 masl, a field study to determine the numbers of organisms and its biomass was carried out. Three land use systems were selected: prairie with the grass Lolium multiflorum (Ryegrass, pasture with Pennisetum clandestinum (kikuyu and secondary forest. The prairie of .L multiflorum and the secondary forest showed the highest values of abundance of earth worms (5648 and 4864 ind m-2, respectively. Biomass was 141.3 and 670.7 gpfm-2 for L. multiflorum and P. clandestinum, respectively. Mites were abundant (2768 ind m-2 with a biomass of 0.22 gpfm-2. At all land use systems, the highest abundance of organisms and biomass at 2 depth of

  12. Plan técnico de mejoras en el rendimiento de la planta de biomasa para generación eléctrica; térmica AFAP S.A Villacañas (Toledo)

    OpenAIRE

    Paton Mancebo, Angel Hilario

    2014-01-01

    La planta Térmica AFAP S.A se dedica a la generación eléctrica procedente de la combustión de principalmente Biomasa forestal (madera de pino principalmente) y algo de residuos maderables de las fabricas de puertas que existen la localidad de Villacañas, municipio donde se encuentra ubicada dicha planta. El objeto de este proyecto es la mejora en el rendimiento y rentabilidad de dicha planta enfocado en varías líneas: -infraestructuras en la planta: instalación de Nave de almacenamiento para ...

  13. Two Phase Flow Models and Numerical Methods of the Commercial CFD Codes

    Energy Technology Data Exchange (ETDEWEB)

    Bae, Sung Won; Jeong, Jae Jun; Chang, Seok Kyu; Cho, Hyung Kyu

    2007-11-15

    The use of commercial CFD codes extend to various field of engineering. The thermal hydraulic analysis is one of the promising engineering field of application of the CFD codes. Up to now, the main application of the commercial CFD code is focused within the single phase, single composition fluid dynamics. Nuclear thermal hydraulics, however, deals with abrupt pressure changes, high heat fluxes, and phase change heat transfer. In order to overcome the CFD limitation and to extend the capability of the nuclear thermal hydraulics analysis, the research efforts are made to collaborate the CFD and nuclear thermal hydraulics. To achieve the final goal, the current useful model and correlations used in commercial CFD codes should be reviewed and investigated. This report gives the summary information about the constitutive relationships that are used in the FLUENT, STAR-CD, and CFX. The brief information of the solution technologies are also enveloped.

  14. CFD based Investigation of Wave-Structure Interaction and Hydrodynamics of an Oscillating Water Column Device

    OpenAIRE

    Kamath, Arun

    2015-01-01

    The application of computational fluid dynamics (CFD) methods to various problems in the field of coastal and ocean engineering is gaining importance due to the level of detail and accuracy offered by these methods. With the advances made in the computing power over the last decade and anticipated future increase in computational power, large and complex problems can be handled using CFD modeling. The PhD study aims at the development of a CFD-based numerical wave tank, vali...

  15. CFD validation of the thermal comfort in a room using draft rates

    OpenAIRE

    2007-01-01

    Air temperature and velocity are the two main factors affecting the thermal comfort indoors. These two values can be easily obtained using computational fluid dynamic (CFD) simulations together with the turbulence kinetic energy value. This paper evaluates methods of calculating thermal comfort indices using CFD. Simulated results are compared against experimental data measured in a purpose build full-scale model room. The results show that CFD data can reliably predict thermal comfort values...

  16. Predictions of a Supersonic Jet-in-Crossflow: Comparisons Among CFD Solvers and with Experiment

    Science.gov (United States)

    2014-09-01

    Predictions of a Supersonic Jet-in-Crossflow: Comparisons Among CFD Solvers and with Experiment by James DeSpirito, Kevin D Kennedy, Clark...Aberdeen Proving Ground, MD 21005-5066 ARL-RP-0505 September 2014 Predictions of a Supersonic Jet-in-Crossflow: Comparisons Among CFD ...SUBTITLE Predictions of a Supersonic Jet-in-Crossflow: Comparisons Among CFD Solvers and with Experiment 5a. CONTRACT NUMBER 5b. GRANT NUMBER 5c

  17. Computational Fluid Dynamic (CFD) Study of an Articulating Turbine Blade Cascade

    Science.gov (United States)

    2016-11-01

    ARL-TR-7871 ● NOV 2016 US Army Research Laboratory Computational Fluid Dynamic (CFD) Study of an Articulating Turbine Blade...ARL-TR-7871 ● NOV 2016 US Army Research Laboratory Computational Fluid Dynamic (CFD) Study of an Articulating Turbine Blade Cascade by Luis...COVERED (From - To) 1 June–31 August 2016 4. TITLE AND SUBTITLE Computational Fluid Dynamic (CFD) Study of an Articulating Turbine Blade Cascade 5a

  18. Quantitative Relative Comparison of CFD Simulation Uncertainties for a Transonic Diffuser Problem

    OpenAIRE

    Hosder, Serhat; Grossman, Bernard; Haftka, Raphael T.; Mason, William H.; Watson, Layne T.

    2004-01-01

    Different sources of uncertainty in CFD simulations are illustrated by a detailed study of two-dimensional, turbulent, transonic flow in a converging-diverging channel. Runs were performed with the commercial CFD code GASP using different turbulence models, grid levels, and flux-limiters to see the effect of each on the CFD simulation uncertainties. Two flow conditions were studied by changing the exit pressure ratio: the first is a complex case with a strong shock and a separated flow region...

  19. Non-Newtonian Liquid Flow through Small Diameter Piping Components: CFD Analysis

    Science.gov (United States)

    Bandyopadhyay, Tarun Kanti; Das, Sudip Kumar

    2016-10-01

    Computational Fluid Dynamics (CFD) analysis have been carried out to evaluate the frictional pressure drop across the horizontal pipeline and different piping components, like elbows, orifices, gate and globe valves for non-Newtonian liquid through 0.0127 m pipe line. The mesh generation is done using GAMBIT 6.3 and FLUENT 6.3 is used for CFD analysis. The CFD results are verified with our earlier published experimental data. The CFD results show the very good agreement with the experimental values.

  20. REDUCCIÓN DE LA BIOMASA DEL PINO CARRASCO (PINUS HALEPENSIS EN UN ÁREA DEL SURESTE SEMIÁRIDO PENINSULAR COMO ESTRATEGIA PARA EVITAR EL ESTRÉS HÍDRICO

    Directory of Open Access Journals (Sweden)

    Francisco Belmonte Serrato

    2008-01-01

    Full Text Available En las épocas de fuertes sequías, la vegetación mediterránea sufre un estado de estrés hídrico prolongado que le obliga a adoptar diversas estrategias de supervivencia, entre las que fi guran, como último recurso, y antes de llegar a superar su capacidad de resilencia, la reducción de la biomasa de hojas. En este trabajo se pone de manifi esto como algunos ejemplares de Pinus halepensis existentes en el área de estudio (el campo experimental de El Ardal, Murcia, redujeron apreciablemente su biomasa aérea en respuesta a la sequía, que se manifestó en un importante aumento de la producción de hojarasca. La producción de hojarasca se relaciona además de con la precipitación registrada en el periodo de estudio, con la humedad del suelo, parámetro clave en la supervivencia de la vegetación en ambientes secos.

  1. CFD evaluation of SFP cooling capacity during normal operating conditions

    Energy Technology Data Exchange (ETDEWEB)

    Yoon, Dong Hyeog; Kim, Jin Hyuck; Seul, Kwang Won [Korea Institute of Nuclear Safety, Daejeon (Korea, Republic of)

    2012-10-15

    In Fukushima nuclear accident, due to earthquake, the cooling system of the spent fuel pool failed and the safety issue of the spent fuel pool (SFP) generated. Because of the unavailability of offsite storage for spent nuclear fuel in Korea, the spent fuel should be placed in storage at specially designed facilities, kept and monitored in the plant. In recent years, spent fuel storage racks are being replaced with high density racks due to the lack of storage capacity. For the above reasons, the necessity is felt to analyze the safety of the spent fuel pool. Hence, to evaluate the safety of spent fuel pools, in case of loss of offsite power like the Fukushima nuclear accident, the safety analysis was conducted for Gori Unit 1 and Ulchin unit3 in order to estimate the time it takes for nuclear fuels to be uncovered, when water in the pool evaporated by decay heat of spent fuels. In addition, there are some researches evaluating heat removal, thermal hydraulic behaviors and accident circumstances in the spent fuel pool with system thermal hydraulic codes, such as RELAP, TRACE and ASTEC. Some researchers are attempting to carry out 3D CFD analysis. In this study, thermal hydraulic characteristics of the spent fuel pool of Ulchin unit 3 are investigated by using ANSYS CFX 13 which is a commercial CFD code. Three dimensional fluid flow and heat removal capacity of the spent fuel pool are evaluated by 3 D CFD simulation, while carrying out comparative analysis with the multi D analysis of MARS KS.

  2. CFD simulation of air discharge tests in the PPOOLEX facility

    Energy Technology Data Exchange (ETDEWEB)

    Tanskanen, V.; Puustinen, M. (Lappeenranta Univ. of Technology, Nuclear Safety Research Unit (Finland))

    2008-07-15

    This report summarizes the CFD simulation results of two air discharge tests of the characterizing test program in 2007 with the scaled down PPOOLEX facility. Air was blown to the dry well compartment and from there through a DN200 blowdown pipe into the condensation pool (wet well). The selected tests were modeled with Fluent CFD code. Test CHAR-09-1 was simulated to 28.92 seconds of real time and test CHAR-09-3 to 17.01 seconds. The VOF model was used as a multiphase model and the standard k epsilon-model as a turbulence model. Occasional convergence problems, usually at the beginning of bubble formation, required the use of relatively short time stepping. The simulation time costs threatened to become unbearable since weeks or months of wall-clock time with 1-2 processors were needed. Therefore, the simulated time periods were limited from the real duration of the experiments. The results obtained from the CFD simulations are in a relatively good agreement with the experimental results. Simulated pressures correspond well to the measured ones and, in addition, fluctuations due to bubble formations and breakups are also captured. Most of the differences in temperature values and in their behavior seem to depend on the locations of the measurements. In the vicinity of regions occupied by water in the experiments, thermocouples getting wet and drying slowly may have had an effect on the measured temperature values. Generally speaking, most temperatures were simulated satisfyingly and the largest discrepancies could be explained by wetted thermocouples. However, differences in the dry well and blowdown pipe top measurements could not be explained by thermocouples getting wet. Heat losses and dry well / wet well heat transfer due to conduction have neither been estimated in the experiments nor modeled in the simulations. Estimation of heat conduction and heat losses should be carried out in future experiments and they should be modeled in future simulations, too. (au)

  3. Investigation of microclimate between wall and furniture with CFD

    DEFF Research Database (Denmark)

    Mortensen, Lone Hedegaard; Woloszyn, Monika; Rode, Carsten

    2005-01-01

    velocities and diffusion transport in constructions is presented. It is a CFD model where the air is modelled as a mixture of dry air and water vapour and walls fluids modelled with ordinary wall characteristics as material properties. This enables easy modelling of moisture transfer within the walls....... This investigation has special focus on the coupling of the moisture transfers in the wall and the moisture content of the air. The microclimate in a room is studied for different geometrical configurations, meaning that the moisture and temperature conditions are analysed and discussed using different distances...... between wall constructions and furnishing....

  4. Scaling studies and conceptual experiment designs for NGNP CFD assessment

    Energy Technology Data Exchange (ETDEWEB)

    D. M. McEligot; G. E. McCreery

    2004-11-01

    The objective of this report is to document scaling studies and conceptual designs for flow and heat transfer experiments intended to assess CFD codes and their turbulence models proposed for application to prismatic NGNP concepts. The general approach of the project is to develop new benchmark experiments for assessment in parallel with CFD and coupled CFD/systems code calculations for the same geometry. Two aspects of the complex flow in an NGNP are being addressed: (1) flow and thermal mixing in the lower plenum ("hot streaking" issue) and (2) turbulence and resulting temperature distributions in reactor cooling channels ("hot channel" issue). Current prismatic NGNP concepts are being examined to identify their proposed flow conditions and geometries over the range from normal operation to decay heat removal in a pressurized cooldown. Approximate analyses have been applied to determine key non-dimensional parameters and their magnitudes over this operating range. For normal operation, the flow in the coolant channels can be considered to be dominant turbulent forced convection with slight transverse property variation. In a pressurized cooldown (LOFA) simulation, the flow quickly becomes laminar with some possible buoyancy influences. The flow in the lower plenum can locally be considered to be a situation of multiple hot jets into a confined crossflow -- with obstructions. Flow is expected to be turbulent with momentumdominated turbulent jets entering; buoyancy influences are estimated to be negligible in normal full power operation. Experiments are needed for the combined features of the lower plenum flows. Missing from the typical jet experiments available are interactions with nearby circular posts and with vertical posts in the vicinity of vertical walls - with near stagnant surroundings at one extreme and significant crossflow at the other. Two types of heat transfer experiments are being considered. One addresses the "hot channel" problem, if necessary

  5. Prospects for Eulerian CFD analysis of helicopter vortex flows

    Science.gov (United States)

    Drela, Mark; Murman, Earll M.

    1987-01-01

    The applicability of current finite-volume CFD algorithms based on the Euler equations to the vortex flow over a helicopter in forward flight is investigated analytically. The general characteristics of the flow are reviewed; existing Euler, Navier-Stokes, perturbation, high-order, and adaptive methods are briefly characterized; and a novel Eulerian/Lagrangian approach with entropy and vorticity corrections is presented in detail. Numerical results for simple convection of a finite-core Lamb vortex moving downstream with its axis perpendicular to the flow are presented in graphs, and the possibility of extending the method to three-dimensional, viscous, and shock flows is discussed.

  6. CFD code comparison for 2D airfoil flows

    DEFF Research Database (Denmark)

    Sørensen, Niels N.; Méndez, B.; Muñoz, A.

    2016-01-01

    The current paper presents the effort, in the EU AVATAR project, to establish the necessary requirements to obtain consistent lift over drag ratios among seven CFD codes. The flow around a 2D airfoil case is studied, for both transitional and fully turbulent conditions at Reynolds numbers of 3...... × 106 and 15 × 106. The necessary grid resolution, domain size, and iterative convergence criteria to have consistent results are discussed, and suggestions are given for best practice. For the fully turbulent results four out of seven codes provide consistent results. For the laminar...

  7. CFD modeling of dust dispersion through Najaf historic city centre

    Directory of Open Access Journals (Sweden)

    Maher A.R. Sadiq Al-Baghdadi

    2014-01-01

    Full Text Available The aim of this project is to study the influences of the wind flow and dust particles dispersion through Najaf historic city centre. Two phase Computational Fluid Dynamics (CFD model using a Reynolds Average Navier Stokes (RANS equations has been used to simulate the wind flow and the transport and dispersion of the dust particles through the historic city centre. This work may provide useful insight to urban designers and planners interested in examining the variation of city breathability as a local dynamic morphological parameter with the local building packing density.

  8. Prediction of Hyper-X Stage Separation Aerodynamics Using CFD

    Science.gov (United States)

    Buning, Pieter G.; Wong, Tin-Chee; Dilley, Arthur D.; Pao, Jenn L.

    2000-01-01

    The NASA X-43 "Hyper-X" hypersonic research vehicle will be boosted to a Mach 7 flight test condition mounted on the nose of an Orbital Sciences Pegasus launch vehicle. The separation of the research vehicle from the Pegasus presents some unique aerodynamic problems, for which computational fluid dynamics has played a role in the analysis. This paper describes the use of several CFD methods for investigating the aerodynamics of the research and launch vehicles in close proximity. Specifically addressed are unsteady effects, aerodynamic database extrapolation, and differences between wind tunnel and flight environments.

  9. Modeling chemical reactions in the indoor environment by CFD

    DEFF Research Database (Denmark)

    Sørensen, Dan Nørtoft; Weschler, Charles J.

    2002-01-01

    The concentrations of ozone and a terpene that react in the gas-phase to produce a hypothetical product were investigated by computational fluid dynamics (CFD) for two different air exchange rates. Ozone entered the room with the ventilation air. The terpenes were introduced as a localized source...... with an emission pattern similar to an air freshener; this was in contrast to an otherwise identical earlier study in which the terpene was introduced as a floor source with an emission pattern similar to a floor care product (Sørensen and Weschler, 2002). The results show that there are large concentration...

  10. 3D CFD analysis of a twin screw expander

    OpenAIRE

    Kovacevic, A.; S Rane

    2013-01-01

    Twin screw machines can be used as expanders for variety of applications. This paper describes how the performance of an oil free twin screw air expander of 3/5 lobe configuration was estimated by use of full 3D Computational Fluid Dynamics (CFD) applying a procedure similar to that used for screw compressors. The grid generator SCORG© was employed for pre-processing of the moving domains between the rotors while the stationary grids for the ports were derived from a commercial grid generator...

  11. Automation of the CFD Process on Distributed Computing Systems

    Science.gov (United States)

    Tejnil, Ed; Gee, Ken; Rizk, Yehia M.

    2000-01-01

    A script system was developed to automate and streamline portions of the CFD process. The system was designed to facilitate the use of CFD flow solvers on supercomputer and workstation platforms within a parametric design event. Integrating solver pre- and postprocessing phases, the fully automated ADTT script system marshalled the required input data, submitted the jobs to available computational resources, and processed the resulting output data. A number of codes were incorporated into the script system, which itself was part of a larger integrated design environment software package. The IDE and scripts were used in a design event involving a wind tunnel test. This experience highlighted the need for efficient data and resource management in all parts of the CFD process. To facilitate the use of CFD methods to perform parametric design studies, the script system was developed using UNIX shell and Perl languages. The goal of the work was to minimize the user interaction required to generate the data necessary to fill a parametric design space. The scripts wrote out the required input files for the user-specified flow solver, transferred all necessary input files to the computational resource, submitted and tracked the jobs using the resource queuing structure, and retrieved and post-processed the resulting dataset. For computational resources that did not run queueing software, the script system established its own simple first-in-first-out queueing structure to manage the workload. A variety of flow solvers were incorporated in the script system, including INS2D, PMARC, TIGER and GASP. Adapting the script system to a new flow solver was made easier through the use of object-oriented programming methods. The script system was incorporated into an ADTT integrated design environment and evaluated as part of a wind tunnel experiment. The system successfully generated the data required to fill the desired parametric design space. This stressed the computational

  12. Application of CFD based wave loads in aeroelastic calculations

    DEFF Research Database (Denmark)

    Schløer, Signe; Paulsen, Bo Terp; Bredmose, Henrik

    2014-01-01

    realizations compare well with corresponding surface elevations from laboratory experiments. In aeroelastic calculations of an offshore wind turbine on a monopile foundation the hydrodynamic loads due to the potential flow solver and Morison’s equation and the hydrodynamic loads calculated by the coupled......Two fully nonlinear irregular wave realizations with different significant wave heights are considered. The wave realizations are both calculated in the potential flow solver Ocean-Wave3D and in a coupled domain decomposed potential-flow CFD solver. The surface elevations of the calculated wave...

  13. CFD Studies on Multi Lead Rifled [MLR] Boiler Tubes

    Directory of Open Access Journals (Sweden)

    Dr T C Mohankumar

    2013-09-01

    Full Text Available This paper reports the merits of multi lead rifled [MLR] tubes in vertical water tube boiler using CFD tool. Heat transfer enhancement of MLR tubes was mainly taken in to consideration. Performance of multi lead rifled tube was studied by varying its influencing geometrical parameter like number of rifling, height of rifling, length of pitch of rifling for a particular length. The heat transfer analysis was done at operating conditions of an actual coal fired water tube boiler situated at Apollo Tyres LTD, Chalakudy, India for saturated process steam production. The results showed that the heat transfer increased when compared with existing inner plane wall water tubes.

  14. Comportamiento de la biomasa y de las tasas de crecimiento de dos variedades de lulo (Solanum quitoense Lam. en Pachavita, Boyacá

    Directory of Open Access Journals (Sweden)

    Pedro José Almanza-Merchán

    2016-01-01

    Full Text Available Se estudió la dinámica del crecimiento y desarrollo del fruto de dos variedades de lulo (chonto grueso y criollo bajo las condiciones del municipio de Pachavita (Boyacá. Se evaluaron la biomasa seca y las tasas de Crecimiento Absoluto (TAC y de Crecimiento Relativa (TRC. Los frutos de las dos variedades presentaron crecimiento tipo sigmoide simple, con tres fases que se describieron como: FI (división celular, FII (elongación celular y FIII (maduración. La variedad Chonto grueso mostró un incremento exponencial en la TAC, que abarcó la FI y parte de la FII, hasta los 78 días después de antesis (dda, cuando alcanzó su mayor valor, de 0,117 g/día, y una rápida ganancia de masa seca hasta este punto; luego disminuyó hasta la cosecha. La variedad Criollo mostró un aumento lento en la FI, que fue progresivo hasta llegar a su máximo valor a los 128 dda, acumulando 0,107 g/día, lo que implicó un aumento de tamaño más lento en el tiempo; demostrando mayor poder vertedero inicial en la variedad Chonto grueso, respecto a la variedad Criollo, en términos de materia seca. La TRC para la variedad Chonto grueso mostró una lenta disminución en la FI, reduciéndose drásticamente en la FII y lentamente en la FIII; en tanto que la variedad Criollo mostró un descenso gradual y constante hasta los 140 dda. Se estableció, para la variedad Chonto grueso en la FIII, y en general para la variedad Criollo, una baja tasa de variación del tamaño por unidad de tamaño inicial.

  15. CFD Analysis of the Effect on Buoyancy Due to Terrain Temperature Based on an Integrated DEM and Landsat Infrared Imagery Análisis CFD de vientos convectivos naturales debidos a la temperatura de un terreno basado en un modelo DEM integrado con imágenes infrarrojas Landsat

    Directory of Open Access Journals (Sweden)

    Santiago Giraldo

    2008-12-01

    aire sobre la superficie del terreno (Dominio CFD. Datos obtenidos de la misión satelital Landsat fueron utilizados para establecer temperaturas sobre el terreno para distintos materiales y fue mapeada sobre el terreno utilizando técnicas de interpolación. Las ecuaciones de Navier–Stokes fueron solucionadas para modelos de fenómenos de convección natural con efectos de flujo turbulento de fluidos compresibles, tomando en cuenta efectos convectivos y de transferencia de calor. La simulación incluye convección y condiciones de turbulencia bajo el modelo k–epsilon utilizando las instalaciones de computaci´on de alto desempeño de Westgrid (Western Canada Research Grid. Los resultados preliminares muestran distribuciones de viento comparables a las observadas en la región de baja altitud

  16. Comparison of CFD Predictions with Shuttle Global Flight Thermal Imagery and Discrete Surface Measurements

    Science.gov (United States)

    Wood, William A.; Kleb, William L.; Tang, chun Y.; Palmer, Grant E.; Hyatt, Andrew J.; Wise, Adam J.; McCloud, Peter L.

    2010-01-01

    Surface temperature measurements from the STS-119 boundary-layer transition experiment on the space shuttle orbiter Discovery provide a rare opportunity to assess turbulent CFD models at hypersonic flight conditions. This flight data was acquired by on-board thermocouples and by infrared images taken off-board by the Hypersonic Thermodynamic Infrared Measurements (HYTHIRM) team, and is suitable for hypersonic CFD turbulence assessment between Mach 6 and 14. The primary assessment is for the Baldwin-Lomax and Cebeci-Smith algebraic turbulence models in the DPLR and LAURA CFD codes, respectively. A secondary assessment is made of the Shear-Stress Transport (SST) two-equation turbulence model in the DPLR code. Based upon surface temperature comparisons at eleven thermocouple locations, the algebraic-model turbulent CFD results average 4% lower than the measurements for Mach numbers less than 11. For Mach numbers greater than 11, the algebraic-model turbulent CFD results average 5% higher than the three available thermocouple measurements. Surface temperature predictions from the two SST cases were consistently 3 4% higher than the algebraic-model results. The thermocouple temperatures exhibit a change in trend with Mach number at about Mach 11; this trend is not reflected in the CFD results. Because the temperature trends from the turbulent CFD simulations and the flight data diverge above Mach 11, extrapolation of the turbulent CFD accuracy to higher Mach numbers is not recommended.

  17. Design of 500kW grate fired test facility using CFD

    DEFF Research Database (Denmark)

    Rosendahl, Lasse Aistrup; Kær, Søren Knudsen; Jørgensen, K.

    2005-01-01

    A 500kW vibrating grate fired test facility for solid biomass fuels has been designed using numerical models including CFD. The CFD modelling has focussed on the nozzle layout and flowpatterns in the lower part of the furnace, and the results have established confidence in the chosen design...

  18. iCFD: Interpreted Computational Fluid Dynamics – Degeneration of CFD to one-dimensional advection-dispersion models using statistical experimental design – The secondary clarifier

    DEFF Research Database (Denmark)

    Guyonvarch, Estelle; Ramin, Elham; Kulahci, Murat;

    2015-01-01

    both in 2-D and 1-D was undertaken. Results suggest that the iCFD model developed for the SST through the proposed methodology is able to predict solid distribution with high accuracy – taking a reasonable computational effort – when compared to multi-dimensional numerical experiments, under a wide...... range of flow and design conditions. iCFD tools could play a crucial role in reliably predicting systems' performance under normal and shock events....

  19. Application of CFD Codes in Nuclear Reactor Safety Analysis

    Directory of Open Access Journals (Sweden)

    T. Höhne

    2010-01-01

    Full Text Available Computational Fluid Dynamics (CFD is increasingly being used in nuclear reactor safety (NRS analyses as a tool that enables safety relevant phenomena occurring in the reactor coolant system to be described in more detail. Numerical investigations on single phase coolant mixing in Pressurised Water Reactors (PWR have been performed at the FZD for almost a decade. The work is aimed at describing the mixing phenomena relevant for both safety analysis, particularly in steam line break and boron dilution scenarios, and mixing phenomena of interest for economical operation and the structural integrity. For the experimental investigation of horizontal two phase flows, different non pressurized channels and the TOPFLOW Hot Leg model in a pressure chamber was build and simulated with ANSYS CFX. In a common project between the University of Applied Sciences Zittau/Görlitz and FZD the behaviour of insulation material released by a LOCA released into the containment and might compromise the long term emergency cooling systems is investigated. Moreover, the actual capability of CFD is shown to contribute to fuel rod bundle design with a good CHF performance.

  20. Analysis of a waste-heat boiler by CFD simulation

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Yongziang; Jokilaakso, A. [Helsinki Univ. of Technology, Otaniemi (Finland)

    1996-12-31

    Waste-heat boilers play important roles in the continuous operation of a smelter and in the conservation of energy. However, the fluid flow and heat transfer behaviour has not been well studied, concerning the boiler performance and design. This presentation describes simulated gas flow and heat transfer of a waste-heat boiler in the Outokumpu copper flash smelting process. The governing transport equations for the conservation of mass, momentum and enthalpy were solved with a commercial CFD-code PHOENICS. The standard k-{epsilon} turbulence model and a composite-flux radiation model were used in the computations. The computational results show that the flow is strongly recirculating and distinctly three-dimensional in most part of the boiler, particularly in the radiation section. The predicted flow pattern and temperature distribution were in a good agreement with laboratory models and industrial measurements. The results provide detailed information of flow pattern, the temperature distribution and gas cooling efficiency. The CFD proved to be a useful tool in analysing the boiler operation. (author)

  1. Optimization of Hydraulic Machinery Bladings by Multilevel CFD Techniques

    Directory of Open Access Journals (Sweden)

    Thum Susanne

    2005-01-01

    Full Text Available The numerical design optimization for complex hydraulic machinery bladings requires a high number of design parameters and the use of a precise CFD solver yielding high computational costs. To reduce the CPU time needed, a multilevel CFD method has been developed. First of all, the 3D blade geometry is parametrized by means of a geometric design tool to reduce the number of design parameters. To keep geometric accuracy, a special B-spline modification technique has been developed. On the first optimization level, a quasi-3D Euler code (EQ3D is applied. To guarantee a sufficiently accurate result, the code is calibrated by a Navier-Stokes recalculation of the initial design and can be recalibrated after a number of optimization steps by another Navier-Stokes computation. After having got a convergent solution, the optimization process is repeated on the second level using a full 3D Euler code yielding a more accurate flow prediction. Finally, a 3D Navier-Stokes code is applied on the third level to search for the optimum optimorum by means of a fine-tuning of the geometrical parameters. To show the potential of the developed optimization system, the runner blading of a water turbine having a specific speed n q = 41 1 / min was optimized applying the multilevel approach.

  2. Cavitation modeling for steady-state CFD simulations

    Science.gov (United States)

    Hanimann, L.; Mangani, L.; Casartelli, E.; Widmer, M.

    2016-11-01

    Cavitation in hydraulic turbomachines is an important phenomenon to be considered for performance predictions. Correct analysis of the cavitation onset and its effect on the flow field while diminishing the pressure level need therefore to be investigated. Even if cavitation often appears as an unsteady phenomenon, the capability to compute it in a steady state formulation for the design and assessment phase in the product development process is very useful for the engineer. In the present paper the development and corresponding application of a steady state CFD solver is presented, based on the open source toolbox OpenFOAM®. In the first part a review of different cavitation models is presented. Adopting the mixture-type cavitation approach, various models are investigated and developed in a steady state CFD RANS solver. Particular attention is given to the coupling between cavitation and turbulence models as well as on the underlying numerical procedure, especially the integration in the pressure- correction step of pressure-based solvers, which plays an important role in the stability of the procedure. The performance of the proposed model is initially assessed on simple cases available in the open literature. In a second step results for different applications are presented, ranging from airfoils to pumps.

  3. CFD simulation of bubbly turbulent Tayor-Couette flow☆

    Institute of Scientific and Technical Information of China (English)

    Xi Gao; Bo Kong; R. Dennis Vigil

    2016-01-01

    Bubbly gas–liquid Taylor–Couette vortex flow has been the subject of several recent investigations both because of interest in bubble-induced drag reduction and because such devices have potential applications to a variety of chemical and biochemical processing problems. In order to quantitatively describe the hydrodynamics of highly turbulent two phase Taylor–Couette flow, a rigorous two-fluid computational fluid dynamics (CFD) model was developed and compared with previously published experimental data. This model includes a comprehensive description of the constitutive closure for inter-phase forces and turbulence was simulated using both the k–εand k–ωmodels. In addition, the mechanism by which the dispersed fluid attains a non-uniform radial and axial distribution is analyzed and the relative importance of various interphase forces is discussed. Lastly the model was validated by comparison of simulation predictions with experimental data, and it is shown that the CFD model correctly predicts phase velocity, velocity fluctuation, and gas distribution, and may provide guidance for reactor design and scale-up.

  4. Pressure pulsation in Kaplan turbines: Prototype-CFD comparison

    Science.gov (United States)

    Rivetti, A.; Lucino1, C.; Liscia, S.; Muguerza, D.; Avellan, F.

    2012-11-01

    Pressure pulsation phenomena in a large Kaplan turbine are investigated by means of numerical simulations (CFD) and prototype measurements in order to study the dynamic behavior of flow due to the blade passage and its interaction with other components of the turbine. Numerical simulations are performed with the commercial software Ansys CFX code, solving the incompressible Unsteady Reynolds-Averaged-Navier Stokes equations under a finite volume scheme. The computational domain involves the entire machine at prototype scale. Special care is taken in the discretization of the wicket gate overhang and runner blade gap. Prototype measurements are performed using pressure transducers at different locations among the wicket gate outlet and the draft tube inlet. Then, CFD results are compared with temporary signals of prototype measurements at identical locations to validate the numerical model. A detailed analysis was focused on the tip gap flow and the pressure field at the discharge ring. From a rotating reference frame perspective, it is found that the mean pressure fluctuates accordingly the wicket gate passage. Moreover, in prototype measurements the pressure frequency that reveals the presence of modulated cavitation at the discharge ring is distinguished, as also verified from the shape of erosion patches in concordance with the number of wicket gates.

  5. Study of Swirl and Tumble Motion using CFD

    Directory of Open Access Journals (Sweden)

    Abhilash M Bharadwaj

    2013-06-01

    Full Text Available The call for environmentally compatible and economical vehicles, still satisfying demands for high performance, necessitates immense efforts to develop innovative engine concepts. In an Internal Combustion Engine the performance, efficiency and emission formation depends on the formation of air-fuel mixture inside the engine cylinder. The fluid flow dynamics plays an important role for air-fuel mixture preparation to obtain the better engine combustion, performance and efficiency. Due to the extreme conditions inside a typical IC-engine (high combustion temperatures and pressures, precipitation of soot and other combustion products, etc. experimental techniques are sometimes limited in approaching the above mentioned problem. Alternatively, computer simulations (Computational Fluid Dynamics, CFD offer the opportunity to carry out repetitive parameter studies with clearly defined boundary conditions in order to investigate various configurations. We investigate two important, common fluid flow patterns from computational fluid dynamics (CFD simulations, namely, swirl and tumble motion typical of automotive engines. These two parameters represents the fluid flow behaviors occurred inside combustion chamber which influences the air streams to the cylinder during intake stroke and enhances greatly the mixing of air and fuel to give better mixing during compression stoke. In this study we are concerned on the swirl motion of inducted air during the suction stroke and during compression stroke. The results obtain from the numerical analysis can be employed to examine the homogeneity of air-fuel mixture structure for better combustion process and engine performance.

  6. Displaying CFD Solution Parameters on Arbitrary Cut Planes

    Science.gov (United States)

    Pao, S. Paul

    2008-01-01

    USMC6 is a Fortran 90 computer program for post-processing in support of visualization of flows simulated by computational fluid dynamics (CFD). The name "USMC6" is partly an abbreviation of "TetrUSS - USM3D Solution Cutter," reflecting its origin as a post-processor for use with USM3D - a CFD program that is a component of the Tetrahedral Unstructured Software System and that solves the Navier-Stokes equations on tetrahedral unstructured grids. "Cutter" here refers to a capability to acquire and process solution data on (1) arbitrary planes that cut through grid volumes, or (2) user-selected spheroidal, conical, cylindrical, and/or prismatic domains cut from within grids. Cutting saves time by enabling concentration of post-processing and visualization efforts on smaller solution domains of interest. The user can select from among more than 40 flow functions. The cut planes can be trimmed to circular or rectangular shape. The user specifies cuts and functions in a free-format input file using simple and easy-to-remember keywords. The USMC6 command line is simple enough that the slicing process can readily be embedded in a shell script for assembly-line post-processing. The output of USMC6 is a data file ready for plotting.

  7. CFD model simulation of LPG dispersion in urban areas

    Science.gov (United States)

    Pontiggia, Marco; Landucci, Gabriele; Busini, Valentina; Derudi, Marco; Alba, Mario; Scaioni, Marco; Bonvicini, Sarah; Cozzani, Valerio; Rota, Renato

    2011-08-01

    There is an increasing concern related to the releases of industrial hazardous materials (either toxic or flammable) due to terrorist attacks or accidental events in congested industrial or urban areas. In particular, a reliable estimation of the hazardous cloud footprint as a function of time is required to assist emergency response decision and planning as a primary element of any Decision Support System. Among the various hazardous materials, the hazard due to the road and rail transportation of liquefied petroleum gas (LPG) is well known since large quantities of LPG are commercialized and the rail or road transportation patterns are often close to downtown areas. Since it is well known that the widely-used dispersion models do not account for the effects of any obstacle like buildings, tanks, railcars, or trees, in this paper a CFD model has been applied to simulate the reported consequences of a recent major accident involving an LPG railcar rupture in a congested urban area (Viareggio town, in Italy), showing both the large influence of the obstacles on LPG dispersion as well as the potentials of CFD models to foresee such an influence.

  8. CFD Modeling of Particulate Matter Dispersion from Kerman Cement Plant

    Directory of Open Access Journals (Sweden)

    M. Panahandeh

    2010-04-01

    Full Text Available "n "n "nBackgrounds and Objectives: The dispersion of particulate matter has been known as the most serious environmental pollution of cement plants. In the present work, dispersion of the particulate matter from stack of Kerman Cement Plant was investigated using Computational Fluid Dynamics (CFD modeling."nMaterials and Methods: In order to study the dispersion of particulate matter from the stack, a calculation domain with dimensions of 8000m × 800m × 400m was considered. The domain was divided to 936781 tetrahedral control volumes. The mixture two-phase model was employed to model the interaction of the particulate matter (dispersed phase and air (continuous phase. The Large Eddy Simulation (LES method was used for turbulence modeling."nResults: The concentration of particulate matter in the whole calculation domain was computed. The predicted concentrations were compared to the measured values from the literature and a good agreement was observed. The predicted concentration profiles at different cross sections were analyzed."nConclusion:The results of the present work showed that CFD is a useful tool for understanding the dispersion of particulate matter in air. Although the obtained results were promising, more investigations on the properties of the dispersed phase, turbulent parameters and the boundary layer effect is needed to obtain more accurate results.

  9. OPTIMIZATION OF A WAVE CANCELLATION MULTIHULL SHIP USING CFD TOOLS

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    A simple CFD tool, coupled to a discrete surface representation and a gradient-based optimization procedure, is applied to the design of optimal hull forms and optimal arrangement of hulls for a wave cancellation multihull ship. The CFD tool, which is used to estimate the wave drag, is based on the zeroth-order slender ship approximation. The hull surface is represented by a triangulation, and almost every grid point on the surface can be used as a design variable. A smooth surface is obtained via a simplified pseudo-shell problem. The optimal design process consists of two steps. The optimal center and outer hull forms are determined independently in the first step, where each hull forms are determined independently in the first step, where each hull keeps the same displacement as the original design while the wave drag is minimized. The optimal outer-hull arrangement is determined in the second step for the optimal center and outer hull forms obtained in the first step. Results indicate that the new design can achieve a large wave drag reduction in comparison to the original design configuration.

  10. Design Optimization of Diesel Particulate Filter Using CFD

    Directory of Open Access Journals (Sweden)

    Mr. Y. Rajasekhar Reddy

    2015-12-01

    Full Text Available The diesel particulate filter (DPF is a device designed to remove diesel particulate matter or soot from the exhaust gas of a diesel engine. A series of tests have been performed on a downscaled DPF prototype. This prototype had high filtration efficiency. Then the next step is to study the soot and ash handling capacity of DPF system and perform tests on a full-scale prototype. In order to move forward to the next step the functionality of the filter should be investigated. Moreover, a complete model of flow inside the filter can help parameter investigation on both downscale and full-scale prototype. Building up a CFD model using fluent which is capable to simulate the flow through all channels and porous media of the filter plates and tuning the pressure drop parameters for all steps of filtration from clean filter to dirty one are the main achievements of this project. CFD results have been tuned by using experimental data of filtration tests.

  11. Study of Swirl and Tumble Motion using CFD

    Directory of Open Access Journals (Sweden)

    Aravind T

    2012-08-01

    Full Text Available The call for environmentally compatible and economical vehicles, still satisfying demands for high performance, necessitates immense efforts to develop innovative engine concepts. In an Internal Combustion Engine the performance, efficiency and emission formation depends on the formation of air-fuel mixture inside the engine cylinder. The fluid flow dynamics plays an important role for air-fuel mixture preparation to obtain the better engine combustion, performance and efficiency. Due to the extreme conditions inside a typical IC-engine (high combustion temperatures and pressures, precipitation of soot and other combustion products, etc. experimental techniques are sometimes limited in approaching the above mentioned problem. Alternatively, computer simulations (Computational Fluid Dynamics, CFD offer the opportunity to carry out repetitive parameter studies with clearly defined boundary conditions in order to investigate various configurations. We investigate two important, common fluid flow patterns from computational fluid dynamics (CFD simulations, namely, swirl and tumble motion typical of automotive engines. These two parameters represents the fluid flow behaviors occurred inside combustion chamber which influences the air streams to the cylinder during intake stroke and enhances greatly the mixing of air and fuel to give better mixing during compression stoke. In this study we are concerned on the swirl motion of inducted air during the suction stroke and during compression stroke. The results obtain from the numerical analysis can be employed to examine the homogeneity of air-fuel mixture structure for better combustion process and engine performance.

  12. CFD Extraction of Heat Transfer Coefficient in Cryogenic Propellant Tanks

    Science.gov (United States)

    Yang, H. Q.; West, Jeff

    2015-01-01

    Current reduced-order thermal model for cryogenic propellant tanks is based on correlations built for flat plates collected in the 1950's. The use of these correlations suffers from inaccurate geometry representation; inaccurate gravity orientation; ambiguous length scale; and lack of detailed validation. This study uses first-principles based CFD methodology to compute heat transfer from the tank wall to the cryogenic fluids and extracts and correlates the equivalent heat transfer coefficient to support reduced-order thermal model. The CFD tool was first validated against available experimental data and commonly used correlations for natural convection along a vertically heated wall. Good agreements between the present prediction and experimental data have been found for flows in laminar as well turbulent regimes. The convective heat transfer between the tank wall and cryogenic propellant, and that between the tank wall and ullage gas were then simulated. The results showed that the commonly used heat transfer correlations for either vertical or horizontal plate over-predict heat transfer rate for the cryogenic tank, in some cases by as much as one order of magnitude. A characteristic length scale has been defined that can correlate all heat transfer coefficients for different fill levels into a single curve. This curve can be used for the reduced-order heat transfer model analysis.

  13. CFD simulation of a 300 Hz thermoacoustic standing wave engine

    Science.gov (United States)

    Yu, Guoyao; Dai, W.; Luo, Ercang

    2010-09-01

    High frequency operation of standing wave thermoacoustic heat engines is attractive for space applications due to compact size and high reliability. To expedite practical use, further improvement and optimization should be based on deep understanding and quantitative analysis. This article focuses on using computational fluid dynamics (CFD) to investigate nonlinear phenomena and processes of a 300 Hz standing wave thermoacoustic engine (SWTE). The calculated model was tested in detail, which indicated that the co-axially stacked tube model was suitable for the simulation of SWTEs. Two methods of imposing temperature gradient across the stack were studied, and the processes of mean pressure increasing, pressure wave amplification and saturation were obtained under the thermal boundary condition of applying heating power. The acoustic fields were given, and the flow vortices and their evolution in both ends of the stack and resonator were observed. Moreover, a comparison between the simulation and experiments was made, which demonstrated the validity and power of the CFD simulation for characterizing complicated nonlinear phenomenon involved in the self-excited SWTEs.

  14. Hypersonic simulations using open-source CFD and DSMC solvers

    Science.gov (United States)

    Casseau, V.; Scanlon, T. J.; John, B.; Emerson, D. R.; Brown, R. E.

    2016-11-01

    Hypersonic hybrid hydrodynamic-molecular gas flow solvers are required to satisfy the two essential requirements of any high-speed reacting code, these being physical accuracy and computational efficiency. The James Weir Fluids Laboratory at the University of Strathclyde is currently developing an open-source hybrid code which will eventually reconcile the direct simulation Monte-Carlo method, making use of the OpenFOAM application called dsmcFoam, and the newly coded open-source two-temperature computational fluid dynamics solver named hy2Foam. In conjunction with employing the CVDV chemistry-vibration model in hy2Foam, novel use is made of the QK rates in a CFD solver. In this paper, further testing is performed, in particular with the CFD solver, to ensure its efficacy before considering more advanced test cases. The hy2Foam and dsmcFoam codes have shown to compare reasonably well, thus providing a useful basis for other codes to compare against.

  15. Computational Fluid Dynamics (CFD Analysis of Natural Convection of Convergent-Divergent Fins in Marine Environments

    Directory of Open Access Journals (Sweden)

    K. Alawadhi

    2014-12-01

    Full Text Available Computational Fluid Dynamics (CFD analysis was carried out for the convergent-divergent fins arranged inline and staggered on the base plate as per the experimental setup provided in the technical paper [1]. This paper reports on the validation of results of modeling and simulation in CFD. The simulation was carried out using the ANSYS 12.0 as the CFD modeling software. The main objective of the CFD analysis was to calculate the temperature distribution on the surface of the base plate and surface of the convergent-divergent fins for the given inline and staggered arrangement of fins due to the effect of natural convection heat transfer for different heat power inputs, and also to compare the CFD results with the experimental results.

  16. Assessment of Computational Fluid Dynamics (CFD) Models for Shock Boundary-Layer Interaction

    Science.gov (United States)

    DeBonis, James R.; Oberkampf, William L.; Wolf, Richard T.; Orkwis, Paul D.; Turner, Mark G.; Babinsky, Holger

    2011-01-01

    A workshop on the computational fluid dynamics (CFD) prediction of shock boundary-layer interactions (SBLIs) was held at the 48th AIAA Aerospace Sciences Meeting. As part of the workshop numerous CFD analysts submitted solutions to four experimentally measured SBLIs. This paper describes the assessment of the CFD predictions. The assessment includes an uncertainty analysis of the experimental data, the definition of an error metric and the application of that metric to the CFD solutions. The CFD solutions provided very similar levels of error and in general it was difficult to discern clear trends in the data. For the Reynolds Averaged Navier-Stokes methods the choice of turbulence model appeared to be the largest factor in solution accuracy. Large-eddy simulation methods produced error levels similar to RANS methods but provided superior predictions of normal stresses.

  17. Effect of variety and cane yield on sugarcane potential trash Efecto de las variedades y su rendimiento cultural en la biomasa residual potencial

    Directory of Open Access Journals (Sweden)

    Eduardo R. Romero

    , conservando el suelo y ofreciendo una posibilidad para la generación de energía. Una estimación del potencial de residuos disponible de la caña de azúcar cobra gran relevancia en el momento de definir estrategias de manejo. Se realizó un estudio para determinar la cantidad de biomasa residual disponible en los cañaverales en forma previa (SPT y posterior (SFT a la cosecha mecanizada en verde para las principales variedades cultivadas en la provincia de Tucumán (LCP 85-384, TUCCP 77-42, CP 65-357 y RA 87-3. Además, se estudió la relación entre SPT y SFT a fin de validar la precisión de SPT como predictor de SFT en el caso de la cosecha integral en verde. El incremento del SPT estuvo asociado al mayor rendimiento cultural/ha, registrándose valores del 6,9 a 16,0 t/ha de biomasa residual para rendimientos culturales de 32 a 104 t/ha. LCP 85-384 y CP 65-357 produjeron el mayor SPT, mientras que TUCCP 77-42 generó la menor cantidad para niveles similares de rendimiento cultural. La relación SPT/CY disminuyó y el promedio general fue del 16% del rendimiento cultural, aunque su uso para estimar SPT fue limitado, como señalan los bajos coeficientes de determinación. SPT predijo adecuadamente SFT para el caso de la cosecha integral en verde, y el primero puede ser estimado adecuadamente empleando el rendimiento cultural/ha.

  18. Efecto de la sequía en la producción de biomasa y grano de frijol Drought effect in bean biomass and grain production

    Directory of Open Access Journals (Sweden)

    Efraín Acosta-Díaz

    2011-04-01

    Full Text Available La sequía intermitente es el factor que más limita la producción de frijol (Phaseolus vulgaris L. bajo temporal en México. El objetivo fue determinar el efecto de la sequía sobre la acumulación de biomasa del vástago y el rendimiento de grano en variedades criollas e introducidas de frijol de temporal. Se establecieron dos experimentos, uno con 21 variedades nativas y otro con 15 variedades introducidas, de diferente hábito de crecimiento indeterminado, en la Unidad Académica La Ascensión de la Facultad de Agronomía de la Universidad Autónoma de Nuevo León, México en 2009. Los experimentos se condujeron bajo dos tratamientos de humedad del suelo: riego durante todo el ciclo y sequía. En el tratamiento de riego el suelo se mantuvo por encima de 60% de humedad aprovechable durante el ciclo del cultivo, mediante la precipitación y cuatro riegos de auxilio (dos antes y otros dos después de floración, mientras que en el tratamiento de sequía el riego se suspendió a partir del inicio de la floración. En los dos experimentos, bajo la condición de sequía la acumulación de biomasa del vástago y el rendimiento de grano fue significativamente inferior (p≤ 0.01 que en el tratamiento de riego. En general, el efecto del tratamiento de sequía sobre el peso seco del vástago fue mayor en las variedades nativas, mientras que el efecto sobre el rendimiento de grano fue mayor en las variedades introducidas. En sequía, las variedades de mayor rendimiento, fueron: nativas, Pinto-2, Pinto-1, Amarillo Mantequilla, Boleado, Bayo Blanco, Canelo y Quipincillo Rojo-1 e introducidas, Peruano, Flor de Mayo Media Oreja, Pinto-5 y Ojo de Cabra. De acuerdo con el índice de susceptibilidad a la sequía y la media geométrica, las variedades más eficientes para la producción de rendimiento de grano en ambas condiciones de humedad fueron: Pinto-2, Amarillo Mantequilla, Pinto-1, Boleado, Peruano, Flor de Mayo Media Oreja, Pinto-5 y Ojo de Cabra; sin

  19. CFD SIMULATIONS OF JOINT URBAN ATMOSPHERE DISPERSION FIELD STUDY 2003

    Energy Technology Data Exchange (ETDEWEB)

    Lee, R L; Humphreys, T D; Chan, S T

    2004-03-31

    In the Spring of 2003, a series of dispersion field experiments (Joint Urban 2003) were conducted at Oklahoma City. These experiments were complimentary to the URBAN 2000 field studies at Salt Lake City (Allwine, et. al, 2002) in that they will provide a second set of comprehensive field data for evaluation of CFD as well as for other dispersion models. In contrast to the URBAN 2000 experiments that were conducted entirely at night, these new field studies took place during both daytime and nighttime thus including the possibility of convective as well as stable atmospheric conditions. Initially several CFD modeling studies were performed to provide guidance for the experimental team in the selection of release sites and in the deployment of wind and concentration sensors. Also, while meteorological and concentration measurements were taken over the greater Oklahoma City urban area, our CFD calculations were focused on the near field of the release point. The proximity of the source to a large commercial building and to the neighboring buildings several of which have multi-stories, present a significant challenge even for CFD calculations involving grid resolutions as fine as 1 meter. A total of 10 Intensive Observations Periods (IOP's) were conducted within the 2003 field experiments. SF{sub 6} releases in the form of puffs or continuous sources were disseminated over 6 daytime and 4 nighttime episodes. Many wind and concentration sensors were used to provide wind and SF{sub 6} data over both long and short time-averaging periods. In addition to the usual near surface measurements, data depicting vertical profiles of wind and concentrations adjacent to the outside walls several building were also taken. Also of interest were observations of the trajectory of balloons that were released closed to the tracer release area. Many of the balloons released exhibit extremely quick ascents up from ground level to the top of buildings, thus implying highly convective

  20. CFD Verification of 5x5 Rod Bundle with Mixing Vane Spacer Grids

    Energy Technology Data Exchange (ETDEWEB)

    Park, Sungkew; Jang, Hyungwook; Lim, Jongseon; Park, Eungjun; Nahm, Keeyil [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2014-05-15

    Results of the CHF test are used for determining the CHF correlation, which is used to evaluate the thermal margin in the reactor core. Computational fluid dynamics (CFD) has been used to save the time and cost for experimental tests, components design and complicated phenomena in all industries including the reactor coolant system. L. D. Smith et al. applied the CFD methodology in a 5x5 rod bundle with the mixing vane spacer grid using the renormalization group (RNG) k-epsilon model. This CFD model agreed reasonably well with the test data. M. E. Conner et al. conducted experiments to validate the CFD methodology for the single-phase flow conditions in PWR fuel assemblies. In this validation case, the CFD code predicted very similar flow field structures as the test data. In this study, a CFD simulation under single-phase flow condition was conducted for one specific condition in a thermal mixing flow test of 5x5 rod bundle with some mixing vane spacer grids. In this study, a CFD simulation under a single-phase flow condition was conducted for one specific condition in a thermal mixing flow test of 5x5 rod bundle with the mixing vane spacer grids to verify the applicability of the CFD model for predicting the outlet temperature distribution. FLUENT 14.5 Version was used in this CFD analysis. For the successful prediction of the wall bounded turbulent flows, the y+ with 3 prism layers was determined within 5. At this time, k-epsilon standard turbulence model was used. The temperature distribution of CFD for each sub-channel at the outlet region of test bundle showed the difference approximately within 1.1% and 0.2% while comparing to that of test and sub-channel analysis code, respectively.

  1. CFD calculations in high-performance blower design; Einsatz von CFD-Berechnungen bei der Auslegung von Hochleistungsgeblaesen

    Energy Technology Data Exchange (ETDEWEB)

    Rick, W.; Benz, E.; Godichon, A.

    2001-07-01

    ABB is using 3D CFD simulations on the basis of the Navier-Stokes equations for optimizing high-performance blower design. This will also shorten development times. For an exemplary two-stage blower, numeric results are discussed for full load and part load conditions, and integral measured and calculated data are compared. Using the example of a single-stage variant, it is shown how the spiral casing could be better matched to the rotor on the basis of 3D flow calculation. [German] Fuer den Entwurf von Hochleistungsgeblaesen verwendet ABB in zunehmendem Umfang 3-D CFD-Simulationen auf der Basis der Navier-Stokes-Gleichungen um Komponenten sowie deren Abstimmung zu optimieren. Neben der Erzielung eines verbesserten Betriebsverhaltens koennen durch die Reduzierung experimenteller Untersuchungen kuerzere Entwicklungszeiten erreicht werden. Anhand eines zweiflutigen Geblaeses werden numerische Ergebnisse fuer den Voll- und Teillastbetrieb diskutiert und integrale Leistungsdaten von Rechnung und Messung verglichen. Am Beispiel einer einflutigen Variante wird gezeigt, wie auf der Basis einer 3-D Stroemungsberechnung eine verbesserte Anpassung des Spiralgehaeuses zum Laufrad erzielt werden konnte. (orig.)

  2. Inoculación de Burkholderia cepacia y Gluconacetobacter diazotrophicus sobre la fenología y biomasa de Triticum aestivum var. Nana F2007 a 50% de fertilizante nitrogenado

    Directory of Open Access Journals (Sweden)

    Jesús Jaime Hernández-Escareño

    2015-01-01

    Full Text Available El aumento en el consumo de Triticum aestivum (trigo var Nana-F2007 requiere de la aplicación de fertilizante nitrogenado (FN, como NH4NO3 (nitrato de amonio, él que en exceso causa la pérdida de fertilidad del suelo. Una alternativa para reducir y optimizar la dosis de FN en T. aestivum, es inocular su semilla con géneros de bacterias promotoras del crecimiento vegetal endófitas (BPCVE. Se sugiere que cuando éstas invaden internamente su raíz inducen la síntesis de sustancias promotoras de crecimiento vegetal (SPCV, que mejoran la absorción radical del FN. El objetivo de esta investigación fue evaluar el efecto de inoculación de Burkholderia cepacia y Gluconacetobacter diazotrophicus en la fenología y biomasa de T. aestivum a dosis 50% del FN. En invernadero la semilla de trigo se trató con ambos géneros de BPCVE. Con las variables respuesta: fenología: altura de planta, longitud de raíz y biomasa peso fresco/seco total aéreo y radical a plántula y floración. Los resultados mostraron que B. cepacia en T. aestivum causó un incremento en su peso seco total (PST con 0,61 g, valor estadísticamente significativo comparado con los 0,53 g del PST del trigo control relativo (CR con el FN al 100%. La combinación B. cepacia.-G. diazotrophicus en T. aestivum incrementó su PST con 4,23g, valor estadísticamente significativo comparado con los 1,13 g de PST del T. aestivum (CR. Lo anterior sugiere que B. cepacia y G. diazotrophicus mediante SPCV ejercieron un efecto positivo en la fenología y biomasa de T. aestivum a la dosis 50% del FN para esta variedad.

  3. Application of CFD methods for advanced site assessment and micrositing

    Energy Technology Data Exchange (ETDEWEB)

    Strack, M; Riedel, V.; Dutilleux, P. [DEWI German Wind Energy Inst., Wilhelmshaven (Germany)

    2006-07-01

    The DEWI Institute in Germany is in the process of testing a computational fluid dynamic (CFD) method for the site assessment of wind farms. This presentation provided details of flow model testing conducted at the institute and at 2 wind farms in Austria and Spain. Wind profile verification processes are tested at the institute through the use of 130 metre mast, which was selected to verify flow models as it has several years of data which has been extensively evaluated and checked. The verification procedures tested on the mast were then evaluated at a wind farm in Austria with a complex site comprised of steep slopes, large height differences and important terrain structures. Mast measurements at the farm ranged between 50 and 65 m, and sonic detection and ranging (SODAR) measurements were available at 4 different locations. Wind direction at the meteorological masts was determined to be 326.7 degrees and 331.0 degrees. A comparison with SODAR measurements showed considerable variation of energy yield. Flow simulation studies showed a mean deviation of 2.3 per cent, while calculations by the Wind Atlas Analysis and Application Program (WAsP) showed a deviation of 9.1 per cent. The investigation revealed that there were very complex flow patterns at the site, which the flow simulation was able to reproduce. Results of the investigation indicated that very high wind direction resolutions were required to achieve an accurate flow simulation. WaSP was not applicable for the extrapolation of measurement on hub height to the wind turbines. CFD simulation results at a wind farm in Spain with complex terrain showed a percentage error between 0.4 per cent and 6 per cent, and a mean absolute error of between 2.3 per cent and 2.5 per cent. A verification of turbulence intensity results showed an absolute percentage error of between 0 and 7 per cent, and a mean absolute error of between 1.8 and 2.2 per cent. The method allowed wind and turbulence fields to be simulated over

  4. Application perspectives of simulation techniques CFD in nuclear power plants; Perspectivas de aplicacion de tecnicas de modelado CFD en plantas nucleoelectricas

    Energy Technology Data Exchange (ETDEWEB)

    Galindo G, I. F., E-mail: igalindo@iie.org.mx [Instituto de Investigaciones Electricas, Reforma No. 113, Col. Palmira, 62490 Cuernavaca, Morelos (Mexico)

    2013-10-15

    The scenarios simulation in nuclear power plants is usually carried out with system codes that are based on concentrated parameters networks. However situations exist in some components where the flow is predominantly 3-D, as they are the natural circulation, mixed and stratification phenomena. The simulation techniques of computational fluid dynamics (CFD) have the potential to simulate these flows numerically. The use of CFD simulations embraces many branches of the engineering and continues growing, however, in relation to its application with respect to the problems related with the safety in nuclear power plants, has a smaller development, although is accelerating quickly and is expected that in the future they play a more emphasized paper in the analyses. A main obstacle to be able to achieve a general acceptance of the CFD is that the simulations should have very complete validation studies, sometimes not available. In this article a general panorama of the state of the methods application CFD in nuclear power plants is presented and the problem associated to its routine application and acceptance, including the view point of the regulatory authorities. Application examples are revised in those that the CFD offers real benefits and are also presented two illustrative study cases of the application of CFD techniques. The case of a water recipient with a heat source in its interior, similar to spent fuel pool of a nuclear power plant is presented firstly; and later the case of the Boron dilution of a water volume that enters to a nuclear reactor is presented. We can conclude that the CFD technology represents a very important opportunity to improve the phenomena understanding with a strong component 3-D and to contribute in the uncertainty reduction. (Author)

  5. Computational Methods for HSCT-Inlet Controls/CFD Interdisciplinary Research

    Science.gov (United States)

    Cole, Gary L.; Melcher, Kevin J.; Chicatelli, Amy K.; Hartley, Tom T.; Chung, Joongkee

    1994-01-01

    A program aimed at facilitating the use of computational fluid dynamics (CFD) simulations by the controls discipline is presented. The objective is to reduce the development time and cost for propulsion system controls by using CFD simulations to obtain high-fidelity system models for control design and as numerical test beds for control system testing and validation. An interdisciplinary team has been formed to develop analytical and computational tools in three discipline areas: controls, CFD, and computational technology. The controls effort has focused on specifying requirements for an interface between the controls specialist and CFD simulations and a new method for extracting linear, reduced-order control models from CFD simulations. Existing CFD codes are being modified to permit time accurate execution and provide realistic boundary conditions for controls studies. Parallel processing and distributed computing techniques, along with existing system integration software, are being used to reduce CFD execution times and to support the development of an integrated analysis/design system. This paper describes: the initial application for the technology being developed, the high speed civil transport (HSCT) inlet control problem; activities being pursued in each discipline area; and a prototype analysis/design system in place for interactive operation and visualization of a time-accurate HSCT-inlet simulation.

  6. Validation of NEPTUNE-CFD Two-Phase Flow Models Using Experimental Data

    Directory of Open Access Journals (Sweden)

    Jorge Pérez Mañes

    2014-01-01

    Full Text Available This paper deals with the validation of the two-phase flow models of the CFD code NEPTUNEC-CFD using experimental data provided by the OECD BWR BFBT and PSBT Benchmark. Since the two-phase models of CFD codes are extensively being improved, the validation is a key step for the acceptability of such codes. The validation work is performed in the frame of the European NURISP Project and it was focused on the steady state and transient void fraction tests. The influence of different NEPTUNE-CFD model parameters on the void fraction prediction is investigated and discussed in detail. Due to the coupling of heat conduction solver SYRTHES with NEPTUNE-CFD, the description of the coupled fluid dynamics and heat transfer between the fuel rod and the fluid is improved significantly. The averaged void fraction predicted by NEPTUNE-CFD for selected PSBT and BFBT tests is in good agreement with the experimental data. Finally, areas for future improvements of the NEPTUNE-CFD code were identified, too.

  7. Unstructured Grid Adaptation: Status, Potential Impacts, and Recommended Investments Toward CFD Vision 2030

    Science.gov (United States)

    Park, Michael A.; Krakos, Joshua A.; Michal, Todd; Loseille, Adrien; Alonso, Juan J.

    2016-01-01

    Unstructured grid adaptation is a powerful tool to control discretization error for Computational Fluid Dynamics (CFD). It has enabled key increases in the accuracy, automation, and capacity of some fluid simulation applications. Slotnick et al. provides a number of case studies in the CFD Vision 2030 Study: A Path to Revolutionary Computational Aerosciences to illustrate the current state of CFD capability and capacity. The authors forecast the potential impact of emerging High Performance Computing (HPC) environments forecast in the year 2030 and identify that mesh generation and adaptivity continue to be significant bottlenecks in the CFD work flow. These bottlenecks may persist because very little government investment has been targeted in these areas. To motivate investment, the impacts of improved grid adaptation technologies are identified. The CFD Vision 2030 Study roadmap and anticipated capabilities in complementary disciplines are quoted to provide context for the progress made in grid adaptation in the past fifteen years, current status, and a forecast for the next fifteen years with recommended investments. These investments are specific to mesh adaptation and impact other aspects of the CFD process. Finally, a strategy is identified to diffuse grid adaptation technology into production CFD work flows.

  8. A NOVEL DESIGN OF COMPOSITE WATER TURBINE USING CFD

    Institute of Scientific and Technical Information of China (English)

    WANG Ji-feng; PIECHNA Janusz; M(U)LLER Norbert

    2012-01-01

    This paper presents computational investigation of a novel design of composite material axial water turbine using Computational Fluid Dynamics (CFD).Based on three-dimensional numerical flow analysis,the flow characteristics through the water turbine with nozzle,wheel and diffuser are predicted.The extract power and torque of a composite water turbine at different rotating speeds were calculated and analyzed for a specific flow speed.The simulation results show that using nozzle and diffuser can increase the pressure drop across the turbine and extract more power from available water energy.These results provide a fundamental understanding of the composite water turbine,and this design and analysis method is used in the design process.

  9. Aerodynamics of ski jumping: experiments and CFD simulations

    Energy Technology Data Exchange (ETDEWEB)

    Meile, W.; Reisenberger, E.; Brenn, G. [Graz University of Technology, Institute of Fluid Mechanics and Heat Transfer, Graz (Austria); Mayer, M. [VRVis GmbH, Vienna (Austria); Schmoelzer, B.; Mueller, W. [Medical University of Graz, Department for Biophysics, Graz (Austria)

    2006-12-15

    The aerodynamic behaviour of a model ski jumper is investigated experimentally at full-scale Reynolds numbers and computationally applying a standard RANS code. In particular we focus on the influence of different postures on aerodynamic forces in a wide range of angles of attack. The experimental results proved to be in good agreement with full-scale measurements with athletes in much larger wind tunnels, and form a reliable basis for further predictions of the effects of position changes on the performance. The comparison of CFD results with the experiments shows poor agreement, but enables a clear outline of simulation potentials and limits when accurate predictions of effects from small variations are required. (orig.)

  10. CFD modelling of condensers for freeze-drying processes

    Indian Academy of Sciences (India)

    Miriam Petitti; Antonello A Barresi; Daniele L Marchisio

    2013-12-01

    The aim of the present research is the development of a computational tool for investigating condensation processes and equipment with particular attention to freeze-dryers. These condensers in fact are usually operated at very low pressures, making it difficult to experimentally acquire quantitative knowledge of all the variables involved. Mathematical modelling and CFD (Computational Fluid Dynamics) simulations are used here to achieve a better comprehension of the flow dynamics and of the process of ice condensation and deposition in the condenser, in order to evaluate condenser efficiency and gain deeper insights of the process to be used for the improvement of its design. Both a complete laboratory-scale freeze-drying apparatus and an industrial-scale condenser have been investigated in this work, modelling the process of water vapour deposition. Different operating conditions have been considered and the influence exerted by the inert gas as well as other parameters has been investigated.

  11. Investigating the Role of Wind Turbine Pitch using CFD

    Directory of Open Access Journals (Sweden)

    Sobotta Dorit

    2016-01-01

    Full Text Available Horizontal axis wind turbines are an attractive renewable energy source due to their very low carbon emission during their life cycle. In this study the effect of pitching the rotor blades of the NREL Phase VI rotor has been investigated in detail using CFD in order to allow a detailed torque analysis. Initial investigations have shown that at low rotational speeds the inboard section of the blade is responsible for the majority of the power generation. As the rotational speed increases the power producing section is shifted towards the blade tip. These trends are less pronounced when the blade is pitched which allows the blade to generate significantly more power at low rotational speeds. The improved low speed performance however comes at the cost of a significantly lower maximum power output. These findings are particularly relevant for turbines operating in unfavourable wind environments and for small scale turbines which solely rely on their aerodynamic torque for starting.

  12. CFD simulation on membrane distillation of NaCl solution

    Institute of Scientific and Technical Information of China (English)

    Zhaoguang XU; Yanqiu PAN; Yalan YU

    2009-01-01

    A computational fluid dynamics (CFD) simu-lation that coupled an established heat and mass transfer model was carried out for the air-gap membrane distillation (AGMD) of NaCl solution to predict mass and heat behaviors of the process. The effects of temperature and flowrate on fluxes were first simulated and compared with available experimental data to verify the approach. The profiles of temperature, temperature polarization factor, and mass flux adjacent to the tubular carbon membrane surface were then examined under different feed Reynolds number in the computational domain. Results show that the temperature polarization phenomena can be reduced, and mass flux can be enhanced with increase in the feed Reynolds number.

  13. Engineering-Based Thermal CFD Simulations on Massive Parallel Systems

    KAUST Repository

    Frisch, Jérôme

    2015-05-22

    The development of parallel Computational Fluid Dynamics (CFD) codes is a challenging task that entails efficient parallelization concepts and strategies in order to achieve good scalability values when running those codes on modern supercomputers with several thousands to millions of cores. In this paper, we present a hierarchical data structure for massive parallel computations that supports the coupling of a Navier–Stokes-based fluid flow code with the Boussinesq approximation in order to address complex thermal scenarios for energy-related assessments. The newly designed data structure is specifically designed with the idea of interactive data exploration and visualization during runtime of the simulation code; a major shortcoming of traditional high-performance computing (HPC) simulation codes. We further show and discuss speed-up values obtained on one of Germany’s top-ranked supercomputers with up to 140,000 processes and present simulation results for different engineering-based thermal problems.

  14. CFD Calculations of the Flow Around a Wind Turbine Nacelle

    Energy Technology Data Exchange (ETDEWEB)

    Varela, J.; Bercebal, D. [Ciemat, Madrid (Spain)

    2000-07-01

    The purpose of this work is to identify the influence of a MADE AE30 wind turbine nacelle on the site calibration anemometer placed on the upper back of the nacelle by means of flow simulations around the nacelle using FLUENT, a Commercial Computational Fluid Dynamics code (CFD), which provides modeling capabilities for the simulation of wide range laminar and turbulent fluid flow problems. Different 2D and 3D simulations were accomplished in order to estimate the effects of the complex geometry on the flow behavior. The speed up and braking values of the air flow at the anemometer position are presented for different flow conditions. Finally some conclusions about the accuracy of results are mentioned. (Author) 5 refs.

  15. Exploration of submarine wake and powering performance using CFD method

    Energy Technology Data Exchange (ETDEWEB)

    Huizhi, Y.; Hongcui, S.; Nan, Z.; Renyou, Y.; Liangmei, Y. [China Ship Scientific Research Center, Wuxi, Jiangsu (China)]. E-mail: Yaohuizhi@Yahoo.com

    2005-07-01

    In response to the needs of better design and less time, Computational Fluid Dynamic(CFD) methods have become an impartible part in the ship design, especially in the earlier design phases. In this paper FLUENT software was used to predict the wake character and powering performance of submarine at model scale. By an effective combination of the block topology, grid, turbulence model and validation, the simulation scheme was developed and applied to the predictions of multiple designs and optimizations of the earlier submarine design iterations. The incompressible RANS equations with different turbulence models were solved. To handle the block interface between the propeller and submarine stern, sliding girds in multiple blocks were employed, unstructural grids were used in the block around the propeller. Submarine with/without stator and/or propeller were studied. The flow feature, forces and powering performance at various conditions were calculated. The results were compared with experimental data, and a good agreement was obtained. (author)

  16. Inertisation options for BG method and optimisation using CFD modelling

    Institute of Scientific and Technical Information of China (English)

    Morla Ramakrishna; Balusu Rao; Tanguturi Krishna; Ting Ren

    2015-01-01

    Spontaneous combustion (sponcom) is one of the issues of concern with the blasting gallery (BG) method of coal mining and has the potential to cause fires, and impact on production and safety, greenhouse gas (GHG) emissions and huge costs involved in controlling the aftermath situations. Some of the research attempts made to prevent and control coal mine fires and spontaneous combustion in thick seams worked with bord and pillar mining methods are presented in this paper. In the study, computational fluid dynamics (CFD) modelling techniques were used to simulate and assess the effects of various mining methods, layouts, designs, and different operational and ventilation parameters on the flow of goaf gases in BG panels. A wide range of parametric studies were conducted to develop proactive strategies to control and prevent ingress of oxygen into the goaf area preventing spontaneous combustion and mine fires.

  17. Standard Problems for CFD Validation for NGNP - Status Report

    Energy Technology Data Exchange (ETDEWEB)

    Richard W. Johnson; Richard R. Schultz

    2010-08-01

    The U.S. Department of Energy (DOE) is conducting research and development to support the resurgence of nuclear power in the United States for both electrical power generation and production of process heat required for industrial processes such as the manufacture of hydrogen for use as a fuel in automobiles. The project is called the Next Generation Nuclear Plant (NGNP) Project, which is based on a Generation IV reactor concept called the very high temperature reactor (VHTR). The VHTR will be of the prismatic or pebble bed type; the former is considered herein. The VHTR will use helium as the coolant at temperatures ranging from 250°C to perhaps 1000°C. While computational fluid dynamics (CFD) has not previously been used for the safety analysis of nuclear reactors in the United States, it is being considered for existing and future reactors. It is fully recognized that CFD simulation codes will have to be validated for flow physics reasonably close to actual fluid dynamic conditions expected in normal operational and accident situations. The “Standard Problem” is an experimental data set that represents an important physical phenomenon or phenomena, whose selection is based on a phenomena identification and ranking table (PIRT) for the reactor in question. It will be necessary to build a database that contains a number of standard problems for use to validate CFD and systems analysis codes for the many physical problems that will need to be analyzed. The first two standard problems that have been developed for CFD validation consider flow in the lower plenum of the VHTR and bypass flow in the prismatic core. Both involve scaled models built from quartz and designed to be installed in the INL’s matched index of refraction (MIR) test facility. The MIR facility employs mineral oil as the working fluid at a constant temperature. At this temperature, the index of refraction of the mineral oil is the same as that of the quartz. This provides an advantage to the

  18. Engineering-Based Thermal CFD Simulations on Massive Parallel Systems

    Directory of Open Access Journals (Sweden)

    Jérôme Frisch

    2015-05-01

    Full Text Available The development of parallel Computational Fluid Dynamics (CFD codes is a challenging task that entails efficient parallelization concepts and strategies in order to achieve good scalability values when running those codes on modern supercomputers with several thousands to millions of cores. In this paper, we present a hierarchical data structure for massive parallel computations that supports the coupling of a Navier–Stokes-based fluid flow code with the Boussinesq approximation in order to address complex thermal scenarios for energy-related assessments. The newly designed data structure is specifically designed with the idea of interactive data exploration and visualization during runtime of the simulation code; a major shortcoming of traditional high-performance computing (HPC simulation codes. We further show and discuss speed-up values obtained on one of Germany’s top-ranked supercomputers with up to 140,000 processes and present simulation results for different engineering-based thermal problems.

  19. Modeling flow inside an anaerobic digester by CFD techniques

    Energy Technology Data Exchange (ETDEWEB)

    Mendoza, Alexandra Martinez; Jimenez, P. Amparo Lopez [Departmento do Ingenieria Hidralica y Medio Ambiente, Universitat Politecnica de Valencia, Camino de Vera S/N 46022 (Spain); Martinez, Tatiana Montoya; Monanana, Vincente Fajardo [Grupo Aquas de Valencia. Avenida Marques del Turia 19 46005 Valencia (Spain)

    2011-07-01

    Anaerobic processes are used to treat high strength organic wastewater as well as for the treatment of primary and secondary sludge from conventional wastewater treatment plants. In these processes, heterotrophic microorganisms convert biodegradable organic matter to methane and carbon dioxide in the absence of dissolved oxygen and nitrate. Some of the most important aspects of the design of anaerobic digesters are related to hydraulic considerations. In spite of its important role in performance, hydraulics of flow inside digesters has not been quantified or adequately characterized. In this contribution a three-dimensional steady-state computational fluid dynamics (CFD) simulation has been performed for a particular anaerobic digester, in order to visualize the flow patterns. Flow and velocities profiles have been represented inside the digester to identify possible dead zones or stratifications. The geometry of a real digester installed in Valencia Waste Water Treatment Plant (located in Quart-Benager, Valencia, Spain) has been used in order to consider the proposed methodology.

  20. Aerodynamic investigation of winglets on wind turbine blades using CFD

    DEFF Research Database (Denmark)

    Johansen, Jeppe; Sørensen, Niels N.

    2006-01-01

    The present report describes the numerical investigation of the aerodynamics around a wind turbine blade with a winglet using Computational Fluid Dynamics, CFD. Five winglets were investigated with different twist distribution and camber. Four of them were pointing towards the pressure side...... (upstream) and one was pointing towards the suction side (downstream). Additionally, a rectangular modification of the original blade tip was designed with the same planform area as the blades with winglets. Results show that adding a winglet to the existing blade increase the force distribution...... on the outer approx 14 % of the blade leading to increased produced power of around 0.6% to 1.4% for wind speeds larger than 6 m/s. This has to be compared to the increase in thrust of around 1.0% to 1.6%. Pointing the winglet downstream increases the power production even further. The effect of sweep and cant...

  1. Cfd Studies of Two Stroke Petrol Engine Scavenging

    Directory of Open Access Journals (Sweden)

    S Gavudhama Karunanidhi,

    2014-07-01

    Full Text Available This project deals with the numerical analysis of 2 stroke engine scavenging in two cases. One with an existing condition (Flat headed pistons and another with a new design (Dome headed piston .The numerical analysis is done with help of CFD software ANSYS FLUENT 14.5. Here, the modeling of engine piston with flat headed type and with dome headed types was done in workbench. In ANSYS FLUENT after the geometrical design, for the dynamic motion meshing is used and set up species transport model also. At first the scavenging effect of flat headed piston is analyzed. Later the simulation of piston with dome headed type was also checked. Analyzing the variations from each and selected the best method for scavenging. Finally the scavenging efficiency is calculated for both type arrangements.

  2. Real gas CFD simulations of hydrogen/oxygen supercritical combustion

    Science.gov (United States)

    Pohl, S.; Jarczyk, M.; Pfitzner, M.; Rogg, B.

    2013-03-01

    A comprehensive numerical framework has been established to simulate reacting flows under conditions typically encountered in rocket combustion chambers. The model implemented into the commercial CFD Code ANSYS CFX includes appropriate real gas relations based on the volume-corrected Peng-Robinson (PR) equation of state (EOS) for the flow field and a real gas extension of the laminar flamelet combustion model. The results indicate that the real gas relations have a considerably larger impact on the flow field than on the detailed flame structure. Generally, a realistic flame shape could be achieved for the real gas approach compared to experimental data from the Mascotte test rig V03 operated at ONERA when the differential diffusion processes were only considered within the flame zone.

  3. Study of mixing behavior of cstr using CFD

    Directory of Open Access Journals (Sweden)

    D. Rajavathsavai

    2014-03-01

    Full Text Available The continuous stirred tank reactor (CSTR is a widely used equipment in chemical related industries. The flow behaviour of fluid inside the reactor may either change from dispersion to ideal or ideal to dispersion mixing state. It is studied using the computational fluid dynamics (CFD simulation software ANSYS Fluent. The mixing behaviour is predicted in terms of age distribution function, I (θ. For the CSTR without impeller and baffles, I (θ is found by the tracer injection method. It is measured and predicted by the impeller swept volume method for the CSTR in the presence of impeller and baffles. The predicted results are found to be in good agreement with the literature experimental data. Effect of rpm of the impeller, Reynolds number and viscosity of the process fluid on the mixing characteristics has been investigated.

  4. Hypersonic Intake Starting Characteristics–A CFD Validation Study

    Directory of Open Access Journals (Sweden)

    Soumyajit Saha

    2012-05-01

    Full Text Available Numerical simulation of hypersonic intake starting characteristics is presented. Three dimensional RANS equations are solved alongwith SST turbulence model using commercial computational fluid dynamics (CFD software. Wall pressure distribution and intake performance parameters are found to match well with experimental data for different free stream Mach number in the range of 3-8. The unstarting of the intake is traced from the sudden drop of mass capture ratio. Wall condition (adiabatic or isothermal is seen to have pronounced effect in estimating the performance parameters in the intake. The computed unstarting Mach number is seen to be higher for adiabatic condition compared to isothermal condition. For unstarting case, large separation bubble is seen near the entrance of the intake, which is responsible for expulsion of the shock system out of the intake.Defence Science Journal, 2012, 62(1, pp.147-152, DOI:http://dx.doi.org/10.14429/dsj.62.1340

  5. Sample of CFD optimization of a centrifugal compressor stage

    Science.gov (United States)

    Galerkin, Y.; Drozdov, A.

    2015-08-01

    Industrial centrifugal compressor stage is a complicated object for gas dynamic design when the goal is to achieve maximum efficiency. The Authors analyzed results of CFD performance modeling (NUMECA Fine Turbo calculations). Performance prediction in a whole was modest or poor in all known cases. Maximum efficiency prediction was quite satisfactory to the contrary. Flow structure in stator elements was in a good agreement with known data. The intermediate type stage “3D impeller + vaneless diffuser+ return channel” was designed with principles well proven for stages with 2D impellers. CFD calculations of vaneless diffuser candidates demonstrated flow separation in VLD with constant width. The candidate with symmetrically tampered inlet part b3 / b2 = 0,73 appeared to be the best. Flow separation takes place in the crossover with standard configuration. The alternative variant was developed and numerically tested. The obtained experience was formulated as corrected design recommendations. Several candidates of the impeller were compared by maximum efficiency of the stage. The variant with gas dynamic standard principles of blade cascade design appeared to be the best. Quasi - 3D non-viscid calculations were applied to optimize blade velocity diagrams - non-incidence inlet, control of the diffusion factor and of average blade load. “Geometric” principle of blade formation with linear change of blade angles along its length appeared to be less effective. Candidates’ with different geometry parameters were designed by 6th math model version and compared. The candidate with optimal parameters - number of blades, inlet diameter and leading edge meridian position - is 1% more effective than the stage of the initial design.

  6. Determinación de carbono orgánico total presente en el suelo y la biomasa de los páramos de las comunidades de chimborazo y shobol llinllin en Ecuador

    Directory of Open Access Journals (Sweden)

    M. Echeverría

    2013-01-01

    Full Text Available En la determinación del contenido de carbono orgánico total presente en el suelo y la biomasa (cobertura vegetal de los páramos de las comunidades de Chimborazo, con 210ha de páramo cuya ubicación es 746667UTM-9825400UTM, y Shobol Llinllín, con 350 ha de páramo, 754680UTM–9854678UTM, pertenecientes a San Juan en Ecuador, se seleccionaron 9 puntos de muestreo de acuerdo a la variación, características y altitud del suelo, repartidos para este estudio en tres pisos altitudinales comprendidos, para el páramo de la comunidad Chimborazo, entre 3600-3900 msnm y, en el caso de Shobol Llinllín, entre 3600-3950 msnm.

  7. Composición química de la biomasa residual de la planta de piña variedad MD2 proveniente de Guácimo, Limón

    OpenAIRE

    Irías, Andrea; Lutz, Giselle

    2015-01-01

    Se determinó durante el mes de febrero del año 2009, el contenido de humedad, ligninas, holocelulosa, nitrógeno y minerales (potasio, calcio, hierro, magnesio, sodio) en la biomasa residual de la planta de piña variedad MD2 de la región de Guácimo, mediante los métodos extracción con disolventes, Kjeldahl y espectrometría de absorción atómica. Se observaron diferencias en la composición química reportada para cultivos de otras regiones, lo cual debe ser tomado en cuenta para el aprovechamient...

  8. Evaluación de los pretratamientos con ácido sulfúrico diluido y AFEX en la biomasa lignocelulósica del tipo pasto gigante “Pennisetum Sp”

    OpenAIRE

    Mateus Fontecha, Lady

    2011-01-01

    El objetivo de esta investigación fue estudiar la efectividad del pretratamiento con ácido sulfúrico diluido y la explosión de fibras con solución de amoníaco (AFEX) sobre la biomasa lignocelulósica de Pennisetum sp en la hidrólisis de carbohidratos fermentables para la producción de etanol. En el pretratamiento con ácido sulfúrico se estudio el efecto de la temperatura (110, 130, 150, 170 y 190 °C) y la concentración del ácido [0,8; 1,2 y 2,0 % (p/p)], mientras que en el pretratamiento AFEX ...

  9. Dinámica de la Biomasa Microbiana y su Relación con la Respiración y el Nitrógeno del Suelo en Tierras Agrícolas en el Valle del Mantaro

    OpenAIRE

    Hinostroza, Amanda; Universidad Alas Peruanas; Malca, Julio; Universidad Alas Peruanas; Suárez, Luis; Universidad Alas Peruanas

    2016-01-01

    Se estudió el efecto del abonamiento orgánico con estiércol de ganado vacuno, ovino, de cuy, fertilización química y sin abonamiento sobre la variación del nitrógeno, variación de la biomasa microbiana del suelo y la respiración del suelo en cultivos de papa (Solanum tuberosum) y maíz (Zea mays) durante la campaña agrícola 2009 en cuatro localidades del valle del Mantaro: El Mantaro, Chupaca, Santa Ana y Huayao, bajo diseño experimental de bloques completamente aleatorios con arreglo factoria...

  10. Captura de CO2 en centrales termoeléctricas mediante combustión de carbón y biomasa en condiciones de oxicombustión

    OpenAIRE

    Riaza Benito, Juan

    2016-01-01

    El carbón es y va a seguir siendo uno de los principales recursos energéticos para la generación de energía eléctrica. Sin embargo, en la combustión del carbón se libera CO2, que es un gas de efecto invernadero y el principal causante del cambio climático. Una alternativa para la reducción parcial de emisiones de CO2 consiste en sustituir parte del carbón utilizado en la combustión por biomasa, cuyas emisiones se consideran neutras. Sin embargo, para reducir de forma importante las emisiones ...

  11. EFECTO DEL CARBONATO DE POTASIO EN LA EVOLUCIÓN DE LOS GRUPOS FUNCIONALES DE LOS BIOCRUDOS DE CONVERSIÓN HIDROTÉRMICA DE BIOMASA LIGNOCELULÓSICA ALREDEDOR DEL PUNTO CRÍTICO DEL AGUA

    Directory of Open Access Journals (Sweden)

    José Díaz

    2009-04-01

    Full Text Available Un tipo de biomasa pobre en lignina, del género Pennisetum fue sometida al proceso de conversión hidrotérmica en presencia de carbonato de potasio como catalizador. Las reacciones se llevaron a cabo en ambientes cercanos al punto crítico del agua. Los productos de reacción no acuosos (biocrudo se separaron por decantación y se analizaron por espectrometría infrarroja. Los biocrudos obtenidos contienen compuestos con funcionalidades aromáticas, olefínicas, hidroxiladas, éteres, y para el caso del biocrudo obtenido bajo la condición subcrítica funciones carbonilo. La fracción gaseosa y el biocrudo aumentan en presencia del carbonato de potasio.   

  12. CFD Analyses of Air-Ingress Accident for VHTRs

    Science.gov (United States)

    Ham, Tae Kyu

    The Very High Temperature Reactor (VHTR) is one of six proposed Generation-IV concepts for the next generation of nuclear powered plants. The VHTR is advantageous because it is able to operate at very high temperatures, thus producing highly efficient electrical generation and hydrogen production. A critical safety event of the VHTR is a loss-of-coolant accident. This accident is initiated, in its worst-case scenario, by a double-ended guillotine break of the cross vessel that connects the reactor vessel and the power conversion unit. Following the depressurization process, the air (i.e., the air and helium mixture) in the reactor cavity could enter the reactor core causing an air-ingress event. In the event of air-ingress into the reactor core, the high-temperature in-core graphite structures will chemically react with the air and could lose their structural integrity. We designed a 1/8th scaled-down test facility to develop an experimental database for studying the mechanisms involved in the air-ingress phenomenon. The current research focuses on the analysis of the air-ingress phenomenon using the computational fluid dynamics (CFD) tool ANSYS FLUENT for better understanding of the air-ingress phenomenon. The anticipated key steps in the air-ingress scenario for guillotine break of VHTR cross vessel are: 1) depressurization; 2) density-driven stratified flow; 3) local hot plenum natural circulation; 4) diffusion into the reactor core; and 5) global natural circulation. However, the OSU air-ingress test facility covers the time from depressurization to local hot plenum natural circulation. Prior to beginning the CFD simulations for the OSU air-ingress test facility, benchmark studies for the mechanisms which are related to the air-ingress accident, were performed to decide the appropriate physical models for the accident analysis. In addition, preliminary experiments were performed with a simplified 1/30th scaled down acrylic set-up to understand the air

  13. CFD simulation analysis and research based on engine air intake system of automotive

    Science.gov (United States)

    Liu, Xia; Yan, Hua Jin; Tian, Ning; Zhao, GuoQi

    2017-01-01

    Traditional method for the design of automotive engine intake system has many issues, such as period, high costs, energy consumption and so on. The paper utilized one kind of CFD numerical simulation analysis based on the basic theory of CFD. It use the three-dimensional geometry modal grid, computational modeling and model analysis to identify the turbulence due to unreasonable design of air filter inlet position, and then through the test to verify the correctness of the results of CFD calculations. It provide a theoretical basis for the intake system structural optimization.

  14. Coupled Outdoor and Indoor Airflow Prediction for Buildings Using Computational Fluid Dynamics (CFD

    Directory of Open Access Journals (Sweden)

    Deo Prasad

    2013-05-01

    Full Text Available The objective of this study is to investigate the accuracy of Computational Fluid Dynamics (CFD for simultaneously predicting the outdoor and indoor airflows of single-cell and multi-storey buildings. Empirical models and two existing wind tunnel experimental data are used for validation. This study found that coupled CFD simulations provide sufficiently accurate airflow predictions and, in cases of buildings with complex façade treatments, accurately accounts for changes in ventilation performance, which may be impossible using empirical models. This study concludes that coupled CFD simulations can generally be used to predict ventilation performance in small and large buildings.

  15. CFD modeling and experience of waste-to-energy plant burning waste wood

    DEFF Research Database (Denmark)

    Rajh, B.; Yin, Chungen; Samec, N.;

    2013-01-01

    Computational Fluid Dynamics (CFD) is being increasingly used in industry for in-depth understanding of the fundamental mixing, combustion, heat transfer and pollutant formation in combustion processes and for design and optimization of Waste-to-Energy (WtE) plants. In this paper, CFD modeling...... of waste wood combustion in a 13 MW grate-fired boiler in a WtE plant is presented. As a validation effort, the temperature profiles at a number of ports in the furnace are measured and the experimental results are compared with the CFD predictions. In the simulation, a 1D model is developed to simulate...

  16. Simultaneous Excitation of Multiple-Input Multiple-Output CFD-Based Unsteady Aerodynamic Systems

    Science.gov (United States)

    Silva, Walter A.

    2008-01-01

    A significant improvement to the development of CFD-based unsteady aerodynamic reduced-order models (ROMs) is presented. This improvement involves the simultaneous excitation of the structural modes of the CFD-based unsteady aerodynamic system that enables the computation of the unsteady aerodynamic state-space model using a single CFD execution, independent of the number of structural modes. Four different types of inputs are presented that can be used for the simultaneous excitation of the structural modes. Results are presented for a flexible, supersonic semi-span configuration using the CFL3Dv6.4 code.

  17. iCFD: Interpreted Computational Fluid Dynamics - Degeneration of CFD to one-dimensional advection-dispersion models using statistical experimental design - The secondary clarifier.

    Science.gov (United States)

    Guyonvarch, Estelle; Ramin, Elham; Kulahci, Murat; Plósz, Benedek Gy

    2015-10-15

    The present study aims at using statistically designed computational fluid dynamics (CFD) simulations as numerical experiments for the identification of one-dimensional (1-D) advection-dispersion models - computationally light tools, used e.g., as sub-models in systems analysis. The objective is to develop a new 1-D framework, referred to as interpreted CFD (iCFD) models, in which statistical meta-models are used to calculate the pseudo-dispersion coefficient (D) as a function of design and flow boundary conditions. The method - presented in a straightforward and transparent way - is illustrated using the example of a circular secondary settling tank (SST). First, the significant design and flow factors are screened out by applying the statistical method of two-level fractional factorial design of experiments. Second, based on the number of significant factors identified through the factor screening study and system understanding, 50 different sets of design and flow conditions are selected using Latin Hypercube Sampling (LHS). The boundary condition sets are imposed on a 2-D axi-symmetrical CFD simulation model of the SST. In the framework, to degenerate the 2-D model structure, CFD model outputs are approximated by the 1-D model through the calibration of three different model structures for D. Correlation equations for the D parameter then are identified as a function of the selected design and flow boundary conditions (meta-models), and their accuracy is evaluated against D values estimated in each numerical experiment. The evaluation and validation of the iCFD model structure is carried out using scenario simulation results obtained with parameters sampled from the corners of the LHS experimental region. For the studied SST, additional iCFD model development was carried out in terms of (i) assessing different density current sub-models; (ii) implementation of a combined flocculation, hindered, transient and compression settling velocity function; and (iii

  18. Reducing uncertainty and bias in acoustic biomass estimations of southern blue whiting (Micromesistius australis in the southeastern Pacific: transducer motion effects upon acoustic attenuation Reduciendo el sesgo e incertidumbre de las estimaciones hidroacústicas de biomasa de merluza de tres aletas (Micromesistius australis en el Pacífico suroriental: efectos del movimiento del transductor sobre la atenuación acústica

    Directory of Open Access Journals (Sweden)

    Alvaro Saavedra

    2012-09-01

    Full Text Available We evaluated the loss of sensitivity due to the motion experienced by a hull-mounted transducer and its effects upon the estimated biomass of southern blue whiting (Micromesistius australis in an acoustic survey conducted in the southeastern Pacific, off the Chilean coast, during the austral winter of 2009. Vessel motion data (pitch and roll were registered in situ using a digital clinometer and used to correct the nautical area scattering coefficients (NASC in elementary sampling units of 926 m distance by 10 m depth. These NASC correction factors (NASCcp were calculated using Dunford's algorithm for circular transducers. We found high variability in NASCcp, which averaged 12%, and ranged between 0 and 50%. NASCcp variability was explained significantly by the mean depth of the integrated stratum (33%, the weather condition, as measured by Beaufort's scale (5%, and the vessel course relative to wind direction (2%. The empirical model we used to explain NASC Cp variability may be suitable for correcting bias due to transducer motion in other, past and future, fisheries acoustic surveys targeting mid-water species under rough weather conditions.Se evaluó la pérdida de sensibilidad producida por el movimiento de un transductor montado en el casco y sus efectos sobre la abundancia y biomasa estimada de merluza de tres aletas (Micromesistius australis en un estudio acústico realizado en el Pacífico suroriental, frente a la costa de Chile, durante el invierno austral de 2009. Los datos de movimiento del barco (cabeceo y balanceo fueron registrados in situ utilizando un clinómetro digital y luego utilizados para estimar la pérdida teórica de sensibilidad del transductor y, finalmente, traducir esta pérdida en factores de corrección del coeficiente de dispersión por área náutica (NASC calculados para intervalos básicos de muestreo de 926 m de distancia por 10 m de profundidad. Los factores de corrección del NASC (NASC Cp fueron calculados

  19. Development of CFD Approaches for Modeling Advanced Concepts of Nuclear Thermal Propulsion Test Facilities Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The project will be developing a CFD approach that can handle the additional complexities needed in a NTP testing facility when modeling the combustion processes in...

  20. Direct CFD Predictions of Low Frequency Sounds Generated by Helicopter Main Rotors

    Science.gov (United States)

    Sim, Ben W.; Potsdam, Mark; Conner, Dave; Watts, Michael E.

    2010-01-01

    This proposed paper will highlight the application of a CSD/CFD methodology currently inuse by the US Army Aerfolightdynamics Directorate (AFDD) to assess the feasibility and fidelity of directly predicting low frequency sounds of helicopter rotors.

  1. CFD-based method of determining form factor k for different ship types and different drafts

    Science.gov (United States)

    Wang, Jinbao; Yu, Hai; Zhang, Yuefeng; Xiong, Xiaoqing

    2016-09-01

    The value of form factor k at different drafts is important in predicting full-scale total resistance and speed for different types of ships. In the ITTC community, most organizations predict form factor k using a low-speed model test. However, this method is problematic for ships with bulbous bows and transom. In this article, a Computational Fluid Dynamics (CFD)-based method is introduced to obtain k for different type of ships at different drafts, and a comparison is made between the CFD method and the model test. The results show that the CFD method produces reasonable k values. A grid generating method and turbulence model are briefly discussed in the context of obtaining a consistent k using CFD.

  2. CFD-Based Method of Determining Form Factor k for Different Ship Types and Different Drafts

    Institute of Scientific and Technical Information of China (English)

    Xiaoqing Xiong

    2016-01-01

    The value of form factor k at different drafts is important in predicting full-scale total resistance and speed for different types of ships. In the ITTC community, most organizations predict form factor k using a low-speed model test. However, this method is problematic for ships with bulbous bows and transom. In this article, a Computational Fluid Dynamics (CFD)-based method is introduced to obtain k for different type of ships at different drafts, and a comparison is made between the CFD method and the model test. The results show that the CFD method produces reasonable k values. A grid generating method and turbulence model are briefly discussed in the context of obtaining a consistent k using CFD.

  3. Summary of the First AIAA CFD High Lift Prediction Workshop (invited)

    Science.gov (United States)

    Rumsey, C. L.; Long, M.; Stuever, R. A.; Wayman, T. R.

    2011-01-01

    The 1st AIAA CFD High Lift Prediction Workshop was held in Chicago in June 2010. The goals of the workshop included an assessment of the numerical prediction capability of current-generation CFD technology/ codes for swept, medium/high-aspect ratio wings in landing/take-off (high lift) configurations. 21 participants from 8 countries and 18 organizations, submitted a total of 39 datasets of CFD results. A variety of grid systems (both structured and unstructured) were used. Trends due to flap angle were analyzed, and effects of grid family, grid density, solver, and turbulence model were addressed. Some participants also assessed the effects of support brackets used to attach the flap and slat to the main wing. This invited paper describes the combined results from all workshop participants. Comparisons with experimental data are made. A statistical summary of the CFD results is also included.

  4. A Multi-Model Approach for Uncertainty Propagation and Model Calibration in CFD Applications

    CERN Document Server

    Wang, Jian-xun; Xiao, Heng

    2015-01-01

    Proper quantification and propagation of uncertainties in computational simulations are of critical importance. This issue is especially challenging for CFD applications. A particular obstacle for uncertainty quantifications in CFD problems is the large model discrepancies associated with the CFD models used for uncertainty propagation. Neglecting or improperly representing the model discrepancies leads to inaccurate and distorted uncertainty distribution for the Quantities of Interest. High-fidelity models, being accurate yet expensive, can accommodate only a small ensemble of simulations and thus lead to large interpolation errors and/or sampling errors; low-fidelity models can propagate a large ensemble, but can introduce large modeling errors. In this work, we propose a multi-model strategy to account for the influences of model discrepancies in uncertainty propagation and to reduce their impact on the predictions. Specifically, we take advantage of CFD models of multiple fidelities to estimate the model ...

  5. PEPT: An invaluable tool for 3-D particle tracking and CFD simulation verification in hydrocyclone studies

    Directory of Open Access Journals (Sweden)

    Hoffmann Alex C.

    2013-05-01

    Full Text Available Particle tracks in a hydrocyclone generated both experimentally by positron emission particle tracking (PEPT and numerically with Eulerian-Lagranian CFD have been studied and compared. A hydrocyclone with a cylinder-on-cone design was used in this study, the geometries used in the CFD simulations and in the experiments being identical. It is shown that it is possible to track a fast-moving particle in a hydrocyclone using PEPT with high temporal and spatial resolutions. The numerical 3-D particle trajectories were generated using the Large Eddy Simulation (LES turbulence model for the fluid and Lagrangian particle tracking for the particles. The behaviors of the particles were analyzed in detail and were found to be consistent between experiments and CFD simulations. The tracks of the particles are discussed and related to the fluid flow field visualized in the CFD simulations using the cross-sectional static pressure distribution.

  6. Benchmark of FDNS CFD Code For Direct Connect RBCC Test Data

    Science.gov (United States)

    Ruf, J. H.

    2000-01-01

    Computational Fluid Dynamics (CFD) analysis results are compared with experimental data from the Pennsylvania State University's (PSU) Propulsion Engineering Research Center (PERC) rocket based combined cycle (RBCC) rocket-ejector experiments. The PERC RBCC experimental hardware was in a direct-connect configuration in diffusion and afterburning (DAB) operation. The objective of the present work was to validate the Finite Difference Navier Stokes (FDNS) CFD code for the rocket-ejector mode internal fluid mechanics and combustion phenomena. A second objective was determine the best application procedures to use FDNS as a predictive/engineering tool. Three-dimensional CFD analysis was performed. Solution methodology and grid requirements are discussed. CFD results are compared to experimental data for static pressure, Raman Spectroscopy species distribution data and RBCC net thrust and specified impulse.

  7. Simulation and Scale-up of Barium Sulphate Precipitation Process Using CFD Modeling

    Institute of Scientific and Technical Information of China (English)

    龚俊波; 卫宏远; 王静康; JohnGarsideb

    2005-01-01

    Some empirical mixing models were used to describe the imperfect mixing in precipitation process.However, the models can not, in general, reflect the details of interactions between mixing and crystallization in a vessel. In this study, CFD (computational fluid dynamics) technique were developed by simulating the precipitation of barium sulphate in stirred tanks by integration of population balance equations with a CFD solver. Two typical impellers, Rushton and pitched blade turbines, were employed for agitation. The influence of feed concentration and position on crystal product properties was investigated by CFD simulation. The scale-up of these precipitators was systematically studied. Significant effect on the crystal properties was found for the scale-up under some conditions.Keywords simulation, scale up, precipitation, CFD(computational fluid dynamics)

  8. CFD analysis of moderator flow and temperature fields inside a vertical calandria vessel of nuclear reactor

    Energy Technology Data Exchange (ETDEWEB)

    Kansal, Anuj Kumar, E-mail: akansal@barc.gov.in [Bhabha Atomic Research Centre, Trombay, Mumbai 400085 (India); Joshi, Jyeshtharaj B., E-mail: jbjoshi@gmail.com [Homi Bhabha National Institute, Anushaktinagar, Mumbai 400094 (India); Maheshwari, Naresh Kumar, E-mail: nmahesh@barc.gov.in [Bhabha Atomic Research Centre, Trombay, Mumbai 400085 (India); Vijayan, Pallippattu Krishnan, E-mail: vijayanp@barc.gov.in [Bhabha Atomic Research Centre, Trombay, Mumbai 400085 (India)

    2015-06-15

    Highlights: • 3D CFD of vertical calandria vessel. • Spatial distribution of volumetric heat generation. • Effect of Archimedes number. • Non-dimensional analysis. - Abstract: Three dimensional computational fluid dynamics (CFD) analysis has been performed for the moderator flow and temperature fields inside a vertical calandria vessel of nuclear reactor under normal operating condition using OpenFOAM CFD code. OpenFOAM is validated by comparing the predicted results with the experimental data available in literature. CFD model includes the calandria vessel, calandria tubes, inlet header and outlet header. Analysis has been performed for the cases of uniform and spatial distribution of volumetric heat generation. Studies show that the maximum temperature in moderator is lower in the case of spatial distribution of heat generation as compared to that in the uniform heat generation in calandria. In addition, the effect of Archimedes number on maximum and average moderator temperature was investigated.

  9. CFD modeling of liquid-solid fluidization: Effect of drag correlation and added mass force

    Institute of Scientific and Technical Information of China (English)

    Xiao yan Huang

    2011-01-01

    Computational fluid dynamics (CFD) has been widely used to study the hydrodynamics of gas-solid fluidization; however,its applications in liquid-solid fluidization are relatively rare.In this study,CFD simulations of a liquid-solid fluidized bed are carried out,focusing on the effect of drag correlation and added mass force on the hydrodynamics of liquid-solid fluidization.It is shown that drag correlation has a significant effect on the simulation results and the correlation proposed by Beetstra et al.(2007) gives the best agreement with experimental data.We further show that the added mass force does play an important role in CFD simulation of liquid-solid fluidization,and therefore should not be ignored in CFD simulations.

  10. Summary of best guidelines and validation of CFD modeling in livestock buildings to ensure prediction quality

    DEFF Research Database (Denmark)

    Rong, Li; Nielsen, Peter V.; Bjerg, Bjarne

    2016-01-01

    scale pig barns was simulated to show the procedures of validating a CFD simulation in livestock buildings. After summarizing the guideline and/or best practice for CFD modeling, the authors addressed the issues related to numerical methods and the governing equations, which were limited to RANS models....... Although it is not necessary to maintain the same format of reporting the CFD modeling as presented in this paper, the authors would suggest including all the information related to the selection of turbulence models, difference schemes, convergence criteria, boundary conditions, geometry simplification......Computational Fluid Dynamics (CFD) is increasingly used to study airflow around and in livestock buildings, to develop technologies to mitigate emissions and to predict the contaminant dispersion from livestock buildings. In this paper, an example of air flow distribution in a room with two full...

  11. CFD Simulation of Personal Exposure to Contaminant Sources in Ventilated Rooms

    DEFF Research Database (Denmark)

    Brohus, Henrik

    In this study Computational Fluid Dynamics (CFD) is used to predict the personal exposure to contaminant sources in a ventilated room. A CFD model of a person is located in a displacement ventilated room as well as in a mixing ventilated room. The personal exposure to different contaminant sources...... is simulated, taking both the concentration gradients and the local influence of the person into account....

  12. Flow study in channel with the use computational fluid dynamics (CFD)

    Science.gov (United States)

    Oliveira, W. D.; Pires, M. S. G.; Canno, L. M.; Ribeiro, L. C. L. J.

    2016-08-01

    The Computational Fluid Dynamics (CFD) is a tool used to numerically simulate fluid flow behavior, and all the laws that govern the study of fluids is the mass transfer and energy, chemical reactions, hydraulic behaviors, among others applications. This tool mathematical equation solves the problem in a specific manner over a region of interest, with predetermined boundary conditions on this region. This work is to study the flow channel through the CFD technique.

  13. Evaluation of heat transfer surfaces for compact recuperator using a CFD code

    Science.gov (United States)

    Ashok Babu, T. P.; Talekala, Mohammad Shekoor

    2009-04-01

    Exhaust recovery recuperator is mandatory in order to realize a thermal efficiency of 30% or higher for micro turbines. In this work an attempt is made to select the cross corrugated heat transfer surface with minimum core volume of a recuperator matrix using a CFD code. Analysis is carried out for selected cross corrugated heat transfer surface configurations. The relation between the minimum core volume from design calculation and average skin friction coefficient from CFD analysis has been established.

  14. Aerodynamic analysis of the ejector-mode RBCC engine by CFD

    OpenAIRE

    Hasegawa, Susumu; Tani, Koichiro; 長谷川 進; 谷 香一郎

    2006-01-01

    Rocket Based Combined-Cycle (RBCC) engines are currently being explored as advanced propulsion for space transportation. JAXA has been conducting RBCC engine research by using various experimental facilities. In order to clarify the experimental results and contribute to the improvement of designing, the analysis of the RBCC engine in an ejector-jet mode was carried out using the CFD (Computational Fluid Dynamics) code developed in-house for unstructured grids. CFD replicated the basic flow s...

  15. CFD analysis and experimental investigations towards optimizing the parameters of Ranque-Hilsch vortex tube

    OpenAIRE

    Behera, Upendra; Paul, PJ; Kasthurirengan, S; Karunanithi, R.; Ram, SN; Dinesh, K; Jacob, S

    2005-01-01

    Computational fluid dynamics (CFD) and experimental studies are conducted towards the optimization of the Ranque-Hilsch vortex tubes.Different types of nozzle profiles and number of nozzles are evaluated by CFD analysis. The swirl velocity, axial velocity and radial velocity components as well as the flow patterns including secondary circulation flow have been evaluated. The optimum cold end diameter (d(c)) and the length to diameter (L/D) ratios and optimum parameters for obtaining the maxim...

  16. Dakota Uncertainty Quantification Methods Applied to the CFD code Nek5000

    Energy Technology Data Exchange (ETDEWEB)

    Delchini, Marc-Olivier [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States). Reactor and Nuclear Systems Division; Popov, Emilian L. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States). Reactor and Nuclear Systems Division; Pointer, William David [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States). Reactor and Nuclear Systems Division

    2016-04-29

    This report presents the state of advancement of a Nuclear Energy Advanced Modeling and Simulation (NEAMS) project to characterize the uncertainty of the computational fluid dynamics (CFD) code Nek5000 using the Dakota package for flows encountered in the nuclear engineering industry. Nek5000 is a high-order spectral element CFD code developed at Argonne National Laboratory for high-resolution spectral-filtered large eddy simulations (LESs) and unsteady Reynolds-averaged Navier-Stokes (URANS) simulations.

  17. Dakota Uncertainty Quantification Methods Applied to the CFD code Nek5000

    Energy Technology Data Exchange (ETDEWEB)

    Delchini, Marc-Olivier [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States). Reactor and Nuclear Systems Division; Popov, Emilian L. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States). Reactor and Nuclear Systems Division; Pointer, William David [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States). Reactor and Nuclear Systems Division

    2016-04-29

    This report presents the state of advancement of a Nuclear Energy Advanced Modeling and Simulation (NEAMS) project to characterize the uncertainty of the computational fluid dynamics (CFD) code Nek5000 using the Dakota package for flows encountered in the nuclear engineering industry. Nek5000 is a high order spectral element CFD code developed at Argonne National Laboratory for high resolution spectral-filtered large eddy simulations (LESs) and unsteady Reynolds averaged Navier-Stokes (URANS) simulations.

  18. Development of Kinetic Mechanisms for Next-Generation Fuels and CFD Simulation of Advanced Combustion Engines

    Energy Technology Data Exchange (ETDEWEB)

    Pitz, William J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); McNenly, Matt J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Whitesides, Russell [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Mehl, Marco [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Killingsworth, Nick J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Westbrook, Charles K. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2015-12-17

    Predictive chemical kinetic models are needed to represent next-generation fuel components and their mixtures with conventional gasoline and diesel fuels. These kinetic models will allow the prediction of the effect of alternative fuel blends in CFD simulations of advanced spark-ignition and compression-ignition engines. Enabled by kinetic models, CFD simulations can be used to optimize fuel formulations for advanced combustion engines so that maximum engine efficiency, fossil fuel displacement goals, and low pollutant emission goals can be achieved.

  19. CFD Simulation of Thermal-Hydraulic Benchmark V1000CT-2 Using ANSYS CFX

    OpenAIRE

    2009-01-01

    Plant measured data from VVER-1000 coolant mixing experiments were used within the OECD/NEA and AER coupled code benchmarks for light water reactors to test and validate computational fluid dynamic (CFD) codes. The task is to compare the various calculations with measured data, using specified boundary conditions and core power distributions. The experiments, which are provided for CFD validation, include single loop cooling down or heating-up by disturbing the heat transfer in the steam gene...

  20. A coupled DEM-CFD method for impulse wave modelling

    Science.gov (United States)

    Zhao, Tao; Utili, Stefano; Crosta, GiovanBattista

    2015-04-01

    Rockslides can be characterized by a rapid evolution, up to a possible transition into a rock avalanche, which can be associated with an almost instantaneous collapse and spreading. Different examples are available in the literature, but the Vajont rockslide is quite unique for its morphological and geological characteristics, as well as for the type of evolution and the availability of long term monitoring data. This study advocates the use of a DEM-CFD framework for the modelling of the generation of hydrodynamic waves due to the impact of a rapid moving rockslide or rock-debris avalanche. 3D DEM analyses in plane strain by a coupled DEM-CFD code were performed to simulate the rockslide from its onset to the impact with still water and the subsequent wave generation (Zhao et al., 2014). The physical response predicted is in broad agreement with the available observations. The numerical results are compared to those published in the literature and especially to Crosta et al. (2014). According to our results, the maximum computed run up amounts to ca. 120 m and 170 m for the eastern and western lobe cross sections, respectively. These values are reasonably similar to those recorded during the event (i.e. ca. 130 m and 190 m respectively). In these simulations, the slope mass is considered permeable, such that the toe region of the slope can move submerged in the reservoir and the impulse water wave can also flow back into the slope mass. However, the upscaling of the grains size in the DEM model leads to an unrealistically high hydraulic conductivity of the model, such that only a small amount of water is splashed onto the northern bank of the Vajont valley. The use of high fluid viscosity and coarse grain model has shown the possibility to model more realistically both the slope and wave motions. However, more detailed slope and fluid properties, and the need for computational efficiency should be considered in future research work. This aspect has also been

  1. Flutter and dynamic analysis based on CFD/CSD coupling method%基于CFD/CSD耦合的颤振与动载荷分析方法

    Institute of Scientific and Technical Information of China (English)

    谢亮; 徐敏; 李杰; 蔡天星

    2012-01-01

    采用CFD/CSD耦合方法,建立了气动弹性仿真系统.基于系统辨识的方法,使用Volterra级数建立了降阶模型(ROM),实现了颤振边界的快速求解,分别使用CFD/CSD全耦合方法与ROM完成了AGARD 445.6标模的颤振分析,计算结果与实验相符较好.使用ROM完成了带边条平直翼的颤振分析.使用CFD/CSD耦合方法计算了此机翼在飞行动压下的气弹响应,结果表明即使在颤振边界内,仍然有可能出现极限环振荡(LCO).对此,分析了其气弹响应中的动载情况.结果表明基于CFD/CSD耦合的方法可以真实地仿真气弹响应过程,准确地分析气弹响应中的动态载荷情况.%CFD/CSD ( computational fluid dynamics/computational solid dynamics) coupling algorithm was concerned, and CFD based nonlinear aeroelastic simulation code was developed for complex aeroelastic system analysis. In order to meet the demand of rapid analysis, a reduced-order model based on Volterra series for nonlinear unsteady aerodynamics analysis was developed. The model was validated on AGARD 445. 6 wing, which is a standard aeroelastic configuration, and used in the flutter analysis of a plate wing with regula. CFD/CSD coupling method was employed to calculate the aeroelastic response under flight dynamic pressure. The result shows that even when the flight dynamic pressure is below the flutter boundary, the aeroelastic response also has the possibility to go into limit cycle oscillation ( LCO). Then the dynamic load was analyzed in this case. The result shows that CFD/CSD coupling method can credibly simulate the aeroelastic response, and give accurate information about dynamic load correspomding to such response.

  2. MHD for fusion: parameters bridge between CFD tools and system codes; MHD para fusion: parametros puente entre herramientas CFD y codigos de sistema

    Energy Technology Data Exchange (ETDEWEB)

    Batet, L.; Mas de les Valls, E.; Sedano, L. A.

    2012-07-01

    In the context of regenerating sheaths for fusion reactors, the CFD simulations of liquid metal channels (ML) are essential to know the phenomenology and obtain relevant information for design as: ML thermal gain, to know the thermal efficiency of the component, existence of hot spots, to define the materials to use, existence of flow inversion, etc. Apart from design parameters there are others, bridge parameter, required as inputs into system code. In this work shown GREENER/T4F capabilities for obtaining both parameters with a CFD tool based on open source OpenFOAM.

  3. Highly Efficient Design-of-Experiments Methods for Combining CFD Analysis and Experimental Data

    Science.gov (United States)

    Anderson, Bernhard H.; Haller, Harold S.

    2009-01-01

    It is the purpose of this study to examine the impact of "highly efficient" Design-of-Experiments (DOE) methods for combining sets of CFD generated analysis data with smaller sets of Experimental test data in order to accurately predict performance results where experimental test data were not obtained. The study examines the impact of micro-ramp flow control on the shock wave boundary layer (SWBL) interaction where a complete paired set of data exist from both CFD analysis and Experimental measurements By combining the complete set of CFD analysis data composed of fifteen (15) cases with a smaller subset of experimental test data containing four/five (4/5) cases, compound data sets (CFD/EXP) were generated which allows the prediction of the complete set of Experimental results No statistical difference were found to exist between the combined (CFD/EXP) generated data sets and the complete Experimental data set composed of fifteen (15) cases. The same optimal micro-ramp configuration was obtained using the (CFD/EXP) generated data as obtained with the complete set of Experimental data, and the DOE response surfaces generated by the two data sets were also not statistically different.

  4. SFO-Project: The New Generation of Sharable, Editable and Open-Access CFD Tutorials

    Science.gov (United States)

    Javaherchi, Teymour; Javaherchi, Ardeshir; Aliseda, Alberto

    2016-11-01

    One of the most common approaches to develop a Computational Fluid Dynamic (CFD) simulation for a new case study of interest is to search for the most similar, previously developed and validated CFD simulation among other works. A simple search would result into a pool of written/visual tutorials. However, users should spend significant amount of time and effort to find the most correct, compatible and valid tutorial in this pool and further modify it toward their simulation of interest. SFO is an open-source project with the core idea of saving the above-mentioned time and effort. This is done via documenting/sharing scientific and methodological approaches to develop CFD simulations for a wide spectrum of fundamental and industrial case studies in three different CFD solvers; STAR-CCM +, FLUENT and Open FOAM (SFO). All of the steps and required files of these tutorials are accessible and editable under the common roof of Github (a web-based Git repository hosting service). In this presentation we will present the current library of 20 + developed CFD tutorials, discuss the idea and benefit of using them, their educational values and explain how the next generation of open-access and live resource of CFD tutorials can be built further hand-in-hand within our community.

  5. Computational Fluid Dynamics (CFD) Analysis Of Optical Payload For Lasercomm Science (OPALS) sealed enclosure module

    Science.gov (United States)

    Anderson, Kevin R.; Zayas, Daniel; Turner, Daniel

    2012-01-01

    Computational Fluid Dynamics (CFD) using the commercial CFD package CFDesign has been performed at NASA Jet Propulsion Laboratory (JPL) California Institute of Technology (Caltech) in support of the Phaeton Early Career Hire Program's Optical Payload for Lasercomm Science (OPALS) mission. The OPALS project is one which involves an International Space Station payload that will be using forced convection cooling in a hermetically sealed enclosure at 1 atm of air to cool "off-the-shelf" vendor electronics. The CFD analysis was used to characterize the thermal and fluid flow environment within a complicated labyrinth of electronics boards, fans, instrumentation, harnessing, ductwork and heat exchanger fins. The paradigm of iteratively using CAD/CAE tools and CFD was followed in order to determine the optimum flow geometry and heat sink configuration to yield operational convective film coefficients and temperature survivability limits for the electronics payload. Results from this current CFD analysis and correlation of the CFD model against thermal test data will be presented. Lessons learned and coupled thermal / flow modeling strategies will be shared in this paper.

  6. Synthesis of the OECD/NEA-PSI CFD benchmark exercise

    Energy Technology Data Exchange (ETDEWEB)

    Andreani, Michele, E-mail: Michele.andreani@psi.ch; Badillo, Arnoldo; Kapulla, Ralf

    2016-04-01

    Highlights: • A benchmark exercise on stratification erosion in containment was conducted using a test in the PANDA facility. • Blind calculations were provided by nineteen participants. • Results were compared with experimental data. • A ranking was made. • A large spread of results was observed, with very few simulations providing accurate results for the most important variables, though not for velocities. - Abstract: The third International Benchmark Exercise (IBE-3) conducted under the auspices of OECD/NEA is based on the comparison of blind CFD simulations with experimental data addressing the erosion of a stratified layer by an off-axis buoyant jet in a large vessel. The numerical benchmark exercise is based on a dedicated experiment in the PANDA facility conducted at the Paul Scherrer Institut (PSI) in Switzerland, using only one vessel. The use of non-prototypical fluids (i.e. helium as simulant for hydrogen, and air as simulant for steam), and the consequent absence of the complex physical effects produced by steam condensation enhanced the suitability of the data for CFD validation purposes. The test started with a helium–air layer at the top of the vessel and air in the lower part. The helium-rich layer was gradually eroded by a low-momentum air/helium jet emerging at a lower elevation. Blind calculation results were submitted by nineteen participants, and the calculation results have been compared with the PANDA data. This report, adopting the format of the reports for the two previous exercises, includes a ranking of the contributions, where the largest weight is given to the time progression of the erosion of the helium-rich layer. In accordance with the limited scope of the benchmark exercise, this report is more a collection of comparisons between calculated results and data than a synthesis. Therefore, the few conclusions are based on the mere observation of the agreement of the various submissions with the test result, and do not

  7. CFD-Based Design Optimization Tool Developed for Subsonic Inlet

    Science.gov (United States)

    1995-01-01

    The traditional approach to the design of engine inlets for commercial transport aircraft is a tedious process that ends with a less-than-optimum design. With the advent of high-speed computers and the availability of more accurate and reliable computational fluid dynamics (CFD) solvers, numerical optimization processes can effectively be used to design an aerodynamic inlet lip that enhances engine performance. The designers' experience at Boeing Corporation showed that for a peak Mach number on the inlet surface beyond some upper limit, the performance of the engine degrades excessively. Thus, our objective was to optimize efficiency (minimize the peak Mach number) at maximum cruise without compromising performance at other operating conditions. Using a CFD code NPARC, the NASA Lewis Research Center, in collaboration with Boeing, developed an integrated procedure at Lewis to find the optimum shape of a subsonic inlet lip and a numerical optimization code, ADS. We used a GRAPE-based three-dimensional grid generator to help automate the optimization procedure. The inlet lip shape at the crown and the keel was described as a superellipse, and the superellipse exponents and radii ratios were considered as design variables. Three operating conditions: cruise, takeoff, and rolling takeoff, were considered in this study. Three-dimensional Euler computations were carried out to obtain the flow field. At the initial design, the peak Mach numbers for maximum cruise, takeoff, and rolling takeoff conditions were 0.88, 1.772, and 1.61, respectively. The acceptable upper limits on the takeoff and rolling takeoff Mach numbers were 1.55 and 1.45. Since the initial design provided by Boeing was found to be optimum with respect to the maximum cruise condition, the sum of the peak Mach numbers at takeoff and rolling takeoff were minimized in the current study while the maximum cruise Mach number was constrained to be close to that at the existing design. With this objective, the

  8. Balance sheet of the first year of O&M at the Ence biomass plant in Mérida; Balance del primer año de operación y mantenimiento de la planta de biomasa de Ence en Mérida

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2016-07-01

    Having received the Final Commissioning Protocol from the Ministry of Agriculture, Rural Development, Environment and Energy of the Extremadura Regional Government, Ence’s biomass generation plant in Mérida started to deliver energy to the electrical system in April 2014. With the construction and commissioning of the Sener turnkey project for the biomass plant having been completed, Ence - the engineering and technology group – set up the company Biomasa Mérida O&M S.L. to provide operation and maintenance works for the facility’s first two years of operation. Following signature of the provisional acceptance of the plant by Ence, Biomasa Mérida O&M S.L. accepted its mission and started work on 15 September 2014. (Author)

  9. CFD Simulation of Air Velocity Distribution in Occupied Livestock Buildings

    DEFF Research Database (Denmark)

    Svidt, Kjeld; Zhang, G.; Bjerg, B.

    In modem livestock buildings the design of the ventilation systems is important in order to obtain good air distribution. The use of Computational Fluid Dynamics for predicting the air flow and air quality makes it possible to include the effect of room geometry, equipment and occupants in the de......In modem livestock buildings the design of the ventilation systems is important in order to obtain good air distribution. The use of Computational Fluid Dynamics for predicting the air flow and air quality makes it possible to include the effect of room geometry, equipment and occupants...... in the design of ventilation systems. However, it is not appropriate to include the detailed geometry of a large group of lying or standing animals affecting the air flow in the building. It is necessary to have relatively simple models of the animals, which are easier to implement in the computer models....... In this study laboratory measurements in a ventilated test room with "pig simulators" are compared with CFD-simulations....

  10. Modelling die filling with charged particles using DEM/CFD

    Institute of Scientific and Technical Information of China (English)

    Emmanuel Nkem Nwose; Chunlei Pei; Chuan-Yu Wu

    2012-01-01

    The effects of electrostatic charge on powder flow behaviour during die filling in a vacuum and in air were analysed using a coupled discrete element method and computational fluid dynamics (DEM/CFD) code,in which long range electrostatic interactions were implemented.The present 2D simulations revealed that both electrostatic charge and the presence of air can affect the powder flow behaviour during die filling.It was found that the electrostatic charge inhibited the flow of powders into the die and induced a loose packing structure.At the same filling speed,increasing the electrostatic charge led to a decrease in the fill ratio which quantifies the volumetric occupancy of powder in the die.In addition,increasing the shoe speed caused a further decrease in the fill ratio,which was characterised using the concept of critical filling speed.When the electrostatic charge was low,the air/particle interaction was strong so that a lower critical filling speed was obtained for die filling in air than in a vacuum.With high electrostatic charge,the electrostatic interactions became dominant.Consequently,similar fill ratio and critical filling speed were obtained for die filling in air and in a vacuum.

  11. CFD MODEL OF THE CNG DIRECT INJECTION ENGINE

    Directory of Open Access Journals (Sweden)

    Zbigniew Czyż

    2014-09-01

    Full Text Available The paper presents CFD analysis of fuel flow in the CNG injector. The issues such a pressure drop along an injector channel, mass flow through the key sections of the injector geometry, flow rates, the impact of the needle shape on the deflection of the sprayed gas cone and the impact of the wall head are analyzed in the article. The simulation was made in the transient states conditions for full injection process, including the opening and closing of the injector. An injection time of 6 ms, velocity of 0.33 mm/ms and a lift of 0.5 mm were selected for opening and closing of injector based on experimental test. The simulation shows that the volume inside the injector is a kind of fuel accumulator, and the opening process of the needle influence the flow parameters in an inlet cross-section after a certain time, depending on a channel cross section. The calculations allowed to select the ratio of an injector duct cross sectional area to the aperture area of the injection capable of the reducing pressure loss. The unusual location of the injector in the socket of a glow plug in the Andoria ADCR engine makes a stream be impaired by a part of the head. This research result would be useful in developing an injector construction which will be used for an investigation of CNG addition into diesel engine.

  12. CFD-based Analysis of Aeroelastic behavior of Supersonic Fins

    Directory of Open Access Journals (Sweden)

    Tianxing Cai

    2011-02-01

    Full Text Available The main goal of this paper is to analyze the flutter boundary, transient loads of a supersonic fin, and the flutter with perturbation. Reduced order mode (ROM based on Volterra Series is presented to calculate the flutter boundary, and CFD/CSD coupling is used to compute the transient aerodynamic load. The Volterra-based ROM is obtained using the derivative of unsteady aerodynamic step-response, and the infinite plate spline is used to perform interpolation of physical quantities between the fluid and the structural grids. The results show that inertia force plays a significant role in the transient loads, the moment cause by inertia force is lager than the aerodynamic force, because of the huge transient loads, structure may be broken by aeroelasticity below the flutter dynamic pressure. Perturbations of aircraft affect the aeroelastic response evident, the reduction of flutter dynamic pressure by rolling perturbation form 15.4% to 18.6% when Mach from 2.0 to 3.0. It is necessary to analyze the aeroelasticity behaviors under the compositive force environment.

  13. CFD Analysis of Automotive Ventilated Disc Brake Rotor

    Directory of Open Access Journals (Sweden)

    Amol V. More

    2014-04-01

    Full Text Available Disc brakes work on the principle of friction by converting kinetic energy into heat energy. The key objective of a disc brake rotor is to accumulate this heat energy and dissipate it immediately. The effect of rotational speed on the aero-thermal performance is assessed. The rotor speed is observed to have substantial effect on the rotor performance. The heat dissipation and thermal performance of ventilated brake discs intensely be influenced by the aerodynamic characteristics of the air flow through the rotor passages. In order to investigate the aero-thermal performance of the ventilated disc brake at several altered driving speeds of the vehicle, the simulations were carried out at 3 different rotational speeds of 44rad/s 88 rad/s and 120 rad/s. The semi-automatic geometric model is created using the package Solid Works and the mesh for the model is done using ICEM CFD and the Post processing of the results is done using FLUENT-14.5.The results are discussed and presented in detail.

  14. Liquid rocket combustion instability analysis by CFD methods

    Science.gov (United States)

    Grenda, J. M.; Venkateswaran, S.; Merkle, C. L.

    1991-01-01

    Combustion instability in liquid rocket engines is simulated computationally by using a simple two-parameter model for the combustion response function. The objectives of the study are to assess the capabilities of CFD algorithms for instability studies and to investigate the response to parametric effects such as bombs and distributed combustion. Results indicate that numerical solutions of high accuracy can be obtained if a sufficient number of grid points are used per wavelength of the disturbance. The short-term response to bombs or pulses triggers a large number of modes in the combustor whose faithful resolution requires highly dense grids, although there is evidence that correct long-term solutions can be obtained even if all the short-term frequencies are not resolved. Long-term responses to pulses are shown to decay to the most unstable mode in small amplitude cases, and to exhibit limit cycles in large amplitude cases. Comparison of distributed with concentrated heat release indicates the former is more stable for given values of the combustion response parameters, and that the distributed heat release gives rise to higher frequency disturbances. Wave steepening is observed in the solutions, but its effect is less pronounced in multidimensional waves than in one-dimensional waves.

  15. Comparative CFD simulations of a hydrogen fire scenario

    Science.gov (United States)

    Nobili, M.; Caruso, G.

    2017-01-01

    Hydrogen leakage and fire ignition and propagation are safety concerns in several industrial plants. In a nuclear fusion power plants the separation of hydrogen and tritium takes place in different steps, among which one or more electrolyzers are foreseen. A fire scenario could take place in case of leakage of hydrogen. In such cases, it is important to prevent the spreading of the fire to adjacent rooms and, at the same time, to withstand the pressure load on walls, to avoid radioactivity release in the surrounding environment. A preliminary study has been carried out with the aim of comparing CFD tools for fire scenario simulations involving hydrogen release. Results have been obtained comparing two codes: ANSYS Fluent© and FDS. The two codes have been compared both for hydrogen dispersion and hydrogen fire in a confined environment. The first scenario is aimed to obtaining of volume fraction 3D maps for the evaluation of the different diffusion/transport models. In the second scenario, characterized by a double-ended guillotine break, the fire is supposed to be ignited at the same time of the impact. Simulations have been carried out for the first 60 seconds. Hydrogen concentration, temperature and pressure fields are compared and discussed.

  16. Aerodynamic investigation of winglets on wind turbine blades using CFD

    Energy Technology Data Exchange (ETDEWEB)

    Johansen, Jeppe; Soerensen, Niels N.

    2006-02-15

    The present report describes the numerical investigation of the aerodynamics around a wind turbine blade with a winglet using Computational Fluid Dynamics, CFD. Five winglets were investigated with different twist distribution and camber. Four of them were pointing towards the pressure side (upstream) and one was pointing towards the suction side (downstream). Additionally, a rectangular modification of the original blade tip was designed with the same planform area as the blades with winglets. Results show that adding a winglet to the existing blade increase the force distribution on the outer approx 14 % of the blade leading to increased produced power of around 0.6% to 1.4% for wind speeds larger than 6 m/s. This has to be compared to the increase in thrust of around 1.0% to 1.6%. Pointing the winglet downstream increases the power production even further. The effect of sweep and cant angles is not accounted for in the present investigation and could improve the winglets even more. (au)

  17. Aerodynamic analysis of Audi A4 Sedan using CFD

    Science.gov (United States)

    Birwa, S. K.; Rathi, N.; Gupta, R.

    2013-04-01

    This paper presents the aerodynamic influence of velocity and ground clearance for Audi A4 Sedan. The topology of the test vehicle was modeled using CATIA P3 V5 R17. ANSYS FLUENT 12 was the CFD solver employed in this study. The distribution of pressure and velocity was obtained. The velocities were 30, 40, 50 and 60 m/s and ground clearances were 76.2 mm,101.6 mm,127 mm and 152.4 mm. The simulation results were compared with the available resources. It was found that the drag coefficient decreases with the velocity increasing from 30 to 60 m/s and increases with the ground clearance from 101.6 mm to 152.4 mm. Further decrease in ground clearance showed no effect on the value of coefficient of drag. The lift coefficient was found to decrease firstly with ground clearance from 152.4 mm to 101.6 mm, and then increase from 101.6 mm to 76.2 mm. Both the lift coefficient and drag coefficient was found to be minimum for the ground clearance of 101.6 mm as designed by the company.

  18. Design of Shrouded Airborne Wind Turbine & CFD Analysis

    Science.gov (United States)

    Anbreen, Faiqa; Faiqa Anbreen Collaboration

    2015-11-01

    The focus is to design a shrouded airborne wind turbine, capable to generate 70 kW to propel a leisure boat. The idea of designing an airborne turbine is to take the advantage of different velocity layers in the atmosphere. The blades have been designed using NREL S826 airfoil, which has coefficient of lift CL of 1.4 at angle of attack, 6°. The value selected for CP is 0.8. The rotor diameter is 7.4 m. The balloon (shroud) has converging-diverging nozzle design, to increase the mass flow rate through the rotor. The ratio of inlet area to throat area, Ai/At is 1.31 and exit area to throat area, Ae/At is1.15. The Solidworks model has been analyzed numerically using CFD. The software used is StarCCM +. The Unsteady Reynolds Averaged Navier Stokes Simulation (URANS) K- ɛ model has been selected, to study the physical properties of the flow, with emphasis on the performance of the turbine. Stress analysis has been done using Nastran. From the simulations, the torque generated by the turbine is approximately 800N-m and angular velocity is 21 rad/s.

  19. CFD Simulation of Fouling by Biological materials in Membrane Bioreactor

    Directory of Open Access Journals (Sweden)

    Raziye, Ahmadi

    2016-06-01

    Full Text Available In recent years membrane bioreactors filtration is increasingly used in wastewater treatment to enhance the quality of wastewater. The main problem in preventing the widespread use of membrane bioreactor is its congestion which has a severe impact on output flux to time ratio. If solid suspensions with high concentrations exist in the wastewater, this influence will be even more severe. In addition to the suspended solids in the liquid mixture, Extracellular polymeric materials (EPS and soluble microbial products (SMP are also known as basic microbial products that cause membrane fouling. EPS can be calculated within and on the membrane which increases the viscosity of suspended solids in the liquid mixture and increases filtration resistance. SMPs cannot penetrate the pores of the ultra filtration membrane due to the limited size of the pores which would cause fouling in membrane processes. According to the above issues, providing a model that indicates the properties and conditions of formation and destruction of SMP and EPS at the same time seems necessary. In this paper, CFD simulation of biological fouling in membrane bioreactor is provided using Fluent software.

  20. CFD Model of Water Droplet Transport for ISS Hygiene Activity

    Science.gov (United States)

    Son, Chang H.

    2011-01-01

    The goal of the study is to assess the impacts of free water propagation in the Waste and Hygiene Compartment (WHC). Free water can be generated inside the WHC in small quantities due to crew hygiene activity. To mitigate potential impact of free water in Node 3 cabin the WHC doorway is enclosed by a waterproof bump-out, Kabin, with openings at the top and bottom. At the overhead side of the rack, there is a screen that prevents large drops of water from exiting. However, as the avionics fan in the WHC causes airflow toward the deck side of the rack, small quantities of free water may exit at the bottom of the Kabin. A Computational Fluid Dynamics (CFD) analysis of Node 3 cabin airflow made possible to identify the paths of water transport. The Node 3 airflow was computed for several ventilation scenarios. To simulate the droplet transport the Lagrangian discrete phase approach was used. Various initial droplet distributions were considered in the study. The droplet diameter was varied in the range of 2-20 mm. The results of the computations showed that most of the drops fall to the rack surface not far from the WHC curtain. The probability of the droplet transport to the adjacent rack surface with electronic equipment was predicted.

  1. Investigation of Indonesian Traditional Houses through CFD Simulation

    Science.gov (United States)

    Suhendri; Koerniawan, M. D.

    2017-03-01

    Modern buildings in Indonesia rely mostly on artificial lighting, heating, cooling and ventilation. It means more energy is used to drive mechanical appliances, and presumably not sustainable. Meanwhile modern buildings consume much energy, traditional architectures are known as the source of knowledge for sustainable, energy efficient and climate responsive design. Noticeably, one of the differences between modern and traditional buildings in Indonesia is shown in their strategy to provide thermal comfort to the user. Traditional buildings use natural ventilation, but modern buildings use mechanical air conditioning. By focusing on wind-driven ventilation, the study aims to investigate natural ventilation strategy of Indonesian traditional house, and their potential improvement to be used in modern Indonesian buildings. Three traditional houses are studied in this research, representing west, central, and east Indonesia. The houses are Lampung traditional house, Javanese traditional house, and Toraja traditional house. CFD simulation is conducted to simulate wind-driven ventilation behaviour and the temperature of the buildings. Concisely, the wind-natural ventilation of case study houses is potential to provide thermal comfort inside the houses. However, the strategy still can be optimized by adding some other passive design strategies: sun-shading; vegetation; or buildings arrangement in the traditional dwelling. Consideration about the roof’s shape and windows position to the roof is important as well to create a uniform air distribution.

  2. Clinical questions and the role CFD can play

    Science.gov (United States)

    Basu, Phd, Saikat; Kimbell, Phd, Julia S.; Zanation, Md, Adam M.; Ebert, Md, Charles S.; Senior, Md, Brent A.

    2016-11-01

    Use of computational fluid dynamics has revolutionized our perspectives on flow problems in engineering. These tools are however still underused in exploring clinical questions. Here we present some representative CFD-based findings that can improve current clinical practice. Chronic rhinosinusitis (CRS) is a complex inflammatory disease affecting over 11 million Americans yearly. It obstructs sinus pathways, thus hindering ventilation and clearance. Prescribed topical medications are often ineffective even after surgeries, partially owing to scanty drug delivery to the affected areas. We focus on improving the use of the most frequently used topical nasal sprays. From computed tomography (CT) scans, we develop 3D sinonasal airway models on the medical imaging software MimicsTM, which are then meshed using ICEM-CFDTM followed by airflow and particle simulations on FluentTM (v.14.5, ANSYS, Inc.). The results quantify aerosol particle delivery to target cavities before and after surgical alleviation. Various combinations of breathing techniques and head-nozzle orientations can increase target-site particle deposition over depositions using prevalent physician recommendations, and our findings facilitate identification of such optimal conditions. Supported by the National Institutes of Health (NIH) Grant R01 HL122154. The content is solely the responsibility of the authors and does not necessarily represent the official views of the NIH.

  3. CFD simulation of anaerobic digester with variable sewage sludge rheology.

    Science.gov (United States)

    Craig, K J; Nieuwoudt, M N; Niemand, L J

    2013-09-01

    A computational fluid dynamics (CFD) model that evaluates mechanical mixing in a full-scale anaerobic digester was developed to investigate the influence of sewage sludge rheology on the steady-state digester performance. Mechanical mixing is provided through an impeller located in a draft tube. Use is made of the Multiple Reference Frame model to incorporate the rotating impeller. The non-Newtonian sludge is modeled using the Hershel-Bulkley law because of the yield stress present in the fluid. Water is also used as modeling fluid to illustrate the significant non-Newtonian effects of sewage sludge on mixing patterns. The variation of the sewage sludge rheology as a result of the digestion process is considered to determine its influence on both the required impeller torque and digester mixing patterns. It was found that when modeling the fluid with the Hershel-Bulkley law, the high slope of the sewage stress-strain curve at high shear rates causes significant viscous torque on the impeller surface. Although the overall fluid shear stress property is reduced during digestion, this slope is increased with sludge age, causing an increase in impeller torque for digested sludge due to the high strain rates caused by the pumping impeller. Consideration should be given to using the Bingham law to deal with high strain rates. The overall mixing flow patterns of the digested sludge do however improve slightly.

  4. CFD study of turbulent jet impingement on curved surface

    Institute of Scientific and Technical Information of China (English)

    Javad Taghinia; Md Mizanur Rahman; Timo Siikonen

    2016-01-01

    The heat transfer and flow characteristics of air jet impingement on a curved surface are investigated with com-putational fluid dynamics (CFD) approach. The first applied model is a one-equation SGS model for large eddy simulation (LES) and the second one is the SST-SAS hybrid RANS-LES. These models are utilized to study the flow physics in impinging process on a curved surface for different jet-to-surface (h/B) distances at two Reynolds numbers namely, 2960 and 4740 based on the jet exit velocity (Ue) and the hydraulic diameter (2B). The predic-tions are compared with the experimental data in the literature and also the results from RANS k-εmodel. Com-parisons show that both models can produce relatively good results. However, one-equation model (OEM) produced more accurate results especial y at impingement region at lower jet-to-surface distances. In terms of heat transfer, the OEM also predicted better at different jet-to-surface spacings. It is also observed that both models show similar performance at higher h/B ratios.

  5. Application of computational fluid dynamics (CFD) to nuclear applications.

    Energy Technology Data Exchange (ETDEWEB)

    Brewster, R. A.; Jonnavithula, S.; Rizwan-Uddin; Rock, D. T.; Weber, D. P.; Wei, T. Y. C.

    1999-02-08

    Detailed analysis of a quarter channel was performed using VIPRE and CFX. Results show that VIPRE and CFX agree closely in both cross-sectionally averaged axial temperature and cross-sectionally averaged axial velocity profiles. Detailed temperature distributions in the radial direction over 1mm from the clad surface towards the center of the channel were calculated using CFX, showing significant local variation. This information can be used for example, to determine if this temperature will lead to bubble nucleation. Quarter subassembly calculations were made with both VIPRE and STAR-CD. Comparison between the solutions show that the two codes yield very similar solutions under comparable conditions. However, the STAR-CD CFD calculation provides the analyst with much more detailed flow and temperature distributions than can be predicted by a one-dimensional code such as VIPRE. In addition, a 60 million cell one-eighth reactor core calculation was made using STAR-CD. This analysis showed the importance of accurately predicting the flow and temperature fields in all assemblies simultaneously with modern parallel processing technology, practical turnaround for these types of calculation can be obtained.

  6. A Quasi-One-Dimensional CFD Model for Multistage Turbomachines

    Institute of Scientific and Technical Information of China (English)

    Olivier Léonard; Olivier Adam

    2008-01-01

    The objective of this paper is to present a fast and reliable CFD model that is able to simulate stationary and transient operations of multistage compressors and turbines. This analysis tool is based on an adapted version of the Euler equations solved by a time-marching, finite-volume method. The Euler equations have been extended by including source terms expressing the blade-flow interactions. These source terms are determined using the velocity triangles and a row-by-row representation of the blading at mid-span. The losses and deviations undergone by the fluid across each blade row are supplied by correlations. The resulting flow solver is a performance prediction tool based only on the machine geometry, offering the possibility of exploring the entire characteristic map of a multistage compressor or turbine. Its efficiency in terms of CPU time makes it possible to couple it to an optimization algorithm or to a gas turbine performance tool. Different test-cases are presented for which the calculated characteristic maps are compared to experimental ones.

  7. Simplistic Approach to Characterize Sloshing Phenomena using CFD Simulation

    Science.gov (United States)

    Mahmud, Md; Khan, Rafiqul; Xu, Qiang

    2015-03-01

    Liquid sloshing in vessels caused by forced acceleration has been the subject of intense investigations for last several decades both by experiments and numerical simulations. Many studies are done to minimize the sloshing induced forces on the vessel internals and some studies focused on different ways to describe the sloshing patterns. Most of the sloshing characterization methods are done using complex mathematical manipulation and more simplified method may be useful for better practical understanding. In this study, simple/easily understandable methods are explored to describe sloshing phenomenon through Computation Fluid Dynamics (CFD) simulation. Several parameters were varied including liquid level/tank length ratio, wave induced vessel motions, motion frequency, amplitudes in various sea state conditions. Parameters such as hydrodynamic force, pressure, moments, turbulent kinetic energy, height of the free surface, vorticity are used to quantify the sloshing intensity. In addition, visual inspections of sloshing motion are done through gas-liquid/oil-water interface fluctuation, streamlines, vector profiles. An equation connecting independent variables to resultant quantities will be established that will make it easier to describe the sloshing.

  8. 3D CFD Analysis of a Vertical Axis Wind Turbine

    Directory of Open Access Journals (Sweden)

    Andrea Alaimo

    2015-04-01

    Full Text Available To analyze the complex and unsteady aerodynamic flow associated with wind turbine functioning, computational fluid dynamics (CFD is an attractive and powerful method. In this work, the influence of different numerical aspects on the accuracy of simulating a rotating wind turbine is studied. In particular, the effects of mesh size and structure, time step and rotational velocity have been taken into account for simulation of different wind turbine geometries. The applicative goal of this study is the comparison of the performance between a straight blade vertical axis wind turbine and a helical blade one. Analyses are carried out through the use of computational fluid dynamic ANSYS® Fluent® software, solving the Reynolds averaged Navier–Stokes (RANS equations. At first, two-dimensional simulations are used in a preliminary setup of the numerical procedure and to compute approximated performance parameters, namely the torque, power, lift and drag coefficients. Then, three-dimensional simulations are carried out with the aim of an accurate determination of the differences in the complex aerodynamic flow associated with the straight and the helical blade turbines. Static and dynamic results are then reported for different values of rotational speed.

  9. The numerical simulation based on CFD of hydraulic turbine pump

    Science.gov (United States)

    Duan, X. H.; Kong, F. Y.; Liu, Y. Y.; Zhao, R. J.; Hu, Q. L.

    2016-05-01

    As the functions of hydraulic turbine pump including self-adjusting and compensation with each other, it is far-reaching to analyze its internal flow by the numerical simulation based on CFD, mainly including the pressure field and the velocity field in hydraulic turbine and pump.The three-dimensional models of hydraulic turbine pump are made by Pro/Engineer software;the internal flow fields in hydraulic turbine and pump are simulated numerically by CFX ANSYS software. According to the results of the numerical simulation in design condition, the pressure field and the velocity field in hydraulic turbine and pump are analyzed respectively .The findings show that the static pressure decreases systematically and the pressure gradient is obvious in flow area of hydraulic turbine; the static pressure increases gradually in pump. The flow trace is regular in suction chamber and flume without spiral trace. However, there are irregular traces in the turbine runner channels which contrary to that in flow area of impeller. Most of traces in the flow area of draft tube are spiral.

  10. PIV-measured versus CFD-predicted flow dynamics in anatomically realistic cerebral aneurysm models.

    Science.gov (United States)

    Ford, Matthew D; Nikolov, Hristo N; Milner, Jaques S; Lownie, Stephen P; Demont, Edwin M; Kalata, Wojciech; Loth, Francis; Holdsworth, David W; Steinman, David A

    2008-04-01

    Computational fluid dynamics (CFD) modeling of nominally patient-specific cerebral aneurysms is increasingly being used as a research tool to further understand the development, prognosis, and treatment of brain aneurysms. We have previously developed virtual angiography to indirectly validate CFD-predicted gross flow dynamics against the routinely acquired digital subtraction angiograms. Toward a more direct validation, here we compare detailed, CFD-predicted velocity fields against those measured using particle imaging velocimetry (PIV). Two anatomically realistic flow-through phantoms, one a giant internal carotid artery (ICA) aneurysm and the other a basilar artery (BA) tip aneurysm, were constructed of a clear silicone elastomer. The phantoms were placed within a computer-controlled flow loop, programed with representative flow rate waveforms. PIV images were collected on several anterior-posterior (AP) and lateral (LAT) planes. CFD simulations were then carried out using a well-validated, in-house solver, based on micro-CT reconstructions of the geometries of the flow-through phantoms and inlet/outlet boundary conditions derived from flow rates measured during the PIV experiments. PIV and CFD results from the central AP plane of the ICA aneurysm showed a large stable vortex throughout the cardiac cycle. Complex vortex dynamics, captured by PIV and CFD, persisted throughout the cardiac cycle on the central LAT plane. Velocity vector fields showed good overall agreement. For the BA, aneurysm agreement was more compelling, with both PIV and CFD similarly resolving the dynamics of counter-rotating vortices on both AP and LAT planes. Despite the imposition of periodic flow boundary conditions for the CFD simulations, cycle-to-cycle fluctuations were evident in the BA aneurysm simulations, which agreed well, in terms of both amplitudes and spatial distributions, with cycle-to-cycle fluctuations measured by PIV in the same geometry. The overall good agreement

  11. Biorefinery Technologies for Biomass Conversion Into Chemicals and Fuels Towards Zero Emissions (Review) / Nulles Emisiju Princips Biomasas Konversijas Tehnoloģijās Aizstājot Fosilos Resursus (Pārskata Raksts)

    Science.gov (United States)

    Gravitis, J.; Abolins, J.

    2013-10-01

    Exhausting of world resources, increasing pollution, and climate change are compelling the shift of the world economy from continuous growth to a kind of economy based on integration of technologies into zero emissions production systems. Transition from non-renewable fossil resources to renewable resources provided by solar radiation and the current processes in biosphere is seen in the bio-refinery approach - replacing crude oil refineries by biomass refineries. Biotechnology and nano-technologies are getting accepted as important players along with conventional biomass refinery technologies. Systems design is a significant element in the integration of bio-refinery technologies in clusters. A number of case-studies, steam explosion auto-hydrolysis (SEA) in particular, are reviewed to demonstrate conversion of biomass into value-added chemicals and fuels. Analysis of energy flows is made as part of modelling the SEA processes, the eMergy (energy memory) approach and sustainability indices being applied to assess environmental impacts. Resursu izsīkums, vides piesārņojums un globāla mēroga klimatiskās izmaiņas ir civilizācijas izdzīvošanai būtiski faktori, kas virza pasaules ekonomikas pārmaiņas, atsakoties no nepārtrauktas izaugsmes idejas par labu tādai ekonomikai, kas balstās uz atjaunojošamies resursiem un dažādu tehnoloģiju integrācijemisiju principam atbilstošās ražošanas sistēmās. Saules radiācijas ierosinātajos planētas biosfērā notiekošajos procesos radīto organisko vielu pārstrādes kompleksi, kas operē ievērojot sabalansētu nulles emisiju principu, tiek uzlūkoti kā tās ekonomiskās (ražošanas) struktūras, kurām jānodrošina pāreja uz atjaunojošos resursu izmantošanu, aizstājot esošās fosilo resursu (naftas, ogļu) pārstrādes rūpnīcas. Līdzās jau apgūtajām biomasas rafinēšanas tehnoloģijām svarīga un pieaugoša loma ekonomiskās sistēmas resursu bāzes nomaiņā ir bio- un nanotehnolo

  12. CFD analysis and flow model reduction for surfactant production in helix reactor = CFD analiza i redukcija modela strujanja za proizvodnju surfaktanta u helix reaktoru

    NARCIS (Netherlands)

    Nikačević, N.M.; Thielen, L.; Twerda, A.; Hof, P.M.J. van den

    2015-01-01

    Flow pattern analysis in a spiral Helix reactor is conducted, for the application in commercial surfactant production. Step change response curves (SCR) were obtained from numerical tracer experiments by three-dimensional computational fluid dynamics (CFD) simulations. Non-reactive flow is simulated

  13. CFD-DEM simulations of current-induced dune formation and morphological evolution

    Science.gov (United States)

    Sun, Rui; Xiao, Heng

    2016-06-01

    Understanding the fundamental mechanisms of sediment transport, particularly those during the formation and evolution of bedforms, is of critical scientific importance and has engineering relevance. Traditional approaches of sediment transport simulations heavily rely on empirical models, which are not able to capture the physics-rich, regime-dependent behaviors of the process. With the increase of available computational resources in the past decade, CFD-DEM (computational fluid dynamics-discrete element method) has emerged as a viable high-fidelity method for the study of sediment transport. However, a comprehensive, quantitative study of the generation and migration of different sediment bed patterns using CFD-DEM is still lacking. In this work, current-induced sediment transport problems in a wide range of regimes are simulated, including 'flat bed in motion', 'small dune', 'vortex dune' and suspended transport. Simulations are performed by using SediFoam, an open-source, massively parallel CFD-DEM solver developed by the authors. This is a general-purpose solver for particle-laden flows tailed for particle transport problems. Validation tests are performed to demonstrate the capability of CFD-DEM in the full range of sediment transport regimes. Comparison of simulation results with experimental and numerical benchmark data demonstrates the merits of CFD-DEM approach. In addition, the improvements of the present simulations over existing studies using CFD-DEM are presented. The present solver gives more accurate prediction of sediment transport rate by properly accounting for the influence of particle volume fraction on the fluid flow. In summary, this work demonstrates that CFD-DEM is a promising particle-resolving approach for probing the physics of current-induced sediment transport.

  14. Development of a compartment model based on CFD simulations for description of mixing in bioreactors

    Directory of Open Access Journals (Sweden)

    Crine, M.

    2010-01-01

    Full Text Available Understanding and modeling the complex interactions between biological reaction and hydrodynamics are a key problem when dealing with bioprocesses. It is fundamental to be able to accurately predict the hydrodynamics behavior of bioreactors of different size and its interaction with the biological reaction. CFD can provide detailed modeling about hydrodynamics and mixing. However, it is computationally intensive, especially when reactions are taken into account. Another way to predict hydrodynamics is the use of "Compartment" or "Multi-zone" models which are much less demanding in computation time than CFD. However, compartments and fluxes between them are often defined by considering global quantities not representative of the flow. To overcome the limitations of these two methods, a solution is to combine compartment modeling and CFD simulations. Therefore, the aim of this study is to develop a methodology in order to propose a compartment model based on CFD simulations of a bioreactor. The flow rate between two compartments can be easily computed from the velocity fields obtained by CFD. The difficulty lies in the definition of the zones in such a way they can be considered as perfectly mixed. The creation of the model compartments from CFD cells can be achieved manually or automatically. The manual zoning consists in aggregating CFD cells according to the user's wish. The automatic zoning defines compartments as regions within which the value of one or several properties are uniform with respect to a given tolerance. Both manual and automatic zoning methods have been developed and compared by simulating the mixing of an inert scalar. For the automatic zoning, several algorithms and different flow properties have been tested as criteria for the compartment creation.

  15. CFD simulation and experimental validation of a GM type double inlet pulse tube refrigerator

    Science.gov (United States)

    Banjare, Y. P.; Sahoo, R. K.; Sarangi, S. K.

    2010-04-01

    Pulse tube refrigerator has the advantages of long life and low vibration over the conventional cryocoolers, such as GM and stirling coolers because of the absence of moving parts in low temperature. This paper performs a three-dimensional computational fluid dynamic (CFD) simulation of a GM type double inlet pulse tube refrigerator (DIPTR) vertically aligned, operating under a variety of thermal boundary conditions. A commercial computational fluid dynamics (CFD) software package, Fluent 6.1 is used to model the oscillating flow inside a pulse tube refrigerator. The simulation represents fully coupled systems operating in steady-periodic mode. The externally imposed boundary conditions are sinusoidal pressure inlet by user defined function at one end of the tube and constant temperature or heat flux boundaries at the external walls of the cold-end heat exchangers. The experimental method to evaluate the optimum parameters of DIPTR is difficult. On the other hand, developing a computer code for CFD analysis is equally complex. The objectives of the present investigations are to ascertain the suitability of CFD based commercial package, Fluent for study of energy and fluid flow in DIPTR and to validate the CFD simulation results with available experimental data. The general results, such as the cool down behaviours of the system, phase relation between mass flow rate and pressure at cold end, the temperature profile along the wall of the cooler and refrigeration load are presented for different boundary conditions of the system. The results confirm that CFD based Fluent simulations are capable of elucidating complex periodic processes in DIPTR. The results also show that there is an excellent agreement between CFD simulation results and experimental results.

  16. CFD analysis of the temperature field in emergency pump room in Loviisa NPP

    Energy Technology Data Exchange (ETDEWEB)

    Rämä, Tommi, E-mail: tommi.rama@fortum.com [Fortum Power and Heat, P.O.B. 100, FI-00048 Fortum (Finland); Toppila, Timo, E-mail: timo.toppila@fortum.com [Fortum Power and Heat, P.O.B. 100, FI-00048 Fortum (Finland); Kelavirta, Teemu, E-mail: teemu.kelavirta@fortum.com [Fortum Power and Heat, Loviisa Power Plant, P.O.B. 23, FI-07901 Loviisa (Finland); Martin, Pasi, E-mail: pasi.martin@fortum.com [Fortum Power and Heat, Loviisa Power Plant, P.O.B. 23, FI-07901 Loviisa (Finland)

    2014-11-15

    Highlights: • Laser scanned room geometry from Loviisa NPP was utilized for CFD simulation. • Uncertainty of CFD simulation was estimated using the Grid Convergence Index. • Measured temperature field of pump room was reproduced with CFD simulation. - Abstract: In the Loviisa Nuclear Power Plant (NPP) six emergency pumps belonging to the same redundancy are located in the same room. During a postulated accident the cooling of the room is needed as the engines of the emergency pumps generate heat. Cooling is performed with fans blowing air to the upper part of the room. Temperature limits have been given to the operating conditions of the main components in order to ensure their reliable operation. Therefore the temperature field of the room is important to know. Temperature measurements were made close to the most important components of the pump room to get a better understanding of the temperature field. For these measurements emergency pumps and cooling fan units were activated. To simulate conditions during a postulated accident additional warm-air heaters were used. Computational fluid dynamic (CFD) simulations were made to support plant measurements. For the CFD study one of the pump rooms of Loviisa NPP was scanned with a laser and this data converted to detailed 3-D geometry. Tetrahedral computation grid was created inside the geometry. Grid sensitivity studies were made, and the model was then validated against the power plant tests. With CFD the detailed temperature and flow fields of the whole room were produced. The used CFD model was able to reproduce the temperature field of the measurements. Two postulated accident cases were simulated. In the cases the operating cooling units were varied. The temperature profile of the room changes significantly depending on which units are cooling and which only circulating the air. The room average temperature stays approximately the same. The simulation results were used to ensure the acceptable operating

  17. Using CFD as Rocket Injector Design Tool: Recent Progress at Marshall Space Flight Center

    Science.gov (United States)

    Tucker, Kevin; West, Jeff; Williams, Robert; Lin, Jeff; Rocker, Marvin; Canabal, Francisco; Robles, Bryan; Garcia, Robert; Chenoweth, James

    2003-01-01

    The choice of tools used for injector design is in a transitional phase between exclusive reliance on the empirically based correlations and extensive use of computational fluid dynamics (CFD). The Next Generation Launch Technology (NGLT) Program goals emphasizing lower costs and increased reliability have produced a need to enable CFD as an injector design tool in a shorter time frame. This is the primary objective of the Staged Combustor Injector Technology Task currently under way at Marshall Space Flight Center (MSFC). The documentation of this effort begins with a very brief status of current injector design tools. MSFC's vision for use of CFD as a tool for combustion devices design is stated and discussed with emphasis on the injector. The concept of the Simulation Readiness Level (SRL), comprised of solution fidelity, robustness and accuracy, is introduced and discussed. This quantitative measurement is used to establish the gap between the current state of demonstrated capability and that necessary for regular use in the design process. MSFC's view of the validation process is presented and issues associated with obtaining the necessary data are noted and discussed. Three current experimental efforts aimed at generating validation data are presented. The importance of uncertainty analysis to understand the data quality is also demonstrated. First, a brief status of current injector design tools is provided as context for the current effort. Next, the MSFC vision for using CFD as an injector design tool is stated. A generic CFD-based injector design methodology is also outlined and briefly discussed. Three areas where MSFC is using injector CFD analyses for program support will be discussed. These include the Integrated Powerhead Development (IPD) engine which uses hydrogen and oxygen propellants in a full flow staged combustion (FFSC) cycle and the TR-107 and the RS84 engine both of which use RP-1 and oxygen in an ORSC cycle. Finally, an attempt is made to

  18. Diseño de un sistema de estabilización utilizando sensores inteligentes

    OpenAIRE

    2015-01-01

    Diseño de un sistema de estabilización utilizando sensores inteligentes. This final project proposes the development of an intelligent sensor system low cost based on accelerometers and PICs to create a stabilization system for detecting tilt of a platform. This system will maintain the platform in an equilibrium position, regardless of the movement of the brackets that supports it. Hence, the system will be able to interpret and process the data output by the accelerometer detecting chang...

  19. Study of Date Exchange Metod for Coupling Computational CFD/CSD%CFD/CSD耦合计算研究

    Institute of Scientific and Technical Information of China (English)

    徐敏; 陈士橹

    2004-01-01

    基于流体--结构干扰计算中流体和结构网格之间的数据交换方法的研究,提出了一种改进的常体积转换法(CVT),即引入面积限制值来保证网格插值的质量.运用该方法对两种常规外形:机翼和弹体圆柱段进行了插值计算,并与无限平板样条法(IPS)进行了比较和误差评估.认为改进的CVT插值方法能避免原CVT方法可能出现的异常情况,且大大提高了插值精度,是一种适合用于CFD/CSD耦合计算接口界面的插值方法.

  20. Caracterización energética y emisiones de una estufa de cocción ecoeficiente con biomasa a diferentes altitudes//Energy and emissions characterization of an eco‐efficient biomass cook stove at different altitudes

    Directory of Open Access Journals (Sweden)

    Juan F. Pérez-Bayer

    2013-09-01

    Full Text Available Cerca de 2500 millones de personas dependen de la leña como su principal combustible para calefacción y cocción.En este trabajo se estudia el efecto de la altitud (678 y 1976 metros sobre el nivel del mar, msnm en el desempeño energético y las emisiones de una estufa de cocción eco-eficiente con biomasa.Los experimentos se llevaron a cabo bajo las pruebas de ebullición de agua y cocción controlada. El rendimiento disminuyó 24% al aumentar la altitud en la prueba de ebullición, y el consumo específico de combustible aumentó 27,3% debido a los cambios en la densidad del aire. En la prueba de cocción controlada, el consumo específico de combustible y las emisiones específicas aumentaron 15,3% y 16%, respectivamente. La altitud afectó significativamente el desempeño de la estufa tipo "Plancha", por lo que es necesario el rediseño de las estufas de acuerdo a su ubicación geográfica con el fin de optimizar el proceso de cocción.Palabras claves: estufa de cocción eco-eficiente, biomasa, combustión, altitud, energía y emisiones, pruebas de desempeño WBT–CCT.______________________________________________________________________________AbstractAround 2.5 billion people depend on wood as their main fuel for heating and cooking.In this work is studied the effect of altitude (678 and 1976 meters above sea level on energy performance and emissions of an improved wood stove under standardized cooking tests. The experiments were carried out under the Water Boiling (WBTand Controlled Cooking (CCT Tests. The efficiency decreased about 24% with increasing altitude in WBT, and specific fuel consumption increased 27.3% due to the air density changes. Regarding the controlled cooking test, the specific fuel consumption and specific emissions increased by 15.3% and 16 %, respectively. It is highlighted that altitude significantly affects the “Plancha” wood stove behavior. Specific emissions increased at higher altitudes, so it is

  1. CFD simulation of steam–air jet condensation

    Energy Technology Data Exchange (ETDEWEB)

    Qu, Xiao-hang [School of Energy and Power Engineering, Shandong University, Jinan 250061, Shandong (China); Sui, Hui [Shandong Laigang Energy Conservation and Environmental Protection Engineering Co., Ltd, Laiwu 271133, Shandong (China); Tian, Mao-cheng, E-mail: tianmc65@sdu.edu.cn [School of Energy and Power Engineering, Shandong University, Jinan 250061, Shandong (China)

    2016-02-15

    Highlights: • Steam–air mixture jet direct contact condensation behavior is studied numerically. • Euler–Euler two-fluid model and species model are coupled to simulated jet condensation. • Thermal phase change model is used to account for interphase mass transfer. • Gas volume fraction from simulation is corrected for comparison with experiment. • Temperature and gas volume fraction distributions agree reasonably with experimental results. - Abstract: A three dimensional model was established based on Euler–Euler two-fluid model to simulate the steam jet direct contact condensation with air involved. Condensation of steam in the gas mixture was realized using thermal phase change model. Species transport equation for the gas phase was employed to account for composition variation of the steam air mixture. The investigated gas mass flux at nozzle exit was within 300 kg/m{sup 2}/s, with non-condensable air of less than 10%. Numerical results show the steam in gas plume condenses rapidly after leaving the nozzle, until only air and a little uncondensed steam remain in the gas plume. The addition of air in the jet deteriorates the condensation heat transfer, leading temperature and void fraction around the nozzle to decrease more slowly in both axial and radial directions. Five cases of experimental results were demonstrated with three of them validating the temperature distribution and two of them validating the void fraction. The comparison between numerical and experimental results demonstrates the CFD model can predict the steam–air jet condensation process quite reasonably.Classification: K. Thermal hydraulics.

  2. CFD validation for flyash particle classification in hydrocyclones

    Energy Technology Data Exchange (ETDEWEB)

    K. Udaya Bhaskar; Y. Rama Murthy; N. Ramakrishnan; J.K. Srivastava; Supriya Sarkar; Vimal Kumar [Regional Research Laboratory (CSIR), Bhopal (India)

    2007-03-15

    The investigation pertains to establishing a simulation methodology for understanding the flyash classification characteristics of a 76 and 50 mm diameter hydrocyclone where the work was carried out using commercially available CFD software. Comparative results on the simulated and experimental water throughput, split values are presented. Results indicted that there is a good match in water split between the experimental and simulated values with error values below 10% at different hydrocyclone designs. Further a discussion is made on the flow features at comparable ratio of cyclone diameter to spigot opening in the 76 and 50 mm designs. Classification of flyash particulates is simulated through discrete phase modeling using particles injection technique and the simulated results are further validated with suitably performed experiments. With 50 mm diameter hydrocyclone, reasonable predictions are observed at 9.4 mm spigot opening. Considerable deviation in particle distribution points with This hydrocyclone is observed at narrowest spigot diameter of 3.2 mm. The simulated values of d{sub 50} in case of 50 mm diameter hydrocyclone are 8 and 10 {mu}m at 9.4 and 3.2 mm diameter spigot openings. Better predictions are obtained with 76 mm diameter hydrocyclone at both 10 and 15 mm diameter spigot openings. Similarly, the simulated d{sub 50} values are 14 and 20 {mu}m at 15 and 10 mm diameter hydrocyclones. Possible reasons for deviations in the results relating the spigot opening, solids concentration at the underflow and in turn role of slurry viscosity on the air core diameter are proposed.

  3. CFD Investigation for Flow Blockage Accident in a Lower Plenum

    Energy Technology Data Exchange (ETDEWEB)

    Yoo, J.; Chang, W. P.; Jeong, J. H.; Ha, K. S. [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2015-10-15

    Large Partial Inlet flow blockage is involved as a BE (Bounding Event) in PGSFR. There are no known sources for objects of this nature in the inlet plenum but one could postulate that a large object might be gotten down to lower plenum. It is possible to block the entrance of nozzle at receptacle which has 6 nozzles located just below the orifice plates. Then it can cause the flow reduction that flows into a fuel assembly and affect cladding integrity. The objective of the present study is to predict the flow reduction of hottest assembly as well as flow features in a lower plenum when orifice nozzle under hottest assembly is blocked by large objects. A CFD analysis by fully resolved RANS simulations has been carried out to predict effects of flow blockage at side orifice as well as flow feature in a lower plenum. In the no-blockage case, the velocity vector around the side orifice nozzle has symmetry because flow is uniformly distributed through 6-side orifice nozzle. The velocity of flow right after passing through orifice nozzle increases very rapidly which is estimated as maximum 7.5 m/s and pressure drops abruptly. This is the conversion of potential energy to kinetic energy in compliance with the Bernoulli's theorem. For 5-orifce nozzle blockage cases, recirculation around the side orifice nozzle was found, which is asymmetric and complex. This means that reduced flow area had a more influence on friction loss by viscosity and it occurred more flow resistance compared to no-blockage case. The maximum velocity for the 5-orifice nozzle blockage case was estimated as 13 m/s The more blockage area at orifice increases, the more flow rate of the hottest assembly decreases. The maximum reduced flow of hottest assembly was predicted to be about 9.32 kg/s.

  4. Needs and opportunities for CFD-code validation

    Energy Technology Data Exchange (ETDEWEB)

    Smith, B.L. [Paul Scherrer Institute, Villigen (Switzerland)]|[Paul Scherrer Instiute, Wuerenlingen (Switzerland)

    1996-06-01

    The conceptual design for the ESS target consists of a horizontal cylinder containing a liquid metal - mercury is considered in the present study - which circulates by forced convection and carries away the waste heat generated by the spallation reactions. The protons enter the target via a beam window, which must withstand the thermal, mechanical and radiation loads to which it is subjected. For a beam power of 5MW, it is estimated that about 3.3MW of waste heat would be deposited in the target material and associated structures. it is intended to confirm, by detailed thermal-hydraulics calculations, that a convective flow of the liquid metal target material can effectively remove the waste heat. The present series of Computational Fluid Dynamics (CFD) calculations has indicated that a single-inlet Target design leads to excessive local overheating, but a multiple-inlet design, is coolable. With this option, inlet flow streams, two from the sides and one from below, merge over the target window, cooling the window itself in crossflow and carrying away the heat generated volumetrically in the mercury with a strong axial flow down the exit channel. The three intersecting streams form a complex, three-dimensional, swirling flow field in which critical heat transfer processes are taking place. In order to produce trustworthy code simulations, it is necessary that the mesh resolution is adequate for the thermal-hydraulic conditions encountered and that the physical models used by the code are appropriate to the fluid dynamic environment. The former relies on considerable user experience in the application of the code, and the latter assurance is best gained in the context of controlled benchmark activities where measured data are available. Such activities will serve to quantify the accuracy of given models and to identify potential problem area for the numerical simulation which may not be obvious from global heat and mass balance considerations.

  5. CFD MODELING ANALYSIS OF MECHANICAL DRAFT COOLING TOWER

    Energy Technology Data Exchange (ETDEWEB)

    Lee, S; Alfred Garrett, A; James02 Bollinger, J; Larry Koffman, L

    2008-03-03

    Industrial processes use mechanical draft cooling towers (MDCT's) to dissipate waste heat by transferring heat from water to air via evaporative cooling, which causes air humidification. The Savannah River Site (SRS) has a MDCT consisting of four independent compartments called cells. Each cell has its own fan to help maximize heat transfer between ambient air and circulated water. The primary objective of the work is to conduct a parametric study for cooling tower performance under different fan speeds and ambient air conditions. The Savannah River National Laboratory (SRNL) developed a computational fluid dynamics (CFD) model to achieve the objective. The model uses three-dimensional steady-state momentum, continuity equations, air-vapor species balance equation, and two-equation turbulence as the basic governing equations. It was assumed that vapor phase is always transported by the continuous air phase with no slip velocity. In this case, water droplet component was considered as discrete phase for the interfacial heat and mass transfer via Lagrangian approach. Thus, the air-vapor mixture model with discrete water droplet phase is used for the analysis. A series of the modeling calculations was performed to investigate the impact of ambient and operating conditions on the thermal performance of the cooling tower when fans were operating and when they were turned off. The model was benchmarked against the literature data and the SRS test results for key parameters such as air temperature and humidity at the tower exit and water temperature for given ambient conditions. Detailed results will be presented here.

  6. CFD Modeling of LNG Spill: Humidity Effect on Vapor Dispersion

    Science.gov (United States)

    Giannissi, S. G.; Venetsanos, A. G.; Markatos, N.

    2015-09-01

    The risks entailed by an accidental spill of Liquefied Natural Gas (LNG) should be indentified and evaluated, in order to design measures for prevention and mitigation in LNG terminals. For this purpose, simulations are considered a useful tool to study LNG spills and to understand the mechanisms that influence the vapor dispersion. In the present study, the ADREA-HF CFD code is employed to simulate the TEEX1 experiment. The experiment was carried out at the Brayton Fire Training Field, which is affiliated with the Texas A&M University system and involves LNG release and dispersion over water surface in open- obstructed environment. In the simulation the source was modeled as a two-phase jet enabling the prediction of both the vapor dispersion and the liquid pool spreading. The conservation equations for the mixture are solved along with the mass fraction for natural gas. Due to the low prevailing temperatures during the spill ambient humidity condenses and this might affect the vapor dispersion. This effect was examined in this work by solving an additional conservation equation for the water mass fraction. Two different models were tested: the hydrodynamic equilibrium model which assumes kinetic equilibrium between the phases and the non hydrodynamic equilibrium model, in order to assess the effect of slip velocity on the prediction. The slip velocity is defined as the difference between the liquid phase and the vapor phase and is calculated using the algebraic slip model. Constant droplet diameter of three different sizes and a lognormal distribution of the droplet diameter were applied and the results are discussed and compared with the measurements.

  7. Lime Kiln Modeling. CFD and One-dimensional simulations

    Energy Technology Data Exchange (ETDEWEB)

    Svedin, Kristoffer; Ivarsson, Christofer; Lundborg, Rickard

    2009-03-15

    The incentives for burning alternative fuels in lime kilns are growing. An increasing demand on thorough investigations of alternative fuel impact on lime kiln performance have been recognized, and the purpose of this project has been to develop a lime kiln CFD model with the possibility to fire fuel oil and lignin. The second part of the project consists of three technical studies. Simulated data from a one-dimensional steady state program has been used to support theories on the impact of biofuels and lime mud dryness. The CFD simulations was carried out in the commercial code FLUENT. Due to difficulties with the convergence of the model the calcination reaction is not included. The model shows essential differences between the two fuels. Lignin gives a different flame shape and a longer flame length compared to fuel oil. Mainly this depends on how the fuel is fed into the combustion chamber and how much combustion air that is added as primary and secondary air. In the case of lignin combustion the required amount of air is more than in the fuel oil case. This generates more combustion gas and a different flow pattern is created. Based on the values from turbulent reaction rate for the different fuels an estimated flame length can be obtained. For fuel oil the combustion is very intense with a sharp peak in the beginning and a rapid decrease. For lignin the combustion starts not as intense as for the fuel oil case and has a smoother shape. The flame length appears to be approximately 2-3 meter longer for lignin than for fuel oil based on turbulent reaction rate in the computational simulations. The first technical study showed that there are many benefits of increasing dry solids content in the lime mud going into a kiln such as increased energy efficiency, reduced TRS, and reduced sodium in the kiln. However, data from operating kilns indicates that these benefits can be offset by increasing exit gas temperature that can limit kiln production capacity. Simulated

  8. Lime Kiln Modeling. CFD and One-dimensional simulations

    Energy Technology Data Exchange (ETDEWEB)

    Svedin, Kristoffer; Ivarsson, Christofer; Lundborg, Rickard

    2009-03-15

    The incentives for burning alternative fuels in lime kilns are growing. An increasing demand on thorough investigations of alternative fuel impact on lime kiln performance have been recognized, and the purpose of this project has been to develop a lime kiln CFD model with the possibility to fire fuel oil and lignin. The second part of the project consists of three technical studies. Simulated data from a one-dimensional steady state program has been used to support theories on the impact of biofuels and lime mud dryness. The CFD simulations was carried out in the commercial code FLUENT. Due to difficulties with the convergence of the model the calcination reaction is not included. The model shows essential differences between the two fuels. Lignin gives a different flame shape and a longer flame length compared to fuel oil. Mainly this depends on how the fuel is fed into the combustion chamber and how much combustion air that is added as primary and secondary air. In the case of lignin combustion the required amount of air is more than in the fuel oil case. This generates more combustion gas and a different flow pattern is created. Based on the values from turbulent reaction rate for the different fuels an estimated flame length can be obtained. For fuel oil the combustion is very intense with a sharp peak in the beginning and a rapid decrease. For lignin the combustion starts not as intense as for the fuel oil case and has a smoother shape. The flame length appears to be approximately 2-3 meter longer for lignin than for fuel oil based on turbulent reaction rate in the computational simulations. The first technical study showed that there are many benefits of increasing dry solids content in the lime mud going into a kiln such as increased energy efficiency, reduced TRS, and reduced sodium in the kiln. However, data from operating kilns indicates that these benefits can be offset by increasing exit gas temperature that can limit kiln production capacity. Simulated

  9. Efecto de aportes superficiales de biomasa vegetal en la temperatura, humedad y dinámica de nemátodos en el suelo en época seca en Santander de Quilichao (Departamento del Cauca. Efecto de aportes superficiales de biomasa vegetal en la temperatura, humedad y dinámica de nemátodos en el suelo en época seca en Santander de Quilichao (Departamento del Cauca

    Directory of Open Access Journals (Sweden)

    Sánchez Marina

    2006-06-01

    Full Text Available

    Effect of superficial contributions of vegetal biomass in the temperature, humidity and dynamics of nematodes in the soil at a season dry time in Santander Quilichao (Department of the Cauca. In the experimental station at CIAT (Santander de Quilichao- Cauca, to 3°06'N and 76°31'W, the effect of surface application of vegetal biomass was explored (6 t dm ha-1 semester-1, after planting of bean. The experiment consisted of four treatments, three cover of the trees that had contrasting characteristics (Calliandra-CAL; Cratylia-CRA and Tithonia - TTH and the control- CON; arranged in a CBRD with 5 repetitions. The evaluated variables were: environmental (humidity and temperature of the soil and biological (abundance and dynamics of the nematodes. Under cover the humidity in a 3% was increased and the soil temperature was regulated from the 0.4 to 0.6°C smaller than the CON treatment. The behavior of the nematodes was very dynamic and was related to the environmental conditions, being favored at wet seasons and by the dynamics of decomposition related to the type of material. In general, the cover modified the microenvironment affecting the population of organisms, generating changes in the aireation, structures and nutrients cycling in the soil by contribution of organic matter through mulch which regule its availability in the productive systems.

    Palabras claves: Suelo, cobertura arbórea, nemátodos, biomasa, factores ambientales.

    En la estación experimental del CIAT (Santander de Quilichao- Cauca, 3°06'N y 76°31'W se exploró el efecto de aplicaciones superficiales de biomasa vegetal (6 t ms ha-1 semestre-1, después de la siembra de fríjol. El

  10. CFD study on inlet flow blockage accidents in rectangular fuel assembly

    Energy Technology Data Exchange (ETDEWEB)

    Fan, Wenyuan, E-mail: fanwy@mail.ustc.edu.cn; Peng, Changhong, E-mail: pengch@ustc.edu.cn; Guo, Yun, E-mail: guoyun79@ustc.edu.cn

    2015-10-15

    Highlights: • 3D CFD and Relap5 simulations on inlet flow blockage are performed. • Transient effects are investigated by dynamic mesh technique. • Similar flow and power redistributions are predicted in both methods. • Local effects of the blockage are captured by CFD method and analyzed. - Abstract: Three-dimensional transient CFD simulation of 90% inlet flow blockage accidents in rectangular fuel assembly is performed, using the dynamic mesh technique. One-dimensional steady calculation is done for comparison, using Relap5 code. Similar mass flow rate redistributions and asymmetric power redistributions of the plate in the blocked scenario are obtained. No boiling is predicted in both simulations, however, CFD approach provides more in-depth investigations of flow transients and the thermal-hydraulic interaction. The development of flow blockage transients is so fast that the rapid redistribution of mass flow rates occurs in only 0.015 s after the formation of the blockage. As a sequence of the inlet flow blockage, jet-flows and reversed flows occur in the blocked channel. This leads to complex temperature distributions of coolants and fuel plates, in which, the highest coolant temperature no longer occurs around the channel outlet. The present study shows the advantage and significance of the application of three-dimensional transient CFD technique in investigating flow blockage accidents.

  11. An Improved CFD-synthesis Method for Predicting Inlet Dynamic Distortion

    Institute of Scientific and Technical Information of China (English)

    Zhang Lifen; Liu Zhenxia; Qu Jiyun; Wang Xiaofeng

    2009-01-01

    This article presents an improved computational fluid dynamics (CFD)-synthesis method to predict dynamic distortion. A steady-state flow field is derived from a CFD solution, through which are acquired total pressure, density, turbulence kinetic energy and others in steady-state at an aerodynamic interface plane (AIP). Back-propagation artificial neural network (BP ANN) is used to find out the relationship between the measured flight turbulence and the CFD-computed turbulence parameters. The dynamic pressure is obtained by incorporating CFD-found total steady-state pressure with fluctuating pressure. Finally, the dynamic distortion is predicted by means of the synthesized dynamic pressure. The fairly good agreement between the computed inlet surface pressure and the flight test data bears out the reliability of CFD solution used in this article. To validate the proposed method, six sets of flight test data are used and the results show that the predicted dynamic distortion is well in line with the distortion displayed in flight tests. An examination of the traditional method is also accomplished and the comparison also shows that the proposed method is superior to the traditional one in higher consistency with flight test data.

  12. Application of Scaling-Law and CFD Modeling to Hydrodynamics of Circulating Biomass Fluidized Bed Gasifier

    Directory of Open Access Journals (Sweden)

    Mazda Biglari

    2016-06-01

    Full Text Available Two modeling approaches, the scaling-law and CFD (Computational Fluid Dynamics approaches, are presented in this paper. To save on experimental cost of the pilot plant, the scaling-law approach as a low-computational-cost method was adopted and a small scale column operating under ambient temperature and pressure was built. A series of laboratory tests and computer simulations were carried out to evaluate the hydrodynamic characteristics of a pilot fluidized-bed biomass gasifier. In the small scale column solids were fluidized. The pressure and other hydrodynamic properties were monitored for the validation of the scaling-law application. In addition to the scaling-law modeling method, the CFD approach was presented to simulate the gas-particle system in the small column. 2D CFD models were developed to simulate the hydrodynamic regime. The simulation results were validated with the experimental data from the small column. It was proved that the CFD model was able to accurately predict the hydrodynamics of the small column. The outcomes of this research present both the scaling law with the lower computational cost and the CFD modeling as a more robust method to suit various needs for the design of fluidized-bed gasifiers.

  13. CFD study of isothermal water flow in rod bundle with split-type spacer grid

    Science.gov (United States)

    Batta, A.; Class, A. G.

    2014-06-01

    The design of rod bundles in nuclear application nowadays is assessed by CFD (computational fluid dynamics). The accuracy of CFD models need validation. Within the OECD/NEA benchmark MATiS-H (Measurement and Analysis of Turbulent Mixing in Sub-channels - Horizontal) a single-phase water flow in a 5x5 rod bundle is studied. In the benchmark, two types of spacer grids are tested, the swirl type and the split type, where the current study focuses on the split type spacer grid. Comparison of CFD results obtained at Karlsruhe Institut of Technology (KIT) with experimental results of KAERI (Korea Atomic Energy Research Institute) are presented. In the benchmark velocities components along selected lines downstream of the spacer grid are measured and compared to CFD results. The CFD code STAR CCM+ with the Realized k-ɛ model is used. Comparisons with experimental results show quantitative and qualitative agreement for the averaged values of velocity components. Comparisons of results to other benchmark partners using different modeling show that the selected mesh size and models for the analysis of the current case gives relatively accurate results. However, the used turbulent model (Realized k-ɛ does not capture the turbulent intensity correctly. Computation shows that the flow has very high mixing due to the spacer grid, which does not decay within the measurements domain (z/ DH =0-10 downstream of spacer grid). The same conclusion can be drawn from experimental data.

  14. Diffusion-Based Coarse Graining in Hybrid Continuum--Discrete Solvers: Applications in CFD--DEM

    CERN Document Server

    Sun, Rui

    2014-01-01

    In this work, a coarse graining method previously proposed by the authors based on solving diffusion equations is applied to CFD--DEM simulations, where coarse graining is used to obtain solid volume fraction, particle phase velocity, and fluid--particle interaction forces. By examining the conservation requirements, the variables to solve diffusion equations for in CFD--DEM simulations are identified. The algorithm is then implemented to a CFD--DEM solver based on OpenFOAM and LAMMPS, the former being a general-purpose, three-dimensional CFD solver based on unstructured meshes. Numerical simulations are performed for a fluidized bed by using the CFD--DEM solver with the diffusion-based coarse graining algorithm. Converged results are obtained on successively refined meshes, even for meshes with cell sizes comparable to or smaller than the particle diameter. This is a critical advantage of the proposed method over many existing coarse graining methods, and would be particularly valuable when small cells are r...

  15. Natural ventilation of a generic cask under a transport hood - CFD and analytical modelling

    Energy Technology Data Exchange (ETDEWEB)

    Powell, D.; Davies, G.; Tso, C.F. [Arup, London (United Kingdom)

    2004-07-01

    In comparison with finite element simulation for structural and thermal behaviour, the use of computational fluid dynamics technique (hereafter CFD) to analyse, predict and design air and heat flow in package design is relatively novel. Arup has been using CFD techniques to investigate fluid and heat flow, and to use it as a tool to design fluid and heat flow across a broad spectrum of industries for over fifteen years. In order demonstrate the power of the technique and its benefits, the airflow and heat flow characteristics around a transport package during transit under a transport hood has been evaluated using the CFD technique. This paper presents the scenario, the model, the analysis technique and the results of this analysis. Comparison with test results is probably the best way to validate a CFD analysis. In the absence of test results, the analysis was verified by comparison with hand calculation solutions. The scenario as it stands is too complex and hand calculation solution cannot describe the scenario sufficiently. However, hand calculation solutions could be derived for simplified version of the scenario against which CFD analysis of the simplified scenario can be compared. The second half of this paper describes the verification out.

  16. The Analysis and Design of Low Boom Configurations Using CFD and Numerical Optimization Techniques

    Science.gov (United States)

    Siclari, Michael J.

    1999-01-01

    The use of computational fluid dynamics (CFD) for the analysis of sonic booms generated by aircraft has been shown to increase the accuracy and reliability of predictions. CFD takes into account important three-dimensional and nonlinear effects that are generally neglected by modified linear theory (MLT) methods. Up to the present time, CFD methods have been primarily used for analysis or prediction. Some investigators have used CFD to impact the design of low boom configurations using trial and error methods. One investigator developed a hybrid design method using a combination of Modified Linear Theory (e.g. F-functions) and CFD to provide equivalent area due to lift driven by a numerical optimizer to redesign or modify an existing configuration to achieve a shaped sonic boom signature. A three-dimensional design methodology has not yet been developed that completely uses nonlinear methods or CFD. Constrained numerical optimization techniques have existed for some time. Many of these methods use gradients to search for the minimum of a specified objective function subject to a variety of design variable bounds, linear and nonlinear constraints. Gradient based design optimization methods require the determination of the objective function gradients with respect to each of the design variables. These optimization methods are efficient and work well if the gradients can be obtained analytically. If analytical gradients are not available, the objective gradients or derivatives with respect to the design variables must be obtained numerically. To obtain numerical gradients, say, for 10 design variables, might require anywhere from 10 to 20 objective function evaluations. Typically, 5-10 global iterations of the optimizer are required to minimize the objective function. In terms of using CFD as a design optimization tool, the numerical evaluation of gradients can require anywhere from 100 to 200 CFD computations per design for only 10 design variables. If one CFD

  17. CFD-DEM Simulations of Current-Induced Dune Formation and Morphological Evolution

    CERN Document Server

    Sun, Rui

    2015-01-01

    Understanding the fundamental mechanisms of sediment transport, particularly those during the formation and evolution of bedforms, is of critical scientific importance and has engineering relevance. Traditional approaches of sediment transport simulations heavily rely on empirical models, which are not able to capture the physics-rich, regime-dependent behaviors of the process. With the increase of available computational resources in the past decade, CFD-DEM (computational fluid dynamics-discrete element method) has emerged as a viable high-fidelity method for the study of sediment transport. However, a comprehensive, quantitative study of the generation and migration of different sediment bed patterns using CFD-DEM is still lacking. In this work, current-induced sediment transport problems in a wide range of regimes are simulated, including 'flat bed in motion', `small dune', `vortex dune' and suspended transport. Simulations are performed by using SediFoam, an open-source, massively parallel CFD-DEM solver...

  18. Numerical Simulation of Bird Flight Using Both CFD and Computational Flight Dynamics

    Science.gov (United States)

    Ueno, Yosuke; Nakamura, Yoshiaki

    A numerical simulation method taking into account both aerodynamics and flight dynamics has been developed to simulate the flight of a low speed flying object, where it undergoes unsteady deformation. This method can also be applied to simulate the unsteady motion of small vehicles such as micro air vehicles (MAV). In the present study, we take up a bird and demonstrate its flight in the air. In particular the effect of fluid forces on the bird's flying motion is examined in detail, based on CFD×CFD: Computational Fluid Dynamics (CFD) and Computational Flight Dynamics. It is found from simulated results that this bird can generate lift and thrust enough to fly by flapping its wing. In addition, it can make a level flight by adjusting its oscillation frequency. Thus, the present method is promising to study the aerodynamics and flight dynamics of a moving object with its shape morphing.

  19. Validation of a CFD methodology for positive displacement LVAD analysis using PIV data.

    Science.gov (United States)

    Medvitz, Richard B; Reddy, Varun; Deutsch, Steve; Manning, Keefe B; Paterson, Eric G

    2009-11-01

    Computational fluid dynamics (CFD) is used to asses the hydrodynamic performance of a positive displacement left ventricular assist device. The computational model uses implicit large eddy simulation direct resolution of the chamber compression and modeled valve closure to reproduce the in vitro results. The computations are validated through comparisons with experimental particle image velocimetry (PIV) data. Qualitative comparisons of flow patterns, velocity fields, and wall-shear rates demonstrate a high level of agreement between the computations and experiments. Quantitatively, the PIV and CFD show similar probed velocity histories, closely matching jet velocities and comparable wall-strain rates. Overall, it has been shown that CFD can provide detailed flow field and wall-strain rate data, which is important in evaluating blood pump performance.

  20. Time Accurate CFD Simulations of the Orion Launch Abort Vehicle in the Transonic Regime

    Science.gov (United States)

    Ruf, Joseph; Rojahn, Josh

    2011-01-01

    Significant asymmetries in the fluid dynamics were calculated for some cases in the CFD simulations of the Orion Launch Abort Vehicle through its abort trajectories. The CFD simulations were performed steady state with symmetric boundary conditions and geometries. The trajectory points at issue were in the transonic regime, at 0 and 5 angles of attack with the Abort Motors with and without the Attitude Control Motors (ACM) firing. In some of the cases the asymmetric fluid dynamics resulted in aerodynamic side forces that were large enough that would overcome the control authority of the ACMs. MSFC s Fluid Dynamics Group supported the investigation into the cause of the flow asymmetries with time accurate CFD simulations, utilizing a hybrid RANS-LES turbulence model. The results show that the flow over the vehicle and the subsequent interaction with the AB and ACM motor plumes were unsteady. The resulting instantaneous aerodynamic forces were oscillatory with fairly large magnitudes. Time averaged aerodynamic forces were essentially symmetric.

  1. Direct CFD Predictions of Low Frequency Sounds Generated by a Helicopter Main Rotor

    Science.gov (United States)

    Sim, Ben W.; Potsdam, Mark A.; Conner, Dave A.; Conner, Dave A.; Watts, Michael E.

    2010-01-01

    The use of CFD to directly predict helicopter main rotor noise is shown to be quite promising as an alternative mean for low frequency source noise evaluation. Results using existing state-of-the-art grid structures and finite-difference schemes demonstrated that small perturbation pressures, associated with acoustics radiation, can be extracted with some degree of fidelity. Accuracy of the predictions are demonstrated via comparing to predictions from conventional acoustic analogy-based models, and with measurements obtained from wind tunnel and flight tests for the MD-902 helicopter at several operating conditions. Findings show that the direct CFD approach is quite successfully in yielding low frequency results due to thickness and steady loading noise mechanisms. Mid-to-high frequency contents, due to blade-vortex interactions, are not predicted due to CFD modeling and grid constraints.

  2. Time-domain CFD computation and analysis of acoustic attenuation performance of water-filled silencers

    Institute of Scientific and Technical Information of China (English)

    刘晨; 季振林; 程垠钟; 刘胜兰

    2016-01-01

    The multi-dimensional time-domain computational fluid dynamics (CFD) approach is extended to calculate the acoustic attenuation performance of water-filled piping silencers. Transmission loss predictions from the time-domain CFD approach and the frequency-domain finite element method (FEM) agree well with each other for the dual expansion chamber silencer, straight-through and cross-flow perforated tube silencers without flow. Then, the time-domain CFD approach is used to investigate the effect of flow on the acoustic attenuation characteristics of perforated tube silencers. The numerical predictions demonstrate that the mean flow increases the transmission loss, especially at higher frequencies, and shifts the transmission loss curve to lower frequencies.

  3. A coupling VWM/CFD/CSD method for rotor airload prediction

    Directory of Open Access Journals (Sweden)

    Yongjie Shi

    2017-02-01

    Full Text Available A coupling fluid-structure method with a combination of viscous wake model (VWM, computational fluid dynamics (CFD and comprehensive structural dynamics (CSD modules is developed in this paper for rotor unsteady airload prediction. The hybrid VWM/CFD solver is employed to model the nonlinear aerodynamic phenomena and complicated rotor wake dynamics; the moderate deflection beam theory is implemented to predict the blade structural deformation; the loose coupling strategy based on the ‘delt method’ is used to couple the fluid and structure solvers. Several cases of Helishape 7A rotor are performed first to investigate the effect of elastic deformation on airloads. Then, two challenging forward flight conditions of UH-60A helicopter rotor are investigated, and the simulated results of wake geometry, chordwise pressure distribution and sectional normal force show excellent agreement with available test data; a comparison with traditional CFD/CSD method is also presented to illustrate the efficiency of the developed method.

  4. Prediction of leakage and rotordynamic coefficients for the circumferential-groove pump seal using CFD analysis

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Sung Ho; Ha, Tae Woong [Gachon University, Seongnam (Korea, Republic of)

    2016-05-15

    The circumferential-groove seal is commonly used in various turbopumps to reduce leakage. The main goal of this paper is to develop the method of three-dimensional CFD analysis for determining leakage and rotordynamic coefficients of the circumferential-groovepump seal. A relative coordinate system was defined for steady-state simulation to calculate the velocity and pressure distributions of the seal clearance at each rotor whirl speed. Instead of setting the inlet and outlet pressures as the boundary conditions in the three dimensional CFD analysis, as it is more commonly done, we used the inlet velocity and outlet pressure obtained from a preliminary two dimensional CFD analysis. For prediction leakage, the presented analysis shows improvement from the bulk-flow model analysis. For the prediction of rotordynamic coefficients of K, k and C, the presented analysis provides results in closer agreement with the experimental values than those of the bulk-flow model analysis at several rotor speeds.

  5. FDNS CFD Code Benchmark for RBCC Ejector Mode Operation: Continuing Toward Dual Rocket Effects

    Science.gov (United States)

    West, Jeff; Ruf, Joseph H.; Turner, James E. (Technical Monitor)

    2000-01-01

    Computational Fluid Dynamics (CFD) analysis results are compared with benchmark quality test data from the Propulsion Engineering Research Center's (PERC) Rocket Based Combined Cycle (RBCC) experiments to verify fluid dynamic code and application procedures. RBCC engine flowpath development will rely on CFD applications to capture the multi -dimensional fluid dynamic interactions and to quantify their effect on the RBCC system performance. Therefore, the accuracy of these CFD codes must be determined through detailed comparisons with test data. The PERC experiments build upon the well-known 1968 rocket-ejector experiments of Odegaard and Stroup by employing advanced optical and laser based diagnostics to evaluate mixing and secondary combustion. The Finite Difference Navier Stokes (FDNS) code [2] was used to model the fluid dynamics of the PERC RBCC ejector mode configuration. Analyses were performed for the Diffusion and Afterburning (DAB) test conditions at the 200-psia thruster operation point, Results with and without downstream fuel injection are presented.

  6. Validation of vortex code viscous models using lidar wake measurements and CFD

    DEFF Research Database (Denmark)

    Branlard, Emmanuel; Machefaux, Ewan; Gaunaa, Mac;

    2014-01-01

    The newly implemented vortex code Omnivor coupled to the aero-servo-elastic tool hawc2 is described in this paper. Vortex wake improvements by the implementation of viscous effects are considered. Different viscous models are implemented and compared with each other. Turbulent flow fields...... with sheared inflow are used to compare the vortex code performance with CFD and lidar measurements. Laminar CFD computations are used to evaluate the performance of the viscous models. Consistent results between the vortex code and CFD tool are obtained up to three diameters downstream. The modelling...... of viscous boundaries appear more important than the modelling of viscosity in the wake. External turbulence and shear appear sufficient but their full potential flow modelling would be preferred....

  7. Towards a generic, reliable CFD modelling methodology for waste-fired grate boilers

    DEFF Research Database (Denmark)

    Rajh, Boštjan; Yin, Chungen; Samec, Niko;

    Computational Fluid Dynamics (CFD) is increasingly used in industry for detailed understanding of the combustion process and for appropriate design and optimization of Waste–to–Energy (WtE) plants. In this paper, CFD modelling of waste wood combustion in a 13 MW grate-fired boiler in a WtE plant...... is presented. To reduce the risk of slagging, optimize the temperature control and enhance turbulent mixing, part of the flue gas is recycled into the grate boiler. In the simulation, a 1D in–house bed model is developed to simulate the conversion of the waste wood in the fuel bed on the grate, which provides...... of the increased CO2 and H2O vapour concentrations on radiative heat transfer in the boiler. The impacts of full buoyancy on turbulence are also investigated. As a validation effort, the temperature profiles at different ports inside the furnace are measured and the experimental values are compared with the CFD...

  8. Computational Fluid Dynamics (CFD) Modeling for High Rate Pulverized Coal Injection (PCI) into the Blast Furnace

    Energy Technology Data Exchange (ETDEWEB)

    Dr. Chenn Zhou

    2008-10-15

    Pulverized coal injection (PCI) into the blast furnace (BF) has been recognized as an effective way to decrease the coke and total energy consumption along with minimization of environmental impacts. However, increasing the amount of coal injected into the BF is currently limited by the lack of knowledge of some issues related to the process. It is therefore important to understand the complex physical and chemical phenomena in the PCI process. Due to the difficulty in attaining trus BF measurements, Computational fluid dynamics (CFD) modeling has been identified as a useful technology to provide such knowledge. CFD simulation is powerful for providing detailed information on flow properties and performing parametric studies for process design and optimization. In this project, comprehensive 3-D CFD models have been developed to simulate the PCI process under actual furnace conditions. These models provide raceway size and flow property distributions. The results have provided guidance for optimizing the PCI process.

  9. CFD analysis and experimental investigations towards optimizing the parameters of Ranque-Hilsch vortex tube

    Energy Technology Data Exchange (ETDEWEB)

    Behera, U.; Paul, P.J. [Indian Institute of Science, Bangalore (India). Department of Aerospace Engineering; Kasthurirengan, S.; Karunanithi, R.; Ram, S.N.; Dinesh, K.; Jacob, S. [Indian Institute of Science, Bangalore (India). Centre for Cryogenic Technology

    2005-05-01

    Computational fluid dynamics (CFD) and experimental studies are conducted towards the optimization of the Ranque-Hilsch vortex tubes. Different types of nozzle profiles and number of nozzles are evaluated by CFD analysis. The swirl velocity, axial velocity and radial velocity components as well as the flow patterns including secondary circulation flow have been evaluated. The optimum cold end diameter (d{sub c}) and the length to diameter (L/D) ratios and optimum parameters for obtaining the maximum hot gas temperature and minimum cold gas temperature are obtained through CFD analysis and validated through experiments. The coefficient of performance (COP) of the vortex tube as a heat engine and as a refrigerator has been calculated. (author)

  10. CFD Analysis of Dry Storage System for CANDU Spent Fuel using Fluent 6.2

    Energy Technology Data Exchange (ETDEWEB)

    Shin, Byung Soo; Jeong, Yong Hoon; Chang, Soon Heung Chang [KAIST, Taejon (Korea, Republic of)

    2006-07-01

    To obtain the licensing for MACSTOR/KN-400 developed by KHNP, 3-D CFD analysis was demanded to prove that the maximum temperature was not over the limited temperature (93 .deg. C locally and 66 .deg. C averagely for concrete). Though the thermal-hydraulic prediction by CATHENA-code show the reliable results, that could not the temperature distribution. That is, that could not predict the location of maximum temperature well. In this study, the analysis of the temperature distribution on the natural convection flow with thermal radiation shows the concrete temperature distribution. It was different from the predicted results by CATHENA-code. Therefore, to obtain the licensing for AMCSTOR/KN- 400, CFD analysis should be performed by 3-D CFD code like FLUENT at the same time.

  11. CFD-based System Identification%基于CFD的系统辨识方法

    Institute of Scientific and Technical Information of China (English)

    孟庆龙; 官燕玲; 谢安生

    2011-01-01

    The principle of CFD (computational fluid dynamics) simulation and system identification were summarized, including the presentation of "grey-box" modeling method and steps of CFD-based system identification ; some applications in practice were analyzed to point out potential problems and its developing trends.%概述了计算流体力学(CFD)数值模拟和系统辨识的原理,详细阐述了基于CFD数值模拟的系统辨识“灰箱”建模方法的基本原理和实现步骤,对近几年该方法的应用案例进行分析,指出该建模方法存在的问题及发展方向.

  12. Using CFD Surface Solutions to Shape Sonic Boom Signatures Propagated from Off-Body Pressure

    Science.gov (United States)

    Ordaz, Irian; Li, Wu

    2013-01-01

    The conceptual design of a low-boom and low-drag supersonic aircraft remains a challenge despite significant progress in recent years. Inverse design using reversed equivalent area and adjoint methods have been demonstrated to be effective in shaping the ground signature propagated from computational fluid dynamics (CFD) off-body pressure distributions. However, there is still a need to reduce the computational cost in the early stages of design to obtain a baseline that is feasible for low-boom shaping, and in the search for a robust low-boom design over the entire sonic boom footprint. The proposed design method addresses the need to reduce the computational cost for robust low-boom design by using surface pressure distributions from CFD solutions to shape sonic boom ground signatures propagated from CFD off-body pressure.

  13. 2-Dimensional CFD Simulation and Correlation Development for Optimization of Fin Heatsinks in Electronic Cooling

    Institute of Scientific and Technical Information of China (English)

    Jing YANG; Li WANG; Huazhi LI

    2001-01-01

    CFD has penetrated into the field of electronic cooling for some time. Both parallel and staggered plate fin heatsinks are widely used in modern computers. This paper presents the ways to make most use of CFD in optimization design of those heatsinks: the flow and heat transfer of staggered and parallel plate fm heatsinks of various geometry were simulated by using Fluent 5.0 commercial CFD code. Based on 60 different simulation solutions, two correlations, concerning Nusselt number and friction factor as the functions of geometrical and operational parameters of the heatsinks were developed. The presentation parameter examination was also performed by comparing the numerical solutions with the analytical solutions of parallel plate arrays, showing that the correct parameters are used in the correlations.

  14. Wind flow conditions in offshore wind farms. Validation and application of a CFD wake model

    Energy Technology Data Exchange (ETDEWEB)

    Westerhellweg, Annette; Canadillas, Beatriz; Kinder, Friederike; Neumann, Thomas [Deutsches Windenergie-Institut GmbH (DEWI), Wilhelmshaven (Germany)

    2013-04-01

    Since August 2009, the first German offshore wind farm 'alpha ventus' is operating close to the wind measurement platform FINO1. Within the research project RAVE-OWEA the wind flow conditions in 'alpha ventus' were assessed in detail, simulated with a CFD wake model and compared with the measurements. Wind data measured at FINO1 have been evaluated for wind speed reduction and turbulence increase in the wake. Additionally operational data were evaluated for the farm efficiency. The atmospheric stability has been evaluated by temperature measurements of air and water and the impact of atmospheric stability on the wind conditions in the wake has been assessed. As an application of CFD models the generation of power matrices is introduced. Power matrices can be used for the continual monitoring of the single wind turbines in the wind farm. A power matrix based on CFD simulations has been created for 'alpha ventus' and tested against the measured data. (orig.)

  15. An overview of CFD and PIV application in investigation of solar thermal systems

    DEFF Research Database (Denmark)

    Ai, Ning; Fan, Jianhua; Ji, Jianbing

    2007-01-01

    Abstract:Solar thermal system is one of the most widely used technologies of renewable energy ipresently. In order to further improve the system design and to increase its performance,a deep understanding of the complicated fluid flow and heat transfer in the system components is necessary....... The most promising solution to this challenge is the use of computational fluid dynamics (CFD) in combination with particle image velocimetry (PIV),which will be the future trend in the investigation of solar thermal systems. The aim of this work is to give an overview of the status of the CFD......-PIV application in solar thermal systems. Key words: Solar thermal system,CFD,PIV...

  16. CFD optimization of continuous stirred-tank (CSTR) reactor for biohydrogen production.

    Science.gov (United States)

    Ding, Jie; Wang, Xu; Zhou, Xue-Fei; Ren, Nan-Qi; Guo, Wan-Qian

    2010-09-01

    There has been little work on the optimal configuration of biohydrogen production reactors. This paper describes three-dimensional computational fluid dynamics (CFD) simulations of gas-liquid flow in a laboratory-scale continuous stirred-tank reactor used for biohydrogen production. To evaluate the role of hydrodynamics in reactor design and optimize the reactor configuration, an optimized impeller design has been constructed and validated with CFD simulations of the normal and optimized impeller over a range of speeds and the numerical results were also validated by examination of residence time distribution. By integrating the CFD simulation with an ethanol-type fermentation process experiment, it was shown that impellers with different type and speed generated different flow patterns, and hence offered different efficiencies for biohydrogen production. The hydrodynamic behavior of the optimized impeller at speeds between 50 and 70 rev/min is most suited for economical biohydrogen production.

  17. DETERMINACIÓN DE LA DENSIDAD DE PARTÍCULA MEDIANTE POROSIMETRÍA DE MERCURIO PARA EL ESTUDIO FLUIDODINÁMICO DE BIOMASA EN LECHOS MÓVILES

    Directory of Open Access Journals (Sweden)

    Juan F. Saldarriaga

    2014-01-01

    Full Text Available La determinación de la densidad de partícula es un requisito necesario para abordar el estudio hidrodinámico de un material en contactores de lecho móvil. La medida de este parámetro se complica cuando las partículas son de forma irregular. En este trabajo se emplearon dos técnicas: compactación del material por compresión mecánica y una alternativa que contempla el potencial de la porosimetría de mercurio para la determinación de propiedades superficiales y estructurales. Se observó que los resultados mediante compactación por compresión mecánica son superiores a los esperados. Sin embargo, los valores obtenidos por porosimetría de mercurio son más acordes con los esperados. Por ejemplo en el aserrín se obtiene un valor de 500 kg/m3, muy similar al valor de la madera original (502 kg/m3. Los valores obtenidos por este procedimiento representan adecuadamente la relación entre masa y volumen de la partícula, y por tanto son válidos para la caracterización fluidodinámica de la biomasa.

  18. Aerodynamic study of different cyclist positions: CFD analysis and full-scale wind-tunnel tests.

    Science.gov (United States)

    Defraeye, Thijs; Blocken, Bert; Koninckx, Erwin; Hespel, Peter; Carmeliet, Jan

    2010-05-07

    Three different cyclist positions were evaluated with Computational Fluid Dynamics (CFD) and wind-tunnel experiments were used to provide reliable data to evaluate the accuracy of the CFD simulations. Specific features of this study are: (1) both steady Reynolds-averaged Navier-Stokes (RANS) and unsteady flow modelling, with more advanced turbulence modelling techniques (Large-Eddy Simulation - LES), were evaluated; (2) the boundary layer on the cyclist's surface was resolved entirely with low-Reynolds number modelling, instead of modelling it with wall functions; (3) apart from drag measurements, also surface pressure measurements on the cyclist's body were performed in the wind-tunnel experiment, which provided the basis for a more detailed evaluation of the predicted flow field by CFD. The results show that the simulated and measured drag areas differed about 11% (RANS) and 7% (LES), which is considered to be a close agreement in CFD studies. A fair agreement with wind-tunnel data was obtained for the predicted surface pressures, especially with LES. Despite the higher accuracy of LES, its much higher computational cost could make RANS more attractive for practical use in some situations. CFD is found to be a valuable tool to evaluate the drag of different cyclist positions and to investigate the influence of small adjustments in the cyclist's position. A strong advantage of CFD is that detailed flow field information is obtained, which cannot easily be obtained from wind-tunnel tests. This detailed information allows more insight in the causes of the drag force and provides better guidance for position improvements.

  19. Validation of CFD simulation for ammonia emissions from an aqueous solution Submitted to Computers and Electronics in Agriculture

    DEFF Research Database (Denmark)

    Rong, Li; Elhadidi, B; Khalifa, H E

    2011-01-01

    as boundary condition for CFD prediction of ammonia emission. The accuracy of CFD simulation depends on many factors. In this study, the effects of appropriate geometry model, inlet turbulent parameters and three turbulence models (low-Reynolds number k–ε model, renormalization group k–ε model and Shear...

  20. CFD simulation of gas and particles combustion in biomass furnaces

    Energy Technology Data Exchange (ETDEWEB)

    Griselin, Nicolas

    2000-11-01

    In this thesis, gas and particle combustion in biomass furnaces is investigated numerically. The aim of this thesis is to use Computational Fluid Dynamics (CFD) technology as an effective computer based simulation tool to study and develop the combustion processes in biomass furnaces. A detailed model for the numerical simulation of biomass combustion in a furnace, including fixed-bed modeling, gas-phase calculation (species distribution, temperature field, flow field) and gas-solid two-phase interaction for flying burning particles is presented. This model is used to understand the mechanisms of combustion and pollutant emissions under different conditions in small scale and large scale furnaces. The code used in the computations was developed at the Division of Fluid Mechanics, LTH. The flow field in the combustion enclosure is calculated by solving the Favre-averaged Navier-Stokes equations, with standard {kappa} - {epsilon} turbulence closure, together with the energy conservation equation and species transport equations. Discrete transfer method is used for calculating the radiation source term in the energy conservation equation. Finite difference is used to solve the general form of the equation yielding solutions for gas-phase temperatures, velocities, turbulence intensities and species concentrations. The code has been extended through this work in order to include two-phase flow simulation of particles and gas combustion. The Favre-averaged gas equations are solved in a Eulerian framework while the submodels for particle motion and combustion are used in the framework of a Lagrangian approach. Numerical simulations and measurement data of unburned hydrocarbons (UHC), CO, H{sub 2}, O{sub 2} and temperature on the top of the fixed bed are used to model the amount of tar and char formed during pyrolysis and combustion of biomass fuel in the bed. Different operating conditions are examined. Numerical calculations are compared with the measured data. It is

  1. User-Dependent CFD Predictions of a Backward-Facing Step Flow

    DEFF Research Database (Denmark)

    Peng, Lei; Nielsen, Peter Vilhelm; Wang, Xiaoxue;

    2015-01-01

    The backward-facing step flow with an expansion ratio of 5 has been modelled by 19 teams without benchmark solution or experimental data. Different CFD codes, turbulence models, boundary conditions, numerical schemes and convergent criteria are adopted based on the participants’ own experience...... in CFD simulation. The predicted non-dimensional penetration lengths as a function of Reynolds number are diverse among different teams. Even when the same turbulence model or even the laminar model is used, the difference is still notable among the results from different users. We believe...

  2. The Effect of Spray Initial Conditions on Heat Release and Emissions in LDI CFD Calculations (Preprint)

    Science.gov (United States)

    2008-06-01

    calculations. The hollow spray cone had a total angle of 90.0° and a cone thickness of 14.0°. A mass flow of 4.15E-04 kg/s and an initial velocity...possibly allowing better coupling with the CFD solver. D. Chemistry Model Ideally, we would prefer to use detailed chemical kinetic models ...obtained. The final stage of CFD calculations was performed by switching from the one-step chemistry model to the reduced chemistry model ; this was

  3. Determine of velocity field with PIV and CFD during the flow around of bridge piers

    Directory of Open Access Journals (Sweden)

    Picka D.

    2013-04-01

    Full Text Available The article describes the processing of specific junior research FAST-J-11-51/1456 which dealt with physical and CFD of the velocity field during the flow around of bridge piers. Physical modelling has been carried out in Laboratory of water management research in Institute of Water Structures in Brno University of Technology – Faculty of Civil Engineering. To measure of the velocity field in profile of bridge piers were used laser measuring method PIV (Particle Image Velocimetry. The results of PIV served as a basis for comparing experimental data with CFD results of this type of flow in the commercial software ANSYS CFX.

  4. Preliminary Computational Fluid Dynamics (CFD) Simulation of EIIB Push Barge in Shallow Water

    Science.gov (United States)

    Beneš, Petr; Kollárik, Róbert

    2011-12-01

    This study presents preliminary CFD simulation of EIIb push barge in inland conditions using CFD software Ansys Fluent. The RANSE (Reynolds Averaged Navier-Stokes Equation) methods are used for the viscosity solution of turbulent flow around the ship hull. Different RANSE methods are used for the comparison of their results in ship resistance calculations, for selecting the appropriate and removing inappropriate methods. This study further familiarizes on the creation of geometrical model which considers exact water depth to vessel draft ratio in shallow water conditions, grid generation, setting mathematical model in Fluent and evaluation of the simulations results.

  5. Relation between wall shear stress and carotid artery wall thickening MRI versus CFD

    DEFF Research Database (Denmark)

    Cibis, Merih; Potters, Wouter V.; Selwaness, Mariana

    2016-01-01

    Wall shear stress (WSS), a parameter associated with endothelial function, is calculated by computational fluid dynamics (CFD) or phase-contrast (PC) MRI measurements. Although CFD is common in WSS (WSSCFD) calculations, PC-MRI-based WSS (WSSMRI) is more favorable in population studies; since...... it is straightforward and less time consuming. However, it is not clear if WSSMRI and WSSCFD show similar associations with vascular pathology. Our aim was to test the associations between wall thickness (WT) of the carotid arteries and WSSMRI and WSSCFD. The subjects (n=14) with an asymptomatic carotid plaque who...

  6. Anwendung von CFD-Programmen für brandtechnische Berechnungen

    DEFF Research Database (Denmark)

    Carlsson, Jörgen; Husted, Bjarne; Göransson, Ulf;

    2006-01-01

    , in the worst case, may give erroneous results and that the calculation times are too long to be useful in practical fire safety engineering. This article takes a practical view on the use of CFD programmes for fire simulation by looking at two widely used models, SOFIE and FDS.......Computational Fluid Dynamics (CFD) programmes have found widespread use in the combustion and fire science community. These programmes make it possible to take into account phenomena that earlier models could not describe; a typical example being the movement of the smoke in a room. Furthermore...

  7. Towards a CFD-based mechanistic deposit formation model for straw-fired boilers

    DEFF Research Database (Denmark)

    Kær, Søren Knudsen; Rosendahl, Lasse Aistrup; Baxter, L.L.

    2006-01-01

    in the reminder of the paper. The growth of deposits on furnace walls and super heater tubes is treated including the impact on heat transfer rates determined by the CFD code. Based on the commercial CFD code FLUENTe, the overall model is fully implemented through the User Defined Functions. The model...... is configured entirely through a graphical user interface integrated in the standard FLUENTe interface. The model considers fine and coarse mode ash deposition and sticking mechanisms for the complete deposit growth, as well as an influence on the local boundary conditions for heat transfer due to thermal...

  8. Integrated Design Engineering Analysis (IDEA) Environment Automated Generation of Structured CFD Grids using Topology Methods

    Science.gov (United States)

    Kamhawi, Hilmi N.

    2012-01-01

    This report documents the work performed from March 2010 to March 2012. The Integrated Design and Engineering Analysis (IDEA) environment is a collaborative environment based on an object-oriented, multidisciplinary, distributed framework using the Adaptive Modeling Language (AML) as a framework and supporting the configuration design and parametric CFD grid generation. This report will focus on describing the work in the area of parametric CFD grid generation using novel concepts for defining the interaction between the mesh topology and the geometry in such a way as to separate the mesh topology from the geometric topology while maintaining the link between the mesh topology and the actual geometry.

  9. Evaluation of flow hydrodynamics in a pilot-scale dissolved air flotation tank: a comparison between CFD and experimental measurements.

    Science.gov (United States)

    Lakghomi, B; Lawryshyn, Y; Hofmann, R

    2015-01-01

    Computational fluid dynamics (CFD) models of dissolved air flotation (DAF) have shown formation of stratified flow (back and forth horizontal flow layers at the top of the separation zone) and its impact on improved DAF efficiency. However, there has been a lack of experimental validation of CFD predictions, especially in the presence of solid particles. In this work, for the first time, both two-phase (air-water) and three-phase (air-water-solid particles) CFD models were evaluated at pilot scale using measurements of residence time distribution, bubble layer position and bubble-particle contact efficiency. The pilot-scale results confirmed the accuracy of the CFD model for both two-phase and three-phase flows, but showed that the accuracy of the three-phase CFD model would partly depend on the estimation of bubble-particle attachment efficiency.

  10. Towards a CFD Model for Prediction of Wind Turbine Power Losses due to Icing in Cold Climate

    DEFF Research Database (Denmark)

    Pedersen, Marie Cecilie; Sørensen, Henrik

    an icing module into the CFD solution and finally by surface boundary displacement also included in the CFD solution. The model has been developed using ANSYS-FLUENT and user-defined functions. The naca profile, NACA64618, has been used to illustrate the functionality of the model. Running ice accretion......Icing induced power losses is an important issue when operating wind turbines in cold climate. This paper presents a concept of modelling ice accretion on wind turbines using Computational Fluid Dynamics (CFD). The modelling concept works towards unifying the processes of modelling ice accretion...... and the aerodynamic analysis of the iced object into one CFD-based icing model. Modelling of icing and obtaining ice shapes in combination with mesh update by surface boundary displacement was demonstrated in the paper. It has been done by expressing in-cloud icing in CFD by an Eulerian multiphase model, implementing...

  11. Higher power - BMW uses PowerVIZ for interactive visualization of CFD data; Sichtlich mehr Leistung - BMW visualisiert CFD-Daten interaktiv mit PowerVIZ

    Energy Technology Data Exchange (ETDEWEB)

    Kobras, D.

    2002-11-01

    The Aerodynamics and Thermal Engineering Department of BMW AG uses the Power VIZ post processor as a standard tool for visualization of flow calculations. The program was developed by science + computing ag (s+C) for the CFD software PowerFLOW of the EXA company. Apart from perfect co-ordination with the solver, the software has the advantage of real time operation. [German] Die Hauptabteilung 'Aerodynamik und Waermetechnik' der BMW AG setzt den Postprozessor PowerVIZ als Standardtool zur Visualisierung von Stroemungsberechnungen ein. Das Programm kommt vom IT-Dienstleistungs- und Softwarehaus science + computing ag (s+c) und ist massgeschneidert fuer die CFD-Software PowerFLOW der Firma EXA. Perfektes Zusammenspiel mit dem Solver ist nur ein Vorteil, den die BMW-Ingenieure schaetzen. Denn vor allem erlaubt PowerVIZ das Arbeiten in Echtzeit. (orig.)

  12. Sistemas microfluídicos amperométricos utilizando enzimas imobilizadas

    OpenAIRE

    Luís Marcos Cerdeira Ferreira

    2011-01-01

    Este trabalho descreve o desenvolvimento de um sistema microfluídico, contendo, como componente principal, um reator enzimático constituído de um microcanal fabricado em substrato de poli(metacrilato de metila) e um sistema amperométrico como detector. Para a construção de microcanais foi utilizando equipamento de usinagem a laser de CO2 para escavar os microcanais, que a seguir foram selados termicamente. A superfície interna desse microcanal foi submetida à modificação química com poli(etil...

  13. Monitoramento dos extratos brutos de espécies de Polygala (Polygalaceae utilizando Artemia salina

    Directory of Open Access Journals (Sweden)

    A.B.P. Montanher

    2003-01-01

    Full Text Available Extratos de duas espécies de Polygala foram submetidos a um biomonitoramento utilizando o teste de toxicidade frente a Artemia salina, com a finalidade de detectar atividade citotóxica. Os resultados obtidos para o extrato bruto, frações hexânica e diclorometano de Polygala sabulosa Aw. Benn. mostraram-se promissores. No entanto, bioensaios mais específicos devem ser encorajados nos extratos vegetais que apresentam atividade diante deste bioensaio, a fim de confirmar estas conclusões.

  14. Clasificación de los elementos de una muestra de sangre utilizando Redes Neuronales

    OpenAIRE

    Lanzarini, Laura Cristina; Vargas Camacho, María Teresa; Badrán, Amado F.; De Giusti, Armando Eduardo

    1996-01-01

    El análisis de una muestra de sangre es una de las prácticas más comunes solicitadas por los médicos para un diagnóstico y pronóstico adecuados. Mediante su estudio es posible detectar distintas. patologías que van desde los más simples procesos fisiológicos o inflamatorios a los más complejos procesos neoplásicos (leucemias) y de allí su importancia. El presente trabajo es una aplicación de reconocimiento de patrones utilizando redes neuronales actualmente en desarrollo, que permite clasi...

  15. Desarrollo de apio minimamente procesado fortificado con vitamina e, utilizando la ingenieria de matrices

    OpenAIRE

    YISELL JOHAN MARTELO CASTAÑO; MISAEL CORTES RODRIGUEZ; HÉCTOR SUAREZ MAHECHA

    2011-01-01

    El objetivo de este trabajo fue desarrollar un producto minimamente procesado fortificado con vitamina E, a partir de apio (Apium graveolens L. var.dulce), utilizando la ingenieria de matrices como metodologia de obtencion de alimentos funcionales. Trozos de apio impregnados al vacio con dl¿¿tocoferol acetato emulsificado en una solucion isotonica al vegetal de NaCl, 1,2%, fueron evaluados en funcion del tiempo de almacenamiento y el envasado (con y sin vacio), en terminos de la cuantificacio...

  16. Productividad en una celda de manufactura flexible simulada en promodel utilizando path networks type crane

    OpenAIRE

    María Elena Bernal Loaiza; German Cock Sarmiento; Jorge Hernán Restrepo Correa

    2015-01-01

    Esta investigación se centra en el diseño de una simulación del proceso de una celda de manufactura flexible (FMC) de la Facultad de Ingeniería Industrial de la Universidad Tecnológica de Pereira, con el propósito de medir y elegir aquella alternativa de solución que mejore en mayor grado la productividad del sistema actual utilizando los resultados que proporciona el software Promodel. Para realizar lo anterior se utilizaron etapas de la simulación como definición del sistema, formulación de...

  17. Seguimiento de la reactogenicidad de la vacuna DTP cubana, utilizando dos métodos paralelos

    OpenAIRE

    María de los Ángeles Peña Machado; Telma María Triana Rodríguez; Jorge Menéndez Hernández; Mayelin Mirabal Sosa; Marlen Armesto del Río; Morelia Baró Suárez; Lorenzo la Rosa Ocampo; Marlen Raymundo Valdés; Liudmila Ibelin Egües Torres; Giset Jiménez López

    2005-01-01

    Con el objetivo de caracterizar la reactogenicidad de la vacuna Antidiftérica-Antitetánica- Antipertusis (DTP) cubana, desarrollada por el Instituto Finlay, se realizó un estudio utilizando dos métodos o fuentes de información diferentes y paralelos. La primera se obtuvo de un ensayo clínico (EC) Fase IV, abierto, no controlado, en el que se incluyeron 57 lactantes. La segunda fuente de información se obtuvo de los reportes de los eventos temporalmente asociados a la vacunación (ETAV), recepc...

  18. Developing a methodology for the evaluation of results uncertainties in CFD codes; Desarrollo de una Metodologia para la Evaluacion de Incertidumbres en los Resultados de Codigos de CFD

    Energy Technology Data Exchange (ETDEWEB)

    Munoz-cobo, J. L.; Chiva, S.; Pena, C.; Vela, E.

    2014-07-01

    In this work the development of a methodology is studied to evaluate the uncertainty in the results of CFD codes and is compatible with the VV-20 standard Standard for Verification and Validation in CFD and Heat Transfer {sup ,} developed by the Association of Mechanical Engineers ASME . Similarly, the alternatives are studied for obtaining existing uncertainty in the results to see which is the best choice from the point of view of implementation and time. We have developed two methods for calculating uncertainty of the results of a CFD code, the first method based on the use of techniques of Monte-Carlo for the propagation of uncertainty in this first method we think it is preferable to use the statistics of the order to determine the number of cases to execute the code, because this way we can always determine the confidence interval desired level of output quantities. The second type of method we have developed is based on non-intrusive polynomial chaos. (Author)

  19. CFD and reaction computational analysis of the growth of GaN by HVPE method

    Science.gov (United States)

    Kempisty, P.; Łucznik, B.; Pastuszka, B.; Grzegory, I.; Boćkowski, M.; Krukowski, S.; Porowski, S.

    2006-10-01

    GaCl synthesis reaction during hydride vapor phase epitaxy (HVPE) growth of GaN in horizontal flow reactor has been analyzed using computerized fluid dynamics (CFD) and molecular estimates of the reaction rates. Finite element code FIDAP (commercially available from Fluent Inc.) [Fidap User Manual, Fluent Inc. [1

  20. Physical characterization of biomass fuels prepared for suspension firing in utility boilers for CFD modelling

    DEFF Research Database (Denmark)

    Rosendahl, Lasse; Yin, Chungen; Kær, Søren Knudsen

    2007-01-01

    shapes. The sample is subdivided by straw type, and coherent size, type and mass distribution parameters are reported for the entire sample. This type of data is necessary in order to use CFD reliably as a design and retrofit tool for co-firing biomass with fossil fuels, as the combustion processes...

  1. A Transient 3D-CFD Model Incorporating Biological Processes for Use in Tissue Engineering

    DEFF Research Database (Denmark)

    Krühne, Ulrich; Wendt, D.; Martin, I.

    2010-01-01

    after 2, 8 and 13 days. The development of the cells is compared to the simulated growth of cells and it is attempted to draw a conclusion about the impact of the shear stress on the cell growth. Keyword: Computational fluid dynamics (CFD),Micro pores,Scaffold,Bioreactor,Fluid structure interaction,Tissue...... engineering...

  2. Estimating steady state and transient characteristics of molten salt natural circulation loop using CFD

    Energy Technology Data Exchange (ETDEWEB)

    Kudariyawar, J.Y. [Homi Bhabha National Institue, Mumbai (India); Vaidya, A.M.; Maheshwari, K.K.; Srivastava, A.K. [Reactor Engineering Division, Bhabha Atomic Research Center, Mumbai (India); Satyamurthy, P. [ATDS, Bhabha Atomic Research Center, Mumbai (India)

    2015-03-15

    The steady state and transient characteristics of a molten salt natural circulation loop (NCL) are obtained by 3D CFD simulations. The working fluid is a mixture of NaNO{sub 3} and KNO{sub 3} in 60:40 ratio. Simulation is performed using PHOENICS CFD software. The computational domain is discretized by a body fitted grid generated using in-built mesh generator. The CFD model includes primary side. Primary side fluid is subjected to heat addition in heater section, heat loss to ambient (in piping connecting heater and cooler) and to secondary side (in cooler section). Reynolds Averaged Navier Stokes equations are solved along with the standard k-ε turbulence model. Validation of the model is done by comparing the computed steady state Reynolds number with that predicted by various correlations proposed previously. Transient simulations were carried out to study the flow initiations transients for different heater powers and different configurations. Similarly the ''power raising'' transient is computed and compared with in-house experimental data. It is found that, using detailed information obtained from 3D transient CFD simulations, it is possible to understand the physics of oscillatory flow patterns obtained in the loop under certain conditions.

  3. Prediction of the aerodynamic performance of the Mexico rotor by using airfoil data extracted from CFD

    DEFF Research Database (Denmark)

    Yang, Hua; Shen, Wen Zhong; Xu, Haoran

    2013-01-01

    some models before they can be used in a BEM code. In this article, the airfoil data for the MEXICO (Model EXperiments in Controlled cOnditions) rotor are extracted from CFD (Computational Fluid Dynamics) results. The azimuthally averaged velocity is used as the sectional velocity to define the angle...

  4. CFD-based multi-objective optimization method for ship design

    Science.gov (United States)

    Tahara, Yusuke; Tohyama, Satoshi; Katsui, Tokihiro

    2006-10-01

    This paper concerns development and demonstration of a computational fluid dynamics (CFD)-based multi-objective optimization method for ship design. Three main components of the method, i.e. computer-aided design (CAD), CFD, and optimizer modules are functionally independent and replaceable. The CAD used in the present study is NAPA system, which is one of the leading CAD systems in ship design. The CFD method is FLOWPACK version 2004d, a Reynolds-averaged Navier-Stokes (RaNS) solver developed by the present authors. The CFD method is implemented into a self-propulsion simulator, where the RaNS solver is coupled with a propeller-performance program. In addition, a maneuvering simulation model is developed and applied to predict ship maneuverability performance. Two nonlinear optimization algorithms are used in the present study, i.e. the successive quadratic programming and the multi-objective genetic algorithm, while the former is mainly used to verify the results from the latter. For demonstration of the present method, a multi-objective optimization problem is formulated where ship propulsion and maneuverability performances are considered. That is, the aim is to simultaneously minimize opposite hydrodynamic performances in design tradeoff. In the following, an overview of the present method is given, and results are presented and discussed for tanker stern optimization problem including detailed verification work on the present numerical schemes.

  5. Validation of CFD-models for non-stoichiometric oxycoal combustion

    Energy Technology Data Exchange (ETDEWEB)

    Bohn, Jan-Peter; Goanta, Adrian; Baumgartner, Andreas; Blume, Maximilian; Spliethoff, Hartmut [Technische Univ. Muenchen, Garching (Germany). Inst. of Energy Systems

    2013-07-01

    To compensate the drawback of high flue gas recirculation rates specific for oxyfuel processes, a new concept based on staged combustion, called controlled staging with non-stoichiometric burners (CSNB) was investigated. A combination of over- and sub-stoichiometric burners avoids inadmissible high flame temperatures even with oxygen concentrations up to 40 vol.-% in the oxidant. The non-stoichiometric burners are arranged in such a way that the overall stoichiometry at the combustion chamber outlet is slightly over-stoichiometric similar to conventional combustion processes, so that full burn out is secured. This concept aims at a more efficient oxyfuel process due to the decreasing effort in the recirculation loop and a new designed, more cost effective, steam generator. For further process optimization of the CSNB concept and the adjacent steam generator layout are validated CFD simulations urgently required. This paper shows first steps in validation of the CSNB combustion concept against state of the art CFD codes. The CFD code was optimized for oxyfuel combustion including a new char combustion and gas radiation model. Experimental investigations and CFD modelling are showing good agreement in concerns of temperature, CO and CO{sub 2} profiles. However the prediction of the oxygen concentration differs significantly between experiment and simulation.

  6. CFD Analysis of Flow Characteristics of Corrugated Louvered Fins at Low Reynolds

    Institute of Scientific and Technical Information of China (English)

    QI Zhao-gang; CHEN Jiang-ping

    2005-01-01

    A 2-D laminar flow model was established for CFD analysis of air-flow between louvered fins. Two louvered fins are studied based on commercial software FLUENT. Air-flow pressure drop characteristics are derived on the calculation of Reynolds number from 75.3 to 600. The numerical results are in good agreement with the experimental data when Reynolds is lower.

  7. Atmospheric stability in CFD &NDASH; Representation of the diurnal cycle in the atmospheric boundary layer

    DEFF Research Database (Denmark)

    Koblitz, Tilman; Bechmann, Andreas; Sogachev, Andrey;

    ), for example the Coriolis force, buoyancy forces and heat transport, are mostly ignored in state-of-the-art CFD models. In order to decrease the uncertainty of wind resource assessment, especially in complex terrain, the effect of thermal stratification on the ABL should be included in such models. The present...

  8. CFD Modeling of Thermal Manikin Heat Loss in a Comfort Evaluation Benchmark Test

    DEFF Research Database (Denmark)

    Nilsson, Håkan O.; Brohus, Henrik; Nielsen, Peter V.

    2007-01-01

    and companies still use several in-house codes for their calculations. The validation and association with human perception and heat losses in reality is consequently very difficult to make. This paper is providing requirements for the design and development of computer manikins and CFD benchmark tests...

  9. Methodology for CFD Design Analysis of National Launch System Nozzle Manifold

    Science.gov (United States)

    Haire, Scot L.

    1993-01-01

    The current design environment dictates that high technology CFD (Computational Fluid Dynamics) analysis produce quality results in a timely manner if it is to be integrated into the design process. The design methodology outlined describes the CFD analysis of an NLS (National Launch System) nozzle film cooling manifold. The objective of the analysis was to obtain a qualitative estimate for the flow distribution within the manifold. A complex, 3D, multiple zone, structured grid was generated from a 3D CAD file of the geometry. A Euler solution was computed with a fully implicit compressible flow solver. Post processing consisted of full 3D color graphics and mass averaged performance. The result was a qualitative CFD solution that provided the design team with relevant information concerning the flow distribution in and performance characteristics of the film cooling manifold within an effective time frame. Also, this design methodology was the foundation for a quick turnaround CFD analysis of the next iteration in the manifold design.

  10. Turbulence modeling needs of commercial CFD codes: Complex flows in the aerospace and automotive industries

    Science.gov (United States)

    Befrui, Bizhan A.

    1995-01-01

    This viewgraph presentation discusses the following: STAR-CD computational features; STAR-CD turbulence models; common features of industrial complex flows; industry-specific CFD development requirements; applications and experiences of industrial complex flows, including flow in rotating disc cavities, diffusion hole film cooling, internal blade cooling, and external car aerodynamics; and conclusions on turbulence modeling needs.

  11. CFD Simulation of Polydispersed Bubbly Two-Phase Flow around an Obstacle

    Directory of Open Access Journals (Sweden)

    E. Krepper

    2009-01-01

    Full Text Available This paper concerns the model of a polydispersed bubble population in the frame of an ensemble averaged two-phase flow formulation. The ability of the moment density approach to represent bubble population size distribution within a multi-dimensional CFD code based on the two-fluid model is studied. Two different methods describing the polydispersion are presented: (i a moment density method, developed at IRSN, to model the bubble size distribution function and (ii a population balance method considering several different velocity fields of the gaseous phase. The first method is implemented in the Neptune_CFD code, whereas the second method is implemented in the CFD code ANSYS/CFX. Both methods consider coalescence and breakup phenomena and momentum interphase transfers related to drag and lift forces. Air-water bubbly flows in a vertical pipe with obstacle of the TOPFLOW experiments series performed at FZD are then used as simulations test cases. The numerical results, obtained with Neptune_CFD and with ANSYS/CFX, allow attesting the validity of the approaches. Perspectives concerning the improvement of the models, their validation, as well as the extension of their applicability range are discussed.

  12. CFD analysis with fluid-structure interaction of opening high-pressure safety valves

    NARCIS (Netherlands)

    Beune, A.; Kuerten, J.G.M.; Heumen, van M.P.C.

    2012-01-01

    A multi-mesh numerical valve model has been developed to analyze the opening characteristic of highpressure safety valves. Newton’s law and the CFD result for the flow force are used to model the movement of the valve. In incompressible transient flow simulations a large force rise and collapse is c

  13. A texture-based frameowrk for improving CFD data visualization in a virtual environment

    Energy Technology Data Exchange (ETDEWEB)

    Bivins, Gerrick O' Ron [Iowa State Univ., Ames, IA (United States)

    2005-01-01

    In the field of computational fluid dynamics (CFD) accurate representations of fluid phenomena can be simulated but require large amounts of data to represent the flow domain. Most datasets generated from a CFD simulation can be coarse, ~ 10,000 nodes or cells, or very fine with node counts on the order of 1,000,000. A typical dataset solution can also contain multiple solutions for each node, pertaining to various properties of the flow at a particular node. Scalar properties such as density, temperature, pressure, and velocity magnitude are properties that are typically calculated and stored in a dataset solution. Solutions are not limited to just scalar properties. Vector quantities, such as velocity, are also often calculated and stored for a CFD simulation. Accessing all of this data efficiently during runtime is a key problem for visualization in an interactive application. Understanding simulation solutions requires a post-processing tool to convert the data into something more meaningful. Ideally, the application would present an interactive visual representation of the numerical data for any dataset that was simulated while maintaining the accuracy of the calculated solution. Most CFD applications currently sacrifice interactivity for accuracy, yielding highly detailed flow descriptions but limiting interaction for investigating the field.

  14. A texture-based framework for improving CFD data visualization in a virtual environment

    Energy Technology Data Exchange (ETDEWEB)

    Bivins, Gerrick O' Ron [Iowa State Univ., Ames, IA (United States)

    2005-01-01

    In the field of computational fluid dynamics (CFD) accurate representations of fluid phenomena can be simulated hut require large amounts of data to represent the flow domain. Most datasets generated from a CFD simulation can be coarse, ~10,000 nodes or cells, or very fine with node counts on the order of 1,000,000. A typical dataset solution can also contain multiple solutions for each node, pertaining to various properties of the flow at a particular node. Scalar properties such as density, temperature, pressure, and velocity magnitude are properties that are typically calculated and stored in a dataset solution. Solutions are not limited to just scalar properties. Vector quantities, such as velocity, are also often calculated and stored for a CFD simulation. Accessing all of this data efficiently during runtime is a key problem for visualization in an interactive application. Understanding simulation solutions requires a post-processing tool to convert the data into something more meaningful. Ideally, the application would present an interactive visual representation of the numerical data for any dataset that was simulated while maintaining the accuracy of the calculated solution. Most CFD applications currently sacrifice interactivity for accuracy, yielding highly detailed flow descriptions hut limiting interaction for investigating the field.

  15. Understanding the Flow Physics of Shock Boundary-Layer Interactions Using CFD and Numerical Analyses

    Science.gov (United States)

    Friedlander, David J.

    2013-01-01

    Computational fluid dynamic (CFD) analyses of the University of Michigan (UM) Shock/Boundary-Layer Interaction (SBLI) experiments were performed as an extension of the CFD SBLI Workshop held at the 48th AIAA Aerospace Sciences Meeting in 2010. In particular, the UM Mach 2.75 Glass Tunnel with a semi-spanning 7.75deg wedge was analyzed in attempts to explore key physics pertinent to SBLI's, including thermodynamic and viscous boundary conditions as well as turbulence modeling. Most of the analyses were 3D CFD simulations using the OVERFLOW flow solver, with additional quasi-1D simulations performed with an in house MATLAB code interfacing with the NIST REFPROP code to explore perfect verses non-ideal air. A fundamental exploration pertaining to the effects of particle image velocimetry (PIV) on post-processing data is also shown. Results from the CFD simulations showed an improvement in agreement with experimental data with key contributions including adding a laminar zone upstream of the wedge and the necessity of mimicking PIV particle lag for comparisons. Results from the quasi-1D simulation showed that there was little difference between perfect and non-ideal air for the configuration presented.

  16. Modelling of a CFD Microscale Model and Its Application in Wind Energy Resource Assessment

    Directory of Open Access Journals (Sweden)

    Yue Jie-shun

    2016-01-01

    Full Text Available The prediction of a wind farm near the wind turbines has a significant effect on the safety as well as economy of wind power generation. To assess the wind resource distribution within a complex terrain, a computational fluid dynamics (CFD based wind farm forecast microscale model is developed. The model uses the Reynolds Averaged Navier-Stokes (RANS model to characterize the turbulence. By using the results of Weather Research and Forecasting (WRF mesoscale weather forecast model as the input of the CFD model, a coupled model of CFD-WRF is established. A special method is used for the treatment of the information interchange on the lateral boundary between two models. This established coupled model is applied in predicting the wind farm near a wind turbine in Hong Gang-zi, Jilin, China. The results from this simulation are compared to real measured data. On this basis, the accuracy and efficiency of turbulence characterization schemes are discussed. It indicates that this coupling system is easy to implement and can make these two separate models work in parallel. The CFD model coupled with WRF has the advantage of high accuracy and fast speed, which makes it valid for the wind power generation.

  17. The step-by-step CFD design method of pressure-compensating emitter

    Institute of Scientific and Technical Information of China (English)

    Wei Zhengying

    2013-01-01

    In order to improve the design and research and development (R & D) efficiency of the pressure-compensating drip irrigation emitter,a step-by-step computational fluid dynamics (CFD) design method was proposed based on CFD theory combined with the finite element method.By analyzing its hydraulic performance through the step-by-step CFD method,the prediction pressure-flow curve(p-Q curve) of the pressure-compensat-ing emitter was obtained.Then the test samples were fabricated using rapid prototype and manufacturing (RP & M) technology.The emitters' hydraulic performance experiment was carried out and the experimental p-Q curve was obtained.The step-by-step CFD design method was verified by comparing the experimental p-Q curve with the prediction values,which showed that the prediction values met the experimental results well within the normal range of the emitter's working pressure.On this basis,the effect of the emitter structure on its pressure-compensating performance was studied,which showed that the height of the pressure-compensating region had significant effects on the emitter's pressure-compensating performance.Series products of the pressure-compensating emitter could be designed by changing the region's height.

  18. Comparison of CFD Simulations with Experimental Measurements of Nozzle Clogging in Continuous Casting of Steels

    Science.gov (United States)

    Mohammadi-Ghaleni, Mahdi; Asle Zaeem, Mohsen; Smith, Jeffrey D.; O'Malley, Ronald

    2016-12-01

    Measurements of clog deposit thickness on the interior surfaces of a commercial continuous casting nozzle are compared with computational fluid dynamics (CFD) predictions of melt flow patterns and particle-wall interactions to identify the mechanisms of nozzle clogging. A submerged entry nozzle received from industry was encased in epoxy and carefully sectioned to allow measurement of the deposit thickness on the internal surfaces of the nozzle. CFD simulations of melt flow patterns and particle behavior inside the nozzle were performed by combining the Eulerian-Lagrangian approach and detached eddy simulation turbulent model, matching the geometry and operating conditions of the industrial test. The CFD results indicated that convergent areas of the interior cross section of the nozzle increased the velocity and turbulence of the flowing steel inside the nozzle and decreased the clog deposit thickness locally in these areas. CFD simulations also predicted a higher rate of attachment of particles in the divergent area between two convergent sections of the nozzle, which matched the observations made in the industrial nozzle measurements.

  19. Analytic corrections to CFD heating predictions accounting for changes in surface catalysis

    Science.gov (United States)

    Gnoffo, Peter A.; Inger, George R.

    1996-01-01

    Integral boundary-layer solution techniques applicable to the problem of determining aerodynamic heating rates of hypersonic vehicles in the vicinity of stagnation points and windward centerlines are briefly summarized. A new approach for combining the insight afforded by integral boundary-layer analysis with comprehensive (but time intensive) computational fluid dynamic (CFD) flowfield solutions of the thin-layer Navier-Stokes equations is described. The approach extracts CFD derived quantities at the wall and at the boundary layer edge for inclusion in a post-processing boundary-layer analysis. It allows a designer at a workstation to address two questions, given a single CFD solution. (1) How much does the heating change for a thermal protection system with different catalytic properties than was used in the original CFD solution? (2) How does the heating change at the interface of two different TPS materials with an abrupt change in catalytic efficiency? The answer to the second question is particularly important, because abrupt changes from low to high catalytic efficiency can lead to localized increase in heating which exceeds the usually conservative estimate provided by a fully catalytic wall assumption.

  20. HART-II Acoustic Predictions using a Coupled CFD/CSD Method

    Science.gov (United States)

    Boyd, D. Douglas, Jr.

    2009-01-01

    This paper documents results to date from the Rotorcraft Acoustic Characterization and Mitigation activity under the NASA Subsonic Rotary Wing Project. The primary goal of this activity is to develop a NASA rotorcraft impulsive noise prediction capability which uses first principles fluid dynamics and structural dynamics. During this effort, elastic blade motion and co-processing capabilities have been included in a recent version of the computational fluid dynamics code (CFD). The CFD code is loosely coupled to computational structural dynamics (CSD) code using new interface codes. The CFD/CSD coupled solution is then used to compute impulsive noise on a plane under the rotor using the Ffowcs Williams-Hawkings solver. This code system is then applied to a range of cases from the Higher Harmonic Aeroacoustic Rotor Test II (HART-II) experiment. For all cases presented, the full experimental configuration (i.e., rotor and wind tunnel sting mount) are used in the coupled CFD/CSD solutions. Results show good correlation between measured and predicted loading and loading time derivative at the only measured radial station. A contributing factor for a typically seen loading mean-value offset between measured data and predictions data is examined. Impulsive noise predictions on the measured microphone plane under the rotor compare favorably with measured mid-frequency noise for all cases. Flow visualization of the BL and MN cases shows that vortex structures generated in the prediction method are consist with measurements. Future application of the prediction method is discussed.

  1. CFD simulations of a hydrocyclone in absence of an air core

    Directory of Open Access Journals (Sweden)

    Delgadillo J.A.

    2012-01-01

    Full Text Available Computational Fluid Dynamics (CFD is a versatile means to predict the characteristics of flow in fluid mechanics problems under a wide range of design and operating conditions . Applying the CFD in many engineering fields alleviates the problem of the usual engineering design. Recent advance in computational methods and computer technology make CFD an efficient means to study the dynamics of many physical systems. CFD simulations use three dimensional grid and the Reynolds Stress Model (RSM to investigate the flow without air core in a 6˝ hydrocyclone have been conducted using FLUENT. The numerical results are compared with the experimental data related to the Laser Doppler Anemometry (LDA measurements of velocity. In the experimental study, a new procedure is developed to reorient the laser beams that permit one to measure two velocity components at a single point using LDA. The conclusion developed from these experiments enables one to use the LDA directly in the hydrocyclone wall without recourse to auxiliary attachments such as an enclosing box that usually used to minimize the refraction effects of laser beams which are caused by the curved solid wall of the hydrocyclone and the refractive index of the test medium.

  2. CFD analysis of cloud cavitation on three tip-modified propellers with systematically varied tip geometry

    DEFF Research Database (Denmark)

    Shin, K. W.; Andersen, Poul

    2015-01-01

    The blade tip loading is often reduced as an effort to restrain sheet and tip vortex cavitation in the design of marine propellers. This CFD analysis demonstrates that an excessive reduction of the tip loading can cause cloud cavitation responsible for much of noise and surface erosion. Detached...

  3. CFD modelling and experimental investigation of an ejector refrigeration system using methanol as the working fluid

    Energy Technology Data Exchange (ETDEWEB)

    Riffat, S.B.; Omer, S.A. [Nottingham Univ., School of the Built Environment, Nottingham (United Kingdom)

    2001-07-01

    This paper presents results of computational fluid dynamic (CFD) analysis and experimental investigation of an ejector refrigeration system using methanol as the working fluid. The CFD modelling was used to investigate the effect of the relative position of the primary nozzle exit within the mixing chamber on the performance of the ejector. The results of the CFD were used to obtain the optimum geometry of the ejector, which was then used to design, construct and test a small-scale experimental ejector refrigeration system. Methanol was used as the working fluid, as it has the advantage of being an 'environmentally friendly' refrigerant that does not contribute to global warming and ozone layer depletion. In addition, use of methanol allows the ejector refrigeration system to produce cooling at temperatures below the freezing point of the water, which of course would not be possible with a water ejector refrigeration system. CFD results showed that positioning the nozzle exit at least 0.21 length of the mixing chamber throat's diameter upstream of the entrance of the mixing chamber gave better performance than pushing it into the mixing chamber. Experimental values of coefficient of performance (COP) between 0.2 and 0.4 were obtained at operating conditions achievable using low-grade heat such as solar energy and waste heat. (Author)

  4. CFD study of ejector flow behavior in a blast furnace gas galvanizing plant

    Science.gov (United States)

    Besagni, Giorgio; Mereu, Riccardo; Inzoli, Fabio

    2015-02-01

    In recent years, there has been a growing interest toward Blast Furnace Gas (BFG) as a low-grade energy source for industrial furnaces. This paper considers the revamping of a galvanic plant furnace converted to BFG from natural gas. In the design of the new system, the ejector on the exhaust line is a critical component. This paper studies the flow behavior of the ejector using a Computational Fluid Dynamics (CFD) analysis. The CFD model is based on a 3D representation of the ejector, using air and exhaust gases as working fluids. This paper is divided in three parts. In the first part, the galvanic plant used as case study is presented and discussed, in the second part the CFD approach is outlined, and in the third part the CFD approach is validated using experimental data and the numerical results are presented and discussed. Different Reynolds-Averaged Navier-Stokes (RANS) turbulence models ( k-ω SST and k-ɛ Realizable) are evaluated in terms of convergence capability and accuracy in predicting the pressure drop along the ejector. Suggestions for future optimization of the system are also provided.

  5. CFD dispersion investigation of CO2 worst case scenarios including terrain and release effects

    NARCIS (Netherlands)

    Mack, A.; Spruijt, M.P.N.

    2014-01-01

    In the present paper, CFD (computational fluid dynamics) computations were performed in order to get insight in heavy gas dispersion behavior based on experimental results and extrapolate them to a representative full bore rupture scenario of a CO2 pipeline. The impact of the release process is inve

  6. CFD analysis and flow model reduction for surfactant production in helix reactor

    NARCIS (Netherlands)

    Nikačević, N.M.; Thielen, L.; Twerda, A.; Hof, P.M.J. van den

    2014-01-01

    Flow pattern analysis in a spiral Helix reactor is conducted, for the application in the commercial surfactant production. Step change response curves (SCR) were obtained from numerical tracer experiments by three-dimensional computational fluid dynamics (CFD) simulations. Non-reactive flow is simul

  7. Capabilities of Numerical Simulation of Multiphase Flows in Centrifugal Pumps using Modern CFD Software

    CERN Document Server

    Kochevsky, A N

    2005-01-01

    The paper describes capabilities of numerical simulation of liquid flows with solid and/or gas admixtures in centrifugal pumps using modern commercial CFD software packages, with the purpose to predict performance curves of the pumps treating such media. In particular, the approaches and multiphase flow models available in the package CFX-5 are described; their advantages and disadvantages are analyzed.

  8. PIV measurements and CFD computations of secondary flow in a centrifugal pump impeller

    NARCIS (Netherlands)

    Westra, R.W.; Broersma, L.; Andel, van K.; Kruyt, N.P.

    2010-01-01

    Two-dimensional particle image velocimetry measurements and three-dimensional computational fluid dynamics (CFD) analyses have been performed on the steady velocity field inside the shrouded impeller of a low specific-speed centrifugal pump operating with a vaneless diffuser. Flow rates ranging from

  9. Microreactors and CFD as Tools for Biocatalysis Reactor Design: A case study

    DEFF Research Database (Denmark)

    Bodla, Vijaya Krishna; Seerup, R.; Krühne, Ulrich;

    2013-01-01

    Microreactors have been used for acquiring process data while consuming significantly lower amounts of expensive reagents. In this article, the combination of microreactor technology and computational fluid dynamics (CFD) is shown to contribute significantly towards understanding the diffusional ...... with similar dimensions to the ones tested here can be used as a screening tool for screening biocatalyst and process alternatives....

  10. Multi-Phase CFD Modeling of Solid Sorbent Carbon Capture System

    Energy Technology Data Exchange (ETDEWEB)

    Ryan, Emily M.; DeCroix, David; Breault, Ronald W.; Xu, Wei; Huckaby, E. D.; Saha, Kringan; Darteville, Sebastien; Sun, Xin

    2013-07-30

    Computational fluid dynamics (CFD) simulations are used to investigate a low temperature post-combustion carbon capture reactor. The CFD models are based on a small scale solid sorbent carbon capture reactor design from ADA-ES and Southern Company. The reactor is a fluidized bed design based on a silica-supported amine sorbent. CFD models using both Eulerian-Eulerian and Eulerian-Lagrangian multi-phase modeling methods are developed to investigate the hydrodynamics and adsorption of carbon dioxide in the reactor. Models developed in both FLUENT® and BARRACUDA are presented to explore the strengths and weaknesses of state of the art CFD codes for modeling multi-phase carbon capture reactors. The results of the simulations show that the FLUENT® Eulerian-Lagrangian simulations (DDPM) are unstable for the given reactor design; while the BARRACUDA Eulerian-Lagrangian model is able to simulate the system given appropriate simplifying assumptions. FLUENT® Eulerian-Eulerian simulations also provide a stable solution for the carbon capture reactor given the appropriate simplifying assumptions.

  11. Multi-phase CFD modeling of solid sorbent carbon capture system

    Energy Technology Data Exchange (ETDEWEB)

    Ryan, E. M.; DeCroix, D.; Breault, Ronald W. [U.S. DOE; Xu, W.; Huckaby, E. David [U.S. DOE

    2013-01-01

    Computational fluid dynamics (CFD) simulations are used to investigate a low temperature post-combustion carbon capture reactor. The CFD models are based on a small scale solid sorbent carbon capture reactor design from ADA-ES and Southern Company. The reactor is a fluidized bed design based on a silica-supported amine sorbent. CFD models using both Eulerian–Eulerian and Eulerian–Lagrangian multi-phase modeling methods are developed to investigate the hydrodynamics and adsorption of carbon dioxide in the reactor. Models developed in both FLUENT® and BARRACUDA are presented to explore the strengths and weaknesses of state of the art CFD codes for modeling multi-phase carbon capture reactors. The results of the simulations show that the FLUENT® Eulerian–Lagrangian simulations (DDPM) are unstable for the given reactor design; while the BARRACUDA Eulerian–Lagrangian model is able to simulate the system given appropriate simplifying assumptions. FLUENT® Eulerian–Eulerian simulations also provide a stable solution for the carbon capture reactor given the appropriate simplifying assumptions.

  12. Using CFD as Preventative Maintenance Tool for the Cold Neutron Source Thermosiphon System

    Directory of Open Access Journals (Sweden)

    Mark Ho

    2016-01-01

    Full Text Available The cold neutron source (CNS system of the Open Pool Australian Light-Water (OPAL reactor is a 20 L cryogenically cooled liquid deuterium thermosiphon system. The CNS is cooled by forced convective helium which is held at room temperature during stand-by (SO mode and at ~20 K during normal operation (NO mode. When helium cooling stops, the reactor is shut down to prevent the moderator cell from overheating. This computational fluid dynamics (CFD study aims to determine whether the combined effects of conduction and natural convection would provide sufficient cooling for the moderator cell under the influence of reactor decay heat after reactor shutdown. To achieve this, two commercial CFD software packages using an identical CFD mesh were first assessed against an experimental heat transfer test of the CNS. It was found that both numerical models were valid within the bounds of experimental uncertainty. After this, one CFD model was used to simulate the thermosiphon transient condition after the reactor is shut down. Two independent shutdown conditions of different decay-heat power profiles were simulated. It was found that the natural convection and conduction cooling in the thermosiphon were sufficient for dissipating both decay-heat profiles, with the moderator cell remaining below the safe temperature of 200°C.

  13. Overview of the LaNCETS Flight Experiment and the CFD Analysis

    Science.gov (United States)

    Cliatt, Larry J., II; Haering, Edward A., Jr.; Bui, Trong

    2008-01-01

    LaCETS baseline flight study include: 29 high-quality nearfield shock structure probings at three Mach numbers; Shocks in exhaust plume measured; ! CFD study of simplified nozzle shows similar plume structures as flight data; ! Phase II flights scheduled for October 2008; and ! US Industry and Academia invited to participate in analysis, review, and assessment of LaNCETS data.

  14. Investigation of Microclimate by CFD Modeling of Moisture Interactions between Air and Constructions

    DEFF Research Database (Denmark)

    Mortensen, Lone Hedegaard; Woloszyn, Monika; Rode, Carsten;

    2007-01-01

    There is a strong demand for accurate moisture modeling since moisture poses a risk for both the constructions and the indoor climate. This investigation has special focus on moisture modeling. The paper describes a new model based on a CFD tool enhanced to include both detailed modeling of airfl...

  15. CFD modeling of methane distribution at a continuous miner face with various curtain setback distances

    Institute of Scientific and Technical Information of China (English)

    Zhou Lihong; Pritchard Christopher; Zheng Yi

    2015-01-01

    Knowledge of the airflow patterns and methane distributions at a continuous miner face under different ventilation conditions can minimize the risks of explosion and injury to miners by accurately forecasting potentially hazardous face methane levels. This study focused on validating a series of computational fluid dynamics (CFD) models using full-scale ventilation gallery data that assessed how curtain setback distance impacted airflow patterns and methane distributions at an empty mining face (no continuous miner present). Three CFD models of face ventilation with 4.6, 7.6 and 10.7 m (15, 25, and 35 ft) blowing curtain setback distances were constructed and validated with experimental data collected in a full-scale ventilation test facility. Good agreement was obtained between the CFD simulation results and this data. Detailed airflow and methane distribution information are provided. Elevated methane zones at the working faces were identified with the three curtain setback distances. Visualization of the setback dis-tance impact on the face methane distribution was performed by utilizing the post-processing capability of the CFD software.

  16. Simulation of a MW rotor equipped with vortex generators using CFD and an actuator shape model

    DEFF Research Database (Denmark)

    Troldborg, Niels; Zahle, Frederik; Sørensen, Niels N.

    2015-01-01

    This article presents a comparison of CFD simulations of the DTU 10 MW reference wind turbine with and without vortex generators installed on the inboard part of the blades. The vortex generators are modelled by introducing body forces determined using a modified version of the so-called BAY mode...

  17. Drag prediction for blades at high angle of attack using CFD

    DEFF Research Database (Denmark)

    Sørensen, Niels N.; Michelsen, J.A.

    2004-01-01

    In the present paper it is first demonstrated that state of the art 3D CFD codes are. capable of predicting the correct dependency of the integrated drag of a flat plate placed perpendicular to the flow. This is in strong contrast to previous 2D investigations of infinite plates, where computations...

  18. Investigation of Airflow in a Room with displacement ventilation by means of a CFD-model

    DEFF Research Database (Denmark)

    Jacobsen, T. V.; Nielsen, Peter Vilhelm

    The airflow in front of an inlet device in a room with displacement ventilation is investigated in this study. In continuation of the full-scale measurements and the development of a CFD-model, described in /1/, this report aims at testing the model and conducting numerical experiments to provide...

  19. CFD Study of Fluid Flow in an All-glass Evacuated Tube Solar Water Heater

    DEFF Research Database (Denmark)

    Ai, Ning; Fan, Jianhua; Li, Yumin

    2008-01-01

    Abstract: The all-glass evacuated tube solar water heater is one of the most widely used solar thermal technologies. The aim of the paper is to investigate fluid flow in the solar water heater by means of computational fluid dynamics (CFD). The investigation was carried out with a focus...

  20. CFD Simulation of Thermal-Hydraulic Benchmark V1000CT-2 Using ANSYS CFX

    Directory of Open Access Journals (Sweden)

    Thomas Höhne

    2009-01-01

    Full Text Available Plant measured data from VVER-1000 coolant mixing experiments were used within the OECD/NEA and AER coupled code benchmarks for light water reactors to test and validate computational fluid dynamic (CFD codes. The task is to compare the various calculations with measured data, using specified boundary conditions and core power distributions. The experiments, which are provided for CFD validation, include single loop cooling down or heating-up by disturbing the heat transfer in the steam generator through the steam valves at low reactor power and with all main coolant pumps in operation. CFD calculations have been performed using a numerical grid model of 4.7 million tetrahedral elements. The Best Practice Guidelines in using CFD in nuclear reactor safety applications has been used. Different advanced turbulence models were utilized in the numerical simulation. The results show a clear sector formation of the affected loop at the downcomer, lower plenum and core inlet, which corresponds to the measured values. The maximum local values of the relative temperature rise in the calculation are in the same range of the experiment. Due to this result, it is now possible to improve the mixing models which are usually used in system codes.