WorldWideScience

Sample records for binodoxys communis gahan

  1. Cryptic species of parasitoids attacking the soybean aphid (Hemiptera:Aphididae) in Asia: Binodoxys communis (Gahan) and Binodoxys koreanus (Hymenoptera: Braconidae: Aphidiinae)

    Czech Academy of Sciences Publication Activity Database

    Desneux, N.; Starý, Petr; Delebecque, C. J.; Gariepy, T. D.; Barta, R. J.; Hoelmer, K. A.; Heimpel, G. E.

    2009-01-01

    Roč. 102, č. 6 (2009), s. 925-936 ISSN 0013-8746 Institutional research plan: CEZ:AV0Z50070508 Keywords : cryptic species * Binodoxys communnis * Binodoxys koreanus Subject RIV: EH - Ecology, Behaviour Impact factor: 0.939, year: 2009

  2. Impact of Rag1 aphid resistant soybeans on Binodoxys communis (Hymenoptera: Braconidae), a parasitoid of soybean aphid (Hemiptera: Aphididae).

    Science.gov (United States)

    Ghising, Kiran; Harmon, Jason P; Beauzay, Patrick B; Prischmann-Voldseth, Deirdre A; Helms, Ted C; Ode, Paul J; Knodel, Janet J

    2012-04-01

    Multiple strategies are being developed for pest management of the soybean aphid, Aphis glycines Matsumura; however, there has been little published research thus far to determine how such strategies may influence each other, thereby complicating their potential effectiveness. A susceptible soybean (Glycine max L.) variety without the Rag1 gene and a near isogenic resistant soybean variety with the Rag1 gene were evaluated in the laboratory for their effects on the fitness of the soybean aphid parasitoid, Binodoxys communis (Gahan). The presence or absence of the Rag1 gene was verified by quantifying soybean aphid growth. To test for fitness effects, parasitoids were allowed to attack soybean aphids on either a susceptible or resistant plant for 24 h and then aphids were kept on the same plant throughout parasitoid development. Parasitoid fitness was measured by mummy and adult parasitoid production, adult parasitoid emergence, development time, and adult size. Parasitoids that attacked soybean aphids on susceptible plants produced more mummies, more adult parasitoids, and had a higher emergence rate compared with those on resistant plants. Adult parasitoids that emerged from resistant plants took 1 d longer and were smaller compared with those from susceptible plants. This study suggests that biological control by B. communis may be compromised when host plant resistance is widely used for pest management of soybean aphids.

  3. Antifungal Efficacy of Myrtus communis Linn

    OpenAIRE

    Sadeghi Nejad; Erfani Nejad; Yusef Naanaie; Zarrin

    2014-01-01

    Background The ethanolic extract of Myrtus communis Linn. leaves was assayed in vitro as a growth inhibitor against opportunistic fungi such as Candida and Aspergillus species. Myrtus communis Linn. (Family, Myrtaceae) is an aromatic evergreen shrub or small tree. It is native to the Mediterranean region. Objectives This study aimed to assess antifungal activity (in vitro) of the ethanolic extracts of Myrtus communis leaves as a g...

  4. Activity of Ricinus communis (Euphorbiaceae) against Spodoptera ...

    African Journals Online (AJOL)

    One of the most studied plant species with insecticidal properties is the castor bean Ricinus communis. However, its activity against Spodoptera frugiperda is unclear. Therefore, to determinate the insecticidal and insectistatic activities of methanol, hexane and ethyl acetate extracts of the seeds and leaves of R. communis, ...

  5. Secondary metabolites and bioactivities of Myrtus communis

    OpenAIRE

    Mahmoud I Nassar; El-Sayed A Aboutabl; Rania F Ahmed; Ezzel-Din A El-Khrisy; Khaled M Ibrahim; Amany A Sleem

    2010-01-01

    Background: Myrtus species are characterized by the presence of phenolic acids, flavonoids, tannins, volatile oils and fatty acids. They are remedies for variety of ailments. This study therefore investigated medicinal effects of Myrtus communis L. Methods: Bioactivity studies of Myrtus communis L. leaves were carried out on volatile oil, 7% methanol and aqueous extracts and the isolated compounds myricetin 3-O-β-glucopyranoside, myricetin 3-O-∝-rhamnopyranoside and gallic acid. Results: Dete...

  6. Antifungal Efficacy of Myrtus communis Linn

    Directory of Open Access Journals (Sweden)

    Sadeghi Nejad

    2014-08-01

    Full Text Available Background The ethanolic extract of Myrtus communis Linn. leaves was assayed in vitro as a growth inhibitor against opportunistic fungi such as Candida and Aspergillus species. Myrtus communis Linn. (Family, Myrtaceae is an aromatic evergreen shrub or small tree. It is native to the Mediterranean region. Objectives This study aimed to assess antifungal activity (in vitro of the ethanolic extracts of Myrtus communis leaves as a growth inhibitor against 24 clinical isolates of Candida, including C. albicans, C. glabrata, and C. tropicalis also three species of Aspergillus, including A. niger, A. flavus, and A. terreus. Materials and Methods The ethanolic extract of myrtle leaves was prepared by maceration method and minimal inhibitory concentration (MIC of Myrtus communis leaves extract was determined by agar-well diffusion technique. Amphotericin B and clotrimazole were used as the positive control in this assay. Results The minimal inhibitory concentration (MICs values of Myrtus communis leaves extract ranged 0.625-5.0 µg/µL and 5-40 µg/µL against tested Candida spp. and Aspergillus spp., respectively. Conclusions Results revealed that the ethanolic extract of Myrtus communis leaves have antifungal potency against both pathogenic tested fungi, and it can be used as a natural antifungal agent.

  7. Acquisition through common slave (servus communis

    Directory of Open Access Journals (Sweden)

    Bogunović Mirjana B.

    2016-01-01

    Full Text Available Common slave (servus communis is a slave who belongs to two masters. Both masters may entirely dispose with the slave because their joint ownership allows it. However, acquisitions through common slave (servus communis is not that clear. Does a slave evenly oblige co-masters or only the master on whose behalf he has acted? Is it possible for a slave to work in the interest of one master and oblige another? Who does the unconscientious slave correspond to, the third party or a betrayed master? This paper will analyze the opinions of two Roman iurists, which will partly solve doubts that this institute causes.

  8. Contribución al estudio de la biología y capacidad de control de Encarsia Formosa Gahan en la Sabana de Bogotá Biology ano control activity ,of Encarsia formosa Gahan in Bogota (Colombia

    Directory of Open Access Journals (Sweden)

    Español Jeannette Amparo

    1988-12-01

    Full Text Available Con la introducción de Encarsia formosa Ganan.(Hvrnenóptero-Aphelinidae, parásito espec ífico de la mosca blanca Trisleurodes vaporariorum (Westwood Ouaintance
    & Baker, se realizó un estudio de biología, comportamiento y adaptación del parásito en condiciones de laboratorio e invernadero a nivel de la Sabana de Bogotá, A partir de las primeras liberaciones de Encsrsie, se observó una buena capacidad de búsqueda, dispersión, adaptación y eficiencia
    de control sobre la mayoría de hospederos vegetales muestreados, En condiciones de la boratorio sobre plantas de tomate, se obtuvo una fecundidad promedia de 63 huevos/
    hembra/20 días, una longevidad promedia de 41,4 días, una relación de sexos de 361: 1 Hembras/macho, una duración del ciclo de vida de 22,1 días cuando parasitó ninfas en tercer instar y de 12,7 días cuando parasitó ninfas de mosca blanca en cuarto instar, En la evaluación del control ejercido sobre las ninfas de mosca blanca en plantas de tomate se determinó un mayor porcentaje de parasitismo en los folíolos medios y apicales y un mayor porcentaje de predación en los folíolos basales, En cuanto al control ejercido por Encarsia formosa sobre plantas de tomate y tabaco en laboratorio y tomate,  milflores y alstroemeria bajo condiciones de
    invernadero y sometidas a libre infestación de la plaga y el parásito se determinó un buen control expresado en un alto porcentaje de parasitismo superior al 70% y un bajo
    porcentaje de predación.
    Some preliminary studies on behavior and adaptation of the newly introduced Encarsia formosa Gahan as a parasite of the greenhouse whitefly Trisleurodes vaporariorum (Westwood under laboratory and greenhouse conditions were determined. Different plant hosts of T. vaporariorum were considered. Using tomato as a host for the greenhouse whitefly it was found that E. formosa showed and average
    fecundity of 63 eggs per female in 20 days, an adult

  9. Volatile Constituents of Ferula communis L. subsp. communis Growing Spontaneously in Greece

    Directory of Open Access Journals (Sweden)

    Stavroula Manolakou

    2013-01-01

    Full Text Available The essential oils of Greek Ferula communis subsp. communis from different plant parts were obtained by hydrodistillation and analyzed by means of GC and GC-MS. Ninety three compounds were identified in the total essential oils. Sesqui terpenes were the most dominant class of compounds in the leaves and inflorescences oils, while infructescences oils were rich in monoterpenes with α-pinene (35.2-40.6% being the dominant component.

  10. Genotyping and Bioforensics of Ricinus communis

    Energy Technology Data Exchange (ETDEWEB)

    Hinckley, Aubree Christine [Univ. of California, Davis, CA (United States)

    2006-01-01

    The castor bean plant (Ricinus communis) is a member of the family Euphorbiaceae. In spite of its common name, the castor plant is not a true bean (i.e., leguminous plants belonging to the family, Fabaceae). Ricinus communis is native to tropical Africa, but because the plant was recognized for its production of oil with many desirable properties, it has been introduced and cultivated in warm temperate regions throughout the world (Armstrong 1999 and Brown 2005). Castor bean plants have also been valued by gardeners as an ornamental plant and, historically, as a natural rodenticide. Today, escaped plants grow like weeds throughout much of the southwestern United States, and castor seeds are even widely available to the public for order through the Internet. In this study, multiple loci of chloroplast noncoding sequence data and a few nuclear noncoding regions were examined to identify DNA polymorphisms present among representatives from a geographically diverse panel of Ricinus communis cultivated varieties. The primary objectives for this research were (1) to successfully cultivate castor plants and extract sufficient yields of high quality DNA from an assortment of castor cultivated varieties, (2) to use PCR and sequencing to screen available universal oligos against a small panel of castor cultivars, (3) to identify DNA polymorphisms within the amplified regions, and (4) to evaluate these DNA polymorphisms as appropriate candidates for assay development (see Figure 1). Additional goals were to design, test and optimize assays targeting any DNA polymorphisms that were discovered and to rapidly screen many castor cultivars to determine the amount of diversity present at that particular locus. Ultimately, the goal of this study was to construct a phylogeographic tree representing the genetic relationships present among Ricinus communis cultivars from diverse geographic regions. These research objectives were designed to test the hypothesis that cultivated varieties

  11. In vitro micropropagation of almond (Amygdalus communis L. cv ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-06-17

    Jun 17, 2008 ... This method here in described will be useful for the rapid multiplication of almond (A. communis L. cv. Nonpareil) in commercial exploitation. Key words: Amygdalus communis L.cv. Nonpareil, micropropagation, zygotic embryos, in vitro. INTRODUCTION. The almond (Prunus dulcis, syn. Prunus amygdalus ...

  12. Immunogenic Properties of Ricinus Communis Var Minor Seed on ...

    African Journals Online (AJOL)

    Prof. Ogunji

    Abstract. The immunogenic properties of Ricinus communis var minor seed was determined after feeding 7 healthy virgin albino white rabbits with varying doses of 0.5g – 0.9g dried ground. Ricinus communis var minor seed included in their feed (5g/100g body weight). Booster doses of the same weight were further ...

  13. Antibacterial profile of fermented seed extracts of ricinus communis ...

    African Journals Online (AJOL)

    The study was carried out to ascertain the antibacterial properties inherent in fermented seed extracts of Ricinus communis. Dry seeds of R. communis (Castor oil plant) were deshelled, grounded to powder, fermented, and then extracted both with alcohol and water using Soxhlet machine. Different concentrations of the ...

  14. Immunogenic Properties of Ricinus Communis Var Minor Seed on ...

    African Journals Online (AJOL)

    The immunogenic properties of Ricinus communis var minor seed was determined after feeding 7 healthy virgin albino white rabbits with varying doses of 0.5g – 0.9g dried ground Ricinus communis var minor seed included in their feed (5g/100g body weight). Booster doses of the same weight were further administered ...

  15. The suitability of biotypes Q and B of Bemisia tabaci (Gennadius (Hemiptera: Aleyrodidae at different nymphal instars as hosts for Encarsia formosa Gahan (Hymenoptera: Aphelinidae

    Directory of Open Access Journals (Sweden)

    Xin Liu

    2016-04-01

    Full Text Available Encarsia formosa Gahan (Hymenoptera: Aphelinidae is a solitary endoparasitoid that is commercially reared and released for augmentative biological control of whiteflies infesting greenhouse crops. In most areas in China, the invasive and destructive whitefly Bemisia tabaci (Gennadius (Hemiptera: Aleyrodidae biotype Q has replaced B. tabaci biotype B and has become dominant between the two. A better understanding of the suitability of different nymphal instars of B. tabaci biotypes Q and B as hosts for E. formosa is needed to improve the use of this parasitoid for biological control. Parasitism of the four nymphal instars of B. tabaci biotypes Q and B by the commercial strain of E. formosa mass reared on Trialeurodes vaporariorum (Westwood (Hemiptera: Aleyrodidae was assessed in the laboratory. The results indicated that E. formosa parasitized and successfully developed on all instars of both biotypes but performed best on the 3rd instar of B. tabaci biotype B and on the 2nd, 3rd, and 4th instars of B. tabaci biotype Q. The host-feeding rate of the adult parasitoid was generally higher on nymphal instars of B. tabaci biotype Q than on the corresponding nymphal instars of biotype B and was significantly higher on the 2nd and 3rd instars. For both whitefly biotypes, the parasitoid’s immature developmental period was the longest on the 1st instar, intermediate on the 2nd and 3rd instars, and the shortest on the 4th instar. The parasitoid emergence rate was significantly lower on the 1st instar than on the other three instars and did not significantly differ between B. tabaci biotype B and biotype Q. Offspring longevity was greater on the 3rd and 4th instars than on the 1st instar and did not significantly differ between the two B. tabaci biotypes. The results indicate that commercially-produced E. formosa can parasitize all instars of B. tabaci biotypes B and Q, making this parasitoid a promising tool for the management of the two biotypes of B

  16. Biology of Bemisia tabaci (Genn. B-biotype and parasitism by Encarsia formosa (Gahan on collard, soybean and tomato plants Aspectos biológicos de Bemisia tabaci (Genn. biótipo B e parasitismo por Encarsia formosa (Gahan em couve, soja e tomateiro

    Directory of Open Access Journals (Sweden)

    Karina Manami Takahashi

    2008-12-01

    Full Text Available The silverleaf whitefly Bemisia tabaci (Genn. B-biotype (= B. argentifolii (Hemiptera: Aleyrodidae is a polyphagous insect attacking many plant species of economic importance. A comparison study was conducted on the duration of the egg-to-adult period, and the percentage of hatching eggs of Bemisia tabaci (Genn. B-biotype on collard (Brassica oleracea L. var. acephala D.C., soybean(Glycine max (L. Merr. and tomato (Lycopersicon esculentum Mill. plants, as well as the egg-to-adult period of Encarsia formosa (Gahan on the 1st, 2nd, 3rd and 4th whitefly nymphal instars on these three plant species. The experiments were conducted in a laboratory (25ºC, 70 ± 10% RH, 14-hour photophase. The duration of the egg-to-adult period of B. tabaci was 19.8 days on collard, 21.2 days on soybean and 22.0 days on tomato. The number of hatched eggs was higher on collard when compared to soybean and tomato plants. Concerning E. formosa regardless of plant species, the duration for the egg-to-adult period was shorter for the 3rd and 4th instar nymphs as compared with the other instars.A mosca branca Bemisia tabaci (Genn. biótipo B é uma praga polífaga que ataca muitas culturas de importância econômica. O controle químico pode causar problemas como o aparecimento de resistência nesse inseto, resíduos nos produtos das culturas, ou mesmo poluição ambiental. Um método alternativo seria o controle biológico, com o parasitóide Encarsia formosa (Gahan, o mais usado contra moscas brancas a nível mundial. Avaliaram-se o tempo de desenvolvimento de ovo a adulto e a porcentagem de ninfas eclodidas de B. tabaci (Genn. biótipo B em couve (Brassica oleracea L. var. acephala D.C., soja (Glycine max (L. Merr. e tomateiro (Lycopersicon esculentum Mill., bem como o desenvolvimento de ovo a adulto de E. formosa em ninfas de 1º, 2º, 3º e 4º ínstares dessa mosca-branca nessas três espécies vegetais. Os experimentos foram desenvolvidos em laboratório, a 25ºC, 70

  17. Antimicrobial activity of the essential oil of Myrtus Communis L ...

    African Journals Online (AJOL)

    The development of microbial resistance to antibiotics is a global concern. The present study was carried out to determine the composition and the antimicrobial potential of the essential oil of Myrtus communis L. against 13 pathogenic strains responsible of many infections. The results show that levels of MIC observed ...

  18. Spatiotemporal features of microsporogenesis in the cycad species Macrozamia communis.

    Science.gov (United States)

    Yan, Xiaodong; Bai, Mei; Ning, Xiping; Ouyang, Haibo; Zhang, Shouzhou; Yang, Ming; Wu, Hong

    2015-07-01

    • Spatiotemporal features of microsporogenesis may provide important clues about the evolution of microsporogenesis in seed plants. One cellular feature that attracts special attention is advance cell wall ingrowths (ACWIs) at future cytokinetic sites in microsporocytes since they have been found only in species of an ancient lineage of angiosperms, Magnolia, and in much less detail, of an ancient lineage of gymnosperms, cycads. Further investigation into microsporogenesis in a cycad species may yield knowledge critical to understanding the establishment of ACWIs as an important feature for comparative studies of microsporogenesis in seed plants.• Bright-field and epifluorescence microscopy, confocal laser scanning microscopy, and transmission electron microscopy were used to investigate the microsporogenic process in Macrozamia communis, a species in the Zamiaceae family of cycads.• In prophase-II microsporocytes in M. communis, ACWIs form as a callose ring between the newly formed nuclei and are not accompanied by cytokinetic apparatuses such as mini-phragmoplasts, wide tubules, or wide tubular networks. Shortly after the second nuclear division, new ACWIs, albeit thinner than the previous ACWIs, form between the newly formed nuclei. Subsequent cell plate formation in the planes of the ACWIs typically results in tetragonal tetrads.• Cytokinesis at the cell periphery is initiated earlier than cell plate formation in the cell interior in microsporogenesis in M. communis. The cellular features uncovered in M. communis may serve as useful reference features for comparative studies of microsporogenesis in plants. © 2015 Botanical Society of America, Inc.

  19. Growth response of Ricinus communis L (castor oil) in spent ...

    African Journals Online (AJOL)

    The growth response of castor oil plant, Ricinus communis, in spent lubricating oil (SLO) was investigated using 1-6% w/w SLO and a control. The result showed that highest percent germination of approximately 92, was obtained in control and the least in 5% w/w. The early germination obtained in this study was significant ...

  20. EFFECT OF CASTOR BEAN (Ricinus communis L.) AQUEOUS ...

    African Journals Online (AJOL)

    User

    EFFECT OF CASTOR BEAN (Ricinus communis L.) AQUEOUS. EXTRACTS ON THE PERFORMANCE OF ROOT-KNOT. NEMATODES (Meloidogyne spp.) ON TOMATO. (Solanum lycopersicum L.) J. Adomako1 and C. K. Kwoseh2. 1. Plant Health Division, CSIR-Crops Research Institute, Fumesua, Kumasi. 2. Department ...

  1. Essential oil composition and antioxidant activity of two Juniperus communis L. varieties growing wild in Serbia

    Directory of Open Access Journals (Sweden)

    Rajčević Nemanja F.

    2016-01-01

    Full Text Available The genus Juniperus L. (Cupressaceae consists of ca. 67 species and 34 varieties. Juniperus communis L. grows on dry hills or mountainous tracts and is widely distributed in the northern hemisphere. A typical variety J. communis L. var. communis was collected in Deliblatska peščara (Deliblato Sands and variety J. communis L. var. saxatilis Pall. in Kopaonik Mountain. Needle essential oils were obtained using Clevenger apparatus and analyzed using GC/MS and GC/FID. Antioxidant activity of essential oils was evaluated using DPPH assay. A total of 78 compounds were detected and identified. Both oils are characterized by high abundance of monoterpenes. The main constituents of J. communis var. communis essential oil were sabinene (39.4%, α-pinene (13.3%, myrcene (4.7% and terpinen-4-ol (3.7%, while J. communis var. saxatilis essential oil had α-pinene (34.9%, sabinene (20.3%, δ-3-carene (6.4% and germacrene B (6.3% as the most abundant components. DPPH test showed IC50 values 0.66 mg/ml for J. communis var. communis and 0.32 mg/ml for J. communis var. saxatilis. Although antioxidant activity was weaker than used standards (BHT and L-ascorbic acid it is still significant.

  2. Truncus arteriosus communis in combination with cor triatriatum sinsitrum.

    Science.gov (United States)

    Klusmeier, Elmar; Haas, Nikolaus A; Sandica, Eugen

    2016-01-01

    Truncus arteriosus communis is a rare CHD, accounting for only 1% of all congenital cardiac abnormalities. It has been associated with other malformations of the heart, mainly truncal valve (bicuspid/quadricuspid) and aortic arch abnormalities such as right, interrupted, and hypoplastic aortic arch. Cor tratriatrum sinistrum is another rare CHD, and it has been associated with other cardiac defects such as anomalous pulmonary venous drainage, ventricular septal defect, coarctation of the aorta, and tetralogy of Fallot. The combination of truncus arteriosus communis and cor tratriatrum sinistrum has not been reported so far. This case study describes the diagnosis of a unique case, including these two very rare cardiac defects and the successful surgical treatment thereafter.

  3. Phytochemical and Pharmacological Investigations of Ricinus communis Linn.

    Directory of Open Access Journals (Sweden)

    Ram Singh

    2015-01-01

    Full Text Available Medicinal plants have always played a vital role for the healthy human life. The family Euphorbiaceous is a family of flowering plants and contains nearly about 300 genera and 7,500 species. Amongst all, the species Ricinus communis or castor plant has high traditional and modern medicinal values. The individual parts of the plant like the seed, seed oil, leaves and the roots showed their importance in pharmacology. Traditionally, the plant has been used for the treatment of various diseases in traditional or folk remedies throughout the world. In modern pharmacology, this plant is reported to possess antioxidant, anti-inflammatory, anti-diabetic, central analgesic, antitumor, anti-nociceptive, antiasthmatic activity and other medicinal properties. These activities of the plant are due to the presence of important phytochemical constituents like flavonoids, glycosides, alkaloids, steroids, terpenoids etc. The aim of present article is to explore the chemical constituents, their structures and medicinal importance of Ricinus communis.

  4. Characterization of Ricin and R. communis Agglutinin Reference Materials

    Directory of Open Access Journals (Sweden)

    Sylvia Worbs

    2015-11-01

    Full Text Available Ricinus communis intoxications have been known for centuries and were attributed to the toxic protein ricin. Due to its toxicity, availability, ease of preparation, and the lack of medical countermeasures, ricin attracted interest as a potential biological warfare agent. While different technologies for ricin analysis have been established, hardly any universally agreed-upon “gold standards” are available. Expert laboratories currently use differently purified in-house materials, making any comparison of accuracy and sensitivity of different methods nearly impossible. Technically challenging is the discrimination of ricin from R. communis agglutinin (RCA120, a less toxic but highly homologous protein also contained in R. communis. Here, we established both highly pure ricin and RCA120 reference materials which were extensively characterized by gel electrophoresis, liquid chromatography-electrospray ionization-tandem mass spectrometry (LC-ESI MS/MS, and matrix-assisted laser desorption ionization–time of flight approaches as well as immunological and functional techniques. Purity reached >97% for ricin and >99% for RCA120. Different isoforms of ricin and RCA120 were identified unambiguously and distinguished by LC-ESI MS/MS. In terms of function, a real-time cytotoxicity assay showed that ricin is approximately 300-fold more toxic than RCA120. The highly pure ricin and RCA120 reference materials were used to conduct an international proficiency test.

  5. Characterization of Ricin and R. communis Agglutinin Reference Materials

    Science.gov (United States)

    Worbs, Sylvia; Skiba, Martin; Söderström, Martin; Rapinoja, Marja-Leena; Zeleny, Reinhard; Russmann, Heiko; Schimmel, Heinz; Vanninen, Paula; Fredriksson, Sten-Åke; Dorner, Brigitte G.

    2015-01-01

    Ricinus communis intoxications have been known for centuries and were attributed to the toxic protein ricin. Due to its toxicity, availability, ease of preparation, and the lack of medical countermeasures, ricin attracted interest as a potential biological warfare agent. While different technologies for ricin analysis have been established, hardly any universally agreed-upon “gold standards” are available. Expert laboratories currently use differently purified in-house materials, making any comparison of accuracy and sensitivity of different methods nearly impossible. Technically challenging is the discrimination of ricin from R. communis agglutinin (RCA120), a less toxic but highly homologous protein also contained in R. communis. Here, we established both highly pure ricin and RCA120 reference materials which were extensively characterized by gel electrophoresis, liquid chromatography-electrospray ionization-tandem mass spectrometry (LC-ESI MS/MS), and matrix-assisted laser desorption ionization–time of flight approaches as well as immunological and functional techniques. Purity reached >97% for ricin and >99% for RCA120. Different isoforms of ricin and RCA120 were identified unambiguously and distinguished by LC-ESI MS/MS. In terms of function, a real-time cytotoxicity assay showed that ricin is approximately 300-fold more toxic than RCA120. The highly pure ricin and RCA120 reference materials were used to conduct an international proficiency test. PMID:26703723

  6. Chemical Investigations of the Castor Bean Plant Ricinus communis

    Science.gov (United States)

    2012-12-01

    Storage Proteins TSP 3-(trimethylsilyl)-2,2,3,3-d4- propionic acid UV Unit Variance VIP Variable Importance in the Projection UNCLASSIFIED...probe head. Each sample was freeze dried and resuspended in D2O [with 0.01% (trimethylsilyl)-2,2,3,3-d4- propionic acid (TSP) and 2% d4-acetic acid ] at...analysing the 2% acidic R. communis extracts was not readily applicable to IRMS and ICPMS techniques due to interference from residual acetic acid

  7. Spontaneous poisoning by Ricinus communis (Euphorbiaceae in cattle

    Directory of Open Access Journals (Sweden)

    Samuel S.C. Albuquerque

    2014-09-01

    Full Text Available The aim of this study is to report cases of spontaneous poisoning of cattle by Ricinus communis (castor beans in Paraíba, a semiarid region of northeastern Brazil. The cases were observed in 2 herds on neighboring properties in 2013. Clinical signs developed within 6-24 h and consisted of weakness, tachycardia, dyspnea, profuse watery diarrhea, dehydration, depression, instability, cramps, permanent lateral recumbency and death within 48-72 h. Of the 60 cattle at risk, 19 were affected and 14 died. Five fully recovered after the course of 12 days. Three animals were necropsied. The main gross lesions were hemopericardium, hemothorax, pulmonary edema, petechial hemorrhages in the epicardium and endocardium, ecchymoses at the papillary muscles and suffusions on the intercostal muscles. Hemorrhages were also observed in the abdominal cavity, spleen and mucosa of the abomasum and small intestine. The rumen content was liquid with a large amount of castor bean seeds. There were circular, whitish and focally diffuse areas in the liver parenchyma. The main microscopic lesions consisted of multifocal coagulative myocardial necrosis with the presence of mononuclear cell infiltration and varying degrees of bleeding between cardiac muscle fibers. The abomasum and small intestine mucosae and submucosa had mild edema and mononuclear and polymorphonuclear inflammatory cell infiltration. The diagnosis of R. communis was based on the history of plant consumption, clinical signs, pathology of the disease and the presence of large amounts of castor bean seeds in the forestomachs.

  8. Synthesis of Estolide 2-ethylhexyl Ester from Ricinus communis

    International Nuclear Information System (INIS)

    Nazrizawati Ahmad Tajuddin; Nor Habibah Rosli

    2013-01-01

    Estolide 2-ethylhexyl ester synthesized through condensation reaction between ricinoleic acid from castor oil (Ricinus communis) and lauric acid, and then capped with 2-ethylhexyl alcohol. The reaction was continuously conducted under vacuum for 24 hours. Product of 2-ethylhexyl ester was characterized by using Fourier Transform Infrared (FTIR) to determine functional group and Nuclear Magnetic Resonans (NMR) for structure's determination. The presence of ester group at 1738.23 cm -1 wavenumber indicates that the formation of estolide ester has occurred. The vibration peak of C-O at 1174.60 cm -1 and 1117.10 cm -1 support the formation of ester. The presence of CH 2 bending indicated the long-chain compound. The ester methine signal at 3.8669 ppm indicated the estolide linkage in the 1 H-NMR spectrum while the 13 C-NMR showed two carbonyl signals at 173.41 ppm for acid and 173.56 ppm for ester. (author)

  9. Physicochemical and phytochemical standardization of berries of Myrtus communis Linn.

    Directory of Open Access Journals (Sweden)

    Sabiha Sumbul

    2012-01-01

    Full Text Available Purpose: Herbal medicines are gaining more and more attention all over the world due to their long historical clinical practice and less side effects. The major limitation with herbal medicines is that the lack of standardization technique. Initially, the crude drugs were identified by comparison only with the standard description available. Materials and Methods: Standardization of drugs means confirmation of its identity and determination of its quality and purity. The quality control standards of various medicinal plants, used in indigenous system of medicine, are significant nowadays in view of commercialization of formulations based on medicinal plants. The quality of herbal drugs is the sum of all factors, which contribute directly or indirectly to the safety, effectiveness, and acceptability of the product. Lack of quality control can affect the efficacy and safety of drugs that may lead to health problems in the consumers. Standardization of drugs is needed to overcome the problems of adulteration and is most developing field of research now. Therefore, there is an urgent need of standardized drugs having consistent quality. Results: The drug showed the presence of phyto-chemical constituents. Powdered drug was treated with different reagents and examined under UV light. Different reagents showed different colors of the drug at 2 wavelengths. The percentage of physiological active compounds viz. total phenolics, tannins, volatile oil, fixed oil, and alkaloids were also observed. Conclusion: Myrtus communis L. (Family: Myrtaceae is one of the important drug being used in Unani system of medicine for various therapeutic purposes. In this study, an attempt has been made to study berries of M. communis from physico-chemical and phytochemical standardization point of view.

  10. Discovery and Characterization of Novel Signatures from the Ricinus communis L. (Castor Bean) Genome

    National Research Council Canada - National Science Library

    O'Connell, Kevin P; Skowronski, Evan W; Dretchen, Kenneth L; Leshin, Jonathan A; Weeks, Andrea

    2006-01-01

    Given the infamous toxicity of ricin and the industrial usefulness of castor oil, there is a surprising lack of information about the genetic diversity of the species that produces both, the castor bean plant (Ricinus communis L...

  11. Genetic structure and diversity in Juniperus communis populations in Saxony, Germany

    Directory of Open Access Journals (Sweden)

    Reim Stefanie

    2016-06-01

    Full Text Available In recent years, land use changes led to a rapid decline and fragmentation of J. communis populations in Germany. Population isolation may lead to a restricted gene flow and, further, to negative effects on genetic variation. In this study, genetic diversity and population structure in seven fragmented J. communis populations in Saxony, Germany, were investigated using nuclear microsatellites (nSSR and chloroplast single nucleotide polymorphism (cpSNP. In all Saxony J. communis populations, a high genetic diversity was determined but no population differentiation could be detected whatever method was applied (Bayesian cluster analysis, F-statistics, AMOVA. The same was true for three J. communis out-group samples originating from Italy, Slovakia and Norway, which also showed high genetic diversity and low genetic differences regarding other J. communis populations. Low genetic differentiation among the J. communis populations ascertained with nuclear and chloroplast markers indicated high levels of gene flow by pollen and also by seeds between the sampled locations. Low genetic differentiation may also provide an indicator of Juniper survival during the last glacial maximum (LGM in Europe. The results of this study serve as a basis for the implementation of appropriate conservation measures in Saxony.

  12. IMUNIDADE CRUZADA PELAS SEMENTES DE Abrus precatorius E Ricinus communis EM BOVINOS Crossimmunity by the seeds of Abrus precatorius and Ricinus communis in cattle

    Directory of Open Access Journals (Sweden)

    Carlos Hubinger Tokarnia

    1997-01-01

    Full Text Available Cinco bovinos imunizados contra a ação tóxica das sementes de Abrus precatorius L. ("tento", "jiquiriti" não adoeceram ou somente levemente pela administração das sementes de Ricinus communis L. ("mamona", em doses que em bovinos que antes nunca ingeriram sementes de A. precatorius ou R. communis, causaram intoxicação de intensidade de grau moderado a acentuado ou até a morte. Um sexto bovino, que não ficou bem imunizado contra a ação tóxica das sementes de A. precatorius, adoeceu em grau acentuado pela administração de dose elevada das sementes de R. communis. Já dos cinco bovinos imunizados contra a ação tóxica das sementes de R. communis quatro adoeceram em grau acentuado, oquinto em grau moderado, pela administração das sementes de A. precatorias em doses que em bovinos que antes nunca ingeriram sementes de R. communis ou A. precatorius causaram intoxicação de intensidade leve a acentuada. Estes resultados permitem concluir que bovinos imunizados contra a ação tóxica das sementes de A. precatorius são resistentes à ação tóxica das sementes de R. communis, mas que o contrário não ocorre, isto é, bovinos imunizados contra a ação tóxica das sementes de R. communis, não se mostraram protegidos contra a intoxicação por A. precatorius. Estudos anteriores por outros autores mostraram que as toxalbuminas de A. precatorius e R. communis, respectivamente abrina e ricina, são diferentes do ponto de vista antigênico. Uma explicação para a divergência desses resultados com os nossos poderia estar no fato de que no presente estudo foram usados poligástricos que receberam as sementes por via oral, enquanto que nos estudos anteriores foram usados monogástricos em que as sementes ou as toxinas foram aplicadas por via parenteral. A administração de folhas frescas ou do pericarpo do fruto de R. communis a bovinos imunizados contra a ação das sementes desta planta tiveram o mesmo efeito tóxico que em animais n

  13. Phenolic contents of myrtle (Myrtus communis L.) fruits

    OpenAIRE

    Arzu BAYIR YEĞİN; Halil İbrahim UZUN

    2015-01-01

    Mersin (Myrtus communis L.) Akdeniz Bölgesinin önemli bir doğal bitkisidir. Meyveleri siyah ve beyaz renklidir. Mersin bitkisi hakkında yapılan çalışmaların çoğu özellikle yapraklarında bulunan uçucu yağların tespiti ile ilgili iken, son yıllarda sağlık üzerine etkileri nedeniyle mersinin içerdiği fenolik bileşikler ve bunların etkileri üzerine çalışmalar yoğunlaşmıştır. Çalışmanın amacı, mersin meyvelerinin içerdiği fenolik bileşik miktarlarını ve bunların genotiplere göre değişimini saptama...

  14. Effect of copper on castor bean (Ricinus communis L.) growth

    Energy Technology Data Exchange (ETDEWEB)

    Chaves, Lucia Helena Garofalo; Cunha, Tassio Cavalcanti da Silva; Lima, Vinicius Mota; Cabral, Paulo Cesar Pinto; Barros Junior, Genival; Lacerda, Rogerio Dantas de [Universidade Federal de Campina Grande (UAEAg/UFCG), PB (Brazil). Unidade Academica de Engenharia Agricola

    2008-07-01

    Castor beans crop (Ricinus communis L.) is raising attention as an alternative crop for oil and biodiesel production. Despite the mineral fertilization is an important factor for increasing castor yield, few research has been made on this issue, mainly on the use de copper. In order to evaluate the effects of copper on growth of this plant an experiment was carried out in a greenhouse, in Campina Grande, Paraiba State, Brazil, from July to December 2007. The substrate for the pot plants was a 6 mm-sieved surface soil (Neossolo Quartzarenico). The experimental design was a completely randomized with three replications. The treatments were composed of five levels of Cu (0; 1; 2; 3 and 4 mg dm{sup -3}), which were applied at the time of planting. One plant of castor bean, cultivar BRS 188 - Paraguacu, was grown per pot after thinning and was irrigated whenever necessary. Data on plant height, number and length of leaves and stem diameter were measured at 21, 34, 77 and 103 days after planting. Copper levels used, in general, did not affect the plant height, stem diameter and leaf area, however they influenced the leaves and shoot biomass dry mass and the quadratic trend was the best to show the behavior of these. (author)

  15. Antileishmanial and cytotoxic effects of essential oil and methanolic extract of Myrtus communis L.

    Science.gov (United States)

    Mahmoudvand, Hossein; Ezzatkhah, Fatemeh; Sharififar, Fariba; Sharifi, Iraj; Dezaki, Ebrahim Saedi

    2015-02-01

    Plants used for traditional medicine contain a wide range of substances that can be used to treat various diseases such as infectious diseases. The present study was designed to evaluate the antileishmanial effects of the essential oil and methanolic extract of Myrtus communis against Leishmania tropica on an in vitro model. Antileishmanial effects of essential oil and methanolic extract of M. communis on promastigote forms and their cytotoxic activities against J774 cells were evaluated using MTT assay for 72 hr. In addition, their leishmanicidal activity against amastigote forms was determined in a macrophage model, for 72 hr. Findings showed that the main components of essential oil were α-pinene (24.7%), 1,8-cineole (19.6%), and linalool (12.6%). Findings demonstrated that M. communis, particularly its essential oil, significantly (Pessential oil and methanolic extract was 8.4 and 28.9 μg/ml against promastigotes, respectively. These values were 11.6 and 40.8 μg/ml against amastigote forms, respectively. Glucantime as control drug also revealed IC50 values of 88.3 and 44.6 μg/ml for promastigotes and amastigotes of L. tropica, respectively. The in vitro assay demonstrated no significant cytotoxicity in J774 cells. However, essential oil indicated a more cytotoxic effect as compared with the methanolic extract of M. communis. The findings of the present study demonstrated that M. communis might be a natural source for production of a new leishmanicidal agent.

  16. Gahan House, High Street, Graiguenamanagh, Kilkenny.

    LENUS (Irish Health Repository)

    Zhou, Ping

    2011-08-03

    Abstract Background To simplify the methodology for the isolation of Campylobacter spp. from retail broiler meat, we evaluated 108 samples (breasts and thighs) using an unpaired sample design. The enrichment broths were incubated under aerobic conditions (subsamples A) and for comparison under microaerobic conditions (subsamples M) as recommended by current reference protocols. Sensors were used to measure the dissolved oxygen (DO) in the broth and the percentage of oxygen (O2) in the head space of the bags used for enrichment. Campylobacter isolates were identified with multiplex PCR assays and typed using pulsed-field gel electrophoresis (PFGE). Ribosomal intergenic spacer analyses (RISA) and denaturing gradient gel electrophoresis (DGGE) were used to study the bacterial communities of subsamples M and A after 48 h enrichment. Results The number of Campylobacter positive subsamples were similar for A and M when all samples were combined (P = 0.81) and when samples were analyzed by product (breast: P = 0.75; thigh: P = 1.00). Oxygen sensors showed that DO values in the broth were around 6 ppm and O2 values in the head space were 14-16% throughout incubation. PFGE demonstrated high genomic similarity of isolates in the majority of the samples in which isolates were obtained from subsamples A and M. RISA and DGGE results showed a large variability in the bacterial populations that could be attributed to sample-to-sample variations and not enrichment conditions (aerobic or microaerobic). These data also suggested that current sampling protocols are not optimized to determine the true number of Campylobacter positive samples in retail boiler meat. Conclusions Decreased DO in enrichment broths is naturally achieved. This simplified, cost-effective enrichment protocol with aerobic incubation could be incorporated into reference methods for the isolation of Campylobacter spp. from retail broiler meat.

  17. Different methods evaluation of antioxidant properties of Myrtus communis extract and its fractions

    Directory of Open Access Journals (Sweden)

    Soheila Moein

    2015-09-01

    Full Text Available Myrtus communis L. is a plant traditionally used as an antiseptic and disinfectant drug. In this research, the antioxidant activity of Myrtus communis was assayed by evaluating radical scavenging activity, reducing power, FRAP method and determination of phenolic compounds. The methanolic extract of leaves of Myrtus communis was fractionated by using petroleum ether, chloroform, ethyl acetate and buthanol. In reducing power, different concentrations of samples were mixed with phosphate buffer, ferrocyanate, TCA and ferric chloride. Different concentrations of samples were mixed with DPPH and after 30 min the absorbances were measured. For determination of phenolic content, 500 μl of sample was mixed with Folin-Ciocalteu and sodium carbonate. For determination of flavonoids, 500 μl of sample was mixed with 2 ml of distilled water, NaNO2 and NaOH. In reducing power method, chloroform fraction showed the highest reducing capacity. In the DPPH radical scavenging method, the highest antioxidant capacity was found in buthanol fraction (IC50=84.42±1.8 μg/ml. In FRAP method, the highest antioxidant capacity was found in crude extract (5.4±0.3 mg/ml and buthanol fractions (5.51±0.4 mg/ml, respectively. The highest amount of phenolic compounds was detected in ethyl acetate fraction of Myrtus communis (17.5±0.001 μg/g. The highest amount of flavonoids was found in crude extract of Myrtus communis (171.9±7.3 μg/ml. Overall, we can suggest that the leaves of Myrtus communis can be used as antioxidant and as a food additives to avoid oxidative degradation of foods.

  18. Hypnotic effect of the essential oil from the leaves of Myrtus communis on mice

    Directory of Open Access Journals (Sweden)

    Birhanie MW

    2016-08-01

    Full Text Available Muluken Walle Birhanie,1 Bizuayehu Walle,1 Kidist Rebba2 1Department of Physiology, 2Department of Nursing, College of Medicine and Health Sciences, Bahir Dar University, Bahir Dar, Ethiopia Background: Myrtus communis has been suggested as a sleep aid in unconventional medicine. Moreover, previous studies have also indicated its sedative- and hypnotic-like activity. In this study, the hypnotic effect of M. communis was investigated.Methods: Essential oil (EO of M. communis (600, 800, and 1,000 mg/kg was given orally to Swiss albino mice of both sex, and the hypnotic effect was evaluated. In addition, the EO of M. communis (500, 600, 800, and 1,000 mg/kg was administered orally to Swiss albino mice of both sex 60 minutes prior to pentobarbital injection (50 mg/kg. Latency to sleep and sleep duration were recorded. The effect of the EO on motor coordination and muscle relaxation was evaluated using chimney and traction tests, 60 and 90 minutes after administration of the respective doses of the EO, respectively.Results: There was no induction of hypnosis as the presence of the righting reflex was intact. However the EO prolonged pentobarbital-induced sleeping time and there was also 50% negative response on the chimney and traction test in a dose dependent manner.Conclusion: The EO of M. communis did not produce a hypnotic effect, but it potentiated a hypnotic effect with significant central nervous system depressant activity. Keywords: Myrtus communis, hypnotic, motor coordination, muscle relaxation, essential oil

  19. Recognition factors of Ricinus communis agglutinin 1 (RCA(1)).

    Science.gov (United States)

    Wu, Albert M; Wu, June H; Singh, Tanuja; Lai, Li-Ju; Yang, Zhangung; Herp, Anthony

    2006-04-01

    Ricinus communis agglutinin (RCA1) is one of the most important applied lectins that has been widely used as a tool to study cell surfaces and to purify glycans. Although the carbohydrate specificity of RCA1 has been described, the information obtained was mainly focused on inhibition of simple Galbeta1-related oligosaccharides and simple clusters. Here, all possible recognition factors of RCA1 of glycan binding were examined by enzyme-linked lectinosorbent (ELLSA) and inhibition assays, using known mammalian Gal/GalNAc carbohydrate structural units and natural polyvalent glycans. Among the glycoproteins (gps) tested and expressed as 50% nanogram inhibition, the high-density polyvalent Galbeta1-4GlcNAc (II) glycotopes occurring in natural gps, such as Pneumococcus type 14 capsular polysaccharide which is composed of repeating poly II residues, resulted in 9.0 x 10(4), 1.5 x 10(5), 2.3 x 10(4) and 2.1 x 10(4)-fold higher affinities to RCA1 than the monomeric Gal, linear I/II and Tri-antennary-II (Tri-II). Of the ligands tested and expressed as nanomoles of 50% inhibition, Tri-II was the best, being about 2, 4, 25.6 and 33.3 times better inhibitor than Di-II, II, I (Galbeta1-3GlcNAc) and Gal, respectively. From the results of this study, it is concluded that: (a) Galbeta1-4GlcNAc and other Galbeta1-related oligosaccharides are essential for lectin binding and their polyvalent form in macromolecules should be the most important recognition factor for RCA1; (b) the combining site of RCA1 may be a groove type, recognizing Galbeta1-4GlcNAc (II) as the major binding site; (c) its combining size may be large enough to accommodate a tetrasaccharide of beta-anomeric Gal at the non-reducing end and most complementary to human blood group I Ma active trisaccharide (Galbeta1-4GlcNAcbeta1-6Gal) and lacto-N-neotetraose (Galbeta1-4GlcNAcbeta1-3Galbeta1-4Glc); (d) RCA1 has a preference for the beta-anomer of Gal oligosaccharides with a Galbeta1-4 linkage > Galbeta1-6 > or = Galbeta

  20. Can adaptive modulation of traits to urban environments facilitate Ricinus communis L. invasiveness?

    Science.gov (United States)

    Goyal, Neha; Pardha-Saradhi, P; Sharma, Gyan P

    2014-11-01

    This paper addresses the phenotypic variation among Ricinus communis L. populations in four urban habitat types (road verges, garbage dumps, construction debris, and natural area) in Delhi, India, by evaluating important traits such as plant height, basal circumference, seeds per plant, seed size, seed weight, specific leaf area, and reproductive index. An important biochemical marker, proline, considered as a good plant performance indicator under stress was also quantified in leaves of R. communis to evaluate its response in different habitats. Interestingly, the species showed significant variation in plant height, specific leaf area, seed size, seed weight, and leaf proline content in different habitat types. Leaf proline content was positively related to plant height, specific leaf area, and seed size while negatively related to the total number of seeds/plant. Interestingly, reproductive index, calculated as a ratio of the total number of seeds to the plant height also showed a negative relation with leaf proline content. Results indicated that R. communis exhibits adaptive modulation of growth, reproductive traits, and leaf proline content in various urban habitats which contributes to invasiveness, range expansion, and establishment of the species. The study also gives evidence of how morphological and physiological traits could directly affect invasiveness of R. communis.

  1. Toxicity of copper sulphate on some haematological parameters of a freshwater teleost Cyprinus carpio var. communis

    OpenAIRE

    Ramesh, M.

    2001-01-01

    Haematological changes in a freshwater teleost, Cyprinus carpio var. communis, exposed to acute and sublethal toxicity of copper sulphate were studied. During the acute treatment, erythrocyte and leucocyte count, and haemoglobin content increased, whereas during the sublethal treatment, erythrocyte count and haemoglobin content decreased and leucocyte count increased.

  2. Discovery and Characterization of Novel Signatures from the Ricinus communis L. (Castor Bean) Genome

    Science.gov (United States)

    2006-11-01

    2006 2. REPORT TYPE N/A 3. DATES COVERED - 4. TITLE AND SUBTITLE Discovery And Characterization Of Novel Signatures From The Ricinus Communis...pressed herbarium specimens prepared from sequenced plants.) Lane 2, PI167112; lane 3, 167287; lane 4, 167342; lane 5, 170684; lane 6, 170686; lane

  3. ANTIMICROBIAL ACTIVITY OF THE ESSENTIAL OIL OF Myrtus communis L BERRIES GROWING WILD IN ALGERIA

    Directory of Open Access Journals (Sweden)

    M. Toauibia

    2015-05-01

    Full Text Available The development of microbial resistance to antibiotics is a global concern. The present study was carried out to determine the composition and the antimicrobial potential of the essential oil of Myrtus communis L. against 13 pathogenic strains responsible of many infections. The results show that levels of MIC observed range from 0.563 to 36 mg/ml. 

  4. Antidiabetic Activity of Different Extracts of Myrtus Communis in Streptozotocin Induced Diabetic Rats

    Directory of Open Access Journals (Sweden)

    Panjeshahin Mohammad Reza

    2016-06-01

    Full Text Available Background and aim: Hydroalcoholic (70° extract of leaves of Myrtus communis has been shown to have antidiabetic effect in streptozotocin induced diabetic rats in our previous study. In this study, we intended to determine the components of the mentioned extract and identify the mechanism for its action.

  5. ANTIMICROBIAL ACTIVITY OF THE ESSENTIAL OIL OF Myrtus communis L BERRIES GROWING WILD IN ALGERIA

    OpenAIRE

    M. Toauibia

    2015-01-01

    The development of microbial resistance to antibiotics is a global concern. The present study was carried out to determine the composition and the antimicrobial potential of the essential oil of Myrtus communis L. against 13 pathogenic strains responsible of many infections. The results show that levels of MIC observed range from 0.563 to 36 mg/ml. 

  6. ANTIMICROBIAL ACTIVITY OF THE ESSENTIAL OIL OF MYRTUS COMMUNIS L BERRIES GROWING WILD IN ALGERIA

    Directory of Open Access Journals (Sweden)

    M. Toauibia

    2015-02-01

    Full Text Available The development of microbial resistance to antibiotics is a global concern. The present study was carried out to determine the composition and the antimicrobial potential of the essential oil of Myrtus communis L. against 13 pathogenic strains responsible of many infections. The results show that levels of MIC observed range from 0.563 to 36 mg/ml.

  7. Effect of powdered castor oil seed ( Ricinus communis L.) on some ...

    African Journals Online (AJOL)

    Effect of powdered castor oil seed ( Ricinus communis L.) on some internal organs of albino rat. ... Four feed formulations were used; powdered castor oil seed and commercial rat feed mixed in ratio 1:1, 1:2, 1:5, 1:10 and ordinary commercial rat feed, which serves as the control.These formulations were given to four ...

  8. In vitro antimicrobial and larvicidal properties of wild Ricinus communis L. in Mauritius

    Directory of Open Access Journals (Sweden)

    Sillma Rampadarath

    2016-02-01

    Conclusions: Ricinus communis (castor plant extracts possess larvicidal properties providing an effective eco-friendly control for fruit flies. The antimicrobial results justify the use of this plant in traditional medicine and the practice of supplementing decoctions/concoctions with conventional antibiotics.

  9. Toxic effects of Ricinus communis non-protein trypsin inhibitor on ...

    African Journals Online (AJOL)

    In the study reported herein, we aimed to isolate a trypsin inhibitor from Ricinus communis leaves through chromatographic and spectrometric techniques and evaluate its toxic effects on the development of Spodoptera frugiperda larvae. Plant extracts were submitted to fractionation in adsorption column. The fraction 10 ...

  10. Essential oil of the leaves of Ricinus communis L.: in vitro cytotoxicity and antimicrobial properties.

    Science.gov (United States)

    Zarai, Zied; Ben Chobba, Ines; Ben Mansour, Riadh; Békir, Ahmed; Gharsallah, Néji; Kadri, Adel

    2012-08-13

    The aim of the present study was to appraise the antimicrobial activity of Ricinus communis L. essential oil against different pathogenic microorganisms and the cytotoxic activity against HeLa cell lines. The agar disk diffusion method was used to study the antibacterial activity of Ricinus communis L. essential oil against 12 bacterial and 4 fungi strains. The disc diameters of zone of inhibition (DD), the minimum inhibitory concentrations (MIC) and the concentration inhibiting 50% (IC50) were investigated to characterize the antimicrobial activities of this essential oil. The in vitro cytotoxicity of Ricinus communis L. essential oil was examined using a modified MTT assay; the viability and the IC50 were used to evaluate this test. The essential oil from the leaves of Ricinus communis L. was analyzed by GC-MS and bioassays were carried out. Five constituents of the oil were identified by GC-MS. The antimicrobial activity of the oil was investigated in order to evaluate its efficacy against twelve bacteria and four fungi species, using disc diffusion and minimum inhibitory concentration methods. The essential oil showed strong antimicrobial activity against all microorganisms tested with higher sensitivity for Bacillus subtilis, Staphylococcus aureus and Enterobacter cloacae. The cytotoxic and apoptotic effects of the essential oil on HeLa cell lines were examined by MTT assay. The cytotoxicity of the oil was quite strong with IC50 values less than 2.63 mg/ml for both cell lines. The present study showed the potential antimicrobial and anticarcinogenic properties of the essential oil of Ricinus communis L., indicating the possibilities of its potential use in the formula of natural remedies for the topical treatment of infections.

  11. Antifungal activity of Myrtus communis against Malassezia sp. isolated from the skin of patients with pityriasis versicolor.

    Science.gov (United States)

    Barac, Aleksandra; Donadu, Matthew; Usai, Donatella; Spiric, Vesna Tomic; Mazzarello, Vittorio; Zanetti, Stefania; Aleksic, Ema; Stevanovic, Goran; Nikolic, Natasa; Rubino, Salvatore

    2017-11-20

    The increasing incidence of fungal infections and antifungal resistance has prompted the search for novel antifungal drugs and alternative agents. We explored the antifungal activity of Myrtus communis essential oil (EO) against Malassezia sp. isolated from the skin of patients with pityriasis versicolor. These broad-spectrum antimicrobial activities of M. communis EO and its potent inhibiting activity on Malassezia growth deserve further research with aim to considerate this EO as candidate for topical use in treatment of skin diseases.

  12. Biochemical, physiological and molecular responses of Ricinus communis seeds and seedlings to different temperatures: a multi-omics approach

    OpenAIRE

    Ribeiro de Jesus, P.R.

    2015-01-01

    Biochemical, physiological and molecular responses of Ricinus communis seeds and seedlings to different temperatures: a multi-omics approach by Paulo Roberto Ribeiro de Jesus The main objective of this thesis was to provide a detailed analysis of physiological, biochemical and molecular-genetic responses of Ricinus communis to temperature during seed germination and seedling establishment. In Chapter 2, I describe the assessment of 17 candidate reference genes across a diverse set of samples,...

  13. Avaliação da atividade antibacteriana de folhas de Myrtus communis L. (Myrtaceae

    Directory of Open Access Journals (Sweden)

    Luiz Estevão Salvagnini

    Full Text Available O óleo essencial e o extrato etanólico obtidos a partir de folhas de Myrtus communis foram avaliados quanto 'a atividade inibitória frente a vários microrganismos. Os halos de inibição de crescimento foram avaliados através das técnicas de "template" e difusão em disco para as linhagens de Staphylococcus aureus, Staphylococcus epidermidis, Escherichia coli, Bacillus subtilis e Serratia marcescens. Os resultados obtidos evidenciaram que o óleo de M. communis apresentou atividade antibacteriana superior ao extrato etanólico frente a todas as bactérias. A atividade demonstrada tanto para o óleo como para o extrato etanólico frente a algumas linhagens, foi melhor evidenciada pela técnica "template". E. coli foi resistente ao óleo e extrato etanólico testados.

  14. Flue-gas-influenced heavy metal bioaccumulation by the indigenous microalgae Desmodesmus communis LUCC 002.

    Science.gov (United States)

    Palanisami, Swaminathan; Lee, Keesoo; Balakrishnan, Baskar; Nam, Paul Ki-souk

    2015-01-01

    Desmodesmus communis LUCC 002 was cultivated using flue gas originating from a coal-fired power plant as a carbon dioxide (CO2) source. The flue gas contains various heavy metals. For investigating the fate of flue-gas-introduced metals on the cultivation system, bioaccumulation was measured in the microalgal biomass and milieu. The accumulated biomass was found to contain eight heavy metals: arsenic, chromium, barium, lead, selenium, silver, cadmium, and mercury. High heavy metal accumulations were also found in the control group of algae grown without the addition of flue gas at the same location. Further testing revealed that some of the heavy metals originated from well water used in the cultivation. The flue-gas-influenced bioaccumulation pattern of different heavy metals was observed. The responses of individual heavy metals and the influence of well water microbial flora on the algal growth were investigated, this study showed that hormesis was developed by the D. communis LUCC 002.

  15. Extracting Extensor Digitorum Communis Activation Patterns using High-Density Surface Electromyography

    Directory of Open Access Journals (Sweden)

    Xiaogang eHu

    2015-10-01

    Full Text Available The extensor digitorum communis muscle plays an important role in hand dexterity during object manipulations. This multi-tendinous muscle is believed to be controlled through separate motoneuron pools, thereby forming different compartments that control individual digits. However, due to the complex anatomical variations across individuals and the flexibility of neural control strategies, the spatial activation patterns of the extensor digitorum communis compartments during individual finger extension have not been fully tracked under different task conditions.The objective of this study was to quantify the global spatial activation patterns of the extensor digitorum communis using high-density (7×9 surface electromyogram (EMG recordings. The muscle activation map (based on the root mean square of the EMG was constructed when subjects performed individual four finger extensions at the metacarpophalangeal joint, at different effort levels and under different finger constraints (static and dynamic. Our results revealed distinct activation patterns during individual finger extensions, especially between index and middle finger extensions, although the activation between ring and little finger extensions showed strong covariance. The activation map was relatively consistent at different muscle contraction levels and for different finger constraint conditions. We also found that distinct activation patterns were more discernible in the proximal-distal direction than in the radial-ulnar direction. The global spatial activation map utilizing surface grid EMG of the extensor digitorum communis muscle provides information for localizing individual compartments of the extensor muscle during finger extensions. This is of potential value for identifying more selective control input for assistive devices. Such information can also provide a basis for understanding hand impairment in individuals with neural disorders.

  16. Use of Energy Crop (Ricinus communis L.) for Phytoextraction of Heavy Metals Assisted with Citric Acid.

    Science.gov (United States)

    Zhang, Hui; Chen, Xueping; He, Chiquan; Liang, Xia; Oh, Kokyo; Liu, Xiaoyan; Lei, Yanru

    2015-01-01

    Ricinus communis L. is a bioenergetic crop with high-biomass production and tolerance to cadmium (Cd) and lead (Pb), thus, the plant is a candidate crop for phytoremediation. Pot experiments were performed to study the effects of citric acid in enhancing phytoextraction of Cd/Pb by Ricinus communis L. Citric acid increased Cd and Pb contents in plant shoots in all treatments by about 78% and 18-45%, respectively, at the dosage of 10 mM kg(-1) soil without affecting aboveground biomass production. Addition of citric acid reduced CEC, weakened soil adsorption of heavy metals and activated Cd and Pb in soil solutions. The acid-exchangeable fraction (BCR-1) of Pb remained lower than 7% and significantly increased with citric acid amendment. Respective increases in soil evaluation index induces by 14% and 19% under the Cd1Pb50 and Cd1Pb250 treatments upon addition of citric acid resulted in soil quality improvement. Ricinus communis L. has great potential in citric acid-assisted phytoextraction for Cd and Pb remediation.

  17. Evaluation of antibacterial effect of Myrtus communis against Acinetobacter baumannii clinical strains

    Directory of Open Access Journals (Sweden)

    Venous Akhavan

    2016-09-01

    Full Text Available Because of inappropriate use of antibiotics and prevalence of resistant bacteria, there is urgent need for antibacterial drugs that have fewer side effects than antibiotics. Myrtus communis is a medicinal plant which had many uses in traditional medicine. In this study, ethanol leave extract of this plant is tested on Acinetobacter baumannii. In the case of antimicrobial evaluation of plants, one of the effecting factors on effectiveness of the microbial inhibition is extraction techniques. In the presents study, the antibacterial activity of the Ethanol, Methanol, and Ethyl acetate extracts of M. communis plant was evaluated at seven different concentrations by broth microdilution method. The results of this study showed that the antimicrobial effect of M. communis extract is concentration dependent. Different extracts were obtained by the maceration method. Extracts of the plant exhibited antibacterial activity at varied levels against A. baumannii. Obtained results from our antibacterial experiments showed that all extracts have anti-bacterial activity against tested bacterial isolates According to the results, the ethyl acetate extracted fraction showed the highest level of activity at a MIC 400 mg/ml for A. baumannii. The results of this study indicate that, different extracts had growth inhibitory effect on A. baumannii. Therefore this plant has the potential to be evaluated as an alternative or adjunct to antibiotics to treat Acinetobacter infections.

  18. Antifungal and Herbicidal Effects of Fruit Essential Oils of Four Myrtus communis Genotypes.

    Science.gov (United States)

    Kordali, Saban; Usanmaz, Ayse; Cakir, Ahmet; Komaki, Amanmohammad; Ercisli, Sezai

    2016-01-01

    The chemical composition of the essential oils isolated by hydrodistillation from the fruits of four selected Myrtus communis L. genotypes from Turkey was characterized by GC-FID and GC/MS analyses. 1,8-Cineole (29.20-31.40%), linalool (15.67-19.13%), α-terpineol (8.40-18.43%), α-pinene (6.04-20.71%), and geranyl acetate (3.98-7.54%) were found to be the major constituents of the fruit essential oils of all M. communis genotypes investigated. The oils were characterized by high amounts of oxygenated monoterpenes, representing 73.02-83.83% of the total oil compositions. The results of the fungal growth inhibition assays showed that the oils inhibited the growth of 19 phytopathogenic fungi. However, their antifungal activity was generally lower than that of the commercial pesticide benomyl. The herbicidal effects of the oils on the seed germination and seedling growth of Amaranthus retroflexus L., Chenopodium album L., Cirsium arvense (L.) Scop., Lactuca serriola L., and Rumex crispus L. were also determined. The oils completely or partly inhibited the seed germinations and seedling growths of the plants. The findings of the present study suggest that the M. communis essential oils might have potential to be used as natural herbicides as well as fungicides. Copyright © 2016 Verlag Helvetica Chimica Acta AG, Zürich.

  19. Selective response of Ricinus communis seedlings to soil borne rhizoctonia infection

    Directory of Open Access Journals (Sweden)

    Andras Bittsanszky

    2015-09-01

    Full Text Available Seedlings of Ricinus communis tolerated soil-borne Rhizoctonia infection in strain dependent manner. There was no connection revealed between pathogenicity of strains and their origin or taxonomic position, however, the castor plant proved to be susceptible to most strains highly pathogenic to other host plants as well. Rhizoctonia zeae (teleomorph: Waitea circinata, a species new for European flora, was less aggressive to R. communis as the most potent R. solani strains. The effect of Rhizoctonia infection on mass accumulation of hypocotyls was more prominent than that on cotyledons. The protein content and glutathione S-transferase (GST activity increased in parallel with evolution of disease syndrome. Metalaxyl, an acetanilide type systemic anti-omycete fungicide induced locally the GST activity in R. communis cotyledons with 24 hours lag phase, and this induction was altered in the seedlings grown in Rhizoctonia infested soil by strain dependent manner. It might be concluded, that the stress response related detoxication mechanisms of plants in tolerant host/parasite pairs take effect at higher level than in highly susceptible relationships.

  20. Ricinus communis L. A Value Added Crop for Remediation of Cadmium Contaminated Soil.

    Science.gov (United States)

    Bauddh, Kuldeep; Singh, Kripal; Singh, Rana P

    2016-02-01

    Heavy metal pollution of soil is a global environmental problem and therefore its remediation is of paramount importance. Cadmium (Cd) is a potential toxicant to living organisms and even at very low concentrations. This study was aimed to assess the effectiveness of Ricinus communis for remediation of Cd contaminated soils. For this, growth and biomass of R. communis and Cd accumulation, translocation and partitioning in different plant parts were investigated after 8 months of plant growth in Cd contaminated soil (17.50 mg Cd kg−1 soil). Eight months old plants stabilized 51 % Cd in its roots and rest of the metal was transferred to the stem and leaves. There were no significant differences in growth, biomass and yield between control and Cd treated plants, except fresh weight of shoots. The seed yield per plant was reduced only by 5 % of Cd contaminated plants than control. The amount of Cd translocated to the castor seeds was nominal i.e. 0.007 µg Cd g−1 seeds. The bioconcentration factor reduced significantly in shoots and seeds in comparison to roots. The data indicates that R. communis is highly tolerant to Cd contamination and can be used for remediation of heavy metal polluted sites.

  1. Contrasting patterns of genetic divergence in two sympatric pseudo-metallophytes: Rumex acetosa L. and Commelina communis L.

    Directory of Open Access Journals (Sweden)

    Ye M

    2012-06-01

    Full Text Available Abstract Background Patterns of genetic divergence between populations of facultative metallophytes have been investigated extensively. However, most previous investigations have focused on a single plant species making it unclear if genetic divergence shows common patterns or, conversely, is species-specific. The herbs Rumex acetosa L. and Commelina communis L. are two pseudo-metallophytes thriving in both normal and cupriferous soils along the middle and lower reaches of the Yangtze River in China. Their non-metallicolous and metallicolous populations are often sympatric thus providing an ideal opportunity for comparative estimation of genetic structures and divergence under the selective pressure derived from copper toxicity. Results In the present study, patterns of genetic divergence of R. acetosa and C. communis , including metal tolerance, genetic structure and genetic relationships between populations, were investigated and compared using hydroponic experiments, AFLP, ISSR and chloroplast genetic markers. Our results show a significant reduction in genetic diversity in metallicolous populations of C. communis but not in R. acetosa . Moreover, genetic differentiation is less in R. acetosa than in C. communis , the latter species also shows a clustering of its metallicolous populations. Conclusions We propose that the genetic divergences apparent in R. acetosa and C. communis , and the contrasting responses of the two species to copper contamination, might be attributed to the differences in their intrinsic physiological and ecological properties. No simple and generalised conclusions on genetic divergence in pseudo-metallophytes can thus be drawn.

  2. Measurements of essential oil extract and antioxidant in Syrian Myrtus communis L. leaves using photo chemiluminescence assay

    International Nuclear Information System (INIS)

    Zayzafoon, G.; Odeh, A.; Mahzia, Y.

    2012-01-01

    The essential oil extracts and antioxidant measurements of Syrian Myrtus communis L. leaves as hydrophilic and hydrophobic existence species have been carried out. The plant leaves as a source of antioxidants was tested by the influence of its aqueous and essential oil extracts on the yield of photo chemiluminescence, PCL solution applying very sensitive and reliable method. By means of a photo chemiluminescence assay, it was possible to assess the total antioxidants capacity of hydrophilic and hydrophobic species existence in Syrian Myrtus communis L. leaves. It has been found that, the integral antioxidant capacity measurements value of Syrian Myrtus communis L. leaves was found in Kurdaha site which has a value of 465.67 1.18 nmol TE/g DM (total Trolox equivalent /gram of Dry material) . The following three mainly chemical species were found in the essential oil extracts: -Pinene, Cineole and Limonene. (author)

  3. Hyperglycaemic effect of Artocarpus communis Forst (Moraceae) root bark aqueous extract in Wistar rats.

    Science.gov (United States)

    Adewole, S O; Ojewole, J O

    2007-01-01

    Decoctions and infusions of Artocarpus communis (Forst) (family: Moraceae) root bark are traditionally used among the Yoruba-speaking people of western Nigeria as folk remedies for the management, control and treatment of an array of human diseases, including type 2 diabetes mellitus. Although numerous bioactive prenylflavonoids have been isolated from the roots, stem bark and leaves of A communis, to the best of our knowledge, the effects of the plant's root bark extract on animal models of diabetes mellitus have hitherto not been reported in the biomedical literature. In our pilot study, we observed that A communis root bark aqueous extract (ACE) raised blood glucose concentrations in rats. In view of this finding, the present study was undertaken to investigate the glycaemic effect of ACE in comparison with that of streptozotocin (STZ) in Wistar rats. Four groups (A, B, C and D) of Wistar rats, each group consisting of 10 rats, were used in this study. Group A rats received distilled water in quantities equivalent to the volume of ACE administered. Diabetes mellitus was induced in the animals in groups B and C by intraperitoneal (ip) injections of STZ (75 mg/kg body weight). The rats in group C were additionally treated with ACE (50 mg/kg body weight ip) from the third to the tenth day following STZ treatment. Group D rats received ACE (12.5-100 mg/kg body weight ip) only. The effects of ACE were compared with those of STZ on blood glucose concentrations, serum and pancreatic insulin levels, hepatic hexokinase (HXK) and glucokinase (GCK) activities, and hepatic glycogen contents in the experimental animal paradigm used. The rats in treated groups B, C and D exhibited pronounced polyuria, hypo-insulinaemia and hyperglycaemia. Group D rats developed significant hyperglycaemia (p < 0.05) immediately after ACE administration, whereas groups B and C rats became hyperglycaemic 24 to 72 hours post STZ and STZ + ACE treatments, when compared with the control group A

  4. Effect of experimental Ricinus communis solution for denture cleaning on the properties of acrylic resin teeth.

    Science.gov (United States)

    Pisani, Marina Xavier; Macedo, Ana Paula; Paranhos, Helena de Freitas Oliveira; Silva, Cláudia Helena Lovato da

    2012-01-01

    This study evaluated Knoop hardness, surface roughness and color alteration of artificial teeth for dentures after immersion in water, 1% sodium hypochlorite and an experimental solution of 2% Ricinus communis (RC). Thirty specimens of Vipi, Biolux and Trilux were analyzed. Tests of Knoop hardness, surface roughness and color alteration were conducted immediately after specimen preparation (T0) and after two immersion protocols for 15 days (ΔT(15)) and 183 days (ΔT(183)). Data variation (ΔT) were subjected to ANOVA and Tukey's test (pproperties. Both immersion protocols caused alterations on the analyzed properties.

  5. Gregarine Cephaloidophora communis mawrodiadi, 1908 in the barnacle Euraphia rhyzophorae, Oliveira, 1940 from Brazil

    Directory of Open Access Journals (Sweden)

    Lacombe Dyrce

    2002-01-01

    Full Text Available The gregarine Cephaloidophora communis was observed for the first time in Brazil in the barnacles Euraphia rhyzophorae collected in Angra dos Reis, Rio de Janeiro, Brazil, between 1990 and 1996. Histological studies showed growth phases of the parasite in specific parts of the digestive system. The intracellular forms occurred in the vacuoles of the intestinal cells. Syzygy was frequent, and the most common form following syzygy was cylindrical, with a single membrane. The cytoplasm of the gregarines was always irregular, dense, and occasionally presenting a dark stoch area.

  6. Phytosynthesis of Silver Nanoparticles Using Myrtus communis L. Leaf Extract and Investigation of Bactericidal Activity

    Science.gov (United States)

    Ajdari, M. R.; Tondro, G. H.; Sattarahmady, N.; Parsa, A.; Heli, H.

    2017-12-01

    Silver nanoparticles have been synthesized using only Myrtus communis L. leaf extract by a facile procedure without other reagents. The extract played the roles of both reducing and capping agent. The nanoparticles were characterized using field-emission scanning microscopy, and remained stable for at least 3 weeks. Antibacterial activity of the nanoparticles was evaluated toward Escherichia coli, Bacillus subtilis, Pseudomonas aeruginosa, Staphylococcus aureus, methicillin-resistant Staphylococcus aureus, and Enterococcus faecalis based on inhibition zone disk diffusion assays. The minimum inhibitory and bactericidal concentrations of the nanoparticles were obtained. Mechanisms for the antibacterial activity were proposed.

  7. HPLC-DAD-MS identification of bioactive secondary metabolites from Ferula communis roots.

    Science.gov (United States)

    Arnoldi, Lolita; Ballero, Mauro; Fuzzati, Nicola; Maxia, Andrea; Mercalli, Enrico; Pagni, Luca

    2004-06-01

    A simple HPLC method was developed to distinguish between 'poisonous' and 'non-poisonous' chemotypes of Ferula communis. The method was performed on a C8 reverse phase analytical column using a binary eluent (aqueous TFA 0.01%-TFA 0.01% in acetonitrile) under gradient condition. The two chemotypes showed different fingerprints. The identification of five coumarins and eleven daucane derivatives by HPLC-diode array detection (HPLC-DAD) and HPLC-MS is described. A coumarin, not yet described, was detected. Copyright 2004 Elsevier B.V.

  8. Apis mellifera pollination improves agronomic productivity of anemophilous castor bean (Ricinus communis

    Directory of Open Access Journals (Sweden)

    Rômulo A.G. Rizzardo

    2012-12-01

    Full Text Available Castor bean (Ricinus communis L. is cultivated mainly for biodiesel production because of its oil-rich seeds; it is assumed to be an anemophylous species. But pollination deficit can lead to low productivity often attributed to other reasons. In this paper, we investigated pollination requirements, pollination mechanism, occurrence of pollination deficit, and the role of biotic pollinators in a large commercial plantation of castor bean. Our results show that R. communis bears a mixed breeding system favoring selfing by geitonogamy, although the wind promotes mostly outcrossing. We also found that the honey bee (Apis mellifera L. foraging on castor bean can both transfer pollen from male to female flowers within the same raceme and boost the release of airborne pollen by male flowers. Both situations increase geitonogamy rates, raising significantly fruit set and seed yield. This is the first report of an animal foraging activity increasing seed yield in an anemophilous and geitonogamous crop and elucidates the role of biotic pollinators in castor bean reproduction.A mamoneira (Ricinus communis L. é cultivada principalmente para produção de biodiesel devido ao alto teor de óleo de suas sementes e considerada como sendo de polinização anemófila. Mas déficits de polinização podem levar a baixos índices de produtividade geralmente atribuídos a outros fatores. Neste trabalho foram investigados os requerimentos, mecanismos e déficit de polinização e o papel dos polinizadores bióticos em um monocultivo comercial de mamona. Os resultados mostram que R. communis possui um sistema de polinização misto, favorecendo a autopolinização por geitonogamia, embora o vento normalmente promova polinização cruzada. Observou-se também que a abelha melífera (Apis mellifera L. forrageando na mamoneira pode tanto transferir pólen das flores estaminadas para as pistiladas do mesmo racemo, quanto aumentar consideravelmente a liberação de p

  9. Evaluation of Sebostatic Activity of Juniperus communis Fruit Oil and Pelargonium graveolens Oil Compared to Niacinamide

    Directory of Open Access Journals (Sweden)

    Justyna Kozlowska

    2017-09-01

    Full Text Available As a facial skin condition, oily skin causes cosmetic problems, such as large pores, shiny appearance, and the feeling of greasiness and heaviness. Furthermore, extensive sebum production leads to common skin disorders such as acne vulgaris or seborrheic dermatitis. This study investigated the efficacy of sebum control tonics containing Juniperus communis fruit oil, Pelargonium graveolens oil, or niacinamide. The effects of Juniperus communis fruit oil, Pelargonium graveolens oil, and niacinamide on sebum excretion rates were investigated using Sebumeter®. Sebum measurements (Sebumeter® SM 815, Courage & Khazaka®, Köln, Germany were made on the skin surface in three places by applying the sebumeter probe to the forehead after 10, 60, and 120 min from application of the tonic. The results indicated that the application of the tonic maintained a lower sebum secretion 10 min and 60 min after the application of the cosmetic, compared to those before it. However, a visible sebum-reducing efficacy after 2 h was reported only for tonic containing 0.25% Pelargonium graveolens oil and for the tonic with the addition of 3% niacinamide. After 2 h, the values of sebum measurements were 44 ± 5.13 a.u. and 58 ± 9.07 a.u., respectively. Our results show that the tonic with the addition of 0.25% Pelargonium graveolens oil is the most effective in reducing sebum production.

  10. Antimicrobial activities of the methanol extract and compounds from Artocarpus communis (Moraceae

    Directory of Open Access Journals (Sweden)

    Ngadjui Bonaventure T

    2011-05-01

    Full Text Available Abstract Background Artocarpus communis is used traditionally in Cameroon to treat several ailments, including infectious and associated diseases. This work was therefore designed to investigate the antimicrobial activities of the methanol extract (ACB and compounds isolated from the bark of this plant, namely peruvianursenyl acetate C (1, α-amyrenol or viminalol (2, artonin E (4 and 2-[(3,5-dihydroxy-(Z-4-(3-methylbut-1-enylphenyl]benzofuran-6-ol (5. Methods The liquid microdilution assay was used in the determination of the minimal inhibitory concentration (MIC and the minimal microbicidal concentration (MMC, against seven bacterial and one fungal species. Results The MIC results indicated that ACB as well as compounds 4 and 5 were able to prevent the growth of all tested microbial species. All other compounds showed selective activities. The lowest MIC value of 64 μg/ml for the crude extract was recorded on Staphylococcus aureus ATCC 25922 and Escherichia coli ATCC 8739. The corresponding value of 32 μg/ml was recorded with compounds 4 and 5 on Pseudomonas aeruginosa PA01 and compound 5 on E. coli ATCC 8739, their inhibition effect on P. aeruginosa PA01 being more than that of chloramphenicol used as reference antibiotic. Conclusion The overall results of this study provided supportive data for the use of A. communis as well as some of its constituents for the treatment of infections associated with the studied microorganisms.

  11. Antimicrobial activities of the methanol extract and compounds from Artocarpus communis (Moraceae).

    Science.gov (United States)

    Kuete, Victor; Ango, Patrick Y; Fotso, Ghislain W; Kapche, Gilbert D W F; Dzoyem, Jean P; Wouking, Arlette G; Ngadjui, Bonaventure T; Abegaz, Berhanu M

    2011-05-25

    Artocarpus communis is used traditionally in Cameroon to treat several ailments, including infectious and associated diseases. This work was therefore designed to investigate the antimicrobial activities of the methanol extract (ACB) and compounds isolated from the bark of this plant, namely peruvianursenyl acetate C (1), α-amyrenol or viminalol (2), artonin E (4) and 2-[(3,5-dihydroxy)-(Z)-4-(3-methylbut-1-enyl)phenyl]benzofuran-6-ol (5). The liquid microdilution assay was used in the determination of the minimal inhibitory concentration (MIC) and the minimal microbicidal concentration (MMC), against seven bacterial and one fungal species. The MIC results indicated that ACB as well as compounds 4 and 5 were able to prevent the growth of all tested microbial species. All other compounds showed selective activities. The lowest MIC value of 64 μg/ml for the crude extract was recorded on Staphylococcus aureus ATCC 25922 and Escherichia coli ATCC 8739. The corresponding value of 32 μg/ml was recorded with compounds 4 and 5 on Pseudomonas aeruginosa PA01 and compound 5 on E. coli ATCC 8739, their inhibition effect on P. aeruginosa PA01 being more than that of chloramphenicol used as reference antibiotic. The overall results of this study provided supportive data for the use of A. communis as well as some of its constituents for the treatment of infections associated with the studied microorganisms.

  12. Antioxidant properties and xanthine oxidase inhibitory effects of Tamus communis L. root extracts.

    Science.gov (United States)

    Boumerfeg, Sabah; Baghiani, Abderrahmane; Messaoudi, Dalila; Khennouf, Seddik; Arrar, Lekhmici

    2009-02-01

    This study was conducted to search for xanthine oxidase (XO) inhibitors from the root extracts of Tamus communis L. traditionally used in folk medicine in Algeria. Root extracts with different solvents were screened for purified milk xanthine oxidase inhibition. The root extracts (methanol, chloroform and ethyl acetate) and proteins, obtained in distilled water, inhibited bovine, sheep and human milk XO from three species in a concentration-dependent manner, with an additional superoxide scavenging capacity, which reached its highest level with ethyl acetate extract (IC(50) = 0.15, 0.04 and 0.09 g/L) for bovine XO, sheep XO and human XO, respectively. The antioxidant potential was confirmed with the non-enzymatic method, total radical-trapping antioxidant parameter (TRAP) assay, which showed that the Tamus communis L. extracts have a potential antioxidant activity in the same order obtained by using the reduction of cytochrome c, an enzymatic method, in which the antioxidant activity followed a decreasing order: ethyl acetate extract > chloroform extract > protein. Copyright (c) 2008 John Wiley & Sons, Ltd.

  13. Evaluation of Ricinus communis L. for the Phytoremediation of Polluted Soil with Organochlorine Pesticides

    Directory of Open Access Journals (Sweden)

    Sandra Regina Rissato

    2015-01-01

    Full Text Available Phytoremediation is an attractive alternative to conventional treatments of soil due to advantages such as low cost, large application areas, and the possibility of in situ treatment. This study presents the assessment of phytoremediation processes conducted under controlled experimental conditions to evaluate the ability of Ricinus communis L., tropical plant species, to promote the degradation of 15 persistent organic pollutants (POPs, in a 66-day period. The contaminants tested were hexachlorocyclohexane (HCH, DDT, heptachlor, aldrin, and others. Measurements made in rhizosphere soil indicate that the roots of the studied species reduce the concentration of pesticides. Results obtained during this study indicated that the higher the hydrophobicity of the organic compound and its molecular interaction with soil or root matrix the greater its tendency to concentrate in root tissues and the research showed the following trend: HCHs < diclofop-methyl < chlorpyrifos < methoxychlor < heptachlor epoxide < endrin < o,p′-DDE < heptachlor < dieldrin < aldrin < o,p′-DDT < p,p′-DDT by increasing order of log Kow values. The experimental results confirm the importance of vegetation in removing pollutants, obtaining remediation from 25% to 70%, and demonstrated that Ricinus communis L. can be used for the phytoremediation of such compounds.

  14. Development of an energy-protein for animal food based crop residues pear (Pyrus communis

    Directory of Open Access Journals (Sweden)

    Néstor Julián Pulido-Suárez,

    2016-01-01

    Full Text Available Pear (Pyrus communis is a fruit from the species of deciduous, widely consumed worldwide for its high quality energ y. However, pear itself does not provide the amount of protein required for cattle feeding, so alternatives to improve its nutritional quality have been studied. On these grounds, the objective of this study was to evaluate the parameters of solid state fermentation, and compositional energ y value of a protein food based on pears (Pyrus communis with apparent physical damage. A completely random design was used to evaluate three treatments; these correspond to percentages of inclusion of calcium carbonate (0.25, 0.50, 0.75 formulation based on already established (40 % pear, 25 % rice flour, 25 % wheat bran and 10 % urea, the parameters evaluated were: pH, ashes (CZ, crude protein (CP and crude fiber (CF, and they were recorded at 0, 24, 48 and 72 hours. As a result, it was found that the pH dropped gradually for each treatment and at each sampling period; however, there were no significant differences. The lower value at the end of the process is recorded T2 (0.25 with 4.66, followed by T3 (0.50 with 4.50, the ash reached values of up to 6 % with T3, and T2 (0.50 reached the highest percentages in fiber and crude protein. Finally, decreasing the fermentation variables ensures a food with no presence of undesirable microorganisms and stable over time.

  15. The phytoremediation potential of bioenergy crop Ricinus communis for DDTs and cadmium co-contaminated soil.

    Science.gov (United States)

    Huang, Huagang; Yu, Ning; Wang, Lijun; Gupta, D K; He, Zhenli; Wang, Kai; Zhu, Zhiqiang; Yan, Xingchu; Li, Tingqiang; Yang, Xiao-e

    2011-12-01

    Cadmium (Cd) and dichlorodiphenyltrichloroethane (DDT) or its metabolite residues are frequently detected in agricultural soils and food, posing a threat to human health. The objective of this study was to compare the ability of 23 genotypes of Ricinus communis in mobilizing and uptake of Cd and DDTs (p,p'-DDT, o,p'-DDT, p,p'-DDD and p,p'-DDE) in the co-contaminated soil. The plant genotypes varied largely in the uptake and accumulation of DDTs and Cd, with mean concentrations of 0.37, 0.43 and 70.51 for DDTs, and 1.22, 2.27 and 37.63 mg kg(-1) dw for Cd in leaf, stem and root, respectively. The total uptake of DDTs and Cd varied from 83.1 to 267.8 and 66.0 to 155.1 μg per pot, respectively. These results indicate that R. communis has great potential for removing DDTs and Cd from contaminated soils attributed to its fast growth, high biomass, strong absorption and accumulation for both DDTs and Cd. Copyright © 2011 Elsevier Ltd. All rights reserved.

  16. Apis mellifera pollination improves agronomic productivity of anemophilous castor bean (Ricinus communis).

    Science.gov (United States)

    Rizzardo, Rômulo A G; Milfont, Marcelo O; Silva, Eva M S da; Freitas, Breno M

    2012-12-01

    Castor bean (Ricinus communis L.) is cultivated mainly for biodiesel production because of its oil-rich seeds; it is assumed to be an anemophylous species. But pollination deficit can lead to low productivity often attributed to other reasons. In this paper, we investigated pollination requirements, pollination mechanism, occurrence of pollination deficit, and the role of biotic pollinators in a large commercial plantation of castor bean. Our results show that R. communis bears a mixed breeding system favoring selfing by geitonogamy, although the wind promotes mostly outcrossing. We also found that the honey bee (Apis mellifera L.) foraging on castor bean can both transfer pollen from male to female flowers within the same raceme and boost the release of airborne pollen by male flowers. Both situations increase geitonogamy rates, raising significantly fruit set and seed yield. This is the first report of an animal foraging activity increasing seed yield in an anemophilous and geitonogamous crop and elucidates the role of biotic pollinators in castor bean reproduction.

  17. In Vitro Assessment of Cytotoxicity, Antioxidant, and Anti-Inflammatory Activities of Ricinus communis (Euphorbiaceae Leaf Extracts

    Directory of Open Access Journals (Sweden)

    Vhutshilo Nemudzivhadi

    2014-01-01

    Full Text Available Ricinus communis has been utilized traditionally as medicine to treat inflammatory related diseases including wounds, sores, and boils. The leaves of R. communis were sequentially extracted with n-hexane, dichloromethane, acetone, and methanol using serial exhaustive extraction method. Antioxidant activity of all crude extracts was quantitatively measured against 2,2′-azino-bis (3-ethylbenzothiazoline-6-sulphonic acid free radical molecules using ABTS+ assay. Cytotoxic effect and anti-inflammatory activity of R. communis leaves extracts were evaluated on Human Caucasian skin fibroblast and Raw 264.7 macrophage cell lines, respectively. Methanol extract had the highest percentage free radical (ABTS+ scavenging activity of 95% at 2.50 mg/mL, acetone 91%, dichloromethane 62%, and hexane the least (50%. Percentage scavenging activity of ABTS+ free radical molecules increases with increase in concentrations of the plant extracts. Hexane and dichloromethane extracts had more than 90% cell viability at 100 µg/mL after 24 and 48 hours of exposure. Methanol extract had LC50 of 784 µg/mL after 24-hour exposure, hexane had 629.3 µg/mL and dichloromethane 573.6 µg/mL, and 544.6 µg/mL was the lowest with acetone extract. The study present the first report on the scavenging activity of R. communis leaf extracts against ABTS+ radicals and cytotoxic effects on human Caucasian skin fibroblast cell lines.

  18. Biochemical, physiological and molecular responses of Ricinus communis seeds and seedlings to different temperatures: a multi-omics approach

    NARCIS (Netherlands)

    Ribeiro de Jesus, P.R.

    2015-01-01

    Biochemical, physiological and molecular responses of Ricinus communis seeds and seedlings to different temperatures: a multi-omics approach by Paulo Roberto Ribeiro de Jesus The main objective of this thesis was to provide a detailed analysis of physiological,

  19. Antimicrobial activity of untenospongin B, a metabolic from the marine sponge Hippospongia communis collected from the Atlantic coast of Morocco

    NARCIS (Netherlands)

    Rifai, S.; Kijjoa, A.; van Soest, R.W.M.

    2004-01-01

    (-)-Untenospongin B isolated from the marine sponge Hippospongia communis has been tested for its antimicrobial activity against bacteria and human pathogenic fungi using agar disk method and was found to possess a broad and strong activity toward the test organisms. Its antifungal activity was

  20. Biochemical, physiological and molecular responses of Ricinus communis seeds and seedlings to different temperatures: a multi-omics approach

    NARCIS (Netherlands)

    Ribeiro de Jesus, P.R.

    2015-01-01

    Biochemical, physiological and molecular responses of Ricinus communis seeds and seedlings to different temperatures: a multi-omics approach

    by Paulo Roberto Ribeiro de Jesus

    The main objective of this thesis was to provide a detailed

  1. Isolation and characterization of polyphenol oxidase from Sardinian poisonous and non-poisonous chemotypes of Ferula communis (L.).

    Science.gov (United States)

    Zucca, Paolo; Sanjust, Enrico; Loi, Martina; Sollai, Francesca; Ballero, Mauro; Pintus, Manuela; Rescigno, Antonio

    2013-06-01

    Ferula communis (L.), a plant belonging to Apiaceae, is widely present in Sardinia, Italy. Currently, interest in F. communis focuses on the presence of two chemotypes in the wild. One chemotype is poisonous to animals, whereas the other chemotype is non-poisonous. Polyphenol oxidase (PPO) has been extracted and partially purified from the two chemotypes of F. communis. The biochemical characterization of the enzymes showed significant differences. In particular, while the two PPOs were not able to use 6- and 7-hydroxycoumarin as substrates, they showed distinct specificity for 6,7- and 7,8-dihydroxycoumarin. Significant differences in the enzyme behavior towards common PPO inhibitors were also observed. In addition, activation energy and activation energy for denaturation were determined, showing significant differences between FP-PPO and FNP-PPO, particularly for denaturation kinetics. The possible roles of the two PPOs in determining differences in composition and toxicity of the two F. communis chemotypes are also discussed. Copyright © 2013 Elsevier Ltd. All rights reserved.

  2. Effect of temperature on biomass allocation in seedlings of two contrasting genotypes of the oilseed crop Ricinus communis

    NARCIS (Netherlands)

    Ribeiro de Jesus, P.R.; Zanotti, R.F.; Deflers, C.; Fernandez, L.G.; Castro, De R.D.; Ligterink, W.; Hilhorst, H.W.M.

    2015-01-01

    Ricinus communis is becoming an important crop for oil production, and studying the physiological and biochemical aspects of seedling development may aid in the improvement of crop quality and yield. The objective of this study was to assess the effect of temperature on biomass allocation in two R.

  3. Component composition of essential oils and ultrastructure of secretory cells of resin channel needles Juniperus communis (Cupressaceae

    Directory of Open Access Journals (Sweden)

    N. V. Gerling

    2015-12-01

    Full Text Available The results of determining the qualitative and quantitative composition of essential oil Juniperus communis, growing under the canopy of spruce blueberry sphagnum subzone middle taiga. Juniperus communis essential oil is liquid light yellow color. The content of essential oil was 0.46 % in shoots with needles. 37 substances of components identified. Mass fraction of components in the essential oil of Juniperus communis reached 89 %. The highest percentage of occupied fraction of monoterpenes (82.3 %, the proportion of sesquiterpenes less than 0.5 % of the total composition of essential oils, alcohols 3.5 and 0.7 % esters. In monoterpenes fraction predominant α-pinene (24.5–32.6 %, β-pinene (15–20.3 % and α-phellandrene (6.4–8.8 %. Essential oil of Juniperus communis is characterized by high content of monoterpenoids in contrast to other conifers of the taiga zone. All stages of biosynthesis essential oils occur in the epithelial cells of the resin channel (terpenoidogennyh cells. An oval shape have epithelial cells of the resin channel needles in transverse sections the Juniperus communis, which is situated vacuole in the center. Large number of lipid globules (up to 40 noted in the hyaloplasm of explored cells. Leucoplasts surrounded by membranes of smooth endoplasmic reticulum in cross sections of epithelial cells in resin channel of juniper. Endoplasmic reticulum is poorly developed in epithelial cells, which corresponds to the low content of sesquiterpenes in the needles during the study period. Development of large leucoplasts and large number of mitochondria associated with predominance of synthesis monoterpenoids the in the epithelium cells resin channel.

  4. Expression of Ricinus communis receptors on epithelial cells in oral carcinomas and oral wounds.

    Science.gov (United States)

    Dabelsteen, E; Mackenzie, I C

    1978-12-01

    The histological distribution of receptors for Ricinus communis Fraction 1 (RCA1) in oral carcinomas and in oral epithelial cells during wound healing has been studied by use of fluorescein-tagged RCA1. Biopsies from 15 human oral carcinomas and adjacent normal mucosa showed RCA1 receptors at the cell membranes in the basal and spinous layer of the normal epithelium, whereas receptors could not be demonstrated in invading islands of the tumors. In healing oral wounds from eight humans and three monkeys, RCA1 receptors were demonstrated both in normal epithelium adjacent to the wounds and in the epithelial outgrowth from the wound margin. Titrations, however, showed that the epithelial outgrowth reacted more weakly than did the normal adjacent epithelium. These results support previous in vitro studies showing changes in carbohydrate composition of moving normal cells and of malignant cells, a finding that may be of interest in relation to formation of metastases.

  5. Karakteristik Cookies Berbahan Dasar Tepung Sukun (Artocarpus communis Bagi Anak Penderita Autis

    Directory of Open Access Journals (Sweden)

    Dede Sukandar

    2017-03-01

    Full Text Available Abstrak Tepung sukun (Artocarpus communis merupakan tepung yang bebas gluten sehingga baik digunakan sebagai alternatif dalam pembuatan cookies untuk anak penderita autis. Penelitian ini bertujuan mengetahui tingkat kesukaan panelis terhadap cookies sukun dan berbagai formulasinya dibandingkan dengan cookies berbahan dasar tepung lain yang meliputi pengaruh penambahan bahan tambahan terhadap sifat kimia, fisika, daya terima cookies sukun, kadar kalsium dan fosforus cookies sukun, dan mengetahui cookies sukun tersukai memenuhi standar mutu cookies menurut SNI 01-2973-1992 atau tidak. Uji organoleptik dilakukan untuk mengetahui tingkat kesukaan dan penerimaan panelis terhadap cookies sukun dibandingkan dengan cookies berbahan dasar tepung lain (terigu, beras, sagu dan cookies sukun dalam berbagai formulasi. Parameter yang digunakan meliputi warna, aroma, tekstur, rasa dan penerimaan keseluruhan. Uji kadar kalsium dilakukan menggunakan spektroskopi serapan atom pada λ 422.7 nm dan kadar fosforus menggunakan spektroskopi UV-Vis pada λ 880 nm. Data yang diperoleh dianalisis menggunakan analisis sidik ragam anova dan analisis Duncan. Cookies sukun memiliki penerimaan yang rendah dibandingkan cookies tepung lain berdasarkan penerimaan rasa dan penerimaan umum. Formulasi cookies sukun memperbaiki sifat fisik (aroma, rasa, warna, dan tekstur dan daya terima cookies sukun oleh panelis. Cookies sukun tersukai adalah formulasi 718 dengan bahan tambahan susu kedelai.  Mutu cookies sukun tersukai formulasi 718 sesuai dengan SNI 01-2973-1992 kecuali kadar protein yang masih rendah 8.05% dan terdapat kandungan tembaga dengan sebesar 1.56 ppm. Cookies sukun tersukai memiliki kadar kalsium dan fosforus tertinggi dibandingkan dengan tepung sukun dan cookies komersil untuk anak penderita autis sehingga cookies sukun tersukai sangat baik dikonsumsi oleh anak penderita autis. Kata kunci : Artocarpus communis, autis, cookies sukun, organoleptik, kalsium, fosforus

  6. A BATCH REACTOR CONSTRUCTION FOR OBTAINING BIODIESEL FROM OIL Ricinus communis

    Directory of Open Access Journals (Sweden)

    Yolimar Fernández

    2014-06-01

    Full Text Available A batch reactor was constructed to obtain biodiesel from 5 liters of extracted from the seed of Ricinus communis. The reactor is made of stainless steel, 29cm length, 15.24 cm of inner diameter and a conical base of 20cm long, wall thickness of 0.2 cm, 1000 W tubular resistance and 110 volt motor. It is extracted and compared with the respective norms the physical and chemical properties of crude oil. Preliminary tests catalyzed transesterification of the oil with NaOH to verify the feasibility of the reaction and define the performed operational conditions. Obtained biodiesel was characterized and compared with references. The results showed that it is possible to obtain the biofuel in the batch reactor with a conversion 88%, confirming its application in transesterification reactions in a basic medium.

  7. Variability of Polyphenol Compounds in Myrtus Communis L. (Myrtaceae Berries from Corsica

    Directory of Open Access Journals (Sweden)

    Nathalie Chiaramonti

    2010-11-01

    Full Text Available Polyphenol compounds were extracted from Myrtus communis L. berries (Myrtaceae by maceration in 70% ethanol and analysed by HPLC-DAD and electrospray mass spectrometry. The Myrtus berries were collected at maturity from seven localities on the island of Corsica (France and the sampling was carried out during three years. The polyphenol composition of Corsican Myrtus berries was characterized by two phenolic acids, four flavanols, three flavonols and five flavonol glycosides. The major compounds were myricetin-3-O-arabinoside and myricetin-3-O-galactoside. Principal components analysis (PCA is applied to study the chemical composition and variability of myrtle berries alcoholic extracts from the seven localities. Canonical analysis and PCA data distinguishes two groups of myrtle berries characterized by different concentrations of polyphenols according to soil and years of harvest. The variations in the polyphenol concentration were due to biotic and abiotic factors.

  8. Mersin (Myrtus communis L. Meyvesinin bazı Fiziksel ve Kimyasal Özellikleri

    Directory of Open Access Journals (Sweden)

    Musa Özcan

    2015-02-01

    Full Text Available İçel’den (Büyükeceli-Gülnar toplanan farklı büyüklük ve renklerdeki mersin (Myrtus communis L. meyvelerinin fiziksel ve kimyasal özellikleri belirlenmiştir. Mor meyvelerde antosiyanin tespit edilirken beyaz renklide bulunmamıştır. Mor meyvelerde tanen miktarı beyazlara göre oldukça yüksektir. Titrasyon asitliği mor meyvelerde aynı olup, beyaza göre yüksektir. Meyveler mineral bakımından zengindir ve en yüksek olarak potasyum belirlenmiştir.

  9. Mersin (Myrtus communis L.) Meyvesinin bazı Fiziksel ve Kimyasal Özellikleri

    OpenAIRE

    Özcan, Musa; Akbulut, Mehmet

    1998-01-01

    İçel’den (Büyükeceli-Gülnar) toplanan farklı büyüklük ve renklerdeki mersin (Myrtus communis L.) meyvelerinin fiziksel ve kimyasal özellikleri belirlenmiştir. Mor meyvelerde antosiyanin tespit edilirken beyaz renklide bulunmamıştır. Mor meyvelerde tanen miktarı beyazlara göre oldukça yüksektir. Titrasyon asitliği mor meyvelerde aynı olup, beyaza göre yüksektir. Meyveler mineral bakımından zengindir ve en yüksek olarak potasyum belirlenmiştir. 

  10. Green synthesis of silver nanoparticles by Ricinus communis var. carmencita leaf extract and its antibacterial study

    Science.gov (United States)

    Ojha, Sunita; Sett, Arghya; Bora, Utpal

    2017-09-01

    In this study, we report synthesis of silver nanoparticles (RcAgNPs) from silver nitrate solution using methanolic leaf extract of Ricinus communis var. carmencita. The polyphenols present in the leaves reduce Ag++ ions to Ag0 followed by a color change. Silver nanoparticle formation was ensured by surface plasmon resonance between 400 nm to 500 nm. Crystallinity of the synthesized nanoparticles was confirmed by UHRTEM, SAED and XRD analysis. The capping of phytochemicals and thermal stability of RcAgNPs were assessed by FTIR spectra and TGA analysis, respectively. It also showed antibacterial activity against both gram positive and gram negative strains. RcAgNPs were non-toxic against normal cell line (mouse fibroblast cell line L929) at lower concentrations (80 µg ml-1).

  11. Forensic Applications of Light-Element Stable Isotope Ratios of Ricinus communis Seeds and Ricin Preparations

    Energy Technology Data Exchange (ETDEWEB)

    Kreuzer, Helen W.; West, Jason B.; Ehleringer, James

    2013-01-01

    Seeds of the castor plant Ricinus communis, also known as castor beans, are of forensic interest because they are the source of the poison ricin. We have tested whether stable isotope ratios of castor seeds and ricin prepared by various methods can be used as a forensic signature. We collected over 300 castor seed samples from locations around the world and measured the C, N, O, and H stable isotope ratios of the whole seeds, oil, and three types of ricin preparations. Our results demonstrate that N isotope ratios can be used to correlate ricin prepared by any of these methods to source seeds. Further, stable isotope ratios distinguished >99% of crude and purified ricin protein samples in pair-wise comparison tests. Stable isotope ratios therefore constitute a valuable forensic signature for ricin preparations.

  12. Isotope labeling-based quantitative proteomics of developing seeds of castor oil seed (Ricinus communis L.)

    DEFF Research Database (Denmark)

    Nogueira, Fábio C S; Palmisano, Giuseppe; Schwämmle, Veit

    2013-01-01

    In this study, we used a mass spectrometry-based quantification approach employing isotopic (ICPL) and isobaric (iTRAQ) labeling to investigate the pattern of protein deposition during castor oil seed (Ricinus communis L.) development, including that of proteins involved in fatty acid metabolism...... give important insights into certain aspects of the biology of castor oil seed development such as carbon flow, anabolism, and catabolism of fatty acid and the pattern of deposition of SSPs, toxins, and allergens such as ricin and 2S albumins. We also found, for the first time, some genes of SSP...... could be mapped to extant castor gene models, considerably expanding the number of proteins so far identified from developing castor seeds. Cluster validation and statistical analysis resulted in 975 protein trend patterns and the relative abundance of 618 proteins. The results presented in this work...

  13. Sodium Copper Chlorophyllin Immobilization onto Hippospongia communis Marine Demosponge Skeleton and Its Antibacterial Activity

    Directory of Open Access Journals (Sweden)

    Małgorzata Norman

    2016-09-01

    Full Text Available In this study, Hippospongia communis marine demosponge skeleton was used as an adsorbent for sodium copper chlorophyllin (SCC. Obtained results indicate the high sorption capacity of this biomaterial with respect to SCC. Batch experiments were performed under different conditions and kinetic and isotherms properties were investigated. Acidic pH and the addition of sodium chloride increased SCC adsorption. The experimental data were well described by a pseudo-second order kinetic model. Equilibrium adsorption isotherms were determined and the experimental data were analyzed using both Langmuir and Freundlich isotherms. The effectiveness of the process was confirmed by 13C Cross Polarization Magic Angle Spinning Nuclear Magnetic Resonance (13C CP/MAS NMR, Fourier transform infrared spectroscopy (FTIR, energy-dispersive X-ray spectroscopy (EDS and thermogravimetric analysis (TG. This novel SCC-sponge-based functional hybrid material was found to exhibit antimicrobial activity against the gram-positive bacterium Staphylococcus aureus.

  14. Single nucleotide polymorphisms for assessing genetic diversity in castor bean (Ricinus communis

    Directory of Open Access Journals (Sweden)

    Rabinowicz Pablo D

    2010-01-01

    Full Text Available Abstract Background Castor bean (Ricinus communis is an agricultural crop and garden ornamental that is widely cultivated and has been introduced worldwide. Understanding population structure and the distribution of castor bean cultivars has been challenging because of limited genetic variability. We analyzed the population genetics of R. communis in a worldwide collection of plants from germplasm and from naturalized populations in Florida, U.S. To assess genetic diversity we conducted survey sequencing of the genomes of seven diverse cultivars and compared the data to a reference genome assembly of a widespread cultivar (Hale. We determined the population genetic structure of 676 samples using single nucleotide polymorphisms (SNPs at 48 loci. Results Bayesian clustering indicated five main groups worldwide and a repeated pattern of mixed genotypes in most countries. High levels of population differentiation occurred between most populations but this structure was not geographically based. Most molecular variance occurred within populations (74% followed by 22% among populations, and 4% among continents. Samples from naturalized populations in Florida indicated significant population structuring consistent with local demes. There was significant population differentiation for 56 of 78 comparisons in Florida (pairwise population ϕPT values, p Conclusion Low levels of genetic diversity and mixing of genotypes have led to minimal geographic structuring of castor bean populations worldwide. Relatively few lineages occur and these are widely distributed. Our approach of determining population genetic structure using SNPs from genome-wide comparisons constitutes a framework for high-throughput analyses of genetic diversity in plants, particularly in species with limited genetic diversity.

  15. Investigation of antibacterial activities of Albizia gummifera and Ferula communis on Streptococcus pneumoniae and Streptoccus pyogenes.

    Science.gov (United States)

    Unasho, Abayneh; Geyid, Aberra; Melaku, Abebe; Debela, Asfaw; Mekasha, Amha; Girma, Samson; Kebede, Tesfaye; Fantaw, Surafael; Asaminew, Nega; Mamo, Kidanemariam

    2009-01-01

    Respiratory Tract infections continue to be a major cause of morbidity and mortality world wide. There is a failure to treat respiratory infections due to the emergence of antibiotic resistant strains among the most common respiratory pathogens. To evaluate the in vitro antibacterial activities of two traditionally used plants: Albizia gummifera (Ambabesa-Muka, Oromifa, Sessa-Amharic.) and Ferula communis (Doge-Oromifa, Dog-Amharic) against clinical isolates of S. pyogenes and S. pneumoniae. The study involving the antibacterial susceptibility test of traditionally used plant species against Gram-positive bacterial pathogens was conducted over a period of 5 months (January - August, 2004) at the Ethiopian Health, and Nutrition Research Institute. The in vitro antibacterial activities of 80% methanol crude extracts prepared from the seeds of Ablizia gummifera and, roots of Ferula communis as well as their respective hydro alcoholic solvent fractionates of both plant species were tested for inhibitory activity against the clinical isolates of six S. pneumonae and twenty two S. pyogenes using agar dilution method. Eighty percent ethanol solubilized fractions of both plants were found to have antibacterial effects to all assayed bacteria while aqueous solubilized fractions did not exhibit any effect. Minimum inhibitory concentration (MIC) of the 80% ethanol solubilized fractions was determined and the MIC of the fractions ranged from 500 mg/ ml to 1000 mg/ml for both plants showing the extracts may contain bioactive compounds of therapeutic interest. All extracts showed antibacterial activities against clinical isolates of S. pyogenes and S. pneumoniae. The extracts may contain compounds with potential therapeutic activity. Further purification and identification are needed to be tested using animal models.

  16. Myrtus communis essential oil: chemical composition and antimicrobial activities against food spoilage pathogens.

    Science.gov (United States)

    Ben Hsouna, Anis; Hamdi, Naceur; Miladi, Ramzi; Abdelkafi, Slim

    2014-04-01

    Myrtus communis is a typical plant of the Mediterranean area, which is mainly used as animal and human food and, in folk medicine, for treating some disorders. In the present study, we evaluated in vitro antibacterial and antifungal properties of the essential oils of Myrtus communis (McEO), as well as its phytochemical composition. The GC/MS analysis of the essential oil revealed 17 compounds. Myrtenyl acetate (20.75%), 1,8-cineol (16.55%), α-pinene (15.59%), linalool (13.30%), limonene (8.94%), linalyl acetate (3.67%), geranyl acetate (2.99%), and α-terpineol (2.88%) were the major components. The antimicrobial activity of the essential oil was also investigated on several microorganisms. The inhibition zones and minimal inhibitory concentration (MIC) values of bacterial strains were in the range of 16-28 mm and 0.078-2.5 mg/ml, respectively. The inhibitory activity of the McEO against Gram-positive bacteria was significantly higher than against Gram-negative. It also exhibited remarkable activity against several fungal strains. The investigation of the mode of action of the McEO by the time-kill curve against Listeria monocytogenes (food isolate) showed a drastic bactericidal effect after 5 min using a concentration of 312 μg/ml. These results evidence that the McEO possesses antimicrobial properties, and it is, therefore, a potential source for active ingredients for food and pharmaceutical industries. Copyright © 2014 Verlag Helvetica Chimica Acta AG, Zürich.

  17. Energy flow in castor bean (Ricinus communis L. production systems Fluxos de energia em sistemas de produção de mamona (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Adilson Nunes da Silva

    2010-12-01

    Full Text Available Although energy analysis is a way to evaluate the sustainability of production systems, this practice is not often used in the agribusiness. In this context, the castor bean (Ricinus communis L is an agricultural crop not yet well studied despite its great potential in the Brazilian energetic scenario. This article aimed to evaluate the productive potential of the castor bean oil, using an energetic view applied to two management systems: low (System 1 and medium (System 2 technologies. The quantification of the used material fluxes was made converting these factors in energy units. The input energy fluxes were 3,170.6 MJ ha¹ and 10,366.0 MJ ha¹ for Systems 1 and 2, respectively. The energy balance of System 1 was 11,938.2 MJ ha¹ and that of System 2 16,296.5 MJ ha¹. The net energetic gain or the energy gain over the invested energy (EROI of System 1 was 3.8 and of System 2, 2.6. Although presenting a greater energy demand and a lower EROI, System 2 had a greater energy balance, demonstrating a better viability of this cultivation system for the production of castor bean oil.A análise energética é uma forma de se avaliar a sustentabilidade de um sistema produtivo, apesar de ainda pouco utilizada no setor agropecuário. Inserida neste setor encontra-se a produção da mamoneira (Ricinus communis L., cultura ainda pouco estudada e que apresenta grande importância para o agronegócio brasileiro. Avaliou-se sob a ótica energética a produção potencial de óleo de mamona em dois sistemas de cultivo: com baixa (Sistema 1 e média (Sistema 2 tecnologias. Foi realizada a quantificação dos fluxos de materiais empregados nos dois sistemas de produção e conversão destes fatores em unidades de energia. Os fluxos de energia de entrada foram de 3.170,6 MJ ha¹ e 10.366 MJ ha¹ para os sistemas 1 e 2, respectivamente. O balanço de energia foi de 11.938,2 MJ ha¹ no sistema 1 e 16.296,5 MJ ha¹ no sistema 2. A lucratividade energética, retorno

  18. [Inhibition by cysteine of the carbohydrate-binding activity of lectins from Ricinus communis, Canavalia ensiformis and Euonymus europaeus].

    Science.gov (United States)

    Dvorkin, V M

    1985-10-01

    Precipitation induced by different lectins has been studied in the presence of some aminoacids. It was shown that precipitates formed by lectins from Ricinus communis (RCA1), Canavalia ensiformis (Con A), Euonymus europaeus (Eel) in the presence of appropriate carbohydrate-containing molecules disappeared after cysteine addition, like after addition of specific carbohydrate precipitation inhibitors. It is assumed that cysteine residues of RCA1, Con A and Eel lectins are essential for their carbohydrate binding activity.

  19. In vitro effect of Aloe vera, Coriandrum sativum and Ricinus communis fractions on Leishmania infantum and on murine monocytic cells.

    Science.gov (United States)

    Rondon, Fernanda C M; Bevilaqua, Claudia M L; Accioly, Marina P; Morais, Selene M; Andrade-Junior, Heitor F; Machado, Lyeghyna K A; Cardoso, Roselaine P A; Almeida, Camila A; Queiroz-Junior, Eudson M; Rodrigues, Ana Caroline M

    2011-06-10

    In South America, visceral leishmaniasis is a zoonosis caused by the protozoan species Leishmania infantum (syn. L. chagasi) and is primarily transmitted through the bite of the female Lutzomyia longipalpis. Its main reservoir in urban areas is the dog. The application of control measures recommended by health agencies have not achieved significant results in reducing the incidence of human cases, and the lack of effective drugs to treat dogs resulted in the prohibition of this course of action in Brazil. Therefore, it is necessary to search new alternatives for the treatment of canine and human visceral leishmaniasis. The objectives of this study were to evaluate the in vitro effect of fractions from Aloe vera (aloe), Coriandrum sativum (coriander), and Ricinus communis (castor) on promastigotes and amastigotes of L. infantum and to analyze the toxicity against the murine monocytic cells RAW 264.7. To determine the viability of these substances on 50% parasites (IC50), we used a tetrazolium dye (MTT) colorimetric assay (bromide 3-4.5-dimethylthiazol-2-yl-2,5-dephenyltetrazolium), and on amastigotes we performed an in situ ELISA. All fractions were effective against L. infantum promastigotes and did not differ from the positive control pentamidine (p>0.05). However, the R. communis ethyl acetate and chloroform fractions, as well as the C. sativum methanol fraction, were the most effective against amastigotes and did not differ from the positive control amphotericin B (p>0.05). The R. communis ethyl acetate fraction was the least toxic, presenting 83.5% viability of RAW 264.7 cells, which was similar to the results obtained with amphotericin B (p>0.05). Based on these results, we intend to undertake in vivo studies with R. communis ethyl acetate fractions due the high effectiveness against amastigotes and promastigotes of L. infantum and the low cytotoxicity towards murine monocytic cells. Copyright © 2011 Elsevier B.V. All rights reserved.

  20. Study of the Antibacterial Activity of Methanolic and Aqueous Extracts of Myrtus communis on Pathogenic Strains Causing Infection

    Directory of Open Access Journals (Sweden)

    Behrooz Alizadeh Behbahani

    2016-02-01

    Full Text Available Background Medicine plants have been used as sources of medicine in virtually all cultures. During the last decade, the use of traditional medicine (TM has been expanded globally and is gaining popularity. Objectives The antimicrobial activities of methanol and water extracts of Myrtus communis L. leaves were evaluated in this study. Materials and Methods In this experimental study, the tests were carried out using disk agar diffusion method at four extract concentrations (5, 10, 15 and 20 mg/mL. The MICs and MBCs of the extracts of M. communis were determined by agar dilution method. Average results were reported as the mean and standard error (mean ± SE and SPSS-18 statistical software, oneway ANOVA followed by Turkey’s test were used to do inter-group comparison, while considering P ≤ 0.05 as the significance level. Results Methanol extract of M. communis exhibited significant antibacterial activity in the concentration of 20 mg/mL (P ≤ 0.05 against Staphylococcus epidermidis and Enterococcus faecalis with a greater inhibition zone of 20 mm, while a 14 mm zone of inhibition was observed in Escherichia coli and Shigella flexneri. The minimum inhibitory concentration (MIC of the extracts ranged between 2 mg/mL and 128 mg/mL while the minimum bactericidal concentration (MBC ranged between 4 mg/mL and 256 mg/mL. Conclusions The study showed that species, strains and concentrations of M. communis extract are of those factors that may influence the sensitivity of the tested bacteria. A significant correlation was observed between zone of inhibition and concentration of extract.

  1. CAPILLARY ELECTROPHORETIC ANALYSIS OF LOW-MOLECULAR-MASS OF CA SPECIES IN PHLOEM SAP OF Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Noor Fitri

    2010-06-01

    Full Text Available A capillary electrophoretic (CE analysis with ultra-violet (UV detection was performed for further separation of low-molecular-mass (LMM calcium species in phloem sap of Ricinus communis L. Two different background electrolytes (BGE were used for the separation; these are (1 hydrogen phosphate/dihydrogen phosphate buffer containing cetyltrimethylammonium bromide (CTAB as an electro-osmotic flow (EOF modifier, and (2 boric acid buffer containing CTAB. Various parameters affecting the analysis, including the composition and pH of the BGE were systematically studied. The sensitivity, resolution, baseline noise, migration time of the species peaks, and reproducibility of the method were evaluated under optimised condition. At least 13 UV-active species were optimally separated within about ten minutes. The optimised measurement condition was also achieved using 10 mM hydrogen phosphate/10 mM dihydrogen phosphate containing 0.5 mM CTAB at pH 8.0 as BGE, and by applying voltage of ‑20 kV and temperature of 14°C. Evidently, the analytical method was successfully used for the separation of LMM calcium species in phloem sap of R. communis L.   Keywords: capillary electrophoresis, calcium species, phloem sap, Ricinus communis

  2. Hasil Biji dan Kadar Minyak Jarak Kepyar Lokal Beaq Amor (Ricinus communis L. pada Berbagai Umur Pemangkasan Batang Utama

    Directory of Open Access Journals (Sweden)

    Bambang Budi Santoso

    2015-03-01

    Full Text Available ABSTRACTSuccessful castor (Ricinus communis L. cropping depends on the reliability of production technique. Branching is a useful agronomic trait because infloresence developed at each branch’s terminal. Pruning is considered as an important technique for branching stimulation. This study attempted to elucidate the effect of main stem pruning on the yield of Beaq Amor local variety of castor (Ricinus communis L. with short cultivation system. The experiment was conducted on dry land area of Amor-Amor, North Lombok, West Nusa Tenggara during February-July 2011 and was arranged in a single-factor randomized complete block design with three replications. The treatments were four types of pruning (i.e. no pruning, main stem pruning at 30 days after planting, 45 days after planting, and 60 days after planting. The results showed that the effect of pruning was significant on dry seed yield and was not significant on kernel oil content. Pruning at 30 days old and 45 days old plant yielded in the highest dry seed weight (374.9-387.8 g tree-1 or 943.0-974.3 kg ha-1 with oil content of 62.2%.Keywords: branching, canopy, dry seed, Ricinus communis L.

  3. Repellent activity of Cnidoscolus phyllacanthus Mart. and Ricinus communis L. extracts against Aedes aegypti L. oviposition behavior

    Directory of Open Access Journals (Sweden)

    Lafayette Pereira Candido

    2015-12-01

    Full Text Available Female Aedes aegypti lay their eggs on nearly any moist substrate. Methods with potential to repel oviposition may reduce infestation, thereby contributing to control of epidemics. We evaluated the influence of Cnidoscolus phyllacanthus and Ricinus communis plant extracts on the oviposition behavior of A. aegypti. Lethal concentrations were first determined in experiments with larvae after 24 h of exposure, after which LC50 and LC90 were used to test oviposition repellency. The experiment consisted of an oviposition preference test based multiple-choice and no-choice assays. The Oviposition Activity Indices (OAIs from the multiple-choice test using both R. communis and C. phyllacanthus were negative, suggesting oviposition repellent and deterrent activity. The LC90 of both plant extracts deterred oviposition by this vector, as demonstrated by an OAI = value of -1. In the choice study, mean oviposition values were significantly different between R. communis and C. phyllacanthus. In the absence of choice, mosquitoes laid eggs independent of the substrate. In conclusion, our OAI values indicate that all substrates used repelled oviposition by A. aegypti.

  4. Chemical composition and in vitro activity of plant extracts from Ferula communis and Dittrichia viscosa against postharvest fungi.

    Science.gov (United States)

    Mamoci, Erjon; Cavoski, Ivana; Simeone, Vito; Mondelli, Donato; Al-Bitar, Lina; Caboni, Pierluigi

    2011-03-22

    F. communis and D. viscosa are perennial Mediterranean weeds that have been used for different therapeutic purposes in traditional pharmacopeia. Plant extracts were obtained from air dried D. viscosa young shoots (DvA) and F. communis aerial part (FcA) and roots (FcR) with n-hexane. The chemical compositions of the extracts were analyzed by HPLC-DAD, LC-MS (ESI) and LC-Q-TOF techniques. Two sesquiterpene lactones (inuviscolide, tomentosin) and three sesquiterpene acids (costic acid, hydroxycostic acid, ilicic acid) were identified from the D. viscosa extract, while in F. communis extracts three daucane sesquiterpenes (acetoxyferutinin, oxojaeskeanadioyl anisate, fertidin) and one coumarin (ferulenol) derivates were found. Biological activities of plant extracts were studied in in vitro experiments on the colonies and conidia of Botryotinia fuckeliana, Penicillium digitatum, P. expansum, Monilinia laxa, M. fructigena and Aspergillus spp. Extracts showed varying degree of antifungal activities on colony growth and conidia germination. The extract from FcA showed the least effect, while DvA extract had the strongest fungitoxic effects. FcR extract presented a fungitoxic effect on the colony growth, but it was not able to inhibit the conidia germination. These distinctions can be attributed to the differences in chemical composition of plant extracts.

  5. Chemical Composition and In Vitro Activity of Plant Extracts from Ferula communis and Dittrichia viscosa against Postharvest Fungi

    Directory of Open Access Journals (Sweden)

    Donato Mondelli

    2011-03-01

    Full Text Available F. communis and D. viscosa are perennial Mediterranean weeds that have been used for different therapeutic purposes in traditional pharmacopeia. Plant extracts were obtained from air dried D. viscosa young shoots (DvA and F. communis aerial part (FcA and roots (FcR with n-hexane. The chemical compositions of the extracts were analyzed by HPLC-DAD, LC-MS (ESI and LC-Q-TOF techniques. Two sesquiterpene lactones (inuviscolide, tomentosin and three sesquiterpene acids (costic acid, hydroxycostic acid, ilicic acid were identified from the D. viscosa extract, while in F. communis extracts three daucane sesquiterpenes (acetoxyferutinin, oxojaeskeanadioyl anisate, fertidin and one coumarin (ferulenol derivates were found. Biological activities of plant extracts were studied in in vitro experiments on the colonies and conidia of Botryotinia fuckeliana, Penicillium digitatum, P. expansum, Monilinia laxa, M. fructigena and Aspergillus spp. Extracts showed varying degree of antifungal activities on colony growth and conidia germination. The extract from FcA showed the least effect, while DvA extract had the strongest fungitoxic effects. FcR extract presented a fungitoxic effect on the colony growth, but it was not able to inhibit the conidia germination. These distinctions can be attributed to the differences in chemical composition of plant extracts.

  6. Myrtus communis L. as source of a bioactive and safe essential oil.

    Science.gov (United States)

    Bouzabata, Amel; Cabral, Célia; Gonçalves, Maria José; Cruz, Maria Teresa; Bighelli, Ange; Cavaleiro, Carlos; Casanova, Joseph; Tomi, Félix; Salgueiro, Ligia

    2015-01-01

    In Algeria, Myrtus communis L. is distributed throughout the Tell Atlas and the coastal regions of Algiers and Constantine. The leaves are used in respiratory disorders, diarrhea and hemorrhoids. The aims of this work were to evaluate the antifungal and anti-inflammatory potential of well characterized essential oils (EO). Since EO can be applied by inhalation, dermal application and oral administration, we used several mammalian cell lines to assess safe bioactive doses. The chemical composition of two samples was investigated by GC-FID, GC-MS and (13)C NMR spectroscopy. Monoterpene derivatives are the main compounds: α-pinene (50.8 and 33.6%), 1,8-cineole (21.9 and 13.3%), linalool (2.7 and 14.8%), and linalyl acetate (0.5 and 9.5%). The antifungal evaluation revealed that the oils were more active against Cryptococcus neoformans (yeast) and Epidermophyton floccosum, Microsporum canis, Trichophyton rubrum (dermatophytes). The anti-inflammatory potential was evaluated using an in vitro model of lipopolysaccharide (LPS)-stimulated macrophages. Assessment of cell viability was made through the MTT assay. Both oils were able to significantly inhibit NO production, without affecting cell viability, in concentrations up to 0.64 mg/mL. These promising results, disclose bioactive concentrations of Myrtle essential oils with a safety profile suggesting a potential oral and topical application or use by inhalation. Copyright © 2014 Elsevier Ltd. All rights reserved.

  7. Eficiencia del extracto de Ricinus communis para el control del mosquito Culex

    Directory of Open Access Journals (Sweden)

    Diego Tomás Corradine Mora

    2014-05-01

    Full Text Available Este artículo evaluó el efecto insecticida del extracto de Ricinus communis sobre larvas de mosquitos Culex. A las 24 h la mortalidad es de 8.33 % con dosis de 1 mL del extracto en una concentración de 500 ppm; 35 % en dosis de 1 mL de una concentración de 1000 ppm; 65 % en dosis de 5 mL de una concentración de 1000 ppm; 98.33 % con 10 mL en concentración de 1000 ppm; testigos 3.3 %. Cuando se evaluó el efecto insecticida del extracto aplicado por aspersión en concentraciones de 500, 750 y 1000 ppm, se consiguieron mortalidades de 18.33, 36.66 y 48.32 %, respectivamente. Ninguna de las concentraciones evaluadas alcanzó el cien por ciento de letalidad. En la prueba de semicampo, solo se logró una mortalidad de 9 %. Se evidenció que el extracto tiene un mejor efecto insecticida para el control de ejemplares inmaduros en estado larvario que sobre los adultos.

  8. Perineal hernia repair using an autologous tunica vaginalis communis in nine intact male dogs.

    Science.gov (United States)

    Pratummintra, Kittiya; Chuthatep, Suwicha; Banlunara, Wijit; Kalpravidh, Marissak

    2013-01-01

    Perineal hernia in dogs is very problematic and mostly requires surgical reconstruction of the weak pelvic diaphragm. Tissue or synthetic grafts have been used for the correction after failure of the conventional herniorrhaphy. Aim of this clinical trial was to assess the possible use of the autologous tunica vaginalis communis as a free graft for perineal hernia repair in intact male dogs. Seven unilateral and 2 bilateral perineal hernias in nine intact male dogs free from testicular and scrotal neoplasms were included in this study. The median surgical time for unilateral herniorrhaphy was 75 min. The median follow-up time was 13 months. The success of the autografting, based on no recurrence and comfort of the animals during urination and defecation, was found in ten of 11 hernias; giving a success rate of 90.91%. One hernia (9.09%) recurred 10 days after surgery. Histopathological examination of the apposing area between the graft and the adjacent tissue, taken during the repair of the recurred case at day 20, revealed neovascularization and connective tissue ingrowth. In conclusion, the tunica vaginalis autograft can be used for perineal herniorrhaphy in intact male dogs.

  9. Apomixis and the problem of obtaining haploids and homozygote diploids in pear (Pyrus communis L.

    Directory of Open Access Journals (Sweden)

    Є. О. Долматов

    2013-02-01

    Full Text Available The article highlights results of research over simulative apomixes in pear and its utilization for obtaining haploids and homozygote diploids. It has been established that over 50% pear varieties with failed remote hybridization are capable of generating seeds of apomictic origin producing diploid plants. Genotypes displaying maximal inclination to apomixes have been singled out. Apomictic pear seedlings obtained from foreign pollination within the limits of the same combination are inherent in profound morphological diversity. Fruit-bearing apomicts originated from one and the same maternal plant differ to the same extent as hybrid seedlings of the same family. Genetic markers have enabled to establish that these are embryo sacs in which meiosis has completed that give rise to apomictic seeds. In vitro method as used for the purpose of increasing apomictic plants output has been illustrated. The greatest induction of apomictic shoots in vitro has been reached by alternation of BAP cytokinin at concentration of 1mg/l and 2 mg/l on the background of GA3 amounting to 1,5 mg/l. Grafting with shoots in vitro on non-sterile rootstocks of pear (Pyrus communis has increased the output of plants up to 80%. A cytological assessment of 9 apomictic samples is provided. The cytological analysis of samples of apomictic forms has certified the presence of simulative haploid parthenogenesis in pear.

  10. Composition of Myrtus communis L. Essential Oils as Affected by Climatic Conditions

    Directory of Open Access Journals (Sweden)

    Paula Pereira

    2016-12-01

    Full Text Available Myrtus Communis L. (Myrtaceae family, commonly known as myrtle, possesses a set of qualities that make it very interesting for the pharmaceutical, nutraceutical and cosmetic industries. In this work, myrtle was studied over a period of three years (2006-2008, encompassing the main stages of the development cycle of the plant. The influence of climatic conditions, such as temperature and rainfall, on the chemical composition and yield of the essential oils obtained from leaves and berries was studied. The leaves and berries essential oils were obtained by Clevenger distillation and analysed by GC and GC-MS. The results show that the major components were limonene+1,8-cineole, myrtenyl acetate, α-pinene and linalool. Over the three year period of study, a decrease in the composition of the most volatile compounds (α-pinene and limonene+1,8-cineole was observed, the reverse being found for linalool and myrtenyl acetate. The highest value for the yield of the leaves’ essential oils was observed in the third year (0.64%, w/w, whereas that same year the lowest yield (0.07%, w/w of fruit was observed. These results were likely due to an atypically high record for rainfall in April and May of that year. The highest value of the berry essential oils (0.14%, w/w was obtained in the second year.

  11. Essential Oil of Myrtus communis L. as a Potential Antioxidant and Antimutagenic Agents

    Directory of Open Access Journals (Sweden)

    Neda Mimica-Dukić

    2010-04-01

    Full Text Available The present study describes DPPH (2,2-diphenyl-1-picrylhydrazyl radical scavenging activity and antimutagenic properties of the essential oil of myrtle (Myrtus communis L.. Plant samples were collected from the two distant localities (southernmost and northern point of the Montenegro coastline. Chemical profiles of the two samples were evaluated by GC-MS. In both of the samples monoterpenes were found to be the predominant compounds. Among them a-pinene, linalool, 1,8-cineole, and myrtenyl acetate were the major compounds. Significant differences between the samples were found in the ranges of a-pinene (14.7%–35.9% and myrtenyl acetate (5.4%–21.6%. Both oils exhibited moderate DPPH scavenging activity, with IC50 values of 6.24 mg/mL and 5.99 mg/mL. The antimutagenic properties were assayed against spontaneous and t-BOOH-induced mutagenesis in Escherichia coli oxyR mutant IC202, a bacterial strain deficient in removing ROS. Reduction of the spontaneous mutagenesis in presence of myrtle EO was only slight, up to 13% at the highest concentration tested. When the oxidative mutagen was used, EO expressed higher reduction of mutagenesis, in a concentration dependent manner, with statistical significance for effect at the highest concentration tested (28%. Suppression of t-BOOH induced mutagenesis was correlated with the observed scavenging activity.

  12. Antibacterial activity of ethanolic extract of Myrtus communis. L leaves against salivary Mutans streptococci

    International Nuclear Information System (INIS)

    AlAnbori, Dalia K.A; AlNimer, Marwan S.M; AlWeheb, Athraa M

    2008-01-01

    The aim of this study was to evaluate the efficacy of ethanolic extract of Myrtus communis (myrtle) leaves in the selective reduction of Mutans streptococci count in saliva compared to chlorhexidine through in vitro and in vivo experiments. Ethanolic extract (2%) was prepared and screened by UV-visible spectrophotometer to detect peaks of active compounds. The minimum inhibitory concentrations (MICs) of myrtle extract as well as chlorhexidine (0.12%) were determined against Mutans streptococci isolated from human saliva and identified bacteriologically in vivo experiments, the effect of single mouth rinse of myrtle extract or chlorhexidine was investigated against the number of colony forming unit (CFU) of Mutans streptococci for two hours after rinse. The results showed the presence of one large peak at λ266.5 nm and a small one at λ672 of the extract in UV-visible spectra suggesting the presence of flavanoid. The MIC of myrtle was 106.6 μg/mL compared with 3.3 μg/mL of chlorhexidine. Single mouth rinse of myrtle extract significantly reduced the number of CFU of salivary Mutans streptococci but its effect was significantly less than that of chlorhexidine. It was concluded that the antibacterial effect of myrtle on Mutans streptococci was due to its flavanoid content. Therefore, ethanolic extract of myrtle could be a potential remedy for the prevention of colonization by Mutans streptococci thereby preventing or retarding development of dental caries. (author)

  13. Effects of GA3 applications on seedlesness and fruit quality in black myrtle (Myrtus communis L.

    Directory of Open Access Journals (Sweden)

    Esra Alım

    2017-12-01

    Full Text Available Myrtle (Myrtus communis L. is one of the medical and aromatic plants naturally grown in Mediterranean basin. Myrtle fruits are mostly consumed as fresh or dried while essential oils obtained from the leaves are widely used in pharmacy, perfumery, cosmetic and even as pesticide. Myrtle fruits have white and black color. Nowadays, there is a big demand for myrtle fruits because of its high antioxidant capacity. But it contains high amount of seeds which reduce marketing and production. Main objective of this study is to investigate the effects of GA3 on seedlesness and quality in black myrtle fruits. At different flowering stages, GA3 dose of 100 ppm were applied to whole of the plants. Some applications significantly reduced seed number in fruits. Two applications of GA3 at great ballon and full bloom stages consecutively decreased seed number from 10.69 (control to 1.98 seed fruit-1 . In addition, with three consecutive application of GA3, seed rate decreased to 4.98% while 15.08% in control. Some GA3 applications resulted in fully seedless fruits up to 10.67%. Conversely, GA3 applications did not change fruit weight and some biochemical parameters of fruits.

  14. Variation in Myrtus communis L. Essential Oil Composition and its Antibacterial Activities Components

    International Nuclear Information System (INIS)

    Al-Mairiri, A.; Swied, G.; Hallab, L. A.; Oda, A.

    2016-01-01

    The Myrtus communis L. leaves samples were collected from five locations of its native grown areas in Lattakia, Syria, during their blooming seasons (June, 2009). Essential oil (EO) extraction was carried out by hydro-distillation in a Clevenger apparatus. The EO was analysed by both gas chromatography-Flame Ionization Detector (GC-FID) and gas chromatography/mass (GC/MS) techniques. The EO yield of the dry samples was found to be around 1.88%. The main identified components of EO were: alpha-pinene 30.40%, 1,8-cineole 17.66%, limonene 8.96%, myrtenol 5.78%, and beta-caryophyllene 5.00%. The bulk EO and the separated components were tested for their antibacterial activities against Escherichia coli O157, Salmonella typhimurium, Klebsiella pneumoniae, Yersinia enterocolitica O9, Brucella melitensis, Proteus spp., and Pseudomonas aeruginosa by using broth micro-dilution method. It was found that citronellal and nerol were the most effective components against all pathogens. (author)

  15. Origins of Common Neural Inputs to Different Compartments of the Extensor Digitorum Communis Muscle.

    Science.gov (United States)

    Dai, Chenyun; Shin, Henry; Davis, Bradley; Hu, Xiaogang

    2017-10-24

    The extensor digitorum communis (EDC) is a multi-compartment muscle that allows dexterous extension of the four digits. However, the level of common input shared across different compartments of this muscle is not well understood. We seek to systematically characterize the common and independent neural input, originated from different levels of the central nervous system, to the different compartments. A motor unit (MU) coherence analysis was used to capture the different sources of common and independent input, by quantifying the coherence of MU discharge between different compartments. The MU activities were obtained from decomposition of surface electromyogram recordings. Our results showed that the MU coherence across different muscle compartments accounted for only a small proportion (60%) in the delta (1-4 Hz) band. Additionally, cross-compartment coherence between the middle and ring-little fingers tended to be higher as compared with other finger combinations. Overall, the common input shared across different fingers are found to be at low to moderate levels, in comparison with the total input, which allows dexterous control of individual digits with some degree of coordinated control of multiple digits.

  16. Proteomic profile of the nucellus of castor bean (Ricinus communis L.) seeds during development.

    Science.gov (United States)

    Nogueira, Fábio C S; Palmisano, Giuseppe; Soares, Emanoella L; Shah, Mohibullah; Soares, Arlete A; Roepstorff, Peter; Campos, Francisco A P; Domont, Gilberto B

    2012-03-16

    In this study, we performed a proteomic analysis of nucellus from two developmental stages of Ricinus communis seeds by a GeLC-MS/MS approach, using of a high resolution orbitrap mass spectrometer, which resulted in the identification of a total of 766 proteins that were grouped into 553 protein groups. The distribution of the identified proteins in stages III and IV into different Gene Ontology categories was similar, with a remarkable abundance of proteins associated with the protein synthesis machinery of cells, as well as several classes of proteins involved in protein degradation, particularly of peptidases associated with programmed cell death. Consistent with the role of the nucellus in mediating nutrient transfer from maternal tissues to the endosperm and embryo, a significant proportion of the identified proteins are related to amino acid metabolism, but none of the identified proteins are known to have a role as storage proteins. Moreover for the first time, ricin isoforms were identified in tissues other than seed endosperm. Results are discussed in the context of the spatial and temporal distribution of the identified proteins within the nucellar cell layers. Copyright © 2012 Elsevier B.V. All rights reserved.

  17. Evaluation of experimental cleanser solution of Ricinus communis: effect on soft denture liner properties.

    Science.gov (United States)

    Pisani, Marina Xavier; da Silva, Cláudia Helena Lovato; Paranhos, Helena Freitas Oliveira; Souza, Raphael Freitas; Macedo, Ana Paula

    2012-06-01

    This study evaluated colour stability, hardness and roughness of soft denture liners after immersion in various cleansers. Thirty specimens (14 mm × 4 mm) of Elite Soft Relining (ES) and Mucopren Soft (MS) were randomly immersed in distilled water at 37°C, sodium hypochlorite 1%, and an experimental Ricinus communis solution (RC) for 7, 15 and 183 continuous days. anova (p < 0.05) and Tukey's test indicated that after T7 (μ =8.79 ± 7.36); T15 (μ = 4.23 ± 2.62) and T183 (μ = 8.78 ± 3.16), MS presented a higher increase in hardness than ES. After T7, MS underwent an increase in roughness (μ = 0.09 ± 0.80); ES underwent a decrease (μ = -0.08 ± 0.16). RC caused the smallest variation in roughness. After T15, both materials presented an increase in roughness. After T183, ES (μ = -0.30 ± 0.48) presented a higher roughness variation than MS (μ = -0.07 ± 0.32). Hypochlorite caused an increase in roughness (μ = 0.02 ± 0.19). After all periods ES presented higher colour alteration than MS; highest colour alteration was caused by hypochlorite. Both materials were more stable after immersion in RC. © 2010 The Gerodontology Society and John Wiley & Sons A/S.

  18. Physicochemical characteristics of seeds from wild and cultivated castor bean plants (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Jose Daniel Mosquera

    2018-01-01

    Full Text Available The castor (Ricinus communis L. is an oilseed plant whose main features are its drought resistance, and its adaptation to eroded, polluted, and low fertility soils. Its oil has a great demand in the industrial sector and it has recently attracted considerable interest for its use in the production of biodiesel and jet fuel. In this study, morphological, physical and chemical characterizations were performed to ascertain the quality of wild (VQ-1 and under cultivation (VQ-7 oil castor seeds. The results showed that there are differences in the morphological and physicochemical characteristics regarding oil content (44,95 vs 33,84%, ash (3,20 vs 2,42%, and 100-seed-weight (45,87 vs 54,23g; similar behavior was recorded when characterizing the oil: kinematic viscosity (269,67 vs 266,44mm2 /s, density (0,9389 vs 0,9465g/cm3 , and acidity index (0,9918 vs 0,5440mg KOH/g for VQ-1 and VQ-7, respectively. Growing conditions to which castor plants were subjected may influence both the final quality of seeds and chemical properties of the oil.

  19. Physicochemical characterization of seven Mexican Ricinus communis L. seeds and oil contents

    International Nuclear Information System (INIS)

    Perdomo, Felipe A.; Acosta-Osorio, Andrés A.; Herrera, G.; Vasco-Leal, José F.; Mosquera-Artamonov, José D.; Millan-Malo, Beatriz; Rodriguez-Garcia, Mario E.

    2013-01-01

    This paper presents a rigorous study and characterization of seven Mexican Ricinus communis L. seeds and its respective extracted oil. Several physical–chemical properties were measured in order to know moisture, total lipid content, fiber content, starch presence, morphology, acidity, free fatty acid profile, ricinoleic acid content, viscosity and crude oil density. Three different methodologies were implemented for the oil extraction in each variety (extraction with chemical solvents and mechanical compression heated and non-heated). The yield percentage of the oil extraction was evaluated as well as the extraction method influence over the oil's nature. -- Highlights: ► We characterized seven different Castor seeds and oils from semi deserted region. ► We evaluate the performance of three different methods to obtain Castor Oils. ► It was found that the density and fatty acid profile depend on the method of extraction. ► According to x-ray diffraction experiments no crystalline compounds were found in the defatted mass. ► The viscosity of the Castor Oils was strongly influence by the extractive method

  20. Chemical And Physiological Studies On Drought Stress Tolerance Of Irradiated Communis Pear Using Tissue Culture

    International Nuclear Information System (INIS)

    Zaied, N.S.; Ragab, E.A.

    2007-01-01

    The rooted in vitro irradiated pear rootstocks (Pyrus communis) were subjected to drought stress by using different concentrations of mannitol (20, 40, 60, 80 and 100 gm/l), polyethylene glycol (PEG) at concentrations 2, 4, 6, 8 and 10 % to culture medium and also agar at concentrations 6, 8, 10, 12 and 14 gm/l to study their effects on tissue culture and chemical analysis and their tolerance to drought stress. The obtained results showed that the number of shoots, shoot length and number of leaves were higher at 20 and 40 gm/l mannitol. Increasing mannitol concentration enhanced the increase of chlorophyll b, reducing sugars, total indoles and total phenols up to the highest level at 100 gm/l. Adding PEG at concentration 2% to the culture medium encouraged significant increases in the number of shoots and number of leaves and increase chlorophyll a, and non-reducing sugars as well as significant decrease in number of shoots, shoots length, number of leaves, root length and number of roots with increasing agar concentrations to the culture medium. However, decreasing agar concentration in the culture medium induced increase in chlorophyll A and non-reducing sugar

  1. Antioxidant activities and fatty acid composition of wild grown myrtle (Myrtus communis L.) fruits

    Science.gov (United States)

    Serce, Sedat; Ercisli, Sezai; Sengul, Memnune; Gunduz, Kazim; Orhan, Emine

    2010-01-01

    The fruits of eight myrtles, Myrtus communis L. accessions from the Mediterranean region of Turkey were evaluated for their antioxidant activities and fatty acid contents. The antioxidant activities of the fruit extracts were determined by using 2,2-diphenyl-1-picrylhydrazyl (DPPH) and β-carotene-linoleic acid assays. The fatty acid contents of fruits were determined by using gas chromatography. The methanol extracts of fruits exhibited a high level of free radical scavenging activity. There was a wide range (74.51-91.65%) of antioxidant activity among the accessions in the β-carotene-linoleic acid assay. The amount of total phenolics (TP) was determined to be between 44.41-74.44 μg Gallic acid equivalent (GAE)/mg, on a dry weight basis. Oleic acid was the dominant fatty acid (67.07%), followed by palmitic (10.24%), and stearic acid (8.19%), respectively. These results suggest the future utilization of myrtle fruit extracts as food additives or in chemoprevention studies. PMID:20548930

  2. Formulation and Optimization of Oral Mucoadhesive Patches of Myrtus Communis by Box Behnken Design.

    Science.gov (United States)

    Hashemi, Mahbubeh; Ramezani, Vahid; Seyedabadi, Mohammad; Ranjbar, Ali Mohamad; Jafari, Hossein; Honarvar, Mina; Fanaei, Hamed

    2017-09-01

    Purpose: Recurrent aphthous stomatitis (RAS) is the most common painful ulcerative disease of oral mucosa happening in ~20% of people. Aimed to develop Myrtus communis L. (Myrtle) containing oral patches, we applied box-behnken design to evaluate the effect of polymers such as Polyvinyl pyrrolidone (PVP), Gelatin, Methylcellulose (MC) and Pectin. Methods: The patches properties such as tensile strength, folding endurance, swelling index, thickness, mucoadhesive strength and the pattern of myrtle release were evaluated as dependent variables. Then, the model was adjusted according to the best fitted equation with box behnken design. Results: The results indicated that preparation of myrtle patch with hydrophilic polymers showed the disintegration time up to 24h and more. Using of polyvinyl pyrrolidone as a water soluble polymer and a pore-former polymer led to faster release of soluble materials from the patch to 29 (min -1 ). Also it decreases swelling index by increasing the patch disintegration. Gelatin and Pectin, with rigid matrix and water interaction properties, decreased the swelling ratio. Pectin increased the tensile strength, but gelatin produced an opposite effect. Thinner Myrtle patch (about 28µm) was obtained by formulation of methyl cellulose with equal ratio with polyvinyl pyrrolidone or gelatin. Conclusion: Altogether, the analysis showed that the optimal formulation was achieved with of 35.04 mg of Gelatin, 7.22 mg of Pectin, 7.20 mg of polyvinyl pyrrolidone, 50.52 mg of methyl cellulose and 20 mg of Myrtle extract.

  3. IDENTIFICACIÓN DE MICROORGANISMOS ASOCIADOS A RESIDUOS DE HIGUERILLA (Ricinus communis

    Directory of Open Access Journals (Sweden)

    Teresa Cabra Cendales

    2015-05-01

    Full Text Available El objetivo de este artículo fue aislar e identificar los microorganismos presentes en los residuos de fruto y  torta de higuerilla (Ricinus communis. Se utilizaron medios de cultivo selectivos para la caracterización morfológica y bioquímica y para la identificación molecular se usó la técnica de PCR con oligonucleótidos universales RM y RB del gen 16S para bacterias y secuencias intergénicas ITS1 e ITS4 para hongos y levaduras. Las secuencias fueron analizadas identificándose nueve especies de hongos, siendo Penicillium brevicompactum predominante; 12 especies de bacterias, donde el género más recurrente fue Bacillus sp. y dos especies de levaduras, Rhodosporidium paludigenum y Pichia burtonni. La identificación de la microbiota nativa presente en los residuos de higuerilla es muy promisoria, aportando un amplio conocimiento sobre la versatilidad metabólica de cada una de las cepas aisladas. El mayor número de aislamientos se obtuvieron de la torta probablemente debido al alto contenido de nutrientes presentes en este residuo.

  4. Production, optimization and quality assessment of biodiesel from Ricinus communis L. oil

    Directory of Open Access Journals (Sweden)

    Maryam Ijaz

    2016-04-01

    Full Text Available At present, biodiesel is gaining tremendous attention due to its eco-friendly nature and is possible substitute for diesel fuel. Biodiesel as renewable energy source can be produced from edible and non-edible feedstock. Non-edible resources are preferred to circumvent for food competition. In the present study FAME was produced from Ricinus communis L. oil by transesterification with methanol and ethanol in the presence of potassium hydroxide. The practical optimal condition for the production of biodiesel from castor bean was found to be: methanol/oil molar ratio, 6:1; temperature, 60 °C; time, 45 min; catalyst concentration 0.32 g. Quality assessment of biodiesel showed comparable results with ASTM standards. The values of specific gravity (SG were 0.5, kinematic viscosity 2.45 cSt, acid values 0.13 mg KOH/g, carbon residue 0.03%, flash point 119 °C, fire point 125 °C, cloud point −10 °C and pour point −20 °C of Ricinus FAME, respectively. Based on our data, it is suggested that to overcome prevailing energy crisis this non-edible plant is useful for production of biodiesel, which is an alternate to fossil fuel and may be used alone or in blend with HSD in engine combustion.

  5. Evaluation of the cadmium and lead phytoextraction by castor bean (Ricinus communis L.) in hydroponics

    Science.gov (United States)

    Niu, Z. X.; Sun, L. N.

    2017-06-01

    Phytoextraction has been considered as an innovative method to remove toxic metals from soil; higher biomass plants such as castor bean (Ricinus communis L.) have already been considered as a hyperaccumulating candidate. In the present study, castor bean was used to accumulate the cadmium and lead in hydroponic culture, and the root exudates and biomass changes were analyzed. Results demonstrated that ratios of aerial biomass/ root biomass (AW/RW) in treatments declined with concentrations of Cd or Pb. Optical density (OD) at 190 nm and 280 nm of root exudates observed in Cd and Pb treatments were lower than the control. In single Cd or Pb treatments, bioconcentration factors (BCF) of Cd or Pb increased with time and decreased with concentrations, the highest BCFs appeared in Cd5 (14.36) and Pb50 (6.48), respectively. Cd-BCF or Pb-BCF showed positive correlations with AW/RW ratios and OD values, and they were negative correlated with Cd and Pb concentration. Results in this study may supply useful information for phytoremediation of soil contaminated with cadmium and lead in situ.

  6. Isolamento do alcalóide ricinina das folhas de Ricinus communis (Euphorbiaceae através de cromatografias em contracorrente Isolation of the alkaloid ricinine from the leaves of Ricinus communis (Euphorbiaceae through counter-current chromatography

    Directory of Open Access Journals (Sweden)

    Ana Cristina Leite

    2005-12-01

    Full Text Available Droplet counter-current chromatography, rotation locular counter-current chromatography and high-speed counter-current chromatography were applied to the preparative separation of the alkaloid ricinine from the dichloromethane extracts of Ricinus communis leaves. The solvent system used was composed of dichloromethane-methanol-water (93:35:72 v/v/v and all techniques led to the isolation of large amounts of the alkaloid. The best result was obtained through HSCCC, since the ricinine yield was respectively 50% and 30% higher than when using RLCCC or DCCC.

  7. Negative effects of temperature and atmospheric depositions on the seed viability of common juniper (Juniperus communis).

    Science.gov (United States)

    Gruwez, R; De Frenne, P; De Schrijver, A; Leroux, O; Vangansbeke, P; Verheyen, K

    2014-02-01

    Environmental change is increasingly impacting ecosystems worldwide. However, our knowledge about the interacting effects of various drivers of global change on sexual reproduction of plants, one of their key mechanisms to cope with change, is limited. This study examines populations of poorly regenerating and threatened common juniper (Juniperus communis) to determine the influence of four drivers of global change (rising temperatures, nitrogen deposition, potentially acidifying deposition and altering precipitation patterns) on two key developmental phases during sexual reproduction, gametogenesis and fertilization (seed phase two, SP2) and embryo development (seed phase three, SP3), and on the ripening time of seeds. In 42 populations throughout the distribution range of common juniper in Europe, 11,943 seeds of two developmental phases were sampled. Seed viability was determined using seed dissection and related to accumulated temperature (expressed as growing degree-days), nitrogen and potentially acidifying deposition (nitrogen plus sulfur), and precipitation data. Precipitation had no influence on the viability of the seeds or on the ripening time. Increasing temperatures had a negative impact on the viability of SP2 and SP3 seeds and decreased the ripening time. Potentially acidifying depositions negatively influenced SP3 seed viability, while enhanced nitrogen deposition led to lower ripening times. Higher temperatures and atmospheric deposition affected SP3 seeds more than SP2 seeds. However, this is possibly a delayed effect as juniper seeds develop practically independently, due to the absence of vascular communication with the parent plant from shortly after fertilization. It is proposed that the failure of natural regeneration in many European juniper populations might be attributed to climate warming as well as enhanced atmospheric deposition of nitrogen and sulfur.

  8. Antibacterial Effect of Myrtus Communis Hydro-Alcoholic Extract on Pathogenic Bacteria

    Directory of Open Access Journals (Sweden)

    Ali Taheri

    2013-06-01

    Full Text Available Background: Today, due to the changes in the form of the resistance of pathogenic bacteria, discovering new antimicrobial drugs is under study. So, the aim of this study is to evaluate the antimicrobial properties of the extract of the myrtle herb on some of pathogenic bacteria. Materials and Methods: Hydroalcoholic extract of the leaves of myrtle herb was evaluated at 4 concentrations including 10-80 mg/ml on four strains of pathogenic bacteria using penetrative dissemination method together with the measuring diameter of the growth inhibition zone; then the results were compared to four conventional antibiotics. The minimum inhibitory and bactericidal concentrations were studied using macro dilution method. Results: Treatment by the concentration of 80 mg/ml extract of this herb showed the greatest effect on the bacterium Staphylococcus aureus and Vibrio cholera serotype Ogawa which had a significant difference with all other treatments and standard antibiotics (p> 0.05. The extract showed no effect on the bacterium Pseudomonas aeruginosa and just concentration of 80 mg/ml showed a little effect on E. coli and other antibiotics had no significant effect except tetracycline which has little effect on this strain. Minimum inhibitory concentration was 0.2 mg/ml for bacterium Staphylococcus aureus (S. aureus and the maximum for E.coli by 8 mg/ml.Conclusion: This study showed that under study bacteria were more resistant to the antibiotics and the extract of Myrtus communis leaves showed greatest antibacterial effect against S. aureus and V. cholerae cerotype Ogawa.

  9. Collection of castor-oil plant germoplasm (Ricinus communis L. in two municipalities of Arauca, Colombia

    Directory of Open Access Journals (Sweden)

    Carlos Iván Cardozo Conde

    2013-05-01

    Full Text Available Ricinus communis L., commonly known as the castor-oil plant, is important for its use in biofuels production. With the objective of learning about its current status, in 40 villages influential to the oil complex of Caricare (municipality of Arauquita and Caño Limón (municipality of Arauca in Arauca, Colombia (where five years earlier the crop had been established, a collection of sexual seed was carried out between December 2011 and January 2012. The variables studied include passport data as a collection resource, local name, relief, and soil type among others. A Garmin map76CSx was used in order to identify the transects and record data such as geographic location and elevation. Simple descriptive statistics were used to identify the variables of greatest variation. Using the qualitative variables of greatest importance, a contingency table analysis with a significance level of 5%, a multiple correspondence analysis (MCA and principal component analysis (PCA were performed for quantitative and qualitative variables, in addition to a classification analysis through a similarity matrix. The castor-oil plant was found in 25% of the villages visited. 12 introductions were collected, four from Caricare and eight from Caño Limón. Although the environmental conditions were favo­rable for its cultivation, there are no castor-oil plant crops in the locations visited. The absence of grain commercialization and oil extraction equipment is the main limiting factor. A garden was established using collected materials for the purpose of research, breeding and propagation.

  10. Potential of castor bean (Ricinus communis L.) for phytoremediation of mine tailings and oil production.

    Science.gov (United States)

    Ruiz Olivares, Alejandro; Carrillo-González, Rogelio; González-Chávez, Ma del Carmen A; Soto Hernández, Ramón Marcos

    2013-01-15

    Bioenergy production combined with phytoremediation has been suggested to help in solving two critical world problems: the gradual reduction of fossil fuels and soil contamination. The aim of this research was to investigate the potential for the use of Ricinus communis L. (castor oil plant) as an energy crop and plant species to remediate metal-polluted sites. This study was performed in mine tailings containing high concentrations of Cu, Zn, Mn, Pb and Cd. Physico-chemical characterization, total, DTPA-extractable and water-soluble metals in rhizospheric tailings heap samples were carried. Metal concentrations in plant tissues and translocation factors (TFs) were also determined. The Ricinus seed-oil content was high between 41 and 64%, seeds from San Francisco site 6 had the highest oil content, while these from site 7 had the lowest. No trend between oil yield vs seed origin site was observed. Seed-oil content was negatively correlated with root concentration of Cu, Zn, Pb and Cd, but no correlation was observed with the extractable-metals. According to its shoot metal concentrations and TFs, castor bean is not a metal accumulator plant. This primary colonizing plant is well suited to cope with the local toxic conditions and can be useful for the stabilization of these residues, and for then decreasing metal bioavailability, dispersion and human health risks on these barren tailings heaps and in the surrounding area. Our work is the first report regarding combined oil production and a phytostabilization role for Ricinus plants in metal mine tailings and may give a new value to suitable metal-polluted areas. Copyright © 2012 Elsevier Ltd. All rights reserved.

  11. Effect of copper tolerant Elsholtzia splendens on bacterial community associated with Commelina communis on a copper mine spoil.

    Science.gov (United States)

    Yang, Ruyi; Guo, Fuyu; Li, Jing; Su, Nannan; Shao, Zongyuan; Zan, Shuting

    2016-08-01

    Facilitation, or positive plant-plant interaction, has received increasing concern from ecologists over the last two decades. Facilitation may occur through direct mitigation of severe environments or indirect mediation by a third participant from the same or different trophic levels. The copper (Cu) tolerant species Elsholtzia splendens facilitates the establishment and growth of co-occurring Commelina communis through indirect enrichment of microbial activity. However, whether and how E. splendens impacts the microbial community that is associated with C. communis is less known. We characterized the soil bacterial community in the rhizosphere of C. communis in the absence and presence of E. splendens using PCR-DGGE (polymerase chain reaction-denaturing gradient gel electrophoresis) and sequencing. The result showed that the richness of the bacterial community increased, but diversity and evenness remained similar, in the presence of E. splendens. Chloroflexi, Acidobacteria and Proteobacteria were the most dominant bacteria. The relative abundance of dominant and minor bacterial groups showed distinctly different responses to E. splendens. Principal component analysis and redundancy analysis indicated that variation of the bacterial community was determined by multiple factors and might be driven by the tested soil parameters collectively, or alternatively changed through plant root exudates or other microorganisms. Our results enhance the understanding of how the bacterial community associated with a beneficiary plant responds to a benefactor plant and suggests that the changes of bacterial community composition may have far-reaching influence on plant-soil feedback and the aboveground plant community in the long run. Copyright © 2016. Published by Elsevier B.V.

  12. The Effect of Myrtus communis Extract on Liver Enzymes and Blood Biochemical Factors in Diabetic Adult Male Rats

    Directory of Open Access Journals (Sweden)

    Habiballah Johari

    2014-10-01

    Full Text Available Background: The aim of this study was the effect of Myrtus communis extract on liver enzymes and blood biochemical factors in diabetic adult male rats. Materials and Methods: This study has been carried out experimentally and completely random. Seventy adult male Wistar rats were divided in 7 groups including: control which received no treatment, sham who received 2 mL of distilled water, the 1st, 2nd and 3rd experimental groups which received 0.75, 1.5 and 3 mg/kg Myrtus communis leaf extract respectively, the 4th experimental group as the diabetic control group who received streptozotocin (60 mg/kg and the 5th experimental group as the diabetic treatment group who received 3 mg/kg of extract. This experiment lasted 14 days with prescript orally. After this period, all the rats, were weighted, anesthetized and blood samples were taken from the heart centrifuged and sera were evaluated for the concentration of various factors. In addition liver were removed and sliced. Results: According to the obtained results, the plasma concentration of liver enzyme (alanine aminotransferase, alkaline phosphatase, aspartate aminotransferase, cholesterol and glucose presented a significant decrease at (p≤0.05. Whereas no significant change were seen in body weight, triglyceride, urea, albumin and total protein. Histological studies of the liver tissue showed no significant difference among various groups. Conclusion: Myrtus communis is comprise of collections of flavonoids and other various components with antioxidant and anti inflammatory properties. Thence it can effective in treatment of liver diseases and decrease of blood sugar and cholesterol in diabetes mellitus patients.

  13. First report of Neofabraea kienholzii causing bull’s eye rot on pear (Pyrus communis) in the Netherlands

    OpenAIRE

    Wenneker, M.; Pham, K.T.K.; Boekhoudt, L.C.; Boer, de, F.A.; Leeuwen, van, P.J.; Hollinger, T.C.; Thomma, B.P.H.J.

    2017-01-01

    Pear (Pyrus communis L.) is an important fruit crop in the Netherlands, with a total production of 349,000 tons in 2014, and ‘Conference’ is the main cultivar. In the Netherlands, pears are kept in controlled atmosphere cold storage up to 11 months after harvest. Symptoms of bull’s eye rot were observed in 2015 on ‘Conference’ pears in storage in the Netherlands. Bull’s eye lesions on apple and pear fruits are generally caused by four Neofabraea species: N. alba Jacks, N. malicorticis Guthrie...

  14. Evaluation of the Antimicrobial Properties of the Essential Oil of Myrtus communis L. against Clinical Strains of Mycobacterium spp.

    Directory of Open Access Journals (Sweden)

    Stefania Zanetti

    2010-01-01

    Full Text Available Mycobacterium tuberculosis is the etiological agent of tuberculosis. The World Health Organization has estimated that 8 million of people develop active TB every year and the situation is complicated by an increase of Mycobacterium tuberculosis strains resistant to drugs used in antitubercular therapy: MDR and XDR-TB. Myrtle leaf extracts, used as an antiseptic in Sardinian traditional medicine, have strong antibacterial activity as several investigations showed. In this study we investigated the antimicrobial properties of the essential oil of Myrtus communis against clinical strains of M. tuberculosis and M. paratuberculosis.

  15. The Antimicrobial Effect of Methanolic Extracts of Achillea wilhelmsii, Myrtus communis, and Allium sativum on Pseudomonas aeruginosa

    Directory of Open Access Journals (Sweden)

    Mehdi Rostami Rad

    2017-12-01

      In this study, the effect of Achillea Wilhelmsii, Myrtus communis, and Allium sativum extracts, was investigated on 4 strains of Pseudomonas aeruginosa, and the effect of each extract, was studied using agar dilution method.   Among these three extracts, the Allium sativum  extract showed the highest antimicrobial activity. Also, observations were indicative of difference in the susceptibility of the studied strains to different extracts, which showed different reactions to each of the extracts based on the origin and antibiotic resistance level.   According to the results of this study, extracts are a natural and valuable sources to produce antimicrobial drugs against pseudomonas strains and other resistant pathogenic bacteria.    

  16. Effect of temperature on biomass allocation in seedlings of two contrasting genotypes of the oilseed crop Ricinus communis.

    Science.gov (United States)

    Ribeiro, Paulo R; Zanotti, Rafael F; Deflers, Carole; Fernandez, Luzimar G; Castro, Renato D de; Ligterink, Wilco; Hilhorst, Henk W M

    2015-08-01

    Ricinus communis is becoming an important crop for oil production, and studying the physiological and biochemical aspects of seedling development may aid in the improvement of crop quality and yield. The objective of this study was to assess the effect of temperature on biomass allocation in two R. communis genotypes. Biomass allocation was assessed by measuring dry weight of roots, stems, and cotyledons of seedlings grown at three different temperatures. Root length of each seedling was measured. Biomass allocation was strongly affected by temperature. Seedlings grown at 25°C and 35°C showed greater biomass than seedlings grown at 20°C. Cotyledon and stem dry weight increased for both genotypes with increasing temperature, whereas root biomass allocation showed a genotype-dependent behavior. Genotype MPA11 showed a continuous increase in root dry weight with increasing temperature, while genotype IAC80 was not able to sustain further root growth at higher temperatures. Based on metabolite and gene expression profiles, genotype MPA11 increases its level of osmoprotectant molecules and transcripts of genes encoding for antioxidant enzymes and heat shock proteins to a higher extent than genotype IAC80. This might be causal for the ability to maintain homeostasis and support root growth at elevated temperatures in genotype MPA11. Copyright © 2015 Elsevier GmbH. All rights reserved.

  17. Ethnobotanical, Ethnopharmacological, and Phytochemical Studies of Myrtus communis Linn: A Popular Herb in Unani System of Medicine.

    Science.gov (United States)

    Sisay, Mekonnen; Gashaw, Tigist

    2017-10-01

    Myrtus communis L (Myrtaceae) is one of the popular drugs being used in the Unani system of phytomedicine since ancient Greece period. From time immemorial, different parts of this plant and essential oil have been used for a variety of purposes such as cosmetics (hair fall control), flavoring of food and drinks as well as extensive therapeutic purposes. Ethnobotanical information revealed that M communis L has been a folkloric repute for the treatment of several diseases like gastric ulcer, diarrhea, dysentery, cancer, rheumatism, hemorrhage, deep sinuses, leucorrhoea, hemorrhoid, inflammation, dyspepsia, anxiety, insomnia, diabetes, hypertension, pulmonary disorders, and skin diseases. Moreover, ethnopharmacological studies revealed that the plant is endowed with extensive pharmacological activities, including antimicrobial, antidiarrheal, antidiabetic, antispasmodic, vasodilator, antiulcer, antioxidant, anticancer, anxiolytic, sedative-hypnotic, and anti-inflammatory activities, among others. The plant has been known to contain phenolic acids, tannins, flavonoids, glycosides, and terpenes. The myrtle oil was also found to be rich in a variety of bioactive monoterpenes and sesquiterpenes with their derivatives. Most of these studies validate the aforementioned traditional claims of this medicinal plant. Further studies are needed to unravel other pharmacological activities of this plant in the long run.

  18. Chemical Composition of Juniperus communis L. Cone Essential Oil and Its Variability among Wild Populations in Kosovo.

    Science.gov (United States)

    Hajdari, Avni; Mustafa, Behxhet; Nebija, Dashnor; Miftari, Elheme; Quave, Cassandra L; Novak, Johannes

    2015-11-01

    Ripe cones of Juniperus communis L. (Cupressaceae) were collected from five wild populations in Kosovo, with the aim of investigating the chemical composition and natural variation of essential oils between and within wild populations. Ripe cones were collected, air dried, crushed, and the essential oils obtained by hydrodistillation. The essential-oil constituents were identified by GC-FID and GC/MS analyses. The yield of essential oil differed depending on the population origins and ranged from 0.4 to 3.8% (v/w, based on the dry weight). In total, 42 compounds were identified in the essential oils of all populations. The principal components of the cone-essential oils were α-pinene, followed by β-myrcene, sabinene, and D-limonene. Taking into consideration the yield and chemical composition, the essential oil originating from various collection sites in Kosovo fulfilled the minimum requirements for J. communis essential oils of the European Pharmacopoeia. Hierarchical cluster analysis (HCA) and principal component analysis (PCA) were used to determine the influence of the geographical variations on the essential-oil composition. These statistical analyses suggested that the clustering of populations was not related to their geographic location, but rather appeared to be linked to local selective forces acting on the chemotype diversity. Copyright © 2015 Verlag Helvetica Chimica Acta AG, Zürich.

  19. ANTIBACTERIAL AND ANTIOXIDANT ACTIVITIES OF THE ESSENTIAL OILS AND PHENOLIC EXTRACTS OF MYRTUS COMMUNIS AND ZYGOPHYLUM ALBUM FROM ALGERIA.

    Directory of Open Access Journals (Sweden)

    A. Belmimoun

    2016-05-01

    Full Text Available The present study deals with the evaluation of the in vitro antioxidant and antibacterial activity of phenolic extracts and essential oils of two medicinal and aromatic plants Zygophyllum album and Myrtus communis by using the 2,2- diphenyl-2-picrylhydrazyl radical ,total antioxidant power and agar diffusion methods and minimum inhibitory concentration (MIC determination.Moreover,the extracts were investigated for their polyphenolic,flavonoids,tannins and anthocyans content by using the Folin-Ciocalteu assay,the aluminium trichlorid method,reaction with vanillin and colometer method based on differentiation of absorbance,respectively.The results showed that the highest antioxidant capacity was exhibited by the aqueous extract of Myrtus communis with IC50= 29,080mg/ml.All extracts  possessed more or less antibacterial activity against the  tested Gram- positive and Gram –negative bacteria Bacillus subtilis and E.coli were the more susceptible microorganisms to all extracts and essential oils. Pronounced antibacterial activity was observed by the methanolic extract of Zygophylum album (MIC value=25 µg/ml.Morever,the results showed that the phenolic compounds and flavonoids were abundant in Myrtle aqueous extracts.

  20. The phenolic content and its involvement in the graft incompatibility process of various pear rootstocks (Pyrus communis L.).

    Science.gov (United States)

    Hudina, Metka; Orazem, Primoz; Jakopic, Jerneja; Stampar, Franci

    2014-03-01

    This study investigates the influence of various rootstocks for pear on the phytochemical composition in the phloem above and below the graft union and the role of phenols in pear graft incompatibility. Assays of phloem with cambium from 4-year-old 'Conference', 'Abate Fetel' and 'Williams' pear trees grafted on different rootstocks: Quince MA, Quince BA 29, Fox 11, Farold 40 (Daygon), seedling Pyrus communis L. and own rooted (P. communis L.) were analyzed with HPLC-MS. The most abundant phenolic compound in phloem above and below the graft union was arbutin, followed by procyanidin B1 and chlorogenic acid. In 'Conference' and 'Abate Fetel', higher arbutin content levels were measured above the graft union, while in the incompatible scion of 'Williams' on quince MA higher arbutin content levels were measured below the graft union. In all three observed cultivars (in 'Conference' the difference was not significant) grafted on Fox 11 rootstock, the highest content of arbutin was measured below the graft union. The results indicate that not only catechin and procyanidin B1, but also arbutin and several flavonols could be involved in graft incompatibility. All cultivars grafted on quince rootstocks had higher levels of epicatechin and procyanidin B2 below the graft union, even though some differences were not significant. It seems that those phenols do not affect pear incompatibility. A severe incompatibility between Fox 11 rootstock and 'Williams' was detected. Copyright © 2013 Elsevier GmbH. All rights reserved.

  1. In-vitro regeneration of castor bean (ricinus communis, L) and physic nut (jatropha curcas, L.)

    International Nuclear Information System (INIS)

    Afful, N. T.

    2008-06-01

    Investigations were conducted on in vitro regeneration of physic nut (Jatropha curcas, 1.) and castor bean (Ricinus communis, 1.) using zygotic embryo culture, shoot tip and meristem culture as well as somatic embryogenesis. Zygotic embryos from different stages of fruit maturity cultured on Murashige and Skoog (MS) medium supplemented with benzylaminopurine (BAP), kinetin and 2-isopentyl (2iP) produced vigorous seedlings with roots. However the optimal concentration of cytokinin for seedling development depended on the type cytokinin as well as the maturity stage of the fruit. Embryos from yellow fruits of Jatropha had the highest germination (100%) on an MS medium supplemented with 0.5 mg/L kinetin or 1 mg/L BAP while in Ricinus embryos from black fruits had the highest percentage germination (97%) on an MS medium modified with I mg/L 2iP or 0.5 or I mg/L BAP. Decrease in embryo viability especially in Jatropha as the seed matured may be due to high oil content in matured (black) fruit. Oil content in both Jatropha and Ricinus increased as the fruit matured from green to black and this may have effect on germination of zygotic embryos. In vitro culture response of shoot tip or meristem was significantly influenced by the concentration of growth regulators in the culture medium as well as the plant species. In both plant species, 2iP resulted in highest percentage shoot regeneration. The optimal concentration of 2iP was 0.5 mg/L for Ricinus shoot tip and 1.5 or 2.0 mg/L for Jatropha, indicating genotypic difference between the species. However excessive callus formation and browning in Ricinus led to the loss of all the regenerants. Shoot regeneration from meristem explants was also influenced by growth regulators with 2iP again being the best. Cultures of cotyledon and leaf lobe explants on MS medium supplemented with 2, 4-D and picloram resulted in callus induction with the exception of cotyledons obtained from black fruits. However transfer of calli onto fresh

  2. In vitro colchicine-induced polyploid plantlet production and regeneration from leaf explants of the diploid pear (Pyrus communis L.) cultivar, 'Fertility'

    Science.gov (United States)

    Polyploid plantlets, including triploid, tetraploid and other polyploids, were induced from in vitro leaves of a European pear (Pyrus communis L.) cultivar 'Fertility' by a colchicine treatment. In vitro leaves were incubated in 0.4% colchicine solution for 24, 48 or 72 h, and transferred to an adv...

  3. Assessing the Antimicrobial Effect of the Essential Oil of Myrtus communis on the Clinical Isolates of Porphyromonas gingivalis: An in vitro Study.

    Science.gov (United States)

    Hedayati, Azita; Khosropanah, Hengameh; Bazargani, Abdollah; Abed, Molud; Emami, Amir

    2013-11-01

    One of the major diseases affecting the oral health is periodontal disease. Various therapeutic methods have been introduced to eliminate the periodonto-pathic subgingival microflora. Among these, Porphyromonas gingivalis (P. gingivalis) has a major role in the pathogenesis of different forms of periodontal diseases. The present study investigated the antimicrobial effect of the essential oil of Myrtus communis on Porphyromonas gingivalis (P. gingivalis) as the most destructive periodontal pathogens. The subjects included 27 male and 3 female patients with advanced chronic periodontitis. The mean age of the patients was 47.6 ± 2.0 years old. P. gingivalis was isolated from the samples and identified by various diagnostic tests, including Gram staining, Indol test, and fluorescent test. Minimum inhibitory concentration (MIC) of the essential oil against isolated P. gingivalis was determined by broth micro-dilution method. In this study, 0.12 - 64 μL/mL Myrtus communis essence were used for 30 P. gingivalis isolates and the MIC50 and MIC90 concentration of Myrtus communis essence against the isolates was equal to 1 and 8 μL/mL respectively. The results showed that Myrtus communis has antimicrobial effects against P. gingivalis. Further studies are suggested to include this essence in therapeutic protocols of periodontal disease.

  4. A comparison of the efficacy of metronidazole vaginal gel and Myrtus (Myrtus communis extract combination and metronidazole vaginal gel alone in the treatment of recurrent bacterial vaginosis

    Directory of Open Access Journals (Sweden)

    Mansoure Masoudi

    2017-02-01

    Full Text Available Objective: Due to the high incidence of bacterial vaginosis (BV and its resistance to chemical medications and considering the anti-bacterial and anti-fungal effects of Myrtus communis, the present study aimed to compare the therapeutic effects of the vaginal gel of M. communis 2% (in metronidazole base with metronidazole vaginal gel 0.75% alone on BV.Materials and Methods: This research was a random­ized controlled clinical trial conducted on 80 women of 18-40 years old with BV. Patients were divided into two groups of 40 women. Diagnostic criteria were Amsel's criteria and Gram staining. The first group received vaginal gel of metronidazole plus M. communis 2% and the second group received metronidazole vaginal gel alone for five consecutive nights. Therapeutic effects and Amsel’s criteria were assessed after one week. Finally, the data were analyzed by SPSS 16 using t-test and Chi square tests.Results: There was a significant difference in the therapeutic response between the two groups. The results demonstrated that the combination of metronidazole and M. communis had a higher efficiency (p

  5. Assessment of cross compatibility of pear (Pyrus communis L.) cultivars on the basis of pollen tube observations and analysis of the S-RNase gene

    OpenAIRE

    Wojciech Antkowiak; Andrzej Wojciechowski; Łukasz Wolko; Grzegorz Łysiak

    2013-01-01

    Diallel crosses of P. communis cultivars: 'Amfora', 'Radana', 'Red Williams', 'Carola', 'Conference', and 'Dicolor', were conducted under orchard and laboratory conditions at temperatures of 20°C and 28°C . Based on pollen tube observations and after the determination of the S genotypes, the usefulness of these pear cultivars as cross pollinators was evaluated as good and very good.

  6. Cadmium tolerance and its phytoremediation by two oil yielding plants Ricinus communis (L.) and Brassica juncea (L.) from the contaminated soil.

    Science.gov (United States)

    Bauddh, Kuldeep; Singh, Rana P

    2012-09-01

    The effect of increasing level of cadmium in soil was investigated on biomass production, antioxidants, Cd bioaccumulation and translocation in Ricinus communis vis-à-vis a commonly studied oil crop Brassica juncea. The plants were exposed to 25, 50, 75, 100, and 150 mg Cd/Kg soil for up to 60 days. It was found that R. communis produced higher biomass at all the contamination levels than that of B. juncea. Proline and malondialdehyde in the leaves increased with increase in Cd level in both the species, whereas soluble protein decreased. The bioaccumulation of Cd was higher in B. juncea on the basis of the per unit biomass, total metal accumulation per plant was higher in R. communis. The translocation of Cdfrom roots to shoot was also higher in B. juncea at all Cd concentrations. R. communis appeared more tolerant and capable to clean Cd contaminated soil for longer period in one sowing than B. juncea and the former can grow in wasteland soil also in which later cannot be cultivated.

  7. Effects of Oganic and Biofertilizers on Growth Indices of Castor Bean (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    A Amin Ghafori

    2016-07-01

    Full Text Available Introduction Castor plant, Ricinus communis L. is a species of flowering plant in the spurge family; Euphorbiaceae, which contains a vast number of plants mostly native to the tropics. It belongs to a monotypic genus Ricinus. The name Ricinus is a latin word for tick. The plant is probably named because its seed has markings and a dump at the end that resemble certain ticks (NCRI, 2014. Castorbean is an industrial oil seed crop containing about 45-58 percent oil, which has tremendous application in petrochemicals, pharmaceuticals, cosmetics, textiles, chemicals, soap, leather, paints, varnishes, ink, nylon and plastic. Castor oil is traditionally associated with medicine and veterinary use in the fields of obstetrics, dermatology. It is also used as laxative. Presently, its utilization as bio-diesel has magnified its importance. Its oil does not freeze even at high altitudes and it is one the best lubricants for jet engines. This 100% castor-based product, has numerous applications in industry such as rotating glass car-wipers, ski boots fixatives, and for use in air-brake systems on trucks. Many new uses, based on the biodegradability of castor oil derived products, are expected in the future (Labalette et al., 1996. The shell of the castor bean is used as an organic termite control agent and its seed cake as manure in the soil. Medicinal plants are valuable resources in a wide range of natural resources that scientific identification, cultivation, development and proper utilization of them can have an important role in community health, employment and non-petrol exports. Quality of medicinal plants is more important than other crops. One of the most important factors determining the yield of castor bean is fertility. Integrated supply of nutrient to plants through combinations of organic and inorganic sources is becoming an increasingly important aspect of environmentally sound agriculture. Reports showed that the application of manure on bean

  8. Effects of Oganic and Biofertilizers on Growth Indices of Castor Bean (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    A Amin Ghafori

    2016-07-01

    Full Text Available Introduction Castor plant, Ricinus communis L. is a species of flowering plant in the spurge family; Euphorbiaceae, which contains a vast number of plants mostly native to the tropics. It belongs to a monotypic genus Ricinus. The name Ricinus is a latin word for tick. The plant is probably named because its seed has markings and a dump at the end that resemble certain ticks (NCRI, 2014. Castorbean is an industrial oil seed crop containing about 45-58 percent oil, which has tremendous application in petrochemicals, pharmaceuticals, cosmetics, textiles, chemicals, soap, leather, paints, varnishes, ink, nylon and plastic. Castor oil is traditionally associated with medicine and veterinary use in the fields of obstetrics, dermatology. It is also used as laxative. Presently, its utilization as bio-diesel has magnified its importance. Its oil does not freeze even at high altitudes and it is one the best lubricants for jet engines. This 100% castor-based product, has numerous applications in industry such as rotating glass car-wipers, ski boots fixatives, and for use in air-brake systems on trucks. Many new uses, based on the biodegradability of castor oil derived products, are expected in the future (Labalette et al., 1996. The shell of the castor bean is used as an organic termite control agent and its seed cake as manure in the soil. Medicinal plants are valuable resources in a wide range of natural resources that scientific identification, cultivation, development and proper utilization of them can have an important role in community health, employment and non-petrol exports. Quality of medicinal plants is more important than other crops. One of the most important factors determining the yield of castor bean is fertility. Integrated supply of nutrient to plants through combinations of organic and inorganic sources is becoming an increasingly important aspect of environmentally sound agriculture. Reports showed that the application of manure on bean

  9. Growth, tolerance efficiency and phytoremediation potential of Ricinus communis (L.) and Brassica juncea (L.) in salinity and drought affected cadmium contaminated soil.

    Science.gov (United States)

    Bauddh, Kuldeep; Singh, Rana P

    2012-11-01

    We have previously reported that Ricinus communis (castor) is more tolerant to soil cadmium (Cd) and more efficient for Cd phytoremediation than Brassica juncea (Indian mustard) (Bauddh and Singh, 2012). In the present study, R. communis was found more tolerant to salinity and drought in presence of Cd and removed more Cd in a given time than Indian mustard. R. communis produced 23 and twelve folds higher biomass in terms of fresh weight and dry weight, respectively than that in B. juncea during three months when grown in Cd contaminated soil in presence of 100mM NaCl salinity and ten day water withdrawal based drought at 90 day after sowing (DAS). Castor plants showed stronger self-protection ability in form of proline bioaccumulation (r(2)=0.949) than Indian mustard (r(2)=0.932), whereas a lower r(2) for malondialdehyde (MDA) and total soluble protein in R. communis (r(2)=0.914 and r(2)=0.915, respectively) than that of B. juncea (r(2)=0.947 and r(2)=0.927, respectively) indicated a greater damage to cell membrane in Indian mustard during the multiple stress conditions. Though, the amount of Cd accumulated in the roots and shoots of Indian mustard was higher as per unit biomass than that in castor, total removal of the metal from soil was much higher in castor on per plant basis in the same period in presence of the stresses. R. communis accumulated about seventeen and 1.5 fold higher Cd in their roots and shoots, respectively than that of B. juncea in 90 DAS under the multiple stresses. Salinity alone enhanced Cd uptake, whereas drought stress reduced its uptake in both the plants. Copyright © 2012 Elsevier Inc. All rights reserved.

  10. Evaluation of the antidiarrheal activity of the leaf extracts of Myrtus communis Linn (Myrtaceae) in mice model.

    Science.gov (United States)

    Sisay, Mekonnen; Engidawork, Ephrem; Shibeshi, Workineh

    2017-02-10

    Myrtus communis L. has a folkloric repute for the management of diarrhea and dysentery in different parts of the world. However, the safety and efficacy of the leaf extract have not been scientifically validated in animal model. This study was, therefore, aimed to investigate the antidiarrheal effect of 80% methanol extract (80ME) and solvent fractions of the leaves of Myrtus communis L. in mice. The antidiarrheal activity of the 80ME and solvent fractions was evaluated against castor oil induced diarrheal model, charcoal meal and enteropooling tests. For the 80%ME, the test groups received 100, 200 and 400 mg/kg of the extract. In case of fractions, the test groups received various doses of fractions (200, 300, 400 mg/kg and an additional dose of 800 mg/kg for the aqueous fraction (AF)), where as negative controls received the vehicle (10 ml/kg) and positive controls received loperamide (3 mg/kg). The 80ME at 200 mg/kg (p < 0.05) & 400 mg/kg (p < 0.01) as well as the chloroform fraction (CF) and methanol fraction (MF) at 400 mg/kg (p < 0.05) significantly delayed the onset of diarrhea. Besides, the 80ME (at all tested doses) and both of these fractions (at 300 & 400 mg/kg) significantly decreased the frequency and weight of fecal outputs. Results from the charcoal meal test revealed that the 80ME, at all doses, (p < 0.001) as well as the CF and MF at 300 mg/kg (p < 0.05) & 400 mg/kg (p < 0.001) produced a significant anti-motility effect. Similarly, in the entero-pooling test, the 80ME (at all tested doses) (p < 0.01) as well as the CF and MF (at 300 & 400 mg/kg, p < 0.05) produced a significant decline in the weight and volume of intestinal contents, whereas the AF revealed significant effect (p < 0.05) at dose of 800 mg/kg only. The study demonstrated that the 80ME and solvent fractions contain bioactive constituents that have antidiarrheal activity. Therefore, this study provides a scientific support for the

  11. INTOXICAÇÃO EXPERIMENTAL PELAS SEMENTES TRITURADAS DE Ricinus communis (Euphorbiaceae EM COELHOS

    Directory of Open Access Journals (Sweden)

    Brito Marilene de Farias

    1997-01-01

    Full Text Available As sementes trituradas de Ricinus communis, administradas em doses únicas por sonda intragástrica a coelhos causou graves sintomas de intoxicação com êxito letal nos três coelhos que receberam a dose de 2 g/kg e em um dos quatro que receberam 1 g/kg. Os outros três coelhos que receberam 1g/kg desenvolveram sintomas discretos a moderados e se recuperaram, e os três que receberam 0,5g/kg só mostraram sintomas discretos. O período entre a administração das sementes e a morte ou recuperação variou de 12h47min a 68h08min, e de 3 a 6 dias, respectivamente. Os primeiros sintomas após a administração das sementes, foram observados dentro de cerca 8 horas nos casos letais e nos animais que adoeceram moderadamente, e dentro de cerca 24 horas nos casos com sintomatogia discreta. A evolução da intoxicação variou de 4 a 56 horas nos casos letais e de 2 a 5 meio dias nos casos de recuperação. A sintomatologia consistiu principalmente de perturbações digestivas. Os animais apresentaram inapetência até anorexia. As fezes geralmente eram escassas, com forma e tamanho das síbalas alteradas, eram escuras, às vezes pastosas, com muco. Havia nítidas manifestações de cólica. Os achados de necropsia mais evidentes foram constatados no intestino delgado e ceco. O conteúdo destes segmentos do intestino era líquido. A parede do intestino delgado apresentou congestão e edema e havia fibrina recobrindo a mucosa sob forma de pseudomembranas, ou na luz intestinal sob forma de flocos e/ou filamentos. No ceco havia edema da mucosa como também congestão da parede e fibrina aderida à mucosa ou encontrada em flocos e/ou filamentos no conteúdo. As alterações histológicas mais importantes foram verificadas no intestino delgado e ceco. No intestino delgado observou-se necrose de coagulação associada a congestão/hemorragias na mucosa. Havia ainda congestão/hemorragias e edema na submucosa. Lesões semelhantes foram vistas no ceco onde

  12. Studying the antibacterial effects of some phytochemical compounds isolated from Origanum syriacum, Thymus syriacus and Myrtus communis on some bacteria

    International Nuclear Information System (INIS)

    Almariri, I.; Swied, G.; Oda, A.

    2012-01-01

    Summary The Origanum Syriacum, Thymus syriacus and Myrtus communis leaves samples were collected. Essential oils (EO) extractions were done by hydrodistillation in a Clevenger apparatus. GC-FID was used to analyze the essential oils and GC-MS was used to confirm the identities of the isolated components. Preparative HPLC technique was used to separate and isolate the oils main components. The bulk EO and the separated components were tested for their antibacterial activities against Escherichia coli O157, Salmonella typhimurium, Klebsiella pneumonia, Yersinia enterocolitica O9, Brucella melitensis, Proteus spp., Pseudomonas aeruginosa, Staphylococcus aureus, Listeria monocytogenes and Bacillus cereus using broth microdilution method. The results confirm that the EOs and some of its components exhibited significant bactericidal activity. (author)

  13. Characterization of myrtle seed (Myrtus communis var. baetica as a source of lipids, phenolics, and antioxidant activities

    Directory of Open Access Journals (Sweden)

    Wissem Aidi Wannes

    2016-04-01

    Full Text Available This study aimed to characterize the chemical composition and antioxidant activity of the oil and the methanolic extract of Myrtus communis var. baetica seed. The oil yield of myrtle seed was 8.90%, with the amount of neutral lipid, especially triacylglycerol, being the highest, followed by phospholipids and glycolipids. Total lipids and all lipid classes were rich in linoleic acid. The content of total phenols, flavonoids, tannins, and proanthocyanidins of the methanolic extract and the oil from myrtle seed was determined using spectrophotometric methods. Antioxidant activities of the oil and the methanolic extract from myrtle seed were evaluated using 1,1-diphenyl-2-picrylhydrazyl radical scavenging, β-carotene–linoleic acid bleaching, and reducing power and metal chelating activity assays. In all tests, the methanolic extract of myrtle seed showed better antioxidant activity than oil. This investigation could suggest the use of myrtle seed in food, industrial, and biomedical applications for its potential metabolites and antioxidant abilities.

  14. Mersin Bitkisi (Myrtus communis L.'nde Farklı Hasat Zamanlarının

    Directory of Open Access Journals (Sweden)

    Ayşe Betül AVCI

    2009-04-01

    Full Text Available Bu çalışma Ege Üniversitesi Ziraat Fakültesi Bornova araştırma alanında bulunan Mersin (Myrtus communis L. bitkilerinde farklı hasat zamanlarının uçucu yağ oranlarına etkisini araştırmak amacıyla yürütülmüştür. Araştırmada, Mersin bitkisinden Ekim 2002 tarihinden itibaren bir yıl boyunca her ayın 15'inde ve günün üç farklı saatinde (08:00, 13:00, 18:00 olacak şekilde yapraklı dal örnekleri alınmıştır. Mersin (Myrtus communis L. bitkisinde en yüksek uçucu yağ oranı ortalama % 0.725 ile Temmuz ayında saat 18.00'de yapılan hasatta, en düşük oran ise ortalama % 0.250 ile mart ayında saat 13.00'de yapılan hasatta elde edildiği gözlenmiştir. Yapılan LSD testine göre farklı aylara ve saatlere göre belirlenen uçucu yağ değerleri arasındaki fark istatistiksel açıdan önemli bulunmuştur.

  15. Castor (Ricinus communis L. and Pigweed (Amaranthus retroflexus L. Growth Indices in Terms of Interference

    Directory of Open Access Journals (Sweden)

    naser jafarzadeh

    2016-11-01

    Full Text Available Introduction Growth analysis has been widely used in breeding programs to identify the important plant developmental phases and components related to higher yield under a particular set of environmental conditions. Castor bean (Ricinus communis L. is an important commercial crop. Castor oil based by products is used in manufacturing of several commercially important commodities like surfactants, coatings, greases, pharmaceuticals, cosmetics, polyesters, polymers, etc. Interference (Interactive effects among species on inter-species populations is one of the main issues on the eco-physiology of plant populations where weeds impose negative effects by approaching the plant to compete in light, water and nutrient elements availability and results in reduced growth and yield (Shinggu et al., 2011. Growth indices are useful for interpreting plant reactions to the crop and weed density. Various reasons have been attributed for the low productivity among the most important is weed competition (Radosevich, 1987. The aim of the present experiment was evaluating the interference effects of redroot pigweed on growth indices of castor bean in northwest of Iran. Materials and methods This experiment was conducted in Urmia, Iran (Agricultural Research of West Azarbayjan, Saatlo Station (37°44´18״ N Latitude and 45° 10´ 53״ E Longitude, at 1338 m above sea level in 2012. The soil of the experimental field was sandy - loam, with pH of 7.2. Competitive pattern of experiment was in two-factor based on a randomized complete block design (RCBD with three replications arranged in four castor plant densities (3, 4, 5 and 6 plants.m-2 and four redroot pigweed densities (0, 5, 10 and 15 plants.m-2. Redroot pigweed and castor seeds were simultaneously directly planted on the 22th May in 2012. Redroot pigweed plants were weeded at the times related to the treatments level. Irrigation and intercultural operations were performed whenever necessary. Plots were 3m×5m

  16. Estudio Químico, Micrográfico y Morfológico del Ricinus communis L., y su Aplicación en Pulpa Blanqueable

    OpenAIRE

    Teófilo Escoto García; José Guadalupe Rutiaga Quiñones; Rocío Orihuela Equihua; Antonio Rodríguez Rivas; José de Jesús Rivera Prado

    2014-01-01

    México posee una gran gama de especies vegetales no maderables o arbustivos, de los cuales se sabe muy poco, y para el caso del Ricinus communis L., existen trabajos sobre el uso de la semilla en biocombustibles y en la obtención de celulosa a partir del tallo. Con estos antecedentes se recolectó un espécimen de Ricinus communis , se descortezó y astilló para llevar a cabo los análisis de composición química, micrográfico y morfológico del tejido leñoso; aplicando además un proceso químico a ...

  17. Jatropha curcas and Ricinus communis differentially affect arbuscular mycorrhizal fungi diversity in soil when cultivated for biofuel production in a Guantanamo (Cuba) tropical system.

    Science.gov (United States)

    Alguacil, M. M.; Torrecillas, E.; Hernández, G.; Torres, P.; Roldán, A.

    2012-04-01

    The arbuscular mycorrhizal fungi (AMF) are a key, integral component of the stability, sustainability and functioning of ecosystems. In this study, we characterised the AMF biodiversity in a control soil and in a soil cultivated with Jatropha curcas or Ricinus communis, in a tropical system in Guantanamo (Cuba), in order to verify if a change of land use to biofuel plant production had any effect on the AMF communities. We also asses whether some soil properties related with the soil fertility (total N, Organic C, microbial biomass C, aggregate stability percentage, pH and electrical conductivity) were changed with the cultivation of both crop species. The AM fungal small sub-unit (SSU) rRNA genes were subjected to PCR, cloning, sequencing and phylogenetic analyses. Twenty AM fungal sequence types were identified: 19 belong to the Glomeraceae and one to the Paraglomeraceae. Two AMF sequence types related to cultured AMF species (Glo G3 for Glomus sinuosum and Glo G6 for Glomus intraradices-G. fasciculatum-G. irregulare) disappeared in the soil cultivated with J. curcas and R. communis. The soil properties (total N, Organic C and microbial biomass C) were improved by the cultivation of the two plant species. The diversity of the AMF community decreased in the soil of both crops, with respect to the control soil, and varied significantly depending on the crop species planted. Thus, R. communis soil showed higher AMF diversity than J. curcas soil. In conclusion, R. communis could be more suitable in long-term conservation and sustainable management of these tropical ecosystems.

  18. Assessment of cross compatibility of pear (Pyrus communis L. cultivars on the basis of pollen tube observations and analysis of the S-RNase gene

    Directory of Open Access Journals (Sweden)

    Wojciech Antkowiak

    2013-07-01

    Full Text Available Diallel crosses of P. communis cultivars: 'Amfora', 'Radana', 'Red Williams', 'Carola', 'Conference', and 'Dicolor', were conducted under orchard and laboratory conditions at temperatures of 20°C and 28°C . Based on pollen tube observations and after the determination of the S genotypes, the usefulness of these pear cultivars as cross pollinators was evaluated as good and very good.

  19. Growth and nitrogen removal capacity of Desmodesmus communis and of a natural microalgae consortium in a batch culture system in view of urban wastewater treatment: part I.

    Science.gov (United States)

    Samorì, Giulia; Samorì, Chiara; Guerrini, Franca; Pistocchi, Rossella

    2013-02-01

    The microalgal biomass applications strongly depend on cell composition and the production of low cost products such as biofuels appears to be economically convenient only in conjunction with wastewater treatment. As a preliminary study, in view of the development of a wastewater treatment pilot plant for nutrient removal and algal biomass production, a biological wastewater system was carried out on a laboratory scale growing a newly isolated freshwater algal strain, Desmodesmus communis, and a natural consortium of microalgae in effluents generated by a local wastewater reclamation facility. Batch cultures were operated by using D. communis under different growth conditions to better understand the effects of CO₂, nutrient concentration and light intensity on the biomass productivity and biochemical composition. The results were compared with those obtained using a natural algal consortium. D. communis showed a great vitality in the wastewater effluents with a biomass productivity of 0.138-0.227 g L⁻¹ d⁻¹ in the primary effluent enriched with CO₂, higher biomass productivity compared with the one achieved by the algal consortium (0.078 g L⁻¹ d⁻¹). D. communis cultures reached also a better nutrient removal efficiency compared with the algal consortium culture, with almost 100% for ammonia and phosphorous at any N/P ratio characterizing the wastewater nutrient composition. Biomass composition was richer in polysaccharides and total fatty acids as the ammonia concentration in the water decreased. In view of a future application of this algal biomass, due to the low total fatty acids content of 1.4-9.3 wt% and the high C/N ratio of 7.6-39.3, anaerobic digestion appeared to be the most appropriate biofuel conversion process. Copyright © 2012 Elsevier Ltd. All rights reserved.

  20. Escala diagramática para avaliação de mofo cinzento (Amphobotrys ricini da mamoneira (Ricinus communis L. Diagramatic scale to assess gray mold (Amphobotyrs ricini in castor bean (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Haroldo Antunes Chagas

    2010-06-01

    Full Text Available O objetivo do trabalho foi a elaboração de uma escala diagramática para avaliação de mofo cinzento causado por Amphobotrys ricini (Buchw. em mamoneira (Ricinus communis L.. Utilizaram 59 cachos, que foram desinfestados em solução de hipoclorito de sódio a 2% por 30 segundos e em água destilada e esterilizada. Depois foram acondicionados em bandejas com espuma umedecida, onde receberam discos de micélio de 5mm do patógeno, permanecendo em câmara climática a 25ºC e UR de 80%. Observou-se a evolução da doença e foram obtidos fotos dos cachos doentes diariamente. Para a determinação da porcentagem de severidade dos cachos, os frutos infectados e sadios foram contados, estimando-se dessa forma a porcentagem da área lesionada e elaborando uma escala diagramática com seis níveis de severidade. A adoção da escala proposta, melhorou a acurácia (R²=0,94, com valores de "a" não significativamente diferentes de zero (0 e os valores de "b" não diferentes de um (1.The aim of the present study was to develop a diagrammatic scale to assess gray mold caused by Amphobotrys ricini in castor bean (Ricinus communis L.. The experiment included 59 clusters, which were disinfected in solution of sodium hypochlorite to 2% for 30 seconds and distilled water and sterilized. Then, they were packed in moistened foam trays which received 5mm mycelial discs, and were kept in a climatic chamber at 25º C and 80%. RH. The disease evolution was observed daily pictures of the clusters diseased. To determine the severity percentage of the bunches, infected and healthy fruits were counted, estimating thus the percentage of the injured area, and developing a diagrammatic scale with six severity levels. The adoption of the proposed scale, improved the accuracy (R² = 0,94 "a" values were not significantly different from zero (0 and "b" values were not significantly different from one (1.

  1. Balanço energético para a produção de biodiesel pela cultura da mamona (Ricinus communis L. Energy balance for biodiesel production by the castor bean crop (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Rodolfo Glauber Chechetto

    2010-12-01

    Full Text Available A cultura da mamona (Ricinus communis L. adquiriu prestígio ao interesse da indústria pela qualidade de seu óleo e, recentemente, pela busca de novas fontes de energias. O experimento que serviu como base para os dados utilizados nesse trabalho foi realizado na Fazenda Experimental Lageado, FCA - UNESP, no município de Botucatu - SP, no ano de 2008. O objetivo deste trabalho foi avaliar a viabilidade energética da cultura através do balanço e da eficiência energética, desde a implantação até a produção de biodiesel, utilizando parâmetros de consumo operacional no manejo para instalação e manutenção da cultura, colheita e processamento de óleo. As operações de manejo de solo, semeadura e colheita consumiramo total de 266,20 MJ ha-1, que juntamente com fertilizantes, agrotóxicos, combustíveis e lubrificantes, mão-de-obra, sementes e processamento industrial totalizaram uma entrada de energia de 56.808,10 MJ ha-1. A produção de energia foi de 72.814,00 MJ ha-1. O setor ainda carece de estudos que contribuiriam para o levantamento de dados e coeficientes energéticos mais específicos. A cultura da mamona foi considerada eficiente, permitindo ganho de 15.983,44 MJ ha-1, equivalente a aproximadamente 415 L de óleo diesel.The castor bean crop (Ricinus communis L. has acquired prestige due to industries interest in the oil quality and recently for new sources of energy demand. The experiment that served as basis for the data used in this study was conducted at the Lageado Experimental Farm, in Botucatu - SP, 2008. This study aimed to avaluate the crop viability through energy balance and energy efficiency since the implantation until biodiesel production using parameters of consumption in operational management for installation and maintenance of culture harvest and oil production. The soil management operations, sow and harvest consumed the total of 266.20 MJ ha-1, gathering with the fertilizers, pesticides, fuels

  2. Effects of Myrtus communis leaves decoction on biochemical and hematological disorders induced by Cypermethrin-chronic toxicity in rats.

    Directory of Open Access Journals (Sweden)

    Abdelkrim Berroukche

    2017-12-01

    Full Text Available Background: Uncontrolled and an excessive uses of insecticides, in agriculture, will expose the human and animal health to a high risk of chemical toxicity. Objective: This study aimed to assess Myrtus communis (MC effects against the toxicity induced by the Cypermethrin (CYP in Wistar rat. Methods : The experimental period was 30 days, carried out on 50 rats, divided into 5 groups; group I (controls, group II orally administered with 20 mg / kg of CYP ( < 1/10 LD50 dissolved in corn oil (CO, a group III orally administered with CYP and treated with 1 mL of MC leaves decoction (50 g /L, a group IV receiving 1 mL MC and a group V received 1 mL CO. Results : A decrease in mean body weight was observed in group II (178 g compared to group III (190.66 g. Biochemical parameters were insignificant. Mean blood glucose and urea levels were respectively 0.94 ± 0.03 and 0.65 ± 0.06 g / L (group II and 0.72 ± 0.06 and 0.68 ± 0.05 g / L (group III. Furthermore, liver transaminase activities as GPT was 93 ± 38.7 (group II and 36.6 ± 8.0 IU / L (group III but GOT and ALP were respectively 188.3 ± 55.1 and 73.3 ± 47.7 (II and 210.3 ± 33.8 and 207 ± 5.1 IU / L (III. The hematological parameters (blood cells and Hb were respectively 6.16 ± 0.26 ×105 / mm3 and 13.52 ± 2.9 g / dL( II and 7.37 ± 0.41×105 / mm3 and 14.14 ± 0.87 g / dL (III. Conclusion: The medicinal plant Myrtus communis showed limited and partial beneficial effects against Cypermethrine negative effects in animal model. [J Complement Med Res 2017; 6(4.000: 385-390

  3. Caracterización morfológica y agroproductiva de procedencias de Ricinus communis L. para la producción de aceite Morphological and agroproductive characterization of Ricinus communis L. provenances for oil production

    Directory of Open Access Journals (Sweden)

    R Machado

    2012-12-01

    Full Text Available El objetivo de este trabajo fue caracterizar dos procedencias introducidas desde Suramérica (Planta-2 y Planta-3 y tres colectadas en Cuba (SSCS-5, Colón-1 y Las Tunas, de Ricinus communis L. Para ello se consideraron indicadores morfológicos y agroproductivos. Se utilizaron parcelas de 40 m² (área vital, con diez plantas. El diseño fue totalmente aleatorizado y los datos se analizaron a partir de estadígrafos descriptivos. Planta-2 alcanzó la mayor velocidad de crecimiento (2,98 cm/día y, a los 17 meses, fue superior en cuanto a: el grosor del tallo (17,5 cm; el número de ramas primarias (45, secundarias (41 y terciarias (20; y el grosor de las ramas primarias (5,9 cm. SSCS-5, Colón-1 y Las Tunas mostraron racimos más largos, con un mayor número de frutos; pero fueron superadas por Planta-3 y Planta-2 en el peso de los frutos por racimo (134,9 y 139,0 g, respectivamente, con frutos y semillas más grandes. Las lesiones producidas por insectos y el grado de infestación por microorganismos patógenos no fueron representativos. El mayor rendimiento de semilla (95,1 kg, el de frutos por planta (5,28 kg y por área (4 398 kg/ha y el estimado de aceite por unidad de área (1 130,2 kg/ha se detectaron en Planta-2. Se concluye que estas procedencias poseen características morfoproductivas que las diferencian, y mostraron particularidades relevantes para la producción de aceite, el cual se destina no solo a la producción de biodiesel, sino a múltiples usos a partir de sus derivados. Se recomienda profundizar en estudios sobre la fitotecnia de R. communis, de forma particular en Planta-2; así como introducir tipos medianos que faciliten su cosecha.The objective of this work was to characterize two provenances introduced from South America (Planta-2 and Planta-3 and three provenances collected in Cuba (SSCS-5, Colón-1 and Las Tunas, of Ricinus communis L. For such purpose, morphological and agroproductive indicators were considered

  4. Evaluation of Anti-Acetylcholinesterase Activity and Antioxidant Potential of Ricinine (a Central Nervous System Stimulant) Isolated from Ricinius communis

    International Nuclear Information System (INIS)

    Khan, B.; Rasheed, A.; Yasin, K.A.; Ahmed, M.N.; Ghous, T.; Andleeb, S.

    2016-01-01

    In the current research, an attempt has been made to isolate ricinine (an alkaloid) from the leaves of Ricinus communis L. for its possible applications in the prevention and treatment of Alzheimer's disease. The anti-acetylcholinesterase (anti-AChE) and antioxidant activity of ricinine was determined. Antioxidant and metal chelating activity was evaluated by 2,2-azinobis-(3-ethylbenzothiazoline-6-sulfonic acid) radical cation (ABTS./sup +/) decolorisation and ferrozine metal chelating assays. Screening of the AChE inhibitory activity by flow injection method showed significant inhibitory action with IC/sub 50/ values of 54.5 μg/ml. The stronger ABTS.+ scavenging potential (IC/sub 50/ 63.80μg/ml) as well as metal chelating potential (IC/sub 50/ 31.27 μg/ml) of ricinine was observed. We conclude that because of high yield (4mg/200g of dried material), the compound may be considered as a promising cognition-enhancing drug for the treatment and prevention of human dementia. (author)

  5. Comprehensive thin-layer chromatography mass spectrometry of flavanols from Juniperus communis L. and Punica granatum L.

    Science.gov (United States)

    Smrke, Samo; Vovk, Irena

    2013-05-10

    The coupling of thin-layer chromatography with mass spectrometry (TLC-MS) for the analysis of monomeric flavanols and proanthocyanidins in samples presented as complex matrices has been studied. The elution conditions for TLC-MS were optimised and full scans were compared with selected reaction monitoring for the MS detection of compounds. The performance of silica gel and cellulose plates with different developing solvents in TLC-MS was assessed. Cellulose plates provided superior sensitivity while ionisation suppression was encountered with silica plates. The use of a HILIC guard column beyond the elution head was found to facilitate detection of monomer compounds on silica plates. A new comprehensive TLC×MS procedure for screening flavanols in the entire chromatogram was developed as an alternative to the use of 4-dimethylaminocinnamaldehyde to determine the locations of compounds on the plate. This new procedure was applied to detect flavanols in the peel of Punica granatum L. fruits and in seeds of Juniperus communis L., in which flavanols and proanthocyanidin dimers and trimers were detected for the first time. Copyright © 2013 Elsevier B.V. All rights reserved.

  6. Chemometric investigation of light-shade effects on essential oil yield and morphology of Moroccan Myrtus communis L.

    Science.gov (United States)

    Fadil, Mouhcine; Farah, Abdellah; Ihssane, Bouchaib; Haloui, Taoufik; Lebrazi, Sara; Zghari, Badreddine; Rachiq, Saâd

    2016-01-01

    To investigate the effect of environmental factors such as light and shade on essential oil yield and morphological traits of Moroccan Myrtus communis, a chemometric study was conducted on 20 individuals growing under two contrasting light environments. The study of individual's parameters by principal component analysis has shown that essential oil yield, altitude, and leaves thickness were positively correlated between them and negatively correlated with plants height, leaves length and leaves width. Principal component analysis and hierarchical cluster analysis have also shown that the individuals of each sampling site were grouped separately. The one-way ANOVA test has confirmed the effect of light and shade on essential oil yield and morphological parameters by showing a statistically significant difference between them from the shaded side to the sunny one. Finally, the multiple linear model containing main, interaction and quadratic terms was chosen for the modeling of essential oil yield in terms of morphological parameters. Sun plants have a small height, small leaves length and width, but they are thicker and richer in essential oil than shade plants which have shown almost the opposite. The highlighted multiple linear model can be used to predict essential oil yield in the studied area.

  7. Truncus arteriosus communis in a midtrimester fetus: Comparison of prenatal ultrasound and MRI with postmortem MRI and autopsy

    International Nuclear Information System (INIS)

    Muehler, Matthias R.; Lembcke, Alexander; Fischer, Thomas; Kivelitz, Dietmar; Rake, Anett; Chaoui, Rabih; Heling, Kay-Sven; Schwabe, Michael; Planke, Christiane

    2004-01-01

    Different techniques are used in fetal cardiology, and their accuracy has been demonstrated on several occasions. Color Doppler US has proved to be a reliable and valuable tool in the diagnosis of fetal cardiac abnormalities. Magnetic resonance imaging (MRI) of the fetal heart has, so far, played no role in prenatal diagnostics. We report on a truncus arteriosus communis diagnosed prenatally during a screening ultrasound at 22 weeks of gestation. In addition to real-time ultrasound and color Doppler echocardiography, fetal MRI was performed. Fetal echocardiography arose suspicion of a type I common trunk. Fetal MR showed solely a widened vessel coursing retrocardially and additionally an inhomogeneous fluid distribution of the lung not shown on prenatal US. After termination of pregnancy at 23 weeks of gestation, MR fetography and autopsy were performed, and both found a type II common trunk. MR autopsy of the heart was very reliable in this case and could be an alternative when fetal pathology is not available for different reasons. Postmortem MRI was also able to demonstrate the inhomogeneous fluid distribution in the lung, which was confirmed by autopsy. Fetal and postmortem MR was reliable in the detection of an inhomogeneous fluid distribution in the lung not shown on prenatal US, providing a relevant additional finding to US. Therefore, MRI should be used more often in fetal cardiology, although it still must be further developed. (orig.)

  8. Differential expression of anthocyanin biosynthetic genes and transcription factor PcMYB10 in pears (Pyrus communis L..

    Directory of Open Access Journals (Sweden)

    Li Li

    Full Text Available Anthocyanin biosynthesis in various plants is affected by environmental conditions and controlled by the transcription level of the corresponding genes. In pears (Pyrus communis cv. 'Wujiuxiang', anthocyanin biosynthesis is significantly induced during low temperature storage compared with that at room temperature. We further examined the transcriptional levels of anthocyanin biosynthetic genes in 'Wujiuxiang' pears during developmental ripening and temperature-induced storage. The expression of genes that encode flavanone 3-hydroxylase, dihydroflavonol 4-reductase, anthocyanidin synthase, UDP-glucose: flavonoid 3-O-glucosyltransferase, and R2R3 MYB transcription factor (PcMYB10 was strongly positively correlated with anthocyanin accumulation in 'Wujiuxiang' pears in response to both developmental and cold-temperature induction. Hierarchical clustering analysis revealed the expression patterns of the set of target genes, of which PcMYB10 and most anthocyanin biosynthetic genes were related to the same cluster. The present work may help explore the molecular mechanism that regulates anthocyanin biosynthesis and its response to abiotic stress at the transcriptional level in plants.

  9. Direct Ethanol Production from Breadfruit Starch (Artocarpus communis Forst. by Engineered Simultaneous Saccharification and Fermentation (ESSF using Microbes Consortium

    Directory of Open Access Journals (Sweden)

    Iftachul Farida

    2015-02-01

    Full Text Available Breadfruit (Artocarpus communis Forst. is one of sources for ethanol production, which has high starch content (89%. Ethanol production from breadfruit starch was conducted by Simultaneous Saccharification and Fermentation (SSF technology using microbes consortium. The aim of the research was to examine a method to produce ethanol by SSF technology using microbes consortium at high yield and efficiency. The main research consisted of two treatments, namely normal SSF and enginereed SSF. The results showed that normal SSF using aeration and agitation during cultivation could produce ethanol at 11.15 ± 0.18 g/L, with the yield of product (Yp/s 0.34 g ethanol/g substrate; and yield of biomass (Yx/s 0.29 g cell/g substrate, respectively. A better result was obtained using engineered SSF in which aeration was stopped after biomass condition has reached the end of the exponential phase. The ethanol produced was 12.75 ± 0.04 g/L, with the yields of product (Yp/s 0.41 g ethanol/g substrate, and the yield of cell (Yx/s 0.09 g cell/g substrate.

  10. Global changes in DNA methylation in seeds and seedlings of Pyrus communis after seed desiccation and storage.

    Science.gov (United States)

    Michalak, Marcin; Barciszewska, Mirosława Z; Barciszewski, Jan; Plitta, Beata P; Chmielarz, Paweł

    2013-01-01

    The effects of storage and deep desiccation on structural changes of DNA in orthodox seeds are poorly characterized. In this study we analyzed the 5-methylcytosine (m(5)C) global content of DNA isolated from seeds of common pear (Pyrus communis L.) that had been subjected to extreme desiccation, and the seedlings derived from these seeds. Germination and seedling emergence tests were applied to determine seed viability after their desiccation. In parallel, analysis of the global content of m(5)C in dried seeds and DNA of seedlings obtained from such seeds was performed with a 2D TLC method. Desiccation of fresh seeds to 5.3% moisture content (mc) resulted in a slight reduction of DNA methylation, whereas severe desiccation down to 2-3% mc increased DNA methylation. Strong desiccation of seeds resulted in the subsequent generation of seedlings of shorter height. A 1-year period of seed storage induced a significant increase in the level of DNA methylation in seeds. It is possible that alterations in the m(5)C content of DNA in strongly desiccated pear seeds reflect a reaction of desiccation-tolerant (orthodox) seeds to severe desiccation. Epigenetic changes were observed not only in severely desiccated seeds but also in 3-month old seedlings obtained from these seeds. With regard to seed storage practices, epigenetic assessment could be used by gene banks for early detection of structural changes in the DNA of stored seeds.

  11. Measurement of gliding resistance of the extensor pollicis longus and extensor digitorum communis II tendons within the extensor retinaculum.

    Science.gov (United States)

    Kutsumi, Keiji; Amadio, Peter C; Zhao, Chunfeng; Zobitz, Mark E; An, Kai-Nan

    2004-03-01

    The etiology of spontaneous extensor pollicis longus (EPL) tendon rupture is still largely unknown. It is possible that friction within the sheath may play a role. The purposes of this study were to compare gliding resistance of the EPL tendon with that of the extensor digitorum communis tendon of the index finger (EDC II) and to find the wrist position that gives the EPL tendon the lowest gliding resistance. Fifteen fresh-frozen cadavers were used. Gliding resistance was measured directly in 7 different wrist positions. The mean gliding resistance of the EPL tendon was 0.16 +/- 0.08 N and that of the EDC II tendon was 0.11 +/- 0.06 N. This difference was significant. There was also a significant effect on gliding resistance due to wrist position. For the EPL tendon, the gliding resistance was significantly greater in 60 degrees wrist flexion compared with all other wrist positions tested. Additionally the gliding resistance of the EPL in 30 degrees flexion, 60 degrees extension, and 15 degrees radial deviation was significantly higher than wrist positions of 30 degrees extension, neutral, and 30 degrees ulnar deviation. Positioning the wrist close to neutral flexion/extension and in some ulnar deviation minimizes the friction within the EPL sheath. Such positions may be advantageous for splinting patients at risk for EPL rupture.

  12. Light and electron microscopic observations in connection with the developing pistil and seed-appendix (caruncle of Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Katherine Liszt

    2014-01-01

    Full Text Available The development of the particularly organized stigma and obturator, their fine structure, their function as well as the histological differentiation and the role of the seed-appendix i.e. the caruncle of Ricinus communis L. have been investigated in several developmental phases from the so called "gynoecial primordium" state to the ripe state, 'using the terminology introduced by S a t t 1 e r (1974. The stigma cells are characterized by dens cytoplasm, numerous vesicles mostly of ER origin, ribosomes and negatively stained mitochondria. Dilatation of ER, the appearance of electron opaque substances in it and between the plasmamembran and cell wall are frequent. The degenerating process of some stigma cells will start before the pollination because of autolysis. In the cells of the obturator and young caruncle however dictyosomes can be found more frequently than in stigma cells and the starch content of the ;plastids is remarkable. The thickening of the cell wall is connected with the function of these tissues.

  13. Chemical composition and antimicrobial activity of leaves essential oil of Juniperus communis (Cupressaceae grown in Republic of Macedonia

    Directory of Open Access Journals (Sweden)

    Floresha Sela

    2013-07-01

    Full Text Available Chemical composition and antimicrobial activity of essential oils isolated from leaves of three different samples of wild growing Juniperus communis L. (Cupressaceae from R. Macedonia was investigated. Essential oil yield ranged from 7.3 to 9.0 ml/kg. Performing GC/ FID/MS analysis, ninety components were identified, representing 86.07-93.31% of the oil. The major components of the leaves essential oil (LEO were α-pinene (21.37-28.68% and sabinene (2.29-16.27%, followed by limonene, terpinen-4-ol, β-elemene, trans-(E-caryophyllene, germacrene D and δ-cadinene. Antimicrobial screening of the LEO was made by disc diffusion and broth dilution method against 16 bacterial isolates of Gram positive and Gram negative bacteria and one strain of Candida albicans. Two bacteria, Staphylococcus aureus and Streptococcus pyogenes were sensitive to antimicrobial activity of LEO (MIC = 125 µl/ml. Additionally, LEO showed moderate antimicrobial activity against Streptococcus agalactiae, Haemophilus influnzae, Corynebacterium spp. and Campylobacter jejuni (MIC > 500 µl/ml. Candida albicans, Staphylococcus epidermidis, Acinetobacter spp., Salmonella enteritidis, Shigella flexneri, Klebsiella pneumonia, Pseudomonas aeruginosa and Proteus mirabilis were completely resistant to the antimicrobial effects of this.

  14. Culture of Desmodesmus communis (E.Hegewald E.Hegewald and Its Determination of the Biochemical Properties

    Directory of Open Access Journals (Sweden)

    Rıza Akgül

    2017-04-01

    Full Text Available In this study, culture medium and growth conditions were detected for Desmodesmus communis (E. Hegewald E. Hegewald (Sphaeropleales with KF470792 Accession Number that isolated from Thrace inland water (Bahçedere Stream, Tekirdağ, Turkey and determined by molecular taxonomy techniques. The microalgae was cultured under detected conditions (nutrients, pH, temperature, light density and aeration and when the culture was reached to stationary phase microalgae biomass was harvested for biochemical analysis. Total protein, total lipid, fatty acid and amino acid compositions, vitamin E amounts and variety were detected. Cell density was 9.76x105 colony/ml; dry biomass was 0.762 g/l; chlorophyll-a was 13.3 mg/l in BG11 culture medium (7.5 pH, 24±2ºC, 500 ml/min. aeration. According to biochemical analysis; total protein amount was 42.59% (dw/w; total lipid amount was 5.23% (dw/w and vitamin E amount was 3694.24 µg/glipid. The most abundant fatty acid was linolenic acid (35.18%; amino acid was glutamic acid (46.9 mg/g.

  15. Host Suitability of Eight Prunus spp. and One Pyrus communis Rootstocks to Pratylenchus vulnus, P. neglectus, and P. thornei.

    Science.gov (United States)

    Pinochet, J; Verdejo-Lucas, S; Marull, J

    1991-10-01

    The effects of Pratylenchus vulnus on rootstocks of eight commonly used Prunus spp. and one Pyrus communis were evaluated under greenhouse conditions during a 15-month period. In a first experiment, two almonds (Moncayo and Garrigues), one peach (GF-305), and two peach-almond hybrids (GF-677 and Adafuel) inoculated with 2,000 nematodes per plant proved to be good hosts of P. vulnus. Highest (P < 0.05) numbers of nematodes per gram of fresh root weight were recovered from Adafuel and GF-677. Root weights were higher in uninoculated compared to inoculated plants of all rootstocks, whereas top weights of uninoculated Garrigues, GF-305, and GF-677 differed (P < 0.05) from those of inoculated plants. In a second experiment, three plum (Marianna 2624, Myrobalan 605, and San Julian 655-2) and one pear (OHF-333) rootstocks were also found to be good hosts of P. vulnus, although significantly fewer nematodes were recovered from Myrohalan 605 roots than from the other three materials. Inoculated OHF-333 and San Julian 655-2 differed (P < 0.05) in root weights over uninoculated plants. Only inoculated San Julian 655-2 showed differences in top weights over uninoculated treatments. Rootstocks were poor or non-hosts for P. neglectus and P. thornei.

  16. Local Perceptions about the Effects of Jatropha (Jatropha curcas and Castor (Ricinus communis Plantations on Households in Ghana and Ethiopia

    Directory of Open Access Journals (Sweden)

    Joleen A. Timko

    2014-10-01

    Full Text Available Biofuel plantations have been hyped as a means to reinvigorate Africa’s rural areas. Yet there is still apprehension about the negative environmental and social impacts of large-scale commercial biofuel production around rising food prices, land grabbing, ecological damage, and disruption of rural livelihoods. Given the extent of Jatropha curcas production in Ghana and Ethiopia and Castor bean (Ricinus communis in Ethiopia, this paper presents the results of a study that assessed the socio-economic implications of industrial Jatropha plantations on local livelihoods in Ghana, and of industrial Jatropha and Castor plantations on local livelihoods in Ethiopia. This study used primary data collected from 234 households in Ghana and 165 in Ethiopia. The cultivation of Jatropha and Castor has had several important effects on local livelihoods in the study sites, most notably decreases in household landholdings due to the arrival of industrial Jatropha or Castor plantations; and the resulting changes these plantations have caused in household socio-economic status, food security, fallow periods, and fodder availability. We consider how a lack of meaningful consultation between local people, their traditional authorities and the biofuel company managers, along with shortcomings in each country’s broader land acquisition process and poor land use information, may have contributed to these overall negative effects on local livelihoods. We conclude by suggesting several ways that emerging biofuel industries could be improved from the perspective of local people and their livelihoods.

  17. Chemical investigation of the essential oil from berries and needles of common juniper (Juniperus communis L.) growing wild in Estonia.

    Science.gov (United States)

    Orav, Anne; Kailas, Tiiu; Muurisepp, Mati

    2010-11-01

    The essential oils obtained by simultaneous distillation and extraction (SDE) from the fresh and dried needles and dried berries of Juniperus communis L. of Estonian origin were subjected to GC-FID and GC-MS analyses. The yields of the oils ranged between 0.2% and 0.6% from juniper berries and between 0.5% and 1.0% from needles (dried weight). A total of 87 compounds were identified, representing over 95% of the oil. The major compounds in the needle oil were monoterpenes α-pinene (33.3-45.6%), sabinene (0.2-15.4%), limonene (2.8-4.6%) and sesquiterpenes (E)-β-caryophyllene (0.8-10.3%), α-humulene (0.8-6.2%) and germacrene D (3.0-7.8%). The juniper berry oil was rich in α-pinene (53.6-62.3%), β-myrcene (6.5-6.9%) and germacrene D (4.5-6.1%). The main oxygenated terpenoids found in the needle oil were germacrene D-4-ol (0.4-4.0%) and α-cadinol (to 2.7%). The oil from fresh needles contained high amounts of (E)-2-hexenal (3.7-11.7%).

  18. Semeadura do híbrido Lyra de mamona (Ricinus communis L. sob plantio direto Seeding of castor bean (Ricinus communis L. hybrid Lyra in no-tillage system

    Directory of Open Access Journals (Sweden)

    Nilza Patrícia Ramos

    2008-04-01

    Full Text Available A semeadura mecanizada da mamona (Ricinus communis L. pode reduzir o tempo de operação e os custos associados à mão-de-obra, porém a escassez de informações nesta área tem prejudicado a adoção correta desta tecnologia. Assim, objetivou-se com esse trabalho verificar a regularidade da distribuição longitudinal de sementes do híbrido Lyra de mamona, em área de plantio direto e sua relação com rendimento de grãos; bem como a viabilidade da aplicação de cartas de controle para a avaliação do processo de semeadura, nesta cultura. O ensaio foi conduzido em área comercial de produção de grãos de mamona sob plantio direto, sendo avaliadas: distribuição longitudinal, porcentagens de espaçamentos normais, falhos e duplos na linha, número de planta por metro linear, altura de plantas, altura e comprimento do racemo primário e rendimento de grãos. Utilizou-se a estatística descritiva, a análise de correlações e as cartas de controle para a avaliação dos parâmetros propostos. Há necessidade de refinamento nas regulagens de semeadoras-adubadoras de precisão para a semeadura do híbrido Lyra de mamona, em áreas de plantio direto; a distribuição longitudinal de sementes de mamona influencia vários parâmetros fitotécnicos, incluindo o rendimento de grãos; a aplicação da carta de controle é uma ferramenta eficiente para a avaliação do processo de semeadura da mamona.The mechanized sowing of castor bean (Ricinus communis L. can reduce the operation time and the costs associated to labor, however the privation of information in this area have damaged the correct adoption of this technology. Thus, the research had as an aim to verify the regularity of longitudinal distribution of hybrid Lyra castor bean seeds, in a no-tillage system area, and its relationship with yield; and the viability of control charts for evaluation of sowing in this crop. The essay was carded out in a commercial area of grain production in no

  19. Eficiência da seleção recorrente para redução da estatura de plantas em mamoneira (Ricinus communis L. Recurrent selection efficiency for stature reduction of castor bean (Ricinus communis L. plants

    Directory of Open Access Journals (Sweden)

    Inocencio Junior de Oliveira

    2008-08-01

    Full Text Available Realizou-se, o presente trabalho, com o objetivo de avaliar a eficiência da seleção recorrente para a redução da estatura de plantas de mamona da cultivar Guarani (Ricinus communis L., tornando-a com porte adequado para facilitar a colheita manual e/ou mecânica. Foram realizados quatro ciclos de seleção recorrente com a utilização de progênies autofecundadas na cultivar Guarani para redução da estatura das plantas, nas condições edafoclimáticas dos municípios de São Manuel - SP, Botucatu - SP e Penápolis - SP. As avaliações de estatura das plantas e de produtividade de grãos (kg.ha-1, dos quatro ciclos de seleção e do ciclo original foram realizadas nos municípios de São Manuel - SP, Botucatu - SP e Penápolis - SP na safra 2005/2006, sob um delineamento de blocos casualizados com cinco repetições e parcela útil de 30 m². A análise de variância para as características avaliadas foi feita separadamente para cada local e conjuntamente para os três locais e, posteriormente, realizada a comparação das médias pelo teste de Tukey, a 5%. Foram estimados, para as três localidades, por análise de regressão, os ganhos genéticos dos quatros ciclos de seleção para estatura de plantas. A partir dos resultados obtidos pôde-se concluir que a seleção recorrente foi eficiente para a redução da estatura de plantas e que a cultivar de mamona Guarani apresenta variabilidade genética para essa característica e que a produtividade não foi influenciada pela redução da estatura de plantas.The aim of this work was to evaluate the recurrent selection efficiency for reduction of stature of the castor bean plants of the Guarani cultivar (Ricinus communis L., turning it with appropriate strucuture to facilitate the manual and/or mechanic harvest. Four cycles of recurrent selection were accomplished through the utilization of self-pollinated progenies in the Guarani cultivar for reduction of plants stature, in

  20. Immunochemical studies on the N-acetyllactosamine beta-(1----6)-linked trisaccharide specificity of Ricinus communis agglutinin.

    Science.gov (United States)

    Wu, A M; Sugii, S; Gruezo, F G; Kabat, E A

    1988-07-15

    The combining site of Ricinus communis agglutinin (RCA1) was studied by quantitative precipitin and precipitin inhibition assays. Of 31 complex carbohydrates tested, all except active and inactive antifreeze glycoproteins, Streptococcus group C polysaccharide, and native rat salivary glycoprotein, reacted strongly, and 22 completely precipitated the lectin, indicating that RCA1 has both a broad range of affinity and a low solubility of its carbohydrate-bound complex. Of the monosaccharides and glycosides tested for inhibition of precipitation, p-nitrophenyl beta-D-galactopyranoside was the best. It was about 6.4 times better than methyl beta-D-galactopyranoside. The beta anomer of glycosides of D-galactose was much more potent than the corresponding alpha anomer. Among the oligosaccharides tested, beta-D-Galp-(1----4)-beta-D-GlcpNAc-(1----6)-D-Gal was the best inhibitor, which was approximately 2/3 as active as p-nitrophenyl beta-D-galactopyranoside. It was approximately 1.4 times as active as beta-D-Gal-(1----4)-D-GlcNAc (N-acetyllactosamine), twice as active as beta-D-Gal-(1----3)-D-GlcNAc, and 4.5 times more active than lacto-N-tetraose. From the results, it can be concluded that; (a) hydrophobic interaction is important for binding; (b) the combining site of this lectin is at least as large as a trisaccharide; and (c) of the compounds studied, the trisaccharide beta-D-Galp-(1----4)-beta-D-GlcpNAc-(1----6)-D-Gal was the most complementary to the human blood group I Ma determinant beta-D-Galp-(1----4)-beta-D-GlcpNAc-(1----6)-D-Gal.

  1. Phloem sap proteins from Cucurbita maxima and Ricinus communis have the capacity to traffic cell to cell through plasmodesmata

    Science.gov (United States)

    Balachandran, Suchandra; Xiang, Yu; Schobert, Christian; Thompson, Gary A.; Lucas, William J.

    1997-01-01

    In angiosperms, the functional enucleate sieve tube system of the phloem appears to be maintained by the surrounding companion cells. In this study, we tested the hypothesis that polypeptides present within the phloem sap traffic cell to cell from the companion cells, where they are synthesized, into the sieve tube via plasmodesmata. Coinjection of fluorescently labeled dextrans along with size-fractionated Cucurbita maxima phloem proteins, ranging in size from 10 to 200 kDa, as well as injection of individual fluorescently labeled phloem proteins, provided unambiguous evidence that these proteins have the capacity to interact with mesophyll plasmodesmata in cucurbit cotyledons to induce an increase in size exclusion limit and traffic cell to cell. Plasmodesmal size exclusion limit increased to greater than 20 kDa, but less than 40 kDa, irrespective of the size of the injected protein, indicating that partial protein unfolding may be a requirement for transport. A threshold concentration in the 20–100 nM range was required for cell-to-cell transport indicating that phloem proteins have a high affinity for the mesophyll plasmodesmal binding site(s). Parallel experiments with glutaredoxin and cystatin, phloem sap proteins from Ricinus communis, established that these proteins can also traffic through cucurbit mesophyll plasmodesmata. These results are discussed in terms of the requirements for regulated protein trafficking between companion cells and the sieve tube system. As the threshold value for plasmodesmal transport of phloem sap proteins falls within the same range as many plant hormones, the possibility is discussed that some of these proteins may act as long-distance signaling molecules. PMID:9391168

  2. Phloem sap proteins from Cucurbita maxima and Ricinus communis have the capacity to traffic cell to cell through plasmodesmata.

    Science.gov (United States)

    Balachandran, S; Xiang, Y; Schobert, C; Thompson, G A; Lucas, W J

    1997-12-09

    In angiosperms, the functional enucleate sieve tube system of the phloem appears to be maintained by the surrounding companion cells. In this study, we tested the hypothesis that polypeptides present within the phloem sap traffic cell to cell from the companion cells, where they are synthesized, into the sieve tube via plasmodesmata. Coinjection of fluorescently labeled dextrans along with size-fractionated Cucurbita maxima phloem proteins, ranging in size from 10 to 200 kDa, as well as injection of individual fluorescently labeled phloem proteins, provided unambiguous evidence that these proteins have the capacity to interact with mesophyll plasmodesmata in cucurbit cotyledons to induce an increase in size exclusion limit and traffic cell to cell. Plasmodesmal size exclusion limit increased to greater than 20 kDa, but less than 40 kDa, irrespective of the size of the injected protein, indicating that partial protein unfolding may be a requirement for transport. A threshold concentration in the 20-100 nM range was required for cell-to-cell transport indicating that phloem proteins have a high affinity for the mesophyll plasmodesmal binding site(s). Parallel experiments with glutaredoxin and cystatin, phloem sap proteins from Ricinus communis, established that these proteins can also traffic through cucurbit mesophyll plasmodesmata. These results are discussed in terms of the requirements for regulated protein trafficking between companion cells and the sieve tube system. As the threshold value for plasmodesmal transport of phloem sap proteins falls within the same range as many plant hormones, the possibility is discussed that some of these proteins may act as long-distance signaling molecules.

  3. Anatomic cadaveric study of the extensile extensor digitorum communis splitting approach for exposing the ulnar coronoid process.

    Science.gov (United States)

    Sukegawa, Koji; Suzuki, Takane; Ogawa, Yasufumi; Ueno, Keisuke; Kiuchi, Hitoshi; Kanazuka, Aya; Matsuura, Yusuke; Kuniyoshi, Kazuki

    2016-08-01

    The extensile extensor digitorum communis (EDC) splitting approach can access the ulnar coronoid process (UCP), which can be used to treat terrible triad injuries. The present study anatomically examined the extensile EDC splitting approach for exposing the UCP. Twenty fresh frozen cadaveric upper limbs were dissected. The splitting length of the EDC and detachment length of the extensor carpi radialis brevis (ECRB)-extensor carpi radialis longus (ECRL)-brachioradialis (BR) origin were measured to expose the UCP. The distance between the most distal site of the EDC splitting and the point at which the posterior interosseous nerve (PIN) crosses the anterior aspect of the radial shaft, and the distance between the most proximal site of the ECRB-ECRL-BR origin detachment and the point at which the radial nerve crosses the anterior aspect of the humeral shaft were measured. The splitting length of the EDC was 45.4 ± 4.8 mm, the detachment length of the ECRB-ECRL-BR origin was 30.2 ± 4.7 mm, the distance between the distal site of the EDC splitting and PIN was 10.6 ± 6.1 mm (minimum distance, 1.1 mm), and the distance between the proximal site of the ECRB-ECRL-BR origin detachment and the radial nerve was 49.5 ± 9.7 mm (minimum distance, 31.7 mm). The extensile EDC splitting approach can sufficiently expose the UCP. However, splitting must be performed carefully because the most distal site of the EDC splitting is close to the point at which the PIN crosses the anterior aspect of the radial shaft (average distance, 10 mm; minimum distance, 1 mm). Copyright © 2016 Journal of Shoulder and Elbow Surgery Board of Trustees. Published by Elsevier Inc. All rights reserved.

  4. Alternatif Pembuatan Biodiesel Melalui Transesterifikasi Minyak Castor (Ricinus communis Menggunakan Katalis Campuran Cangkang Telur Ayam dan Kaolin

    Directory of Open Access Journals (Sweden)

    Soni - Setiadji

    2017-05-01

    Full Text Available Biodiesel was produced by transesterification of castor oil (Ricinus communis using a catalyst of CaO and kaolin (CaO / kaolin had been performed. CaO was obtained from the calcination of eggshell. Castor oil is selected as biodiesel feedstock because it belongs to non-food oil and easy to cultivate. In general, the research method aims to comprise the CaO / Kaolin catalysts with a ratio of 15 mmol CaO per 1 gram of kaolin activated using impregnation method and biodiesel produced through transesterification of castor oil using the catalyst at 65 ºC for 8 hours with ratio of castor oil: methanol: catalyst (1: 15: 5% w / w. The reaction is carried out on the reflux system. The XRD analysis show the presence of silica and potassium aluminum silicate hydroxide in the catalyst. The EDS results show the catalyst-forming components CaO and silica. The FTIR analysis results show the absorption peak in the functional group forming the methyl ester compound. Based on the characterization of GC-MS, the largest methyl ester components contained in biodiesel are methyl risinoleate, methyl elaidat, methyl stearate, methyl linoleate, and methyl palmitate. The overall conversion of castor oil to methyl ester using CaO / kaolin catalyst is 97.36%. The largest component in castor oil is risinoleic acid, has been successfully converted to methyl risinoleate by 74.75%.DOI: http://dx.doi.org/10.15408/jkv.v0i0.4778

  5. CAPACIDAD ANTAGÓNICA Y QUITINOLÍTICA DE MICROORGANISMOS AISLADOS DE RESIDUOS DE HIGUERILLA (Ricinus communis

    Directory of Open Access Journals (Sweden)

    TERESA CABRA C

    2014-06-01

    Full Text Available Se ha comprobado que los fertilizantes y controladores biológicos a base de microorganismos benéficos productores de metabolitos de interés, inducen el crecimiento vegetal y actúan contra microorganismos patógenos y plagas que afectan los agroecosistemas. Por lo tanto, su uso constituye una práctica eficiente de producción limpia que ayuda a reducir el impacto ambiental causado por el uso de agroquímicos. En este trabajo se evaluó la capacidad antagónica y quitinolítica de 15 cepas bacterianas y una levaduriforme, aisladas de residuos lignocelulósicos de higuerilla (Ricinus communis. La actividad antagónica de cada cepa se determinó por la capacidad de inhibir el crecimiento del hongo fitopatógeno Fusarium equiseti, en medio de cultivo PDA. Solamente la bacteria Bacillus subtilis, presentó una inhibición significativa del crecimiento del hongo equivalente al 76,08%. Por lo tanto se demuestra que la cepa de Bacillus subtilis puede ser empleada en la formulación de inoculantes microbianos. La capacidad quitinolítica de las cepas se definió por el crecimiento del microorganismo y por la formación de halos de hidrólisis alrededor de las colonias sobre el medio de cultivo suplementado con quitina coloidal. Ninguna de las cepas evaluadas mostró capacidad para degradar quitina.

  6. Chemical characterization and radical scavenging activity of leaves of Juniperus foetidisima, J. excelsa and J. communis from Macedonian flora

    Directory of Open Access Journals (Sweden)

    Marija Karapandzova

    2014-12-01

    Full Text Available Chemical characterization of three Juniperus species: J. foetidisima (JF, J. excelsa (JE and J. communis (JC from Macedonian flora enclosed determination of yield and essential oil composition of the oils obtained by hydro-distillation of dried leaves and determination of the content of total phenols and total flavonoids in dried plant material. GC/FID/MS analysis showed mainly monoterpene profile of the JC oil and combined monoterpene/sesquiterpene profile of JF and JE oils. Sesquiterpene cedrol was found as an important constituent of the JF and JE, thus the JF oil was characterized by three main components (a-pinene, limonene and cedrol, in amount up to 67.63%, 27.11% and 33.91%, respectively and JE oil by four components (a-pinene, sabinene, cis-thujone and cedrol, in amount up to 33.83%, 29.49%, 26.20% and 24.44%, respectively. The JC oil was free of cedrol, but contained relatively large sesquiterpene fraction (sesquiterpene hydrocarbons and oxygen containing sesquiterpenes in amounts up to 28.64% and 13.57%, respectively. The JC oil was characterized by three monoterpene components (a-pinene, sabinene and terpinen-4-ol, presented up to 28.68%, 16.27% and 12.16%, respectively. The content of total phenols determined by Folin-Ciocalteu method ranged from 96.18-122.91 mg GAE/g dw (water extraction while the content of total flavonoids ranged from 2.05-11.91 mg CE/g dw (ethanol extraction. Both water and ethanol extracts possessed radical scavenging activity against DPPH radical. Water extracts were more powerful with % of inhibition of DPPH ranging up to 64.52%, 67.40% and 78.23% for water extract (10 mg/ml of JF, JE and JC, respectively. Obtained results showed correlation with the content of total phenols.

  7. Hydroalcoholic extract of Myrtus communis can alter anxiety and sleep parameters: a behavioural and EEG sleep pattern study in mice and rats.

    Science.gov (United States)

    Hajiaghaee, Reza; Faizi, Mehrdad; Shahmohammadi, Zahra; Abdollahnejad, Fatemeh; Naghdibadi, Hasanali; Najafi, Foroogh; Razmi, Ali

    2016-10-01

    Myrtus communis L. (Myrtaceae), myrtle, is an evergreen shrub with strong antibacterial, anti-inflammatory, antihyperglycemic and antioxidant activities. Also, it is used as a sedative-hypnotic plant in Iranian traditional medicine. This study evaluates the effect of 80% ethanolic extract of M. communis leaves on sleep and anxiety in mice and rats. Male NMRI mice were subjected to open field, righting reflex, grip strength and pentylentetrazole-induced seizure tests. Male Wistar rats were used to evaluate the alterations in rapid eye movement (REM) and non-REM (NREM) sleep. They were treated with 25-400 mg/kg doses of the extract intraperitoneally. The applied doses (50-200 mg/kg) of M. communis extract increased vertical (ED50 = 40.2 ± 6.6 mg/kg) and vertical and horizontal activity (ED50 = 251 ± 55 mg/kg), while treatment with 200 and 400 mg/kg attenuated muscle tone significantly compared to vehicle treated animals (p sleep time was decreased (2.4 ± 0.5%), while total and NREM sleep times were increased significantly compared to the control group of mice (82.5 ± 7.6%). The data show the anxiolytic and muscle relaxant effect of the extract without anticonvulsant activities. The anxiolytic, myorelaxant and hypnotic effects without effect on seizure threshold are in line with the effect of a alpha 2 GABA receptor agonist.

  8. Correlação de pearson e análise de trilha identificando variáveis para caracterizar porta-enxerto de Pyrus communis L

    OpenAIRE

    Galarça,Simone Padilha; Lima,Cláudia Simone Madruga; Silveira,Gustavo da; Rufato,Andreia De Rossi

    2010-01-01

    Objetivou-se, no presente trabalho, através de correlação de Pearson e análise de trilha, identificar variáveis para caracterizar porta-enxertos ananizantes para a cultura da pereira (Pyrus communis L.). Neste experimento foram utilizadas 49 plantas de pereira, plantadas nos canteiros do Departamento de Fitotecnia da FAEM/UFPel. As plantas foram avaliadas na época do seu crescimento vegetativo, segundo parâmetros descritos em instruções do Ministério da Agricultura, Pecuária e Abastecimento. ...

  9. Evaluation of Repellency Effect of Essential Oils of Satureja khuzestanica (Carvacrol), Myrtus communis (Myrtle), Lavendula officinalis and Salvia sclarea using Standard WHO Repellency Tests

    Science.gov (United States)

    Kayedi, Mohammad Hassan; Haghdoost, Ali Akbar; Salehnia, Ali; Khamisabadi, Kiumars

    2014-01-01

    Background Using special lotions and repellent sprays on skin is one of the effective methods to prevent Arthropods biting which was verified in this study. Methods: Essential oils of four plants (Satureja khuzestanica, Salvia sclarea, Lavendula officinalis and Myrtus communis) were separately extracted by Clevenger used hydro distillation method. Then separated solutions with 10%, 20% and 40% concentrations of essential oils of plants in 99.6 % ethanol were prepared. WHO guidelines for efficacy testing of mosquito repellents for human skin were used on different concentrations of essential oils of plants, traditional repellents (DEET, 50% and 33%) as positive control, and ethanol 99.6% and naked hands as negative controls. Results: In negative control groups, the number of bits were comparable (P= 0.42) and had decreasing time trends (naked hands P= 0.011, ethanol Prepellents and it was significantly less than the other groups (Prepellents had association with the number of bites. The maximum and minimum numbers of bites were observed with 10% and 40% concentrations respectively in all groups. Conclusion: Essential oils of Salvia sclarea, Lavendula officinalis and Myrtus communis have repellency effect, even with 10% concentration of essential oils. PMID:25629066

  10. Hierarchical cluster analysis and chemical characterisation of Myrtus communis L. essential oil from Yemen region and its antimicrobial, antioxidant and anti-colorectal adenocarcinoma properties.

    Science.gov (United States)

    Anwar, Sirajudheen; Crouch, Rebecca A; Awadh Ali, Nasser A; Al-Fatimi, Mohamed A; Setzer, William N; Wessjohann, Ludger

    2017-09-01

    The hydrodistilled essential oil obtained from the dried leaves of Myrtus communis, collected in Yemen, was analysed by GC-MS. Forty-one compounds were identified, representing 96.3% of the total oil. The major constituents of essential oil were oxygenated monoterpenoids (87.1%), linalool (29.1%), 1,8-cineole (18.4%), α-terpineol (10.8%), geraniol (7.3%) and linalyl acetate (7.4%). The essential oil was assessed for its antimicrobial activity using a disc diffusion assay and resulted in moderate to potent antibacterial and antifungal activities targeting mainly Bacillus subtilis, Staphylococcus aureus and Candida albicans. The oil moderately reduced the diphenylpicrylhydrazyl radical (IC 50  = 4.2 μL/mL or 4.1 mg/mL). In vitro cytotoxicity evaluation against HT29 (human colonic adenocarcinoma cells) showed that the essential oil exhibited a moderate antitumor effect with IC 50 of 110 ± 4 μg/mL. Hierarchical cluster analysis of M. communis has been carried out based on the chemical compositions of 99 samples reported in the literature, including Yemeni sample.

  11. Evaluation of Repellency Effect of Essential Oils of Satureja khuzestanica (Carvacrol, Myrtus communis (Myrtle, Lavendula officinalis and Salvia sclarea using Standard WHO Repellency Tests.

    Directory of Open Access Journals (Sweden)

    Mohammad Hassan Kayedi

    2014-06-01

    Full Text Available Using special lotions and repellent sprays on skin is one of the effective methods to prevent Arthropods biting which was verified in this study.Essential oils of four plants (Satureja khuzestanica, Salvia sclarea, Lavendula officinalis and Myrtus communis were separately extracted by Clevenger used hydro distillation method. Then separated solutions with 10%, 20% and 40% concentrations of essential oils of plants in 99.6 % ethanol were prepared. WHO guidelines for efficacy testing of mosquito repellents for human skin were used on different concentrations of essential oils of plants, traditional repellents (DEET, 50% and 33% as positive control, and ethanol 99.6% and naked hands as negative controls.In negative control groups, the number of bits were comparable (P= 0.42 and had decreasing time trends (naked hands P= 0.011, ethanol P< 0.001. In all time points, minimum bites were observed in traditional repellents and it was significantly less than the other groups (P< 0.001. The time trend in the number of bites in the other groups was positive and showed minimum number of bites in time zero in all groups. We also found that the concentration of repellents had association with the number of bites. The maximum and minimum numbers of bites were observed with 10% and 40% concentrations respectively in all groups.Essential oils of Salvia sclarea, Lavendula officinalis and Myrtus communis have repellency effect, even with 10% concentration of essential oils.

  12. Effect of the extract of Ricinus communis L. on the osmotic fragility, labeling of red blood cells with Technetium-99m and morphology of the cells

    Directory of Open Access Journals (Sweden)

    Kristiana Cerqueira Mousinho

    2008-12-01

    Full Text Available The aim of this study was to evaluate the influence of the proteic extract of R. communis on the cell physiology by the osmotic fragility, labeling of the blood elements with the 99mTc and cell morphology. To evaluate the osmotic fragility, the blood samples of the Wistar rats were incubated with the concentrations of R. communis and with the solutions of NaCl (0.4; 0.7; 0.9%. In the labeling of the blood elements procedure, the rat blood was treated with a solution of Tc-99m and TCA at 5%, determining the rate of radioactivity (%ATI in the plasma (P and in the red blood cells (RBC. The soluble and insoluble fractions of the plasma were also evaluated. The cells morphology submitted to the extract was evaluated by the optical microscopy (x40. The results indicated that the rate of the hemolysis increased in the presence of 0.125 mg/mL of the extract. There was a decay of 49.69% in the rate of ATI in the insoluble fraction of the cells, with the morphological alterations in the red blood cells. These results suggested that the extract changed the capability of binding of the red blood cells due to the stannous ion oxidation, modifying the cells structure.Produtos naturais são usados freqüentemente por muitas pessoas no tratamento do câncer. O Ricinus communis L é uma Euforbiaceae que apresenta propriedades laxativas, purgativas e antitumorais. O objetivo deste trabalho é estudar a influência da fração protéica do extrato hidroalcoólico de R. communis L. na fisiologia celular através da fragilidade osmótica, da marcação de elementos sanguíneo com 99mTc e da morfologia celular. Para avaliar a fragilidade osmótica, amostras de sangue de ratos Wistar foram incubadas com concentrações de R. communis e com soluções de NaCl (0,4; 0,7; 0,9%. No procedimento de marcação de elementos sanguíneos, as amostras de sangue foram tratadas com solução de Tc-99m e TCA à 5%, determinando o percentual de radioatividade (%ATI no plasma (P e

  13. Modeling the kinetics of essential oil hydrodistillation from juniper berries (Juniperus communis L. using non-linear regression

    Directory of Open Access Journals (Sweden)

    Radosavljević Dragana B.

    2017-01-01

    Full Text Available This paper presents kinetics modeling of essential oil hydrodistillation from juniper berries (Juniperus communis L. by using a non-linear regression methodology. The proposed model has the polynomial-logarithmic form. The initial equation of the proposed non-linear model is q = q∞•(a•(logt2 + b•logt + c and by substituting a1=q∞•a, b1 = q∞•b and c1 = q∞•c, the final equation is obtained as q = a1•(logt2 + b1•logt + c1. In this equation q is the quantity of the obtained oil at time t, while a1, b1 and c1 are parameters to be determined for each sample. From the final equation it can be seen that the key parameter q∞, which presents the maximal oil quantity obtained after infinite time, is already included in parameters a1, b1 and c1. In this way, experimental determination of this parameter is avoided. Using the proposed model with parameters obtained by regression, the values of oil hydrodistillation in time are calculated for each sample and compared to the experimental values. In addition, two kinetic models previously proposed in literature were applied to the same experimental results. The developed model provided better agreements with the experimental values than the two, generally accepted kinetic models of this process. The average values of error measures (RSS, RSE, AIC and MRPD obtained for our model (0.005; 0.017; –84.33; 1.65 were generally lower than the corresponding values of the other two models (0.025; 0.041; –53.20; 3.89 and (0.0035; 0.015; –86.83; 1.59. Also, parameter estimation for the proposed model was significantly simpler (maximum 2 iterations per sample using the non-linear regression than that for the existing models (maximum 9 iterations per sample. [Project of the Serbian Ministry of Education, Science and Technological Development, Grant no. TR-35026

  14. A sheep hydatid cyst glycoprotein as receptors for three toxic lectins, as well as Abrus precatorius and Ricinus communis agglutinins.

    Science.gov (United States)

    Wu, A M; Song, S C; Wu, J H; Pfüller, U; Chow, L P; Lin, J Y

    1995-01-18

    The binding properties of a glycoprotein with blood group P1 specificity isolated from sheep hydatid cyst fluid with Gal and GalNAc specific lectins was investigated by quantitative precipitin and precipitin inhibition assays. The glycoprotein completely precipitated Ricinus communis agglutinin (RCA1), Abrus precatorius agglutinin (APA) and Mistletoe toxic lectin-I (ML-I). Only 1.0 microgram of P1 glycoprotein was required to precipitate 50% of 5.1 micrograms ML-I nitrogen. It also reacted well with abrin-a and ricin, precipitating over 73% of the lectin nitrogen added, but poorly or weakly with Dolichos biflorus (DBL), Vicia villosa (VVL, a mixture of A4, A2B2 and B4), VVL-B4, Arachis hypogaea (PNA), Maclura pomifera (MPL), Bauchinia purpurea alba (BPL) and Wistaria floribunda (WFL) lectins. When an inhibition assay in the range of 5.1 micrograms N to 5.9 micrograms N of lectins (ML-I, abrin-a; ricin, RCA1, and APA, and 10 micrograms P1 active glycoprotein interaction was performed; from 76 to 100% of the precipitations were inhibited by 0.44 and 0.52 mumol of Gal alpha 1-->4Gal and Gal beta 1-->4GlcNAc, respectively, but not or insignificantly with 1.72 mumol of GlcNAc. The Gal alpha 1-->4Gal disaccharide found in this P1 active glycoprotein is a frequently occurring sequence of many glycosphingolipids located at the surface of mammalian cell membranes, especially human erythrocytes and intestinal cells for ligand binding and microbial toxin attachment. The present finding suggests that the Gal alpha 1-->4Gal beta 1-->4GlcNAc sequence in this P1 active glycoprotein is one of the best glycoprotein receptors for three toxic lectins (ricin, abrin-a, and ML-I) as well as for APA, and RCA1, and the result of inhibition assay implies that these lectins are recognizing part or all of the Gal alpha 1-->4Gal beta 1-->4GlcNAc sequence in the P1 active glycoprotein.

  15. Antimicrobial activity of complete denture cleanser solutions based on sodium hypochlorite and Ricinus communis – a randomized clinical study

    Directory of Open Access Journals (Sweden)

    Marcela Moreira SALLES

    2015-12-01

    Full Text Available ABSTRACT To preserve oral health and to maintain the prosthetic devices, it is important not only to improve the properties of commonly known hygiene products, but also to investigate new materials with antimicrobial action. Objectives This study evaluated the antimicrobial activity of sodium hypochlorite (0.25% and 0.50% and 10% Ricinus communis’ solutions against specific microorganisms. Material and Methods Sixty four maxillary complete denture wearers were instructed to brush their dentures three times a day and to soak them (20 min/day in the solutions: SH1: 0.25% sodium hypochlorite; SH2: 0.5% sodium hypochlorite; RC: 10% R. communis oil; and C: 0.85% saline (control. The solutions were used for 7 days in a randomized sequence. Following each period of use, there was a 1-week washout period. Antimicrobial activity was determined by Colony Forming Units (CFU counts of Streptococcus mutans, Candida spp., and gram-negative microorganisms. For collecting biofilm, the internal surface of maxillary dentures was brushed with saline solution, and biofilm suspension obtained. After dilutions (100 - 10-3, aliquots were seeded in Mitis salivarius, CHROMagar Candida®, and MacConkey agar for detecting S. mutans, Candida spp., or gram-negative microorganisms, respectively. After incubation, colonies were counted, and CFU/mL values were calculated. Then, transformation - log10 (CFU+1 - data were analyzed using the Friedman test (α=0.05. Results showed significant differences between the solutions (p<0.001. Results All three solutions showed antimicrobial activity against S. mutans. Against Candida spp., RC and SH1 solutions showed similar effect while SH2 showed superior activity. SH1 and SH2 solutions showed antimicrobial action against gram-negative microorganisms. The Candida species most frequently isolated was C. albicans, followed by C. tropicalis and C. glabrata. Conclusions The 0.5% sodium hypochlorite solution was the most effective and

  16. Vibrio communis sp. nov., isolated from the marine animals Mussismilia hispida, Phyllogorgia dilatata, Palythoa caribaeorum, Palythoa variabilis and Litopenaeus vannamei.

    Science.gov (United States)

    Chimetto, Luciane A; Cleenwerck, Ilse; Alves, Nelson; Silva, Bruno Sergio; Brocchi, Marcelo; Willems, Anne; De Vos, Paul; Thompson, Fabiano L

    2011-02-01

    also be differentiated on the basis of the presence of the fatty acids C(17 : 0,) C(17 : 1)ω8c, iso-C(17 : 0) and iso-C(13 : 0) and the absence of the fatty acid C(18 : 0). The name Vibrio communis sp. nov. is proposed for this taxon. Strain R-40496(T) (=LMG 25430(T) =CAIM 1816(T)) is the type strain.

  17. Exploiting EST databases for the development and characterization of EST-SSR markers in castor bean (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Yang Jun-Bo

    2010-12-01

    Full Text Available Abstract Background The castor bean (Ricinus communis L., a monotypic species in the spurge family (Euphorbiaceae, 2n = 20, is an important non-edible oilseed crop widely cultivated in tropical, sub-tropical and temperate countries for its high economic value. Because of the high level of ricinoleic acid (over 85% in its seed oil, the castor bean seed derivatives are often used in aviation oil, lubricants, nylon, dyes, inks, soaps, adhesive and biodiesel. Due to lack of efficient molecular markers, little is known about the population genetic diversity and the genetic relationships among castor bean germplasm. Efficient and robust molecular markers are increasingly needed for breeding and improving varieties in castor bean. The advent of modern genomics has produced large amounts of publicly available DNA sequence data. In particular, expressed sequence tags (ESTs provide valuable resources to develop gene-associated SSR markers. Results In total, 18,928 publicly available non-redundant castor bean EST sequences, representing approximately 17.03 Mb, were evaluated and 7732 SSR sites in 5,122 ESTs were identified by data mining. Castor bean exhibited considerably high frequency of EST-SSRs. We developed and characterized 118 polymorphic EST-SSR markers from 379 primer pairs flanking repeats by screening 24 castor bean samples collected from different countries. A total of 350 alleles were identified from 118 polymorphic SSR loci, ranging from 2-6 per locus (A with an average of 2.97. The EST-SSR markers developed displayed moderate gene diversity (He with an average of 0.41. Genetic relationships among 24 germplasms were investigated using the genotypes of 350 alleles, showing geographic pattern of genotypes across genetic diversity centers of castor bean. Conclusion Castor bean EST sequences exhibited considerably high frequency of SSR sites, and were rich resources for developing EST-SSR markers. These EST-SSR markers would be particularly

  18. AVALIAÇÃO DO POTENCIAL FITORREMEDIADOR DA MAMONA (Ricinus communis L UTILIZANDO EFLUENTE SINTÉTICO CONTENDO CHUMBO.

    Directory of Open Access Journals (Sweden)

    Anita Lima

    2010-04-01

    Full Text Available Os estudos de novas formas para o tratamento de efluentes domésticos e industriais vêm aumentando gradativamente no Brasil, neste contexto destacam-se as correntes que defendem a atenuação natural e a biorremediação. Por essas razões, em anos recentes, passou-se a dar preferência a métodos in situ, os quais são mais econômicos e perturbam menos o ambiente. Uma técnica de remediação natural é a fitorremediação que, aplica-se à utilização de vegetação (árvores, arbustos, plantas rasteiras e aquáticas e de sua microbiota com o fim de remover, degradar ou isolar substâncias tóxicas ao ambiente. O presente trabalho teve como objetivo testar o capacidade de fitorremediação da mamona (Ricinus Communis L. na redução das concentrações de chumbo presente em efluente sintético, cujas características simulam aquelas encontradas em um dos principais efluentes da indústria de exploração do petróleo, a água de produção tratada. O delineamento experimental utilizado no estudo foi o de blocos inteiramente casualizado com a variação das concentrações de chumbo distribuídas em quatro tratamentos: 0 µg/L (T1, 250 µg/L (T2, 500 µg/L (T3, 1000 µg/L (T4. Na análise dos dados foi aplicado o teste estatístico ANOVA para a comparação das médias nos tratamentos. A avaliação realizada nas concentrações de chumbo no lixiviado indicou que ocorreram remoções máximas de 67,42%, 87,34% e 94,74% para os tratamentos T2, T3 e T4, respectivamente. A retenção do chumbo nos tecidos (sistema radicular, caule e folhas da mamona indicou que a planta apresentou boa capacidade de bioacumular o chumbo. PALAVRAS-CHAVE: Fitorremediação, Chumbo, Mamona.

  19. Poliuretana de mamona (Ricinus communis para desvio da crista tibial no cão Polyurethane resins derived from castor oil (Ricinus communis for tibial crest deviation in dogs

    Directory of Open Access Journals (Sweden)

    Patricia Popak Maria

    2004-06-01

    Full Text Available A luxação medial de patela é uma das principais afecções ortopédicas que afetam cães de raças de pequeno porte. Tendo como princípio que o desvio da crista tibial é uma das alterações anatômicas encontradas, este estudo objetivou avaliar o efeito da poliuretana de mamona (Ricinus communis aplicada em defeitos produzidos experimentalmente na porção proximal medial da tíbia de cães normais em fase de crescimento. Para isto, foram utilizados 12 cães subdivididos aleatoriamente em 3 grupos de igual número, com mesmo tratamento, mas com análise histopatológica aos 30 (GI, 60 (GII e 90 (GIII dias. O estudo constou de avaliações clínica, radiográfica, macroscópica, histopatológica, tomográfica e análise estatística. Avaliação clínica demonstrou não haver rejeição do implante. A análise radiográfica revelou intensa reação periosteal e neoformações ósseas no local da implantação. Macroscopicamente observou-se espessamento da crista tibial, neoformações ósseas e desvio lateral da crista. Os achados à microscopia óptica revelaram presença de tecido conjuntivo fibroso ao redor da poliuretana, ausência de proliferação óssea em direção ao implante e proliferação de periósteo na face medial das tíbias. A tomografia computadorizada revelou desvio lateral da crista em 11 animais e estes desvios foram estatisticamente significantes em nível de 5% por meio do teste t pareado.Medial patellar luxation is one of the most common orthopedic problems in small breeds of dogs and tibial crest deviation is a frequent accompaining anatomical abnormality. For that reason, the purpose of this study was to evaluate the behavior of castor oil derived polyurethane implants when apllied to experimental defects created on the medial side of the proximal tibia of normal puppies. Twelve dogs were randomly divided in 3 groups of 4 animals and were submitted to the same treatment. Histopathological study was performed

  20. Amygdalus communis L.

    African Journals Online (AJOL)

    ONOS

    2010-01-25

    Jan 25, 2010 ... Nakladni zavod Znanje,. Zagreb, Croatia. Mladar N, Strikić F, Kovačević I (1990). Izvješće o radu za 1990 godinu. Institut za jadranske kulture i melioraciju krša, Split, Croatia. Monastra F, Della Strada G, Fideghelli C, Quarta R (1988). Supernova: une nouvelle varieté d'amandier obtenue par mutagenese.

  1. Synthesis of amides and sulfonamides of {beta}-D- galactopyranosylamine and {beta}-lactosylamine and evaluation of their interactions with the lectins from Erythrina cristagalli and Ricinus communis; Sintese de amidas e sulfonamidas de {beta}-D-galactopiranosilamina e {beta}-lactosilamina e avaliacao de suas interacoes com lectinas de Erythrina cristagalli e de Ricinus communis

    Energy Technology Data Exchange (ETDEWEB)

    Butera, Anna Paola; Souza Filho, Jose Dias de [Universidade Federal de Minas Gerais, Belo Horizonte, MG (Brazil). Dept. de Quimica; Carvalho, Diogo Teixeira; Figueiredo, Rute Cunha; Faria, Luiz Carlos Alves de; Nunes, Maria Angelica; Prado, Maria Auxiliadora Fontes; Alves, Ricardo Jose [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil). Faculdade de Farmacia. Dept. de Produtos Farmaceuticos]. E-mail: ricardodylan@farmacia.ufmg.br; Andrade, Milton Hercules Guerra de; Silva, Karina Taciana Santos [Universidade Federal de Ouro Preto (UFOP), MG (Brazil). Inst. de Ciencias Exatas e Biologicas. Dept. de Ciencias Biologicas

    2007-09-15

    We report herein the synthesis of some {beta}-D-galactopyranosylamine and {beta}-lactosylamine amides and sulfonamides. The interactions of these compounds with lectins from the seeds of Erythrina cristagalli (LEC) and Ricinus communis (RCA120) were evaluated in a hemagglutination inhibitory activity assay. D-Galactose and lactose were used as reference compounds. The {beta}-lactosylamine amides and sulfonamides were nearly as active as lactose in inhibiting LEC mediated hemagglutination and were less active against RCA120 agglutinin. The {beta}-D-galactopyranosylamine amides and sulfonamides were, with one exception, considerably less active than D-galactose in the assay with both lectins. (author)

  2. Estabilidade e eficácia de formulações cosméticas contendo extrato de Myrtus communis e um complexo vitamínico hidratante

    OpenAIRE

    Flavio Bueno de Camargo Junior

    2011-01-01

    Considerando que a tendência atual em termos de formulações cosméticas é a veiculação de diferentes substâncias ativas num mesmo produto, visando o sinergismo de efeito, o objetivo desse trabalho foi a avaliação da estabilidade, da segurança e da eficácia clínica de formulações cosméticas, contendo extrato de Myrtus communis e um complexo vitamínico hidratante à base de D-pantenol e derivados de vitaminas C e E, bem como a avaliação da atividade antioxidante in vitro do extrato objeto de estu...

  3. Optimization of Preparation of Activated Carbon from Ricinus communis Leaves by Microwave-Assisted Zinc Chloride Chemical Activation: Competitive Adsorption of Ni2+ Ions from Aqueous Solution

    Directory of Open Access Journals (Sweden)

    M. Makeswari

    2013-01-01

    Full Text Available The preparation of activated carbon (AC from Ricinus communis leaves was investigated in this paper. Orthogonal array experimental design method was used to optimize the preparation of AC using microwave assisted zinc chloride. Optimized parameters were radiation power of 100 W, radiation time of 8 min, concentration of zinc chloride of 30% by volume, and impregnation time of 24 h, respectively. The surface characteristics of the AC prepared under optimized conditions were examined by pHZPC, SEM-EDAX, XRD, and FTIR. Competitive adsorption of Ni2+ ions on Ricinus communis leaves by microwave assisted zinc chloride chemical activation (ZLRC present in binary and ternary mixture was compared with the single metal solution. The effects of the presence of one metal ion on the adsorption of the other metal ion were investigated. The experimental results indicated that the uptake capacity of one metal ion was reduced by the presence of the other metal ion. The extent of adsorption capacity of the binary and ternary metal ions tested on ZLRC was low (48–69% as compared to single metal ions. Comparisons with the biosorption of Ni2+ ions by the biomass of ZLRC in the binary (48.98–68.41%-~Ni-Cu and 69.76–66.29%-~Ni-Cr and ternary solution (67.32–57.07%-~Ni–Cu and Cr could lead to the conclusion that biosorption of Ni2+ ions was reduced by the influence of Cu2+ and Cr3+ ions. The equilibrium data of the adsorption was well fitted to the Langmuir isotherm. The adsorption process follows the pseudo-second-order kinetic model.

  4. Salts and nutrients present in regenerated waters induce changes in water relations, antioxidative metabolism, ion accumulation and restricted ion uptake in Myrtus communis L. plants.

    Science.gov (United States)

    Acosta-Motos, José R; Alvarez, Sara; Barba-Espín, Gregorio; Hernández, José A; Sánchez-Blanco, María J

    2014-12-01

    The use of reclaimed water (RW) constitutes a valuable strategy for the efficient management of water and nutrients in landscaping. However, RW may contain levels of toxic ions, affecting plant production or quality, a very important aspect for ornamental plants. The present paper evaluates the effect of different quality RWs on physiological and biochemical parameters and the recovery capacity in Myrtus communis L. plants. M. communis plants were submitted to 3 irrigation treatments with RW from different sources (22 weeks): RW1 (1.7 dS m(-1)), RW2 (4.0 dS m(-1)) and RW3 (8.0 dS m(-1)) and one control (C, 0.8 dS m(-1)). During a recovery period of 11 weeks, all plants were irrigated with the control water. The RW treatments did not negatively affect plant growth, while RW2 even led to an increase in biomass. After recovery,only plants irrigated with RW3 showed some negative effects on growth, which was related to a decrease in the net photosynthesis rate, higher Na accumulation and a reduction in K levels. An increase in salinity was accompanied by decreases in leaf water potential, relative water content and gas exchange parameters, and increases in Na and Cl uptake. Plants accumulated Na in roots and restricted its translocation to the aerial part. The highest salinity levels produced oxidative stress, as seen from the rise in electrolyte leakage and lipid peroxidation. The use of regenerated water together with carefully managed drainage practices, which avoid the accumulation of salt by the substrate, will provide economic and environmental benefits.

  5. Ricinus communis L. (castor bean) as a potential candidate for revegetating industrial waste contaminated sites in peri-urban Greater Hyderabad: remarks on seed oil.

    Science.gov (United States)

    Boda, Ravi Kiran; Majeti, Narasimha Vara Prasad; Suthari, Sateesh

    2017-08-01

    Ricinus communis L. (castor bean or castor oil plant) was found growing on metal-contaminated sites (4) of peri-urban Greater Hyderabad comprises of erstwhile industrial areas viz Bollaram, Patancheru, Bharatnagar, and Kattedan industrial areas. During 2013-2017, about 60 research papers have appeared focusing the role of castor bean in phytoremediation of co-contaminated soils, co-generation of biomaterials, and environmental cleanup, as bioenergy crop and sustainable development. The present study is focused on its use as a multipurpose phytoremediation crop for phytostabilization and revegetation of waste disposed peri-urban contaminated soils. To determine the plant tolerance level, metal accumulation, chlorophyll, protein, proline, lipid peroxidation, oil content, and soil properties were characterized. It was noticed that the castor plant and soils have high concentration of metals such as cadmium (Cd), lead (Pb), iron (Fe), manganese (Mn), and zinc (Zn). The soils have high phosphorous (P), adequate nitrogen (N), and low concentration of potassium (K). Iron (Fe) concentrations ranged from1672±50.91 to 2166±155.78 mg kg -1 in the soil. The trend of metal accumulation Fe>Zn>Mn>Pb>Cd was found in different plant parts at polluted sites. The translocation of Cd and Pb showed values more than one in industrial areas viz Bollaram, Kattedan, and Bharatnagar indicating the plants resistance to metal toxicity. Chlorophyll and protein content reduced while proline and malondialdehyde increased due to its tolerance level under metal exposure. The content of ricinoleic acid was higher, and the fatty acids composition of polluted areas was almost similar to that of the control area. Thus, R. communis L. can be employed for reclamation of heavy metal contaminated soils.

  6. Allelopatic effect of different caster bean organs (Ricinus communis L. on reducing germination and growth of dodder (Cuscuta campestris Yuncker

    Directory of Open Access Journals (Sweden)

    S.M Seyyedi

    2016-05-01

    Full Text Available Introduction Dodder (Cascuta campestris Yuncker is an annual parasitic plant from the Convolvulaceae family (Mishra et al., 2007. It wraps around many adjacent dicot and a few monocot plants, penetrates in their vascular tissue and exploits photosynthates, nutrients and water (Lanini & Kogan, 2005. Consequently, the growth, vigor and production of the host plant will be severely reduced (Nadler-Hasasr & Rubin, 2003. Dodder is not able to complete its cycle, if it is not attached to a host. Therefore, it is entirely dependent on its host for supplying water, assimilates and minerals (Mishra et al., 2007. Considering the nature of dodder habit, it is rarely possible to completely control dodder by using different chemical herbicides (Lanini & Kogan, 2005. In addition, because of increasing the environmental concerns caused by applying synthetic herbicides, there is considerable attention to alternative strategies for weeds management (Batish et al., 2002; Bowmik & Inderjit, 2003. In recent years, allelopathic plants, an alternative strategy for weed management, have received massive attention (Narwal, 2010; Jamil et al., 2009. Due to the importance of dodder as a parasitic weed, this research was conducted with the purpose of studying the allelopathic effects of aqueous extracts and decay durations of caster bean (Ricinus communis L. organs on germination and emergence of dodder. Materials and methods The current study was conducted based on three separate experiments using a completely randomized design (CRD with factorial arrangement with three replications. The first experiment was conducted in petri dishes and consisted of caster bean organs at four levels (root, stem, leaf and total plant without inflorescence and their aqueous extract concentrations at 11 levels (0, 1, 2, 3, 4, 5, 6, 7, 8, 9 and 10%. The second experiment was conducted in pots and factors were caster bean organs at 4 levels (root, stem, leaf and total plant without

  7. Effet comparé des poudres de Nicotiana tabacum L, Cymbopogon citratus (D.C. Stapf et de l'huile de Ricinus communis L sur la conservation des graines de Vigna unguiculata (L Walp

    Directory of Open Access Journals (Sweden)

    Gakuru, S.

    1995-01-01

    Full Text Available Compared Effect of Nicotiana tabacum L, Cymbopogon citratus (D.C. Stapf Powders and Castor Oil Ricinus communis L. on Conservation of Cowpea Vigna Unguiculata (L. Walp Grains. The effect of powder of tobacco Nicotiana tabacum L. and citronella grass Cymbopogon citratus (D.C. Stapf and castor oil Ricinus communis L. on conservation of cowpea Vigna unguiculata (L. Walp. grains was investigated in Kisangani, Zaire. After 5 months of conservation, infestation rates by bean weevil Acanthoscelides obtectus Say were 72.5 %, 74.5 %, 49.5 % and 5 % respectively for the check, the samples treated by 1 % of citronella grass and tobacco powder and 1 % of castor oil. The powder dose of 7.5 % did not give more interesting results.

  8. Dietary Myrtle (Myrtus communis L.) improved non-specific immune parameters and bactericidal activity of skin mucus in rainbow trout (Oncorhynchus mykiss) fingerlings.

    Science.gov (United States)

    Mansouri Taee, Hadis; Hajimoradloo, Abdolmajid; Hoseinifar, Seyed Hossein; Ahmadvand, Hassan

    2017-05-01

    The present study examined the effects of dietary Myrtle (Myrtus communis L.) on non-specific immune parameters and bactericidal activity of skin mucus in rainbow trout (Oncorhynchus mykiss) fingerlings. Three hundred and sixty fingerlings (6.50 ± 0.55 g (were distributed in twelve cages (65 × 65 × 65 cm) with a metal framework. The study included four treatments repeated in triplicates. The treatments were feeding trouts with experimental diets containing different levels (0, 0.5, 1 and 1.5%) of Myrtle powder. The fingerlings were fed on experimental diet for sixty days and then skin mucus non-specific immune parameters as well as bactericidal activity were measured. At the end of the trial, the highest skin mucus soluble protein level was observed in group fed with 1.5% Myrtle (P alkaline phosphatase (ALP) activity was significantly increased in fish groups fed 1 and 1.5% Myrtle compared with the control group (P  0.05). Also, no antibacterial activity was detected against Escherichia coli, Staphylococcus aureus and Salmonella enterica in all treatments and control group. Whereas skin mucus of rainbow trout showed antimicrobial activity against fish pathogens (Aeromonas hydrophila and Yersinia ruckeri) in 1 and 1.5% Myrtle treatments. These results indicated beneficial effects of dietary Myrtle on mucosal immune parameters of fingerling rainbow trout. Copyright © 2017. Published by Elsevier Ltd.

  9. Mining whole genomes and transcriptomes of Jatropha (Jatropha curcas) and Castor bean (Ricinus communis) for NBS-LRR genes and defense response associated transcription factors.

    Science.gov (United States)

    Sood, Archit; Jaiswal, Varun; Chanumolu, Sree Krishna; Malhotra, Nikhil; Pal, Tarun; Chauhan, Rajinder Singh

    2014-11-01

    Jatropha (Jatropha curcas L.) and Castor bean (Ricinus communis) are oilseed crops of family Euphorbiaceae with the potential of producing high quality biodiesel and having industrial value. Both the bioenergy plants are becoming susceptible to various biotic stresses directly affecting the oil quality and content. No report exists as of today on analysis of Nucleotide Binding Site-Leucine Rich Repeat (NBS-LRR) gene repertoire and defense response transcription factors in both the plant species. In silico analysis of whole genomes and transcriptomes identified 47 new NBS-LRR genes in both the species and 122 and 318 defense response related transcription factors in Jatropha and Castor bean, respectively. The identified NBS-LRR genes and defense response transcription factors were mapped onto the respective genomes. Common and unique NBS-LRR genes and defense related transcription factors were identified in both the plant species. All NBS-LRR genes in both the species were characterized into Toll/interleukin-1 receptor NBS-LRRs (TNLs) and coiled-coil NBS-LRRs (CNLs), position on contigs, gene clusters and motifs and domains distribution. Transcript abundance or expression values were measured for all NBS-LRR genes and defense response transcription factors, suggesting their functional role. The current study provides a repertoire of NBS-LRR genes and transcription factors which can be used in not only dissecting the molecular basis of disease resistance phenotype but also in developing disease resistant genotypes in Jatropha and Castor bean through transgenic or molecular breeding approaches.

  10. Long-term variability in terms of arrival and departure of whitethroat (Sylvia communis and chaffinch (Fringilla coelebs in the South-East of the lake Ladoga

    Directory of Open Access Journals (Sweden)

    Ufimtseva Anna

    2016-10-01

    Full Text Available In the annual cycle of birds several changing physiological states are marked out, and their duration is controlled by endogenous and environmental factors. The change in the annual cycle parameters influences the seasonal differences in the migratory behavior of species as a whole. The results of the analysis of arrival and departure terms of two bird species – long-distance migrant whitethroat (Sylvia communis and short-distance migrant chaffinch (Fringilla coelebs – are presented in this article. The research was based on the materials of the long-term monitoring of migration terms at the Ladoga ornithological station. The results of this research correlate to the studies of birds in the Western Europe. Annual variability of the first and last registration dates of the whitethroat is less pronounced than the dates of short-distance migrant – chaffinch. The both species have a trend to come earlier to the breeding area and to fly away later from this territory. At the same time the displacement of migration dates is significant and more long-lasting for chaffinch. In general, whitethroats stay in the South-East of the lake Ladoga on an average 8 days more, chaffinches – 31 days more (by the results of 40 years observation.

  11. CONTRIBUTIONS TO THE MORPHOLOGY OF POLLEN FROM SOME VARIETIES OF MALUS DOMESTICA, PYRUS COMMUNIS, PRUNUS DOMESTICA, PRUNUS PERSICA AND PRUNUS ARMENIACA

    Directory of Open Access Journals (Sweden)

    Nicoleta IANOVICI

    2010-01-01

    Full Text Available The objective of this study was to compare Rosaceae genotypes from for their pollen viability and morphology. The pollen of some varieties of Malus domestica, Pyrus communis, Prunus domestica, Prunus persica and Prunus armeniaca was identified. Pollen from mature anthers was collected. Pollen grains of all genera of Rosaceae surveyed occur as radially symmetric isopolar monads. The main aspect studied were the shape of pollen in the polar view (polar perimeter and polar area of pollen. Shape of pollen is triangular-obtuse-convex in polar view. The pollen class is trizonocolpate-obtus-triangular while the sculpturing of exine surface is striate. The number of colpi is three while the spines are absent. Apart from fully developed pollen grains, also much smaller, not completely developed pollen were found in the samples of the examined species. The viability of the pollen was determined on 1% 2,3,5-triphenyl tetrazolium chloride (TTC. Viable, semi-viable and dead pollen numbers and their percentages were determined. This stain test may be used to determine pollen viability in these species to provide only a rough estimate of viability. The results presented here are important for improving our understanding of Rosaceae reproduction biology. Knowledge of reproduction biology, particularly pollen viability and quality, is critical for the newly-developed cultivars.

  12. Responses of three different ecotypes of reed (Phragmites communis Trin.) to their natural habitats: leaf surface micro-morphology, anatomy, chloroplast ultrastructure and physio-chemical characteristics.

    Science.gov (United States)

    Liu, Yubing; Li, Xinrong; Liu, Meiling; Cao, Bo; Tan, Huijuan; Wang, Jin; Li, Xiaojun

    2012-02-01

    The adaptational characteristics due to long-term adaptation in the natural habitats of common reed (Phragmites communis Trin.) contrasted considerably among three different ecotypes: dune reed (DR), Gobi salt reed (GSR) and swamp reed (SR). The micromorphologies of leaf adaxial surfaces showed tapered setae and a non-smooth surface in DR, compound papillose structures with wax and hairs in GSR, but only papillose structures for the smooth surface of SR. Anatomical analysis showed that DR and GSR had higher bundle-sheath cell areas and a lower xylem/phloem ratio than SR. There were many sclerenchyma cells in vascular bundle of DR and GSR and crystal idioblasts in all ecotypes. Chloroplasts had ellipsoid shape in SR, but they were attached to the cell wall with oblong shape and contained many starch grains in DR and GSR. Higher concentrations of NO, H(2)O(2) and lipid peroxidation, higher ratio of carotenoids/chlorophyll and higher activities in T-AOC and SOD were found in DR and GSR. Na(+)/K(+)-ATPase and Ca(2+)/Mg(2+)-ATPase activities were greatest in GSR. All these data suggested that the greater relative stress tolerance of DR and GSR was due to a combination of morpho-anatomical adaptational characteristics and physio-chemical responses, and indicated the different mechanisms in their respective natural habitats. Copyright © 2011 Elsevier Masson SAS. All rights reserved.

  13. L’ACTIVITÉ DE LA SUPEROXYDE DISMUTASE ET DE LA CATALASE DANS LES FEUILLES DE GRAND ROSEAU (PHRAGMITES COMMUNIS, DANS LES LACS DE LA RIVIÈRE CIRIC

    Directory of Open Access Journals (Sweden)

    Anca Negura

    2007-12-01

    Full Text Available Notre travail a suivi l’activité de deux enzymes du stress oxydatif, la superoxyde dismutase (SOD et la peroxydase (POD, dans les feuilles de grand roseau (Phragmites communis provenues de plantes ayant atteint la maturité, qui poussent dans les lacs sur le parcours de la rivière Ciric. Parmi les quatre lacs considérés dans l’étude, nous avons remarqué des valeurs élevées de l’activité SOD dans les plantes provenues du lac Ciric I, comparativement aux valeurs normales pour cette enzyme. Cette croissance d’activité pourrait représenter une réponse des plantes au stress oxydatif, apparu probablement dans des conditions de faible pollution de ce lac. Pour toutes les plantes issues de tous les lacs étudiés, la peroxydase n’a pas présenté des valeurs d’activité pouvant soulever le problème de quelconque pollution.

  14. Preparation of low cost activated carbon from Myrtus communis and pomegranate and their efficient application for removal of Congo red from aqueous solution

    Science.gov (United States)

    Ghaedi, Mehrorang; Tavallali, Hossein; Sharifi, Mahdi; Kokhdan, Syamak Nasiri; Asghari, Alireza

    2012-02-01

    In this research, the potential applicability of activated carbon prepared from Myrtus communis (AC-MC) and pomegranate (AC-PG) as useful adsorbents for the removal of Congo red (CR) from aqueous solutions in batch method was investigated. The effects of pH, contact time, agitation time and amount of adsorbents on removal percentage of Congo red on both adsorbents were examined. Increase in pH up to 6 for AC-MC and pH 7 for AC-PG increase the adsorption percentage (capacity) and reach equilibrium within 30 min of contact time. Fitting the experimental data to conventional isotherm models like Freundlich, Langmuir, Tempkin and Dubinin-Radushkevich show that the experimental data fitted very well to the Freundlich isotherm for AC-MC and Langmuir isotherm for AC-PG. Fitting the experimental data to different kinetic models such as pseudo first-order, pseudo second-order, Elovich and intraparticle diffusion mechanism showed the applicability of a pseudo second-order with involvement of intraparticle diffusion model for interpretation of experimental data for both adsorbents. The adsorption capacity of AC-PG and AC-MC for the removal of CR was found to be 19.231 and 10 mg g -1. These results clearly indicate the efficiency of adsorbents as a low cost adsorbent for treatment of wastewater containing CR.

  15. CONSTRUCCIÓN DE UN REACTOR DISCONTINUO PARA LA OBTENCIÓN DE BIODIESEL A PARTIR DEL ACEITE DE Ricinus communis

    Directory of Open Access Journals (Sweden)

    Yolimar Fernández

    2014-01-01

    Full Text Available Se construyó un reactor discontinuo para obtener biodiesel a partir de 5 litros de extracto obtenido de la semilla de Ricinus communis. El reactor es de acero inoxidable, con longitud de 29 cm; diámetro interno de 15,24 cm y fondo cónico de 20cm de largo, espesor de la pared de 0,2cm, resistencia tubular de 1000 W y motor de 110 volt. Se extrajo y se comparó con las normas respectivas las propiedades físicas y químicas del aceite crudo. Se realizaron pruebas preliminares de transesterificación del aceite catalizadas con NaOH para constatar la viabilidad de la reacción y definir las condiciones operacionales. El biodiesel obtenido fue caracterizado y comparado con referencias presentes en la literatura. Los resultaron mostraron que es posible obtener el biocombustible en el reactor discontinuo con un grado de conversión 88%; confirmando su aplicación en reacciones de transesterificación en medio básico.

  16. Description of Some Ecological Factors in Three Forest Sites in Lorestan Province and Their Impact on Myrtle (Myrtus communis L. Essential Oil Yield and Chemical Components

    Directory of Open Access Journals (Sweden)

    Z. Mir-Azadi

    2013-03-01

    Full Text Available Due to the side effects of chemical drugs, special attention is given recently to pharmaceutical plants. Myrtle (Myrtus communis L. is one of the valuable pharmaceutical plants, which is distributed over the vast areas of Iran. Yield and components of essential oil of this plant is dependent on ecological and genetic factors. In order to describe some ecological factors that affect myrtle in Lorestan province, three forest sites (Sepiddasht, Chame-moord, and Hamzeh Camp were selected. Some effective ecological factors on type of essential oil were measured and compared among the sites. To compare the yield and components of essential oil, myrtle leaves were collected during flowering stage in each site. Leaves were dried in open air conditions and the oil was extracted by distillation. Yield of essential oil was calculated and its components were identified by GC and GC/MS. Results showed that maximum yield belongs to Sepiddasht site. The altitude and soil Na, P, and organic carbon content of this site is quite different from other two sites. The main components of essential oils of these three sites had considerable differences. The amount of 9,10 anthracenedione was 29.1% in Sepiddasht site, while it was not found in the oil of Chame-moord site. It seems that differences in ecological and soil properties of the tree sites could have major effect on essential oil yield and its composition.

  17. Life history of Neoseiulus californicus (McGregor, 1954 (Acari: Phytoseiidae fed with castor bean (Ricinus communisL. pollen in laboratory conditions

    Directory of Open Access Journals (Sweden)

    PP Marafeli

    Full Text Available The predatory mite, Neoseiulus californicus(McGregor, 1954 (Acari: Phytoseiidae is one of the principal natural enemies of tetranychid mites in several countries, promoting efficient control of those mites in several food and ornamental crops. Pest attacks such as that of the spider mite, Tetranychus urticaeKoch, 1836 (Acari: Tetranychidae, is one of the problems faced by farmers, especially in the greenhouse, due to the difficulty of its control with the use of chemicals because of the development of fast resistance making it hard to control it. The objective of this work was to study the life history of the predatory mite N. californicus as a contribution to its mass laboratory rearing, having castor bean plant [Ricinus communis L. (Euphorbiaceae] pollen as food, for its subsequent use as a natural enemy of T. urticae on a cultivation of greenhouse rosebushes. The studies were carried out in the laboratory, at 25 ± 2°C of temperature, 70 ± 10% RH and a 14 hour photophase. The biological aspects and the fertility life table were appraised. Longevity of 32.9 days was verified for adult females and 40.4 days for males. The intrinsic rate of increase (rm was 0.2 and the mean generation time (T was 17.2 days. The population doubled every 4.1 days. The results obtained were similar to those in which the predatory mite N. californicus fed on T. urticae.

  18. Norartocarpetin from a folk medicine Artocarpus communis plays a melanogenesis inhibitor without cytotoxicity in B16F10 cell and skin irritation in mice.

    Science.gov (United States)

    Ko, Horng-Huey; Tsai, Yi-Ting; Yen, Ming-Hong; Lin, Chun-Ching; Liang, Chan-Jung; Yang, Tsung-Han; Lee, Chiang-Wen; Yen, Feng-Lin

    2013-12-10

    Many natural products used in preventive medicine have also been developed as cosmeceutical ingredients in skin care products, such as Scutellaria baicalensis and Gardenia jasminoides. Norartocarpetin is one of the antioxidant and antityrosinase activity compound in Artocarpus communis; however, the cytotoxicity, skin irritation and antimelanogenesis mechanisms of norartocarpetin have not been investigated yet. In the present study, cell viability in vitro and skin irritation in vivo are used to determine the safety of norartocarpetin. The melanogenesis inhibition of norartocarpetin was determined by cellular melanin content and tyrosinase in B16F10 melanoma cell. Moreover, we examined the related-melanogenesis protein by western blot analysis for elucidating the antimelanogenesis mechanism of norartocarpin. The result of the present study demonstrated that norartocarpetin not only present non-cytotoxic in B16F10 and human fibroblast cells but also non-skin irritation in mice. Moreover, our result also first found that norartocarpetin downregulated phospho-cAMP response element-binding (phospho-CREB) and microphthalmia-associated transcription factor (MITF) expression, which in turn decreased both synthesis of tyrosinases (TRP-1 and TRP-2) and cellular melanin content. This process is dependent on norartocarpetin phosphorylation by mitogen-activated protein kinases such as phospho-JNK and phospho-p38, and it results in decreased melanogenesis. The present study suggests that norartocarpetin could be used as a whitening agent in medicine and/or cosmetic industry and need further clinical study.

  19. Carotenoid content of wild edible young shoots traditionally consumed in Spain (Asparagus acutifolius L., Humulus lupulus L., Bryonia dioica Jacq. and Tamus communis L.).

    Science.gov (United States)

    García-Herrera, Patricia; Sánchez-Mata, María Cortes; Cámara, Montaña; Tardío, Javier; Olmedilla-Alonso, Begoña

    2013-05-01

    Wild vegetables have traditionally been consumed as part of the Mediterranean diet, being valuable sources of nutrients and bioactive compounds. The objective of this work was to analyse the carotenoid content of the edible young shoots of four species (Asparagus acutifolius L., Humulus lupulus L., Bryonia dioica Jacq. and Tamus communis L.) as part of a wider study on the characterisation of the nutritional composition of wild edible plants commonly consumed in Spain. Samples were gathered from two locations in Central Spain for two consecutive years. Lutein, β-carotene, neoxanthin and violaxanthin were quantified by high-performance liquid chromatography with a photodiode array detector. Median concentration ranges (μg g(-1) edible wet weight) were: β-carotene, 3.39-6.69, lutein, 5.44–19.13;neoxanthin, 5.17-17.37; and violaxanthin, 2.08-8.93. The highest carotenoid content was that of B. dioica (59.01 μg g(-1)) and the lowest was found in A. acutifolius (17.58 μg g(-1)) [corrected]. Our results show that these wild young shoots are richer sources of carotenoids than many of the commercially available leafy vegetables. © 2012 Society of Chemical Industry.

  20. Acyl-ACP thioesterases from castor (Ricinus communis L.): an enzymatic system appropriate for high rates of oil synthesis and accumulation.

    Science.gov (United States)

    Sánchez-García, Alicia; Moreno-Pérez, Antonio J; Muro-Pastor, Alicia M; Salas, Joaquín J; Garcés, Rafael; Martínez-Force, Enrique

    2010-06-01

    Acyl-acyl carrier protein (ACP) thioesterases are enzymes that terminate the intraplastidial fatty acid synthesis in plants by hydrolyzing the acyl-ACP intermediates and releasing free fatty acids to be incorporated into glycerolipids. These enzymes are classified in two families, FatA and FatB, which differ in amino acid sequence and substrate specificity. In the present work, both FatA and FatB thioesterases were cloned, sequenced and characterized from castor (Ricinus communis) seeds, a crop of high interest in oleochemistry. Single copies of FatA and FatB were found in castor resulting to be closely related with those of Jatropha curcas. The corresponding mature proteins were heterologously expressed in Escherichia coli for biochemical characterization after purification, resulting in high catalytic efficiency of RcFatA on oleoyl-ACP and palmitoleoyl-ACP and high efficiencies of RcFatB for oleoyl-ACP and palmitoyl-ACP. The expression profile of these genes displayed the highest levels in expanding tissues that typically are very active in lipid biosynthesis such as developing seed endosperm and young expanding leaves. The contribution of these two enzymes to the synthesis of castor oil is discussed. Copyright 2010 Elsevier Ltd. All rights reserved.

  1. Rendimento e Características Físicas dos Óleos de Nim (Azadirachta indica e Mamona (Ricinus communis

    Directory of Open Access Journals (Sweden)

    Juarez Benigno Paes

    Full Text Available A pesquisa objetivou avaliar o rendimento e a viscosidade de óleos de nim (Azadirachta indica e mamona (Ricinus communis. Os frutos de nim foram coletados no Núcleo de Pesquisa do Semiárido, em Patos, Paraíba, e os de mamona, às margens do Rio Espinharas, Patos e em Igaracy, Paraíba. Os frutos foram beneficiados no Laboratório de Tecnologia de Produtos Florestais, em Patos. Foram retiradas amostras de sementes para a determinação do teor de umidade e do rendimento em óleos. Os óleos foram extraídos com álcool etílico absoluto e empregados no preparo de soluções com os óleos de nim e mamona. Determinaram-se a densidade e a viscosidade das soluções. A mamona teve menor teor de umidade e rendimento em óleo que o nim. A densidade e a viscosidade do óleo de nim foram menores que o da mamona. Uma maior quantidade de óleos de mamona proporcionou aumento na densidade e na viscosidade das soluções preparadas.

  2. Molybdenum (Mo) increases endogenous phenolics, proline and photosynthetic pigments and the phytoremediation potential of the industrially important plant Ricinus communis L. for removal of cadmium from contaminated soil.

    Science.gov (United States)

    Hadi, Fazal; Ali, Nasir; Fuller, Michael Paul

    2016-10-01

    Cadmium (Cd) in agricultural soil negatively affects crops yield and compromises food safety. Remediation of polluted soil is necessary for the re-establishment of sustainable agriculture and to prevent hazards to human health and environmental pollution. Phytoremediation is a promising technology for decontamination of polluted soil. The present study investigated the effect of molybdenum (Mo) (0.5, 1.0 and 2.0 ppm) on endogenous production of total phenolics and free proline, plant biomass and photosynthetic pigments in Ricinus communis plants grown in Cd (25, 50 and 100 ppm) contaminated soils and the potential for Cd phytoextraction. Mo was applied via seed soaking, soil addition and foliar spray. Foliar sprays significantly increased plant biomass, Cd accumulation and bioconcentration. Phenolic concentrations showed significantly positive correlations with Cd accumulation in roots (R 2  = 0.793, 0.807 and 0.739) and leaves (R 2  = 0.707, 721 and 0.866). Similarly, proline was significantly positively correlated with Cd accumulation in roots (R 2  = 0.668, 0.694 and 0.673) and leaves (R 2  = 0.831, 0.964 and 0.930). Foliar application was found to be the most effective way to deliver Mo in terms of increase in plant growth, Cd accumulation and production of phenolics and proline.

  3. Tableros de partículas de bambú (Bambusa vulgaris Schrad y resina poliuretana a base de aceite de rícino (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Flávio Januário José

    Full Text Available Esta investigación tiene como objetivo la elaboración y la evaluación de tableros de partículas homogéneas aglomeradas, utilizándose dos materiales alternativos en la búsqueda de la sustentabilidad del proceso productivo. Fueron utilizadas partículas de Bambusa vulgaris Schrad por la rapidez del ciclo de producción de esta especie de bambú. Como pegante fue utilizada la resina poliuretana a base de aceite de ricino (Ricinus communis L., por su origen parcialmente renovable, y por ser considerada no tóxica. Para la caracterización del material, fueron fabricadas, en escala de laboratorio, tableros de partículas de bambú con dimensiones inferiores al 2.4 mm, combinadas con 5%, 10% y 15% de resina en relación a la masa de partículas de bambú. Probetas fueron evaluadas de acuerdo con las especificaciones de la norma NBR 14810 - Tableros de madera aglomerada. Antes de los ensayos de compresión las probetas fueron evaluadas por medio del ensayo no destructivo por ultra-sonido. Los resultados obtenidos indicaron que los tableros con el contenido de 10% de resina no fue estadísticamente diferente al contenido de 15%, siendo ambos superiores al contenido de 5%. La mayoría de las propiedades de los tableros fueron inferiores a aquellas de los tableros comerciales. No fue posible correlacionar la velocidad del pulso de ultra-sonido con la resistencia a la compresión longitudinal.

  4. Repellency Effects of Essential Oils of Myrtle (Myrtus Communis, Marigold (Calendula Officinalis Compared with DEET Against Anopheles Stephensi on Human Volunteers

    Directory of Open Access Journals (Sweden)

    M Khoobdel

    2011-12-01

    Full Text Available Background: Malaria and leishmaniasis are two most significant parasitic diseases which are endemic in Iran. Over the past decades, interest in botanical repellents has increased as a result of safety to human. The comparative effi­cacy of essential oils of two native plants, myrtle (Myrtus communis and marigold (Calendula officinalis collected from natural habitats at southern Iran was compared with DEET as synthetic repellent against Anopheles stephensi on human subjects under laboratory condition. Methods: Essential oils from two species of native plants were obtained by Clevenger-type water distillation. The protec­tion time of DEET, marigold and myrtle was assessed on human subject using screened cage method against An. stephensi. The effective dose of 50% essential oils of two latter species and DEET were determined by modified ASTM method. ED50 and ED90 values and related statistical parameters were calculated by probit analysis. Results: The protection time of 50% essential oils of marigold and myrtle were respectively 2.15 and 4.36 hours com­pared to 6.23 hours for DEET 25%. The median effective dose (ED50 of 50% essential oils was 0.1105 and 0.6034 mg/cm2 respectively in myrtle and marigold. The figure for DEET was 0.0023 mg/cm2.Conclusion: This study exhibited that the repellency of both botanical repellents was generally lower than DEET as a synthetic repellent. However the 50% essential oil of myrtle showed a moderate repellency effects compared to mari­gold against An. stephensi.

  5. Repellency Effects of Essential Oils of Myrtle (Myrtus communis, Marigold (Calendula officinalis Compared with DEET against Anopheles stephensi on Human Volunteers

    Directory of Open Access Journals (Sweden)

    M Tavassoli

    2011-12-01

    Full Text Available Background: Malaria and leishmaniasis are two most significant parasitic diseases which are endemic in Iran. Over the past decades, interest in botanical repellents has increased as a result of safety to human. The comparative effi­cacy of essential oils of two native plants, myrtle (Myrtus communis and marigold (Calendula officinalis collected from natural habitats at southern Iran was compared with DEET as synthetic repellent against Anopheles stephensi on human subjects under laboratory condition. Methods:  Essential oils from two species of native plants were obtained by Clevenger-type water distillation. The protec­tion time of DEET, marigold and myrtle was assessed on human subject using screened cage method against An. stephensi. The effective dose of 50% essential oils of two latter species and DEET were determined by modified ASTM method. ED50 and ED90 values and related statistical parameters were calculated by probit analysis.   Results: The protection time of 50% essential oils of marigold and myrtle were respectively 2.15 and 4.36 hours com­pared to 6.23 hours for DEET 25%. The median effective dose (ED50 of 50% essential oils was 0.1105 and 0.6034 mg/cm2 respectively in myrtle and marigold. The figure for DEET was 0.0023 mg/cm2. Conclusion: This study exhibited that the repellency of both botanical repellents was generally lower than DEET as a synthetic repellent. However the 50% essential oil of myrtle showed a moderate repellency effects compared to mari­gold against An. stephensi.

  6. Family of Ricinus communis Monosaccharide Transporters and RcSTP1 in Promoting the Uptake of a Glucose-Fipronil Conjugate.

    Science.gov (United States)

    Mao, Gen-Lin; Yan, Yin; Chen, Yan; Wang, Bing-Feng; Xu, Fei-Fei; Zhang, Zhi-Xiang; Lin, Fei; Xu, Han-Hong

    2017-08-02

    Enhancing the systemic distribution of a bioactive compound by exploiting the vascular transport system of a plant presents a means of reducing both the volume and frequency of pesticide/fungicide application. The foliar uptake of the glucose-fipronil conjugate N-[3-cyano-1-[2,6-dichloro-4-(trifluoromethyl)phenyl]-4-[(trifluoromethyl)sulfinyl]-1H-pyrazol-5-yl]-1-(β-d-glucopyranosyl)-1H-1,2,3-triazole-4-methanamine (GTF) achieved in castor bean (Ricinus communis) and its transport via the phloem are known to be mediated by monosaccharide transporter(s) [MST(s)], although neither the identity of the key MST(s) involved nor the mechanistic basis of its movement have yet to be described. On the basis of homology with Arabidopsis thaliana sugar transporters, the castor bean genome was concluded to harbor 53 genes encoding a sugar transporter, falling into the eight previously defined subfamilies INT, PMT, VGT, STP, ERD6, pGlucT, TMT, and SUT. Transcriptional profiling identified the product of RcSTP1 as a candidate for mediating GTF uptake, because this gene was induced by exposure of the plant to GTF. When RcSTP1 was transiently expressed in onion epidermis cells, the site of RcSTP1 deposition was shown to be the plasma membrane. A functional analysis based on RcSTP1 expression in Xenopus laevis oocytes demonstrated that its product has a high affinity for GTF. The long-distance root-to-shoot transport of GTF was enhanced in a transgenic soybean chimera constitutively expressing RcSTP1.

  7. Quantitative Proteomics-Based Reconstruction and Identification of Metabolic Pathways and Membrane Transport Proteins Related to Sugar Accumulation in Developing Fruits of Pear (Pyrus communis).

    Science.gov (United States)

    Reuscher, Stefan; Fukao, Yoichiro; Morimoto, Reina; Otagaki, Shungo; Oikawa, Akira; Isuzugawa, Kanji; Shiratake, Katsuhiro

    2016-03-01

    During their 6 month development, pear (Pyrus communis) fruits undergo drastic changes in their morphology and their chemical composition. To gain a better understanding of the metabolic pathways and transport processes active during fruit development, we performed a time-course analysis using mass spectrometry (MS)-based protein identification and quantification of fruit flesh tissues. After pre-fractionation of the samples, 2,841 proteins were identified. A principal component analysis (PCA) separated the samples from seven developmental stages into three distinct clusters representing the early, mid and late developmental phase. Over-representation analysis of proteins characteristic of each developmental phase revealed both expected and novel biological processes relevant at each phase. A high abundance of aquaporins was detected in samples from fruits in the cell expansion stage. We were able quantitatively to reconstruct basic metabolic pathways such as the tricarboxylic acid (TCA) cycle, which indicates sufficient coverage to reconstruct other metabolic pathways. Most of the enzymes that presumably contribute to sugar accumulation in pear fruits could be identified. Our data indicate that invertases do not play a major role in the sugar conversions in developing pear fruits. Rather, sucrose might be broken down by sucrose synthases. Further focusing on sugar transporters, we identified several putative sugar transporters from diverse families which showed developmental regulation. In conclusion, our data set comprehensively describes the proteome of developing pear fruits and provides novel insights about sugar accumulation as well as candidate genes for key reactions and transport steps. © The Author 2016. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  8. Tissue-specific expression and post-translational modifications of plant- and bacterial-type phosphoenolpyruvate carboxylase isozymes of the castor oil plant, Ricinus communis L.

    Science.gov (United States)

    O’Leary, Brendan; Fedosejevs, Eric T.; Hill, Allyson T.; Bettridge, James; Park, Joonho; Rao, Srinath K.; Leach, Craig A.; Plaxton, William C.

    2011-01-01

    This study employs transcript profiling together with immunoblotting and co-immunopurification to assess the tissue-specific expression, protein:protein interactions, and post-translational modifications (PTMs) of plant- and bacterial-type phosphoenolpyruvate carboxylase (PEPC) isozymes (PTPC and BTPC, respectively) in the castor plant, Ricinus communis. Previous studies established that the Class-1 PEPC (PTPC homotetramer) of castor oil seeds (COS) is activated by phosphorylation at Ser-11 and inhibited by monoubiquitination at Lys-628 during endosperm development and germination, respectively. Elimination of photosynthate supply to developing COS by depodding caused the PTPC of the endosperm and cotyledon to be dephosphorylated, and then subsequently monoubiquitinated in vivo. PTPC monoubiquitination rather than phosphorylation is widespread throughout the castor plant and appears to be the predominant PTM of Class-1 PEPC that occurs in planta. The distinctive developmental patterns of PTPC phosphorylation versus monoubiquitination indicates that these two PTMs are mutually exclusive. By contrast, the BTPC: (i) is abundant in the inner integument, cotyledon, and endosperm of developing COS, but occurs at low levels in roots and cotyledons of germinated COS, (ii) shows a unique developmental pattern in leaves such that it is present in leaf buds and young expanding leaves, but undetectable in fully expanded leaves, and (iii) tightly interacts with co-expressed PTPC to form the novel and allosterically-desensitized Class-2 PEPC heteromeric complex. BTPC and thus Class-2 PEPC up-regulation appears to be a distinctive feature of rapidly growing and/or biosynthetically active tissues that require a large anaplerotic flux from phosphoenolpyruvate to replenish tricarboxylic acid cycle C-skeletons being withdrawn for anabolism. PMID:21841182

  9. Irrigation of Castor Bean (Ricinus communis L. and Sunflower (Helianthus annus L. Plant Species with Municipal Wastewater Effluent: Impacts on Soil Properties and Seed Yield

    Directory of Open Access Journals (Sweden)

    Vasileios A. Tzanakakis

    2011-11-01

    Full Text Available The effects of plant species (castor bean (Ricinus communis L. versus sunflower (Helianthus annus L. and irrigation regime (freshwater versus secondary treated municipal wastewater on soil properties and on seed and biodiesel yield were studied in a three year pot trial. Plant species were irrigated at rates according to their water requirements with either freshwater or wastewater effluent. Pots irrigated with freshwater received commercial fertilizer, containing N, P, and K, applied at the beginning of each irrigation period. The results obtained in this study showed that irrigation with effluent did not result in significant changes in soil pH, soil organic matter (SOM, total kjeldahl nitrogen (TKN, and dehydrogenase activity, whereas soil available P was found to increase in the upper soil layer. Soil salinity varied slightly throughout the experiment in effluent irrigated pots but no change was detected at the end of the experiment compared to the initial value, suggesting sufficient salt leaching. Pots irrigated with effluent had higher soil salinity, P, and dehydrogenase activity but lower SOM and TKN than freshwater irrigated pots. Sunflower showed greater SOM and TKN values than castor bean suggesting differences between plant species in the microorganisms carrying out C and N mineralization in the soil. Plant species irrigated with freshwater achieved higher seed yield compared to those irrigated with effluent probably reflecting the lower level of soil salinity in freshwater irrigated pots. Castor bean achieved greater seed yield than sunflower. Biodiesel production followed the pattern of seed yield. The findings of this study suggest that wastewater effluent can constitute an important source of irrigation water and nutrients for bioenergy crop cultivations with minor adverse impacts on soil properties and seed yield. Plant species play an important role with regard to the changes in soil properties and to the related factors of

  10. Agronomic Management under Organic Farming May Affect the Bioactive Compounds of Lentil (Lens culinaris L. and Grass Pea (Lathyrus communis L.?

    Directory of Open Access Journals (Sweden)

    Valeria Menga

    2014-02-01

    Full Text Available A two year field experiment was carried out to evaluate the effects of three row and eight row seeding on the total phenolic compound (TPC, total flavonoid content (TFC, hydrolyzed (HTC and condensed tannin (CTC, antioxidant activity (ABTS assay, protein content and soluble dietary fiber (SDF and insoluble dietary fiber (IDF in the extracts of lentil (Lens culinaris L. and grass pea (Lathyrus communis L. cultivated under organic farming. The aim of this study was to determine whether row spacing used for seeding in organic farming systems for lentil and grass pea is a suitable method to increase the accumulation of antioxidant compounds in these crops. Grass pea showed the highest mean SDF and protein while lentil varieties showed the greatest and significant content of all of the antioxidant compounds. In lentil, there were increases in TPC (52%, HTC (73%, TFC (85% and CTC (41%, passing from three rows to eight rows, while in grass pea, the increases were lower, and only significant for TFC and CTC (37%, 13% respectively. In both lentils and grass pea, the highest correlation coefficient was between TPC and HTC, which indicates that the HTC includes the predominant phenolic compounds in lentil as well as in grass pea (r = 0.98, 0.71 p < 0.001, respectively. Regardless of legume species, TPC, HTC, TFC and CTC showed significant (p < 0.001 and linear correlations with the ABTS assay. These data confirm the key role of row spacing for the improvement of the antioxidant properties of lentil in organic farming; moreover, they hint at the major responsiveness and adaptation of lentil to environmental stimulus with respect to grass pea.

  11. Defining a safe zone of dissection during the extensor digitorum communis splitting approach to the proximal radius and forearm: an anatomic study.

    Science.gov (United States)

    Schimizzi, Aimee; MacLennan, Allison; Meier, Kristen M; Chia, Benjamin; Catalano, Louis W; Glickel, Steven Z

    2009-09-01

    The extensor digitorum communis (EDC) splitting approach is a direct lateral approach that can provide greater visualization of the proximal radius than the posterolateral approach to the elbow. The purposes of this study were to identify the anatomic relationships of the posterior interosseous nerve (PIN) during the EDC splitting approach to the proximal radius and to determine its safe zone. A fellowship-trained attending hand surgeon performed the EDC splitting approach on 15 cadaveric arms, exposing the EDC origin from the lateral epicondyle and dissecting distally to expose the supinator muscle. Calipers were used to measure the distance from the PIN to the radiocapitellar joint and to the lateral epicondyle in neutral position, full supination, and full pronation. The depth of the nerve from the most superficial aspect of the EDC was recorded for each cadaver. The average distances from the radiocapitellar joint to the PIN in neutral, supination, and pronation were 44.5 +/- 7.9, 40.8 +/- 8.1, and 48.2 +/- 7.9 mm, respectively. The average distances from the lateral epicondyle to the PIN in neutral, supination, and pronation were 61.7 +/- 10.9, 57.6 +/- 9.1, and 64.7 +/- 11.5 mm, respectively. The shortest distance measured from the radiocapitellar joint to the PIN in pronation was 29 mm; the shortest distance measured from the lateral epicondyle to the nerve was 42 mm. The average depth of the nerve from the most superficial aspect of the EDC was 10.2 +/- 2.4 mm. The PIN is generally safe when dissecting up to 29 mm from the radiocapitellar joint and up to 42 mm from the lateral epicondyle with the forearm in pronation.

  12. RELACIÓN ENTRE VARIABLES CLIMÁTICAS CON LA MORFOLOGÍA Y CONTENIDO DE ACEITE DE SEMILLAS DE HIGUERILLA (Ricinus communis L. DE CHIAPAS

    Directory of Open Access Journals (Sweden)

    María Antonieta Goytia-Jiménez

    2011-01-01

    Full Text Available Ciento cincuenta y un accesiones de higuerilla (Ricinus communis L., colectadas en el estado de Chiapas, México, fueron caracterizadas por contenido de aceite, forma, tamaño y peso de la semilla, con el objetivo de generar información que pueda servir de base en un programa de mejoramiento para esta especie, que podría ser una opción rentable para la producción de biodiesel y bioturbosina. De acuerdo con su distribución, se establecieron las cuatro siguientes zonas climáticas: Región 1 clima Lluvioso tropical sin estación seca; Región 2 Sabana tropical con inviernos secos; Región 3 Sabana tropical con inviernos menos secos que la Región 2, y Región 4 Lluvioso Tropical. Se encontró una amplia variación en tamaño (de 0.05 a 2.49 cm2, color, peso (desde 7 hasta 123.9 g por cada 100 semillas y contenido de aceite (desde 12.20 a 64.84 %. Las asociaciones que se establecieron entre el tamaño y peso de 100 semillas con temperatura y precipitación fueron negativas, y significativas sólo en las regiones 3 y 4. No hubo significancia para las asociaciones del contenido de aceite con temperatura y precipitación, pero la tendencia fue a ser positivas en las regiones 1 y 4, las de mayor humedad de las cuatro regiones, y negativas en las regiones 2 y 3. Se concluye que los individuos de esta especie presentan una gran adaptación a diferentes entornos y crean fenotipos especiales para cada lugar en donde se desarrollan.

  13. Ocorrência de Selenaspidus articulatus (Morgan (Hemiptera, Diaspididae e do predador Pentilia egena (Mulsant (Coleoptera, Coccinelidae em Myrtus communis L. (Myrtaceae, em Pinheiral, RJ Occurrence of Selenaspidus articulatus (Morgan (Hemiptera, Diaspididae and of the predator Pentilia egena (Mulsant (Coleoptera, Coccinelidae on Myrtus communis L. (Myrtaceae, in Pinheiral County, Rio de Janeiro, Brazil

    Directory of Open Access Journals (Sweden)

    Edson Henrique de Azeredo

    2004-12-01

    Full Text Available As avaliações foram realizadas, semanalmente, durante os estádios vegetativo e de floração/frutificação em quatro quadrantes (N, S, L, O da planta. Foram coletadas 2.230 espécimes de S. articulatus, sendo 1.224 no estágio vegetativo e 1.006 no florescimento/frutificação, sendo 59,8% adultos. De um total de 965 P. egena, 416 foram imaturos e 549 adultos. As principais conclusões deste trabalho são: (1 M. communis pode ser indicada como planta isca; (2 esta planta pode ser cultivada ou não próxima às culturas de importância econômica, pois funciona como um repositório da praga ou de seu inimigo natural; (3 a relação predador/presa/quadrante da planta/estágio fenológico foi, respectivamente, 1,14:1,0 e 1,0:1,08 nos quadrantes norte e leste; enquanto, à sul e oeste da planta M. communis foi de 1,0:2,26 e 1,0:2,80; (4 a predação de S. articulatus por P. egena ocorreu, em média, de 1,0 a 2,8 ninfas e 1,66 a 4,44 adultos (no estágio vegetativo e de 1,0-3,76 a 1,0-3,98 (no estágio de florescimento/frutificação, com diferenças significativas em PThe evaluations were conducted weekly in the vegetative and blooming/fructification phases in four quadrants (N, S, E, W of the plant. It was collected 2,230 specimens of S. articulatus, 1,224 in the vegetative phase and 1,006 in the blooming/fructification, being 59,8% adults. From the total of 965 of P. egena, 416 were immatures and 549 adults. The main conclusions are: (1 M. communis may be indicated as plant bait; (2 this plant, may be cultivated or not around the crops of economic importance, because it may function as a reservoir of the pest or of its natural enemies; (3 the relation predator/prey/plant quadrant/phenology phases was, respectivelly, 1.14:1.0 and 1.0:1,08 in north and east quadrant; while in south and west quadrant was 1.0:2.26 and 1.0:2.80; and, (4 the predaction of S. articulatus by P. egena was, in average, 1.02.8 nymphs and 1.664.44 adults (in vegetative

  14. Efeitos da exposição ao pesticida carbofurano em duas espécies de microalgas (Desmodesmus communis e Pediastrum boryanum) e seu potencial de biorremediação

    OpenAIRE

    Luz, Daniéli Saul da

    2014-01-01

    As microalgas são organismos de extrema importância responsáveis pela produção de matéria orgânica e oxigênio nos ambientes aquáticos, portanto, qualquer alteração causada por agrotóxicos na estrutura e/ou função desses organismos podem acarretar graves consequências para a biota. Nesta linha,, os efeitos tóxicos do pesticida carbofurano foram avaliados sobre duas espécies de microalgas da Classe Chlorophyceae, Pediastrum boryanum e Desmodesmus communis, a partir da mensuração ...

  15. Chemical composition and antimicrobial effects of essential oils of Eucalyptus globulus, Myrtus communis and Satureja hortensis against Escherichia coli O157:H7 and Staphylococcus aureus in minced beef.

    Science.gov (United States)

    Djenane, D; Yangüela, J; Amrouche, T; Boubrit, S; Boussad, N; Roncalés, P

    2011-12-01

    Essential oils (EOs) extracted by hydrodistillation from leaf parts of Algerian Eucalyptus globulus, Myrtus communis and Satureja hortensis were analyzed by gas chromatography/mass spectrometry (GC/MS). The main components of EOs obtained were γ-terpinene (94.48%), 1,8-cineole (46.98%) and carvacrol (46.10%), respectively, for E. globulus, M. communis and S. hortensis. The in vitro antimicrobial activity of the EOs was evaluated against Staphylococcus aureus CECT 4459 and Escherichia coli O157:H7 CECT 4267 using the agar diffusion technique. Results revealed that E. globulus and S. hortensis EOs had more antibacterial effects than that from M. communis. Minimal inhibitory concentrations (MIC) showed a range of 0.05-0.22% (volume by volume [v/v]). Sensitivity of gram-positive S. aureus was much higher than that of gram-negative E. coli. Plant EOs were added to minced beef (two-fold MIC value) at 0.10-0.44%, experimentally inoculated with the same pathogens at a level of 5 × 10(5) colony forming units (cfu)/g and stored at 5 ± 2 °C. Results showed that the EOs of E. globulus and S. hortensis had remarkable antibacterial properties, higher than that of M. communis, against S. aureus and E. coli. Indeed, a reduction of 5.8 log cfu/g (70.74% of reduction) was recorded after 7 days of storage for S. hortensis against E. coli. However, regarding S. aureus, both S. hortensis and E. globulus caused a highly significant (p < 0.05) decrease of microbial counts, most evident after 5 days of storage; S. aureus numbers were 3.50 and 2.50 cfu/g, respectively, corresponding to a reduction of 2.20 and 3.20 log cfu/g (38.60 and 56.14% of reduction) after 1 week of storage. Sensory evaluation revealed that the aroma of minced beef meat treated with EOs was acceptable by panelists at the levels used.

  16. Secondary seed dispersal of Ricinus communis Linnaeus (Euphorbiaceae by ants in secondary growth vegetation in Minas Gerais Dispersão secundária de sementes de Ricinus communis Linnaeus (Euphorbiaceae por formigas em vegetação secundária em Minas Gerais

    Directory of Open Access Journals (Sweden)

    Mário Marcos do Espírito Santo

    2007-12-01

    Full Text Available In this study, I tested the efficacy of ants as secondary seed dispersers of Ricinus communis in southeastern Brazil. In a natural population of 143 individuals, I determined the ballistic dispersal distance for 62 seeds and 100 additional seeds were experimentally offered to ants in groups of ten seeds along a transect of 50 m. Fifty-three seeds were removed by ants, mainly by the leafcutter Atta sexdens (90.4%. The dispersal distance by ants was high, compared to the global average (4.38 m ± 0.74 m vs. 0.96 m, but was lower than the ballistic distance (7.27 m ± 0.13 m. Ants increased the total dispersal distance (8.66 m ± 0.60 m, but the main benefit for the plant was the directed dispersal, with seed deposition on the enriched soil of ant nests.Este estudo testou a eficiência de formigas como dispersores secundários de Ricinus communis no Brasil. Em uma população natural de 143 indivíduos, a distância de dispersão balística foi determinada para 62 sementes. Além disso, 100 sementes adicionais foram oferecidas a formigas em grupos de 10, ao longo de um transecto de 50 m. Cinqüenta e três sementes foram removidas por formigas, principalmente pela formiga-cortadeira Atta sexdens (90,4%. A distância de dispersão por formigas foi alta se comparada à média global (4,38m ± 0,74 m vs. 0,96 m, porém menor que a distância de dispersão balística (7,27 m ± 0,13 m. As formigas aumentaram a distância de dispersão total (8,66 m ± 0,60 m, mas o principal benefício para a planta foi a dispersão direcionada, com a deposição das sementes no solo enriquecido encontrado nos ninhos das formigas.

  17. Evaluación de dos sistemas de riego por goteo en la producción y la calidad de la fruta de pera (Pyrus communis L. variedad Triunfo de Viena Evaluation of two drip irrigation systems in production and fruit quality of pear (Pyrus communis L. cv. Triunfo de Viena

    Directory of Open Access Journals (Sweden)

    María Cristina Arenas-Bautista

    2012-01-01

    Full Text Available El objetivo del presente estudio fue evaluar el efecto de la utilización del sistema de doble línea de riego versus el tradicional de una línea por hilera de plantas en la producción y calidad de la pera (Pyrus communis variedad Triunfo de Viena. La investigación se basó en la aplicación de dos tratamientos definidos, uno consistente en una línea de goteo por hilera de plantas con seis emisores de 8 lt/h y otro, con dos líneas de goteo por hilera de plantas con tres emisores de 8 lt/h cada uno Se utilizaron sensores Watermark para medir y controlar el potencial matricial del suelo. Se cubrió el 100% de la evapotranspiración potencial que fue de 55.5 mm/mes. Los resultados obtenidos de las variables hídricas del suelo permitieron programar el riego y garantizar el suministro de agua adecuado en el periodo de déficit hídrico. El tratamiento de doble línea no difirió significativamente del control, lo que indica que utilizar una línea de riego permite obtener una producción y calidad similares con un menor costo inicial del equipo.The rational use of water becomes every day ever more important in fruit production. The aim of this study was to evaluate the effect of the use of double drip line from a line by line plant in pear (Pyrus communis production, cv. Triunfo de Viena. The research was based on the application of two specific processes, one consisting of a drip line per row of plants with six emitters of 8 lt h-1 and another with two drip lines per row of plants with three emitters of 8 lt h-1 each. Watermark sensors were used to measure and control the soil matric potential. It covered 100% of potential evapotranspiration, which amounted to 55.5 mm month-1. The results of the variables permitted ground water irrigation scheduling and ensure adequate water supply during the period of water deficit. The double-line treatment did not differ significantly from the control in terms of production and fruit quality, which

  18. Síntese de amidas e sulfonamidas de beta-D-galactopiranosilamina e beta-lactosilamina e avaliação de suas interações com lectinas de Erythrina cristagalli e de Ricinus communis Synthesis of amides and sulfonamides of beta-D- galactopyranosylamine and beta-lactosylamine and evaluation of their interactions with the lectins from Erythrina cristagalli and Ricinus communis

    Directory of Open Access Journals (Sweden)

    Anna Paola Butera

    2007-10-01

    Full Text Available We report herein the synthesis of some beta-D-galactopyranosylamine and beta-lactosylamine amides and sulfonamides. The interactions of these compounds with lectins from the seeds of Erythrina cristagalli (LEC and Ricinus communis (RCA120 were evaluated in a hemagglutination inhibitory activity assay. D-Galactose and lactose were used as reference compounds. The beta-lactosylamine amides and sulfonamides were nearly as active as lactose in inhibiting LEC mediated hemagglutination and were less active against RCA120 agglutinin. The beta-D-galactopyranosylamine amides and sulfonamides were, with one exception, considerably less active than D-galactose in the assay with both lectins.

  19. Ricinus communis agglutinin-mediated agglutination and fusion of glycolipid-containing phospholipid vesicles: effect of carbohydrate head group size, calcium ions, and spermine.

    Science.gov (United States)

    Hoekstra, D; Düzgüneş, N

    1986-03-25

    The glycolipids galactosylcerebroside (GalCer), lactosylceramide (LacCer), and trihexosylceramide (Gb3) were inserted into phospholipid vesicles, consisting of phosphatidylethanolamine and phosphatidic acid. The extent to which their carbohydrate head groups protruded beyond the vesicle surface and their interference with membrane approach were examined by determining vesicle susceptibility toward type I Ricinus communis agglutinin (RCA1) induced agglutination and Ca2+- and spermine-induced aggregation and fusion either in the presence or in the absence of the lectin. The initial agglutination rates increased in the order GalCer much less than LacCer less than Gb3, while a reversed order was obtained for Ca2+- and spermine-induced aggregation and fusion, indicating an enhanced steric interference on close approach of bilayers with increasing head group size. The lectin-mediated agglutination rates for LacCer- and Gb3-containing vesicles increased by an order of magnitude when Ca2+ was also included in the medium, at a concentration that did not induce aggregation per se. Charge neutralization could not account for this observation as the polyvalent cation spermine did not display this synergistic effect with RCA1. Addition of Ca2+ to preagglutinated vesicles substantially reduced the threshold cation concentration for fusion (micromolar vs. millimolar). Quantitatively, this concentration decreased with decreasing carbohydrate head group size, indicating that the head group protrusion determined the interbilayer distance within the vesicle aggregate. The distinct behavior of Ca2+ vs. spermine on RCA1-induced agglutination on the one hand and fusion on the other indicated that Ca2+ regulates the steric orientation of the carbohydrate head group, which appears to be related to its ability to dehydrate the bilayer. As a result, lectin agglutinability becomes enhanced while fusion will be interrupted as the interbilayer distance increases, the threshold head group size

  20. Influence of Calcium Chloride (CaCl/sub 2/) on Fruit Quality of Pear (Pyrus communis) cv. le conte During Storage

    International Nuclear Information System (INIS)

    Sajid, M.; Mukhtiar, M.; Rab, M.; Shah, S.R.; Jan, I.

    2014-01-01

    An experiment was conducted at Postharvest laboratory, Department of Horticulture, The University of Agriculture Peshawar, during 2010 to evaluate the 'Influence of calcium chloride (CaCl/sub 2/) on fruit quality of pear (Pyrus communis) cv. Le-conte'. The experiment was laid out in Randomized Complete Block Design (RCBD) with three factors i.e. (CaCl/sub 2/) concentration (0,3,6 and 9%), dipping time (5,10 and 15 minutes) and storage durations (0,10,20,30 and 40 days). The maximum ascorbic acid (7.93 mg/100 g), reducing sugar (5.86%), while the least percent weight loss (4.52%), pH of fruit juice (4.42), total soluble solids (TSS) (19.83%) and percent disease incidence (2.56%) were observed in fruits treated with 9% CaCl/sub 2/ solution. The dipping time also significantly influenced the quality attributes of pear fruits during storage. The more ascorbic acid (6.88 mg/100 g) and reducing sugar (5.44%) were recorded in the pear fruits dipped for 15 minutes. Storage duration significantly affected the fruit quality 40 days storage. The highest reducing sugar recorded in fresh pear fruits while the highest ascorbic acid (7.83 mg/100 g) were observed in pear fruit stored for 10 days storage duration, while more non-reducing sugar (7.03%) recorded in the fruits stored for 30 days. In the interaction of CaCl/sub 2/ concentration x dipping time, the highest total soluble solid (31.88%) noted in the fruits stored for 40 days and dipped for 5 minutes in CaCl/sub 2/ solution. It is concluded that pear fruit perform best in the postharvest life when treated with 9% CaCl/sub 2/ solution and dipped for 15 minutes. It retained most of the quality attributes up to 10 days storage at ambient temperature while a significant decline was recorded in fruit quality when extended the storage duration from 20 to 40 days. (author)

  1. Concentric needle single fiber electromyography: normative jitter values on voluntary activated Extensor Digitorum Communis Eletromiografia de fibra única com agulha concêntrica: valores normativos do jitter no estudo por contração voluntária do músculo Extensor Digitorum Communis

    Directory of Open Access Journals (Sweden)

    João Aris Kouyoumdjian

    2007-06-01

    Full Text Available Single fiber electromyography (SFEMG is the most sensitive clinical neurophysiological test for neuromuscular junction disorders, particularly myasthenia gravis. Normal values for jitter obtained with SFEMG electrode have been published, but there are few publications for concentric needle electrode (CNE. The aim of this study was to discuss the possibilities to analyse the jitter in CNE recordings and to get normal values of jitter for voluntary activated Extensor Digitorum Communis using disposable CNE. Fifty normal subjects were studied, 16 male and 34 female with a mean age of 37.1±10.3 years (19-55. The jitter values of action potentials pairs of isolated muscular fibers were expressed as the mean consecutive difference (MCD after 20 analysed potential pairs. The mean MCD (n=50 obtained was 24.2±2.8 µs (range of mean values in each subject was 18-31. Upper 95% confidence limit is 29.8 µs. The mean jitter of all potential pairs (n=1000 obtained was 24.07±7.30 µs (range 9-57. A practical upper limit for individual data is set to 46 µs. The mean interpotential interval (MIPI was 779±177 µs (range of individual mean values was 530-1412; there were no potentials with impulse blocking. The present study confirms that CNE is suitable for jitter analysis although certain precautions must be mentioned. Our findings of jitter values with CNE were similar to some other few reports in literature.Eletromiografia de fibra única (SFEMG é o método eletrofisiológico mais sensível para diagnóstico das desordens de junção neuromuscular, particularmente miastenia gravis. Jitter obtido por meio de eletrodo de SFEMG já foi padronizado, porém há poucas publicações com uso de eletrodo de agulha concêntrica (CNE. O objetivo deste estudo é discutir as possibilidades de analisar o jitter por registro com CNE e obter valores normativos para o músculo Extensor Digitorum Communis por ativação muscular mínima. Foram estudados 50 indiv

  2. Growth and carbon assimilation limitations in Ricinus communis (Euphorbiaceae under soil water stress conditions Crescimento e limitações à assimilação de carbono em Ricinus communis (Euphorbiaceae sob condições de estresse hídrico do solo

    Directory of Open Access Journals (Sweden)

    Tanise Luisa Sausen

    2010-09-01

    Full Text Available Water availability may influence plant carbon gain and growth, with large impacts on plant yield. Ricinus communis (L., a drought resistant species, is a crop with increasing economic importance in Brazil, due to its use in chemical industry and for the production of biofuels. Some of the mechanisms involved in this drought resistance were analyzed in this study by imposing progressive water stress to pot-grown plants under glasshouse conditions. Water withholding for 53 days decreased soil water gravimetric content and the leaf water potential. Plant growth was negatively and significantly reduced by increasing soil water deficits. With irrigation suspension, carbon assimilation and transpiration were reduced and remained mostly constant throughout the day. Analysis of A/Ci curves showed increased stomatal limitation, indicating that limitation imposed by stomatal closure is the main factor responsible for photosynthesis reduction. Carboxylation efficiency and electron transport rate were not affected by water stress up to 15 days after withholding water. Drought resistance of castor bean seems to be related to a pronounced, early growth response, an efficient stomatal control and the capacity to keep high net CO2 fixation rates under water stress conditions.A disponibilidade hídrica pode influenciar o ganho de carbono e o crescimento, com grande impacto na produtividade das plantas. Ricinus communis (L., uma espécie resistente à seca, é uma cultura de grande importância econômica no Brasil, devido ao seu uso na indústria química e para a produção de biocombustíveis. Alguns dos mecanismos envolvidos na resistência à seca desta espécie foram analisados através de um progressivo estresse hídrico em plantas cultivadas em vasos sob condições de casa de vegetação. A suspensão da irrigação por 53 dias decresceu o conteúdo gravimétrico de água no solo e o potencial hídrico das folhas. O crescimento das plantas foi

  3. Avaliação de fungicidas, óleos essenciais e agentes biológicos no controle de Amphobotrys ricini em mamoneira (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Haroldo Antunes Chagas

    2014-03-01

    Full Text Available A mamoneira (Ricinus communis L. é uma espécie oleaginosa tropical, sendo o óleo extraído de suas sementes um dos mais versáteis da natureza e com inúmeras aplicações industriais. Embora ainda seja uma espécie rústica, ela está sujeita a diversas doenças, dentre elas o mofo-cinzento, causada pelo fungo Amphobotrys ricini. O melhoramento genético seria a melhor alternativa para o controle da doença, mas demanda tempo para se obter cultivares resistentes. Dessa maneira, o uso de métodos de controle baseado em métodos químicos, alternativos ou biológicos mostra-se viável no curto prazo. O objetivo do trabalho foi estudar a eficiência do controle do mofo-cinzento, na cultura da mamoneira, utilizando-se de métodos químico, alternativo e biológico. Assim, procurou-se avaliar, tanto in vitro, quanto in vivo a eficiência de controle do patógenos utilizando-se de fungicidas, óleos essenciais e agentes de controle biológico. Quanto a inibição do crescimento micelial do patógeno in vitro os melhores tratamentos com os óleos essenciais foram os com a base de Cymbopogon martini e Cynnamomum zeylanicum, nas cinco concentrações testadas. Em ambos os óleos, o diâmetro médio das colônias ficou em 0,7 cm contra a média de 4,79 cm da testemunha. Com os fungicidas, nas quatro concentrações testadas, os mais eficientes foram os ingredientes ativos tiofanato metílico, carbendazim, tebuconazole e iprodione. O ED50 destes fungicidas ficou < 1uL/L, atestando 100% de inibição do crescimento micelial em todas as concentrações. Quanto à inibição da germinação dos conídios de A. ricini, os fungicidas tebuconazole e clorotalonil foram os melhores em todas as concentrações testadas, sendo a média dos conídios germinados destes fungicidas de 0,0 e 0,15%, respectivamente, contra 100% da testemunha. No campo, o tratamento com o fungicida iprodione foi o melhor quanto ao controle da doença quando comparados com os

  4. Caracterização de Amphobotrys ricini, agente causal do mofo-cinzento da mamoneira (Ricinus communis L.), avaliação de genótipos, controle químico e alternativo

    OpenAIRE

    Chagas, Haroldo Antunes [UNESP

    2012-01-01

    A mamoneira (Ricinus communis L.) é uma espécie oleaginosa tropical, cujo principal produto é o óleo extraído de suas sementes, sendo um dos mais versáteis da natureza e com muitas aplicações na indústria. Mesmo considerada uma planta rústica, a mamoneira está sujeita a doenças, dentre elas destacamos o mofo-cinzento, causada pelo fungo Amphobotrys ricini. Apesar de não ter relato no Brasil, o mofo-cinzento causado, também, pelo fungo Botrytis cinerea em mamoneira já foi descrito na Coréia do...

  5. PurificaÃÃo, caracterizaÃÃo bioquÃmica e atividade biolÃgica de um inibidor de tripsina da torta da mamona (Ricinus communis L.)

    OpenAIRE

    Rodolpho Glauber Guedes Silva

    2012-01-01

    A cultura da mamoneira (Ricinus communis L.) à de grande importÃncia socioeconÃmica devido Ãs suas sementes, que sÃo utilizadas, principalmente, na produÃÃo do Ãleo que pode ser empregado para diversos fins industriais. A extraÃÃo do Ãleo gera um subproduto de alto valor nutricional, conhecido como torta da mamona. PorÃm, a presenÃa de compostos tÃxicos e alergÃnicos dificulta utilizaÃÃo desse resÃduo como fonte de alimentaÃÃo animal. Outra forma de agregar valor à torta da mamona seria busca...

  6. Evaluation préliminaire de l'activité larvicide des extraits aqueux des feuilles du ricin (Ricinus communis L. et du bois de thuya (Tetraclinis articulata (Vahl Mast. sur les larves de quatre moustiques culicidés : Culex pipiens (Linné, Aedes caspius (Pallas, Culiseta longiareolata (Aitken et Anopheles maculipennis (Meigen

    Directory of Open Access Journals (Sweden)

    Mahari S.

    2006-01-01

    Full Text Available Preliminary evaluation of larvicidal activity of aqueous extracts from leaves of Ricinus communis L. and from wood of Tetraclinis articulata (Vahl Mast. on the larvae of four mosquito species: Culex pipiens (Linné, Aedes caspius (Pallas, Culiseta longiareolata (Aitken and Anopheles maculipennis (Meigen. Aqueous extracts of Ricinus communis leaves and Tetraclinis articulata wood showed strong toxic activity against larvae of several mosquitoes. In this study, insecticide effects of these plant extracts have been investigated on 2nd and 4th instars larvae of Culicidae insects, Culex pipiens (Linné, Aedes caspius (Pallas, Culiseta longiareolata (Aitken and Anopheles maculipennis (Meigen. After 24 hours of exposition, bioassays revealed low lethal concentrations LC50. To control mosquitoes, these plant extracts might be used as natural biocides.

  7. Ricinus communis biocompatibility histological study in the nose of Cebus apella monkeys Avaliação histológica da biocompatibilidade do polímero da mamona no dorso nasal de macacos-pregos (Cebus apella

    Directory of Open Access Journals (Sweden)

    Paulo Cesar de Jesus Dias

    2009-06-01

    Full Text Available Bone tissue lesions can be caused by congenital and acquired factors, and result in nasal deformities with cosmetic and functional repercussion. Surgical treatment in these cases frequently requires complex reconstructions and the use of biomaterials. The polyurethane derived from castor beans (Ricinus communis has a favorable formulation in terms of ease of processing, flexibility, no emission of toxic vapors and low cost. Nonetheless, despite favorable results, studies about the use of castor beam polymer (Ricinus communis assessing tissue reaction on the nasal dorsum are still missing in the literature. AIM: the goal of the present investigation is to histologically assess the Ricinus communis polymer implant biocompatibility with the nasal dorsum. STUDY DESING: experimental. MATERIALS AND METHODS: we used four Cebus appela monkeys, in which we created a nasal dorsal defect in all the animals and there we placed the aforementioned implant. The animals were sacrificed 270 days after surgery and the samples were submitted to histological study. RESULTS: in the histology analysis we did not observe the presence of foreign body granulomas or phagocytic cells. We also observed a progressive bone formation and maturation. CONCLUSION: macroscopic and microscopic results showed that the castor oil polymer implant was biocompatible.Lesões do tecido ósseo podem ser causadas por fatores congênitos e adquiridos e resultar em deformidade nasal com repercussão estética e funcional. O tratamento cirúrgico desses casos requer reconstruções complexas e frequentemente o uso de biomateriais. O poliuretano derivado do óleo da mamona apresenta uma fórmula com aspectos favoráveis de processabilidade, flexibilidade de formulação, ausência de emissão de vapores tóxicos e baixo custo. Entretanto, a despeito dos resultados favoráveis, estudos referentes ao uso do polímero de mamona, avaliando a reação tecidual no dorso nasal, ainda não foram

  8. Estudo experimental do poliuretano de óleo de mamona (Ricinus communis como substituto parcial do tendão calcâneo comum em coelhos (Oryctolagus cuniculus An experimental study of polyurethane of castor-oil plant (Ricinus communis as a partial substitute of the common calcaneous tendon in rabbits (Oryctogalus cuniculus

    Directory of Open Access Journals (Sweden)

    C.M.F. Rezende

    2001-12-01

    Full Text Available Com o objetivo de avaliar a eficiência da prótese de poliuretano de mamona como substituto parcial do tendão calcâneo comum, foram utilizadas 30 coelhas da raça Nova Zelândia, entre dois e três meses de idade e peso médio de 2kg. Após anestesia geral, o procedimento cirúrgico em ambos os membros constou de incisão caudo-lateral no sentido longitudinal do terço médio ao distal da tíbia e exposição do tendão calcâneo comum. Após a tenectomia do tendão do músculo gastrocnêmio, a prótese de poliuretano de cerca de 0,5cm de extensão por 0,5cm de diâmetro foi fixada aos cotos proximal e distal do tendão, empregando-se o fio de polipropileno monofilamentar 4-0, conforme técnica modificada de Kessler. A prótese de poliuretano na forma elastomérica revelou propriedades como textura e flexibilidade semelhantes à do tecido tendinoso, pode ser confeccionada na forma e no tamanho almejados e permite ser moldada, cortada e esterilizada por calor úmido. Todos os animais apoiaram os membros operados imediatamente após o retorno anestésico. Não se observaram sinais clínicos de infecção e não ocorreu deiscência de ferida. Percebeu-se aumento de volume local devido ao edema, evidente na primeira semana pós-cirúrgica, que gradualmente desapareceu . À palpação foi possível delimitar com facilidade a prótese que se conservou fixa no local e intacta. Clinicamente o poliuretano de mamona não induziu reação desfavorável que comprometesse a cicatrização tendínea, podendo ser indicado como substituto temporário de tendão.With the goal of evaluating the efficiency of a prosthesis of castor-oil plant (Ricinus communis polyurethane as a partial substitute for common calcaneous tendon, 30 New Zealand female rabbits, aging between two to three months, weighting about 2kg were used. After general anesthesia, the surgical procedure in both members consisted of rear lateral longitudinal incision, in the medium third of the

  9. Identification of flavonoids and hydroxycinnamic acids in pak choi varieties (Brassica campestris L. ssp. chinensis var. communis) by HPLC-ESI-MSn and NMR and their quantification by HPLC-DAD.

    Science.gov (United States)

    Harbaum, Britta; Hubbermann, Eva Maria; Wolff, Christian; Herges, Rainer; Zhu, Zhujun; Schwarz, Karin

    2007-10-03

    Twenty-eight polyphenols (11 flavonoid derivatives and 17 hydroxycinnamic acid derivatives) were detected in different cultivars of the Chinese cabbage pak choi ( Brassica campestris L. ssp. chinensis var. communis) by HPLC-DAD-ESI-MS(n). Kaempferol was found to be the major flavonoid in pak choi, glycosylated and acylated with different compounds. Smaller amounts of isorhamnetin were also detected. A structural determination was carried out by (1)H and (13)C NMR spectroscopy for the main compound, kaempferol-3-O-hydroxyferuloylsophoroside-7-O-glucoside, for the first time. Hydroxycinnamic acid derivatives were identified as different esters of quinic acid, glycosides, and malic acid. The latter ones are described for the first time in cabbages. The content of polyphenols was determined in 11 cultivars of pak choi, with higher concentrations present in the leaf blade than in the leaf stem. Hydroxycinnamic acid esters, particularly malic acid derivatives, are present in both the leaf blade and leaf stem, whereas flavonoid levels were determined only in the leaf blade.

  10. Evaluación de dos sistemas de riego por goteo en la producción y la calidad de la fruta de pera (Pyrus communis L. variedad Triunfo de Viena

    Directory of Open Access Journals (Sweden)

    María Cristina Arenas-Bautista

    2012-01-01

    Full Text Available El objetivo del presente estudio fue evaluar el efecto de la utilización del sistema de doble línea de riego versus el tradicional de una línea por hilera de plantas en la producción y calidad de la pera (Pyrus communis variedad Triunfo de Viena. La investigación se basó en la aplicación de dos tratamientos definidos, uno consistente en una línea de goteo por hilera de plantas con seis emisores de 8 lt/h y otro, con dos líneas de goteo por hilera de plantas con tres emisores de 8 lt/h cada uno Se utilizaron sensores Watermark para medir y controlar el potencial matricial del suelo. Se cubrió el 100% de la evapotranspiración potencial que fue de 55.5 mm/mes. Los resultados obtenidos de las variables hídricas del suelo permitieron programar el riego y garantizar el suministro de agua adecuado en el periodo de déficit hídrico. El tratamiento de doble línea no difirió significativamente del control, lo que indica que utilizar una línea de riego permite obtener una producción y calidad similares con un menor costo inicial del equipo.

  11. Evaluación de dos sistemas de riego por goteo en la producción y la calidad de la fruta de pera (Pyrus communis L. variedad Triunfo de Viena

    Directory of Open Access Journals (Sweden)

    Vélez Sánchez Javier Enrique

    2012-03-01

    Full Text Available El objetivo del presente estudio fue evaluar el efecto de la utilización del sistema de doble línea de riego versus el tradicional de una línea por hilera de plantas en la producción y calidad de la pera (Pyrus communis variedad Triunfo de Viena. La investigación se basó en la aplicación de dos tratamientos definidos, uno consistente en una linea de goteo por hilera de plantas con seis emisores de 8 lt/h y otro, con dos lineas de goteo por hilera de plantas con tres emisores de 8 lt/h cada uno Se utilizaron sensores Watermark para medir y controlar el potencial matricial del suelo. Se cubrió el 100% de la evapotranspiración potencial que fue de 55.5 mm/mes. Los resultados obtenidos de las variables hídricas del suelo permitieron programar el riego y garantizar el suministro de agua adecuado en el periodo de deficit hidrico. El tratamiento de doble linea no difirió significativamente del control, lo que indica que utilizar una línea de riego permite obtener una producción y calidad similares con un me- nor costo inicial del equipo.

  12. Cálculo del balance de energía para higuerilla (Ricinus communis L. desde las etapas de producción en campo hasta el valor energético de cada componente de la planta

    Directory of Open Access Journals (Sweden)

    Hipólito Ortíz-Laurel

    2017-01-01

    Full Text Available Introducción : Pruebas de balance de energía permiten redirigir los insumos desde las etapas de producción de un cultivo, e igualmente, precesar la cantidad de energía utilizada para cada proceso y así, verificar la eficiencia al transformar la energía contenida en el cultivo cuando debe cumplir con una función deseada. Método : la planta de higuerilla (Ricinus communis L. con propósitos de cultivo energético fue sembrada en campo y sometida a procesos de mantenimiento de l cultivo y en la cosecha, la planta completa fue colectada para análisis energético, donde cada una de sus partes inclu i das las semillas fueron evaluadas en función de su contenido de energía. Así, para determinar el balance de energía; los valores de la energía biológica de la planta fueron comparados con la energía aplicada en cada uno de los procesos técnicos y físicos para la producción del cult i vo y en su procesamiento . Resultados : La energía aplicada para producir el cultivo r esulta un 28% superior a la energía a obtener de la planta. Asimismo, la biomasa de la planta completa de higuerilla, sin contar las semillas genera el doble de energía comparado con el aceite de las semillas, por lo que, conviene utilizar toda la planta e n términos de energía . Conclusión : Es recomendable utilizar el aceite de las seillas como biomaterial, ya que el b a lance es positivo en un 15%.

  13. Análise clínica, radiológica, macroscópica e histológica do úmero de codornas domésticas (Coturnix japonica, submetido ao implante da poliuretana derivada do polímero de mamona (Ricinnus communis Clinical, radiological, macroscopical and histological analysis of domestic quail (Coturnix japonica humerus submitted to implant of polyurethane from castor oil polymer (Ricinnus communis

    Directory of Open Access Journals (Sweden)

    Juliano Bolson

    2005-10-01

    Full Text Available Na cirurgia ortopédica, são freqüentes as situações em que o cirurgião se depara com grandes perdas ósseas, provocadas especialmente por traumatismos de alta energia, tumores ou infecções. A reparação dessas fraturas requer grande conhecimento a respeito de materiais que possam ser utilizados para preencher essas falhas. Esses materiais podem ser derivados biológicos, sintéticos ou metálicos. Dentre eles, destacam-se os enxertos ósseos e os implantes de biomateriais. Com o aumento dos animais exóticos, utilizados como animais de estimação, a casuística clínica e cirúrgica dessa especialidade vem crescendo, tanto em clínicas quanto em hospitais veterinários. Particularmente, as aves constituem a maioria desses animais, e entre seus problemas cirúrgicos as fraturas são os de maior destaque. O objetivo deste trabalho foi estudar o efeito clínico, radiológico, macroscópico e histológico da poliuretana derivada do polímero de mamona (Ricinnus communis implantada no úmero de codornas domésticas (Coturnix japonica. Para isso, foram utilizadas 20 codornas, machos e fêmeas, separadas aleatoriamente em quatro grupos de cinco animais, os quais receberam o implante no úmero esquerdo, com exame clínico diário durante o período pós-operatório, avaliações radiológica imediata e quinzenal e macroscópica e histológica aos 15, 30, 60 e 90 dias. Clinicamente não foram observadas alterações locais, regionais nem sistêmicas. Ao exame radiológico, notou-se aumento de densidade local, sem sinais de alteração óssea, dos tecidos circunjacentes, e de sacos aéreos. A análise macroscópica revelou que a poliuretana de mamona não foi absorvida em nenhum dos quatro grupos permanecendo implantada no seio do osso pneumático, porém, notou-se alteração em sua resistência. O exame histopatológico mostra inicialmente mínima reação inflamatória, discreta fibrose ao redor do implante e osteointegração pela presen

  14. Influência da concentração de NaCl e pH na extração de ricina em torta de mamona (Ricinus communis L. e sua caracterização por eletroforese Influence of NaCl and pH concentration on the extraction of ricin in castor bean (Ricinus communis L. and its characterization by electrophoresis

    Directory of Open Access Journals (Sweden)

    Bárbara Amorim Silva

    2012-07-01

    Full Text Available A mamoneira (Ricinus communis L. é uma oleaginosa de alto valor econômico pelo fato de apresentar um mercado bem definido para o óleo extraído de suas sementes. A torta, que é um resíduo desta extração, se destaca pelo alto teor em proteínas. Dentre as proteínas encontradas na torta destaca-se a ricina, uma citotoxina, que inviabiliza sua utilização como fonte protéica alternativa para alimentação animal. O presente trabalho tem como objetivo identificar um melhor tratamento experimental para a extração de ricina da torta de mamona, visando futuros estudos de perda de integridade da ricina, o que garantiria a inocuidade do produto. Para tanto, buscou-se identificar a solução de maior capacidade de extração de proteínas, empregando a metodologia de superfície de resposta. Um delineamento composto central rotacional foi elaborado a fim de verificar o melhor pH e concentração de NaCl para a extração. Dos cinco diferentes valores de pH (4,0; 4,6; 6,0; 7,4; 8,0 e concentração de NaCl (0,0M; 0,3M; 1,0M; 1,7M; 2,0M utilizados, o tratamento associando fosfato de potássio 0,2M/NaCl 1,7M pH 7,4 foi escolhido como o melhor. A concentração de proteína extraída neste tratamento chegou a valores quatro vezes maiores que o encontrado no de mínima extração de proteína. Pela evidenciação do gel de eletroforese não houve extração preferencial de ricina nos tratamentos testados, entretanto etapas de purificação usando diálise e precipitação com sulfato de amônio, permitiram uma evidenciação melhor das duas cadeias polipeptídicas de ricina.Castor bean (Ricinus communis L. is an oilseed crop of high economic value due to the fact of presenting a clearly defined market for the oil extracted from its seeds. Castor cake, which is a residue of oil extraction, is at the moment receiving special attention because of its high protein content. However, among the proteins found in this cake it is observed the presence of

  15. Bio-deterioration of breadfruit (Artocarpus Communis)

    African Journals Online (AJOL)

    Gaga E Tonukari

    deteriorating breadfruit in storage The freshly harvested breadfruit has 70.2% carbohydrate which reduced to 59.4% within 9 days of storage under room temperature. The amount of fat content, protein and the energy of the breadfruit also reduced in fruit samples stored for 9 days, while there was an increase in the moisture ...

  16. EFICIÊNCIA DOS ÓLEOS DE NIM (Azadirachta indica A. Juss. E MAMONA (Ricinus communis L. NA RESISTÊNCIA DA MADEIRA DE SUMAÚMA (Ceiba pentandra (L. Gaerth. A FUNGOS XILÓFAGOS EM SIMULADORES DE CAMPO

    Directory of Open Access Journals (Sweden)

    Juarez Benigno Paes

    2012-01-01

    Full Text Available The research aimed to evaluate the efficiency of neem (Azadirachta indica and castor oil plant (Ricinus communis oils for the improvement of Ceiba pentandra wood resistance to xilophagous fungi in soil bed condition (field simulator. The neem and castor oil plant oils were extracted with absolute ethyl alcohol and employed in the preparation of oil solutions. Wood samples with dimensions of 1.5 x 0.5 x 15 cm (radial x tangential x longitudinal were treated to reach a nominal retention of 10 to 16 kg of solution/m³ of wood. The samples were submitted to the action of natural micro-flora of three soils; forest, agricultural use and natural pasture soils, for 180 days. Among the tested soils, the agricultural presented greater biological activity, which damaged the samples even more. Among the tested solutions, the pure neem oil provided increased protection to samples. The prepared solutions using neem and castor oil plant oils did not protect the wood from the attack of xylophagous fungi existing in the ground.

  17. Resposta de fêmeas de Encarsia formosa Gahan (Hymenoptera: Aphelinidae aos odores do hospedeiro e da planta-hospedeira em olfatômetro de quatro vias Response of female Encarsia formosa Gahan (Hymenoptera: Aphelinidae to host and plant-host odors

    Directory of Open Access Journals (Sweden)

    Kátia Maria Medeiros de Siqueira

    2003-01-01

    Full Text Available A crescente importância da mosca-branca Bemisia tabaci raça B (Hemiptera: Aleyrodidae como praga agrícola tem incentivado a busca de inimigos naturais que possam ser utilizados em programas de controle biológico. Estudou-se a atração de fêmeas de Encarsia formosa (Hymenoptera: Aphelinidae aos odores emanados pelo seu hospedeiro - a mosca-branca B. tabaci raça B - em plantas de tomate, em olfatômetro de quatro vias. O parasitóide não apresentou atração aos odores da planta de tomate nem ao complexo planta de tomate-ninfas de B. tabaci.The increasing importance of the whitefly Bemisia tabaci race B (Hemiptera: Aleyrodidae as one of the major agricultural pest of this century, has resulted in a search for natural enemies that can be used in biological control programs. The response of naive females of Encarsia formosa (Hymenoptera: Aphelinidaeto volatiles from its hostspecies: insect (B. tabacci race B and plant (Lycopersicom esculentum Mill. were tested using 4-nose olfactometre. Parasitoid was not attracted by neither or insect hostspecies volatile.

  18. Defining carbohydrate specificity of Ricinus communis agglutinin as Gal beta 1-->4GlcNAc (II) > Gal beta 1-->3GlcNAc (I) > Gal alpha 1-->3Gal (B) > Gal beta 1-->3GalNAc (T).

    Science.gov (United States)

    Wu, J H; Herp, A; Wu, A M

    1993-03-01

    To define carbohydrate specificity of Ricinus communis agglutinin (RCA1), the combining site of RCA1 was further characterized by quantitative precipitin (QPA) and precipitin-inhibition assays (QPIA). Among the oligosaccharides tested for QPIA, Gal beta 1-->4GlcNAc (II, human blood group type II precursor sequence) was found to be 7.1 times more active than Gal beta 1-->3GalNAc (T, Thomsen-Friedenreich sequence) and about 1.7 times more active than the other three disaccharides tested--Gal beta 1-->4Man, Gal beta 1-->3DAra and Gal beta 1-->6GalNAc. Gal alpha 1-->4Gal, the receptor of the uropathogenic E. coli ligand was 3.6 times less active than the II sequence. These results indicate that the beta 1-->4 linkage of the terminal Gal to subterminal GlcNAc is important as this beta 1-->4GlcNAc sequence is at least 1.6 times more active than other types of disaccharides. Among the glycoproteins examined for QPA, native and desialized bovine submandibular glycoproteins, native and desialized human plasma alpha 1-acid glycoproteins, as well as crude hog stomach mucin and its three mild acid hydrolyzed products reacted well with the lectin. These glycoproteins precipitated over 75% of the lectin nitrogen added indicating that RCA1 has the ability to recognize Gal beta 1-->4/3GlcNAc and/or the related residues at the non-reducing ends and at positions in the interior of the chains. However, Tn (GalNAc alpha 1-->Ser/Thr sequence) rich glycoproteins such as desialized ovine submandibular glycoprotein and desialized armadillo salivary glycoprotein, in which over 90% of the carbohydrate side chains are Tn determinants with none or only a trace of I/II or T determinants, precipitated poorly with RCA1. From the present and previous results obtained, the carbohydrate specificity of RCA1 can be constructed and summarized in decreasing order by lectin determinants as follows: II (Gal beta 1-->4GlcNAc) > I (Gal beta 1-->3GlcNAc) > E (Gal alpha 1-->4Gal) and B (Gal alpha 1-->3Gal

  19. Enraizamento in vitro de pereira (Pyrus communis L. cv. Carrick

    Directory of Open Access Journals (Sweden)

    Erig Alan Cristiano

    2004-01-01

    Full Text Available O objetivo do presente trabalho foi avaliar o efeito do ácido naftalenoacético (ANA e do carvão ativado no enraizamento in vitro de pereira (Pyrus comunis L. cv. Carrick. Para tanto, microestacas de pereira com aproximadamente 0,8 a 1cm de comprimento foram utilizadas como explantes. Os tratamentos constituíram-se de três concentração de ANA no meio de cultura (0; 3,2 e 6,4mM e de duas concentração de carvão ativado (0 e 1%. A partir dos resultados obtidos no experimento, conclui-se que o ANA nas concentrações de 3,2 e 6,4mM e na ausência de carvão ativado no meio de cultura, possibilitou um melhor enraizamento de pereira cv. Carrick.

  20. Bio-deterioration of breadfruit (Artocarpus Communis) in storage ...

    African Journals Online (AJOL)

    The bio-deterioration of breadfruit in storage and its effects on the nutrient composition of the fruit was investigated at Ibadan, Southwestern Nigeria. Freshly dropped fruits were stored under laboratory conditions for a period of 9 days. Aspergillus niger, Rhizopus stolonifer, Botryodiplodia theobromae, Mycovellosiella fulva, ...

  1. Possibility of Using Rosmarinus officinalis, Myrtus communis and ...

    African Journals Online (AJOL)

    Eser Bayramoğlu

    2011-11-07

    Nov 7, 2011 ... Organosulfur compound is the world's leading bactericide product for the leather industry. It was reported that it is highly effective for preserving salt and brine solutions, soaking liquors as well as processing materials. This research was conducted in a plant-processing cattle hide in Tuzla. Measurements ...

  2. Phenolic contents of myrtle (Myrtus communis L. fruits

    Directory of Open Access Journals (Sweden)

    Arzu BAYIR YEĞİN

    2015-06-01

    Full Text Available Myrtle is one of the important natural plant of the Mediterranean region. Fruits are in black and white colour. The earlier studies are mostly focused on the essential oil content of leaves in myrtle plant, whereas the latest studies are dealing with the phenolic compounds of leaves and fruits with their effects on human health. The aim of the study was to determine the phenolic content of the myrtle fruit and to investigate the differences between the genotypes. Myrtle fruits were collected from Antalya district. Phenolic content was determined by HPLC. Gallic acid (GA, catechin (CT, epicatechin (ECT, epicatechin-3-0-gallate (ECG, procyanidin B1 (B1, procyanidin B2 (B2, quercetin (Q, kamferol (K and myricetin (M were calculated as phenolic compounds. Epicatechin-3-0-gallate (in flavan-3-ol group and myricetin (in flavonol group were detected in large amounts.

  3. factors influencing corneal blindness in children in a rural communi

    African Journals Online (AJOL)

    Anuli

    Clinical Lecturer, MSc Course Director for Community Eye Health, International Centre for Eye Health, London School of. 2. Hygiene and ..... A-rich foods. Box 4. Measles and Blindness ...our women are conscious of the fact that measles affects the eyes. That is why they use uli (local indigo dye) to paint the eyes in a bid.

  4. Do common whitethroats (Sylvia communis) discriminate against alien eggs?

    Czech Academy of Sciences Publication Activity Database

    Procházka, Petr; Honza, Marcel

    2003-01-01

    Roč. 144, č. 3 (2003), s. 354-363 ISSN 0021-8375 R&D Projects: GA ČR GA206/00/P046; GA AV ČR KSK6005114 Institutional research plan: CEZ:AV0Z6093917 Keywords : brood parasitism * Cuculus canorus * eggs Subject RIV: EG - Zoology Impact factor: 0.675, year: 2003

  5. Toxic effects of Ricinus communis non proteic trypsin inhibitor for ...

    African Journals Online (AJOL)

    Marcelo Haro

    2015-10-21

    Oct 21, 2015 ... studies of alternative and sustainable control methods for lepidopteran pest species. Key words: Castor beans, enzymatic inhibition, integrated pest management, plant defense against herbivory. INTRODUCTION. The fall armyworm .... inhibition in vitro testing. Inhibitor activity was determined as described ...

  6. VARIATIONS IN SEED TRAITS OF CASTOR (Ricinus communis ...

    African Journals Online (AJOL)

    The sizes of castor seed have been reported to vary from a few millimeters long to about 20 mm in the giant species (Weiss, 2000). The seed weight varies. For instance, seeds found in Nigeria and Kenya has been reported to weigh. 69.3 and 59.2 g, respectively (Li et al., 2008). The typical fatty acid composition of castor oil.

  7. Variations in seed traits of castor ( Ricinus communis ) accessions ...

    African Journals Online (AJOL)

    The physicochemical analysis showed that castor seed and oil had saponification value of 182.9 mg/g, moisture content of 4.4%, acid value of 3.085 mg/g, viscosity of 110.41 cP, pH of 6.11, iodine value of 8.46 mg/g, specific gravity of 0.962 and refractive index of 1.477˚C. The proximate analysis showed that moisture ...

  8. Three flavonol glycosides from Ricinus communis | Aqil | Bulletin of ...

    African Journals Online (AJOL)

    Bulletin of the Chemical Society of Ethiopia. Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives · Journal Home > Vol 11, No 1 (1997) >. Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register. Three flavonol glycosides from Ricinus ...

  9. ARTICLE - Inbreeding depression in castor bean (Ricinus communis L. progenies

    Directory of Open Access Journals (Sweden)

    Milton Krieger

    2012-12-01

    Full Text Available The purpose of this study was to investigate inbreeding depression (DE in castor bean. From a population derived from the Guarani cultivar, 60 mother plants were sampled. Three types of progenies were obtained from each one: from self-pollination (AU, from crosses (CR and from open pollination (PL. Grain yield of the progenies was evaluated in two locations. There was a strong interaction of progenies x locations, which led to obtaining estimates within each location. Broad variation was observed in inbreeding depression, with mean values of 6.7% and 13.4%, comparing AU progenies with PL progenies. It was observed that the population has high potential for selecting promising inbred lines. The frequency of mother plants generating progenies with simultaneous high general combination capacity and low inbreeding depression was low. Recurrent selection will increase the occurrence of parent plants associating these two properties, which is necessary for obtaining superior synthetic varieties.

  10. Diversity of castor ( Ricinus communis L.) in Ethiopia | Alemaw ...

    African Journals Online (AJOL)

    An experiment was carried out to assess the diversity of castor germplasm in Ethiopia. A total of 102 accessions, one elite genotype and two standard varieties were characterized at Melkassa and Arsi Negelle, in the Central Rift Valley of Ethiopia using 12 traits for one during 2013 main season. Analysis of variance ...

  11. Three flavonol glycosides from Ricinus communis | Aqil | Bulletin of ...

    African Journals Online (AJOL)

    The PDF file you selected should load here if your Web browser has a PDF reader plug-in installed (for example, a recent version of Adobe Acrobat Reader). If you would like more information about how to print, save, and work with PDFs, Highwire Press provides a helpful Frequently Asked Questions about PDFs.

  12. The Effect Of Ricinus Communis Variety Minor On Reproductive ...

    African Journals Online (AJOL)

    Thee estrous cycle of the rats were distorted. Furthermore, this seed extract induced changes in the ovarian and uterine histology, which may be due partly to alteration in the estrogen/ progesterone balance, as well as direct effect on these reproductive organs. Hematological indices were not affected in women volunteers ...

  13. Radiographic analysis in castor bean seeds (Ricinus communis L.)

    OpenAIRE

    Carvalho, Maria Laene Moreira de; Alves, Renato Augusto; Oliveira, Luciana Magda De.

    2010-01-01

    Castor bean cropping has great social and economic value, but its production has been affected by factors such as low quality seeds used for sowing. The quick and precise evaluation of seed quality by x-ray test is known as an effective method to evaluate seed lots, but little is known about the interpretation between of the type of radiographic image and the seed quality correlation. The potential of x-ray analysis as a marker of seed physiological quality and as an initial process for the i...

  14. Criterios de liberación de Encarsia formosa Gahan (Hymenoptera: Aphelinidae para el control de Trialeurodes vaporariorum (Westwood (Hemiptera: Aleyrodidae en tomate

    Directory of Open Access Journals (Sweden)

    Aragón Sandra

    2008-08-01

    Full Text Available

    Para la toma adecuada de decisiones en el manejo de la mosca blanca de los invernaderos, se han propuesto diferentes criterios que buscan reducir el impacto producido por el uso indiscriminado de insecticidas. Sin embargo, estos criterios de decisión son aplicables principalmente al control químico de plagas y no se conoce su uso en programas de control biológico. Por lo tanto, con este trabajo se propuso generar unos criterios de decisión para el control biológico de la mosca blanca de los invernaderos T. vaporariorum con el parasitoide Encarsia formosa, teniendo en cuenta su respuesta funcional y porcentaje de control. En un diseño completamente al azar se ubicaron 18 plantas de tomate de 8 semanas de edad infestadas con 500 ninfas de mosca blanca y 3 plantas como control absoluto. En cada planta se liberaron 0, 10, 20, 30, 40 y 50 adultos de E. formosa, con tres repeticiones por densidad. Se registró el número de ninfas melanizadas por efectos del parasitismo de E. formosa a los 12; 19 y 26 días después de la primera liberación y, al finalizar la cosecha, se realizó un conteo de las ninfas de mosca blanca totales. Los resultados de este trabajo sugieren que para obtener un control cercano a 80% se debe liberar un parasitoide por cada 17 ninfas de mosca blanca de tercer instar, evaluando el control después de 35 días. Se pueden realizar nuevas liberaciones de E. formosa dirigidas al control de las nuevas ninfas encontradas en los muestreos periódicos del cultivo.

  15. A proposed mechanism behind the development of internal browning in pears (Pyrus communis cv Conference)

    NARCIS (Netherlands)

    Veltman, R.H.; Peppelenbos, H.W.

    2003-01-01

    Storage of pears under low oxygen levels (0.5-1.0 kPa) leads to decreased ascorbic acid and ATP levels, a lower ATP-production, and to internal browning, a storage disorder in pears. Addition of 5 kPa carbon dioxide to the storage atmosphere increased the severity of this disorder. Experiments

  16. Effect of rootstock on 'Forelle' pear ( Pyrus communis L.) growth and ...

    African Journals Online (AJOL)

    PD), 'Old Home' × 'Farmingdale' (OHxF) 217, BU2/33, BP3, OHxF40 and BP1 averaged >100.0 cm2, with the smallest trees on Quince C51 (QC51). Trees on PD, OHxF217, BP1 and OHxF40 yielded >30.0 kg tree−1, whereas trees on Quince A ...

  17. Metal concentration in plant tissues of Ricinus communis L. (Castor oil)

    African Journals Online (AJOL)

    SLO) contaminated soil at concentrations of 1-6% (w/w, oil/soil). Plant height and stem girth were depressed by spent lubricating oil at concentrations of 2% (w/w) and above. One percent (1%) spent lubricating oil in soil promoted growth of ...

  18. Commercial and biological characteristics of pear gene pool (Pyrus communis L. of VNIISPK

    Directory of Open Access Journals (Sweden)

    Н. Г. Красова

    2008-10-01

    Full Text Available The study results for many years (1972- 2006 of pear gene pool in the All- Russian Research Institute of Horticultural Breeding are given. The cultivars and selections have been singled out for wide dissemination and use in breeding.

  19. Element repertoire: change and development with age in Whitethroat Sylvia communis song

    DEFF Research Database (Denmark)

    Balsby, T.J.S.; Hansen, P.

    2010-01-01

    Song repertoires are often important determining factors in sexual selection. In several species, older males have larger repertoires than 1-year-old males. The development of large song repertoires by an individual is, however, poorly understood. We studied song element repertoire changes in five...

  20. On the origin of internal browning in pears : (Pyrus communis L. cv Conference)

    NARCIS (Netherlands)

    Veltman, R.H.

    2002-01-01

    Brown discoloration as a result of polyphenoloxidase (PPO) is a well-known problem during food preservation and -processing, which already has been established long ago. Large quantities of fruits and vegetables are lost every year because of loss of taste or

  1. Nem tudo o que escandaliza é aberração: "error communis facit jus"

    Directory of Open Access Journals (Sweden)

    Francisco Platão Savioli

    2001-02-01

    Full Text Available

    O tema do certo e do errado em língua, que para os lingüistas é considerado com menosprezo e como uma falsa questão, é o que, na verdade, mais ocupa a atenção dos usuários do idioma em geral. O fundamento desse paradoxo pode provir da duplicidade do ponto de vista com que se considera a língua. Se para a língua, encarada como código, g erro não tem importância, o mesmo não se pode dizer quando ela é abordada do ponto de vista de fato social. O erro é encarado pelo lingüista como uma das virtualidades do sistema; pelo usuário, como causador de vergonha e medo. O silêncio do lingüista abre espaço para vozes menos credenciadas que implantam o medo e estimulam o sentimento de vergonha. Uma abordagem da correção lingüística com método e rigor científico é, pois, um grande serviço para os usuários e um bom negócio para autores e editores.

  2. Influence of hydrodistillation rate and hydromodule on chemical composition of Juniperus communis L. essential oil

    Directory of Open Access Journals (Sweden)

    Pavićević Vladimir P.

    2017-01-01

    Full Text Available Essential oils are aromatic, volatile, complex mixtures of various compounds, mainly hydrocarbons (monoterpene and sesquiterpene and some oxygenated hydrocarbons. Juniper berry essential oil has wide application and high commercial value due to its considerable antimicrobial activities. It is used in medicine, food, cosmetic and pharmaceutical industry and veterinary medicine. Generally, it is obtained by hydrodistillation, technique for the extraction of substances which do not mix or mix very poorly with water and are unstable at their boiling temperatures. It provides high quality of essential oil and also represents a relatively simple, safe and environmentally friendly process. The variations in the chemical composition of the essential oil obtained from juniper berries at various distillation rates (3, 6 and 8 ml/min and various mass ratio juniper berries−water (hydromodules - 1:3, 1:4 and 1:5 are presented in this paper. It is important to emphasize that the variations made influence only in quantitative (mass %, but not in qualitative chemical composition (no differences, same 58 components were detected in all experiments. To reflect those effects, only 23 identified components with the content higher than 0.5 mass % were selected, constituted 95−96 mass % of the essential oils. The major constituents of the essential oils were monoterpenes (67.39−71.00 mass %, followed by sesquiterpenes (21.64−24.54 mass %, while the oxygenated monoterpene (1.54−2.42 mas. % and oxygenated sesquiterpenes (0.89−1.46 mass % were much less present. According to volatility, the high volatile (boiling point 153−167ºC components are the main constituents of the essential oils (61.69−63.81 mass %, followed by the low volatile (boiling point 252−288oC components (22.57−26.04 mass %, and the least present medium volatile (boiling point 173−212ºC components (7.24−9.61 mass %. The variations in the mass content of the essential oil at various distillation rates showed clear general trends for all hydromodules (with exceptions at some components. With the increasing of distillation rate, mass % of high and medium volatile components decreased, while mass % of low volatile components increased. This is caused by higher extraction of low volatile components at high distillation rate, which resulted the increasing of their mass %. The variations in the mass composition of the essential oil at various hydromodules showed less expressive trends for all distillation rates. That means it has much less influence on the mass composition than the variation of distillation rate. Therefore, experiments at various distillation rates should be continued in combination with the fractionation of the essential oil by simultaneous hydrodistillation and rectification, including the effects of preparation procedures of juniper berries and defining of optimal energy consumption, i.e. optimal time period of hydrodistillation.

  3. The Essential Oil of Myrtus communis L. Produces a Non-Sedating ...

    African Journals Online (AJOL)

    Group II was given diazepam (0.5 mg/kg, orally) suspended in Tween 80 and served as standard. Group III-VI were given the essential oil at doses of 50, 100, 200 and 400 mg/kg, respectively. Animals were then subjected to different anxiety tests, including elevated plus maze (EPM), stair case and open field. Parameters ...

  4. Comparative Study of Essential Oils Extracted from Algerian Myrtus communis L. Leaves Using Microwaves and Hydrodistillation

    Directory of Open Access Journals (Sweden)

    Karim S. Allaf

    2012-04-01

    Full Text Available Two different extraction methods were used for a comparative study of Algerian Myrtle leaf essential oils: solvent-free-microwave-extraction (SFME and conventional hydrodistillation (HD. Essential oils analyzed by GC and GC-MS presented 51 components constituting 97.71 and 97.39% of the total oils, respectively. Solvent-Free-Microwave-Extract Essential oils SFME-EO were richer in oxygenated compounds. Their major compounds were 1,8-cineole, followed by α-pinene as against α-pinene, followed by 1,8-cineole for HD. Their antimicrobial activity was investigated on 12 microorganisms. The antioxidant activities were studied with the 2,2-diphenyl-1-picrylhydrazyl (DPPH• radical scavenging method. Generally, both essential oils showed high antimicrobial and weak antioxidant activities. Microstructure analyses were also undertaken on the solid residue of myrtle leaves by Scanning Electronic Microscopy (SEM; it showed that the SFME-cellular structure undergoes significant modifications compared to the conventional HD residual solid. Comparison between hydrodistillation and SFME presented numerous distinctions. Several advantages with SFME were observed: faster kinetics and higher efficiency with similar yields: 0.32% dry basis, in 30 min as against 180 min for HD.

  5. Neuroprotective effect of undecylenic acid extracted from Ricinus communis L. through inhibition of μ-calpain.

    Science.gov (United States)

    Lee, Eunyoung; Eom, Ji-Eun; Kim, Hye-Lin; Kang, Da-Hye; Jun, Kyu-Yeon; Jung, Duk Sang; Kwon, Youngjoo

    2012-05-12

    The key neuropathological features of Alzheimer's disease are abnormal deposition of Aβ plaques and insoluble Aβ peptides in extracellular brain and intracellular neurofibril tangles induced by abnormal tau hyperphosphorylation. μ-Calpain is one of the factors that bridge these Aβ- and hyperphosphorylated tau-mediated pathological pathways. Undecylenic acid (UDA), a naturally occurring unsaturated fatty acid, was discovered as a μ-calpain inhibitor by screening a chemical library using a substrate specific μ-calpain assay method. UDA inhibited Aβ oligomerization and Aβ fibrillation and reversed Aβ-induced neuronal cell death. In addition, UDA scavenged ROS and reversed the levels of proapoptotic proteins induced by ROS in SH-SY5Y cells. UDA inhibited μ-calpain activity with better potency than the known peptide-like μ-calpain inhibitor, MDL28170, in SH-SY5Y and HEK293T cells transfected with the catalytic subunit of μ-calpain. These results suggest that UDA is a novel non-peptide-like μ-calpain inhibitor with good cell permeability and potent neuroprotective effect. Copyright © 2012 Elsevier B.V. All rights reserved.

  6. Sensus communis aestheticus and the project of emancipation: The Utopian frame of the avant-gardes.

    Directory of Open Access Journals (Sweden)

    Loredana Niculet

    2011-07-01

    Full Text Available The conceptual basis which would be later developed by the artistic avant-gardes was settled by German Romantic and Idealist thought, whose utopian dimension could be easily recognized in The oldest systemprogram of German Idealism (1796, a text which provided Idealist thought with the claim of a new rationality or a mythology of reason in Hegel, an intellectual intuition in Schelling and the Humanity in Schiller. Although this emancipation project developed later by the avant-garde has lost its credibility for us, we still have to investigate to what extent today’s art can maintain a social function. This article point out certain idealist concepts in light of a philosophy of art modeled along lines sketched out in Kant’s Critique of Judgement and that have contributed to the history of the “advanced” art.

  7. Accumulation of Heavy Metals in Ricinus communis L. from Mn Contaminated Area

    Directory of Open Access Journals (Sweden)

    YI Xin-yu

    2014-02-01

    Full Text Available Xiangbi No. 1 and Zibi No. 7 were planted in the Mn contaminated soils to explore its potential of ecological remediation and ener-gy utilization in the areas of Mn contaminated site. The major nutrient elements and the concentrations of heavy metals(Mn, Pb, Zn, Cu and Cr in different parts(root, branch and leaf and topsoil samples were detected after entering into the period of reproductive growth.The results showed that the average content of Mn was as high as 7 884.96 mg·kg-1,which exceeded 6.5 times of national soil environmental quality standard(level 2.The mean level of Mn in tissues of Xiangbi No. 1 was found to be in the sequence of root>leaf>branch,whereas,the mean level of Mn in different parts of Zibi No. 7 was found to be in the order of leaf>fruit>branchroot respectively. The average concentration of Mn in the leaf reached the peak value(765.43 mg·kg-1,which was higher than Xiangbi No.1 about 79.53%.The leaf/root ratios of Pb, Cu, Cr contents in Zibi No. 7 were higher than those of Xiangbi No. 1 samples.The accumulation and translocation in plants was affect-ed by different heavy metal elements in soils.The results demonstrated that Zibi No. 7 had a better uptake and translocation capacity of Mn,Pb,Cu and Cr, meanwhile,plants of two species had differences in accumulation and translocation ability and were proved to possess good Mn-tolerance ability for remediation of heavy metal contaminated soils.

  8. Proteomic profile of the nucellus of castor bean (Ricinus communis L.) seeds during development

    DEFF Research Database (Denmark)

    Nogueira, Fábio C S; Palmisano, Giuseppe; Soares, Emanoella L

    2012-01-01

    groups. The distribution of the identified proteins in stages III and IV into different Gene Ontology categories was similar, with a remarkable abundance of proteins associated with the protein synthesis machinery of cells, as well as several classes of proteins involved in protein degradation......, particularly of peptidases associated with programmed cell death. Consistent with the role of the nucellus in mediating nutrient transfer from maternal tissues to the endosperm and embryo, a significant proportion of the identified proteins are related to amino acid metabolism, but none of the identified...... proteins are known to have a role as storage proteins. Moreover for the first time, ricin isoforms were identified in tissues other than seed endosperm. Results are discussed in the context of the spatial and temporal distribution of the identified proteins within the nucellar cell layers....

  9. Comparative Study of Essential Oils Extracted from Algerian Myrtus communis L. Leaves Using Microwaves and Hydrodistillation

    Science.gov (United States)

    Berka-Zougali, Baya; Ferhat, Mohamed-Amine; Hassani, Aicha; Chemat, Farid; Allaf, Karim S.

    2012-01-01

    Two different extraction methods were used for a comparative study of Algerian Myrtle leaf essential oils: solvent-free-microwave-extraction (SFME) and conventional hydrodistillation (HD). Essential oils analyzed by GC and GC-MS presented 51 components constituting 97.71 and 97.39% of the total oils, respectively. Solvent-Free-Microwave-Extract Essential oils SFME-EO were richer in oxygenated compounds. Their major compounds were 1,8-cineole, followed by α-pinene as against α-pinene, followed by 1,8-cineole for HD. Their antimicrobial activity was investigated on 12 microorganisms. The antioxidant activities were studied with the 2,2-diphenyl-1-picrylhydrazyl (DPPH•) radical scavenging method. Generally, both essential oils showed high antimicrobial and weak antioxidant activities. Microstructure analyses were also undertaken on the solid residue of myrtle leaves by Scanning Electronic Microscopy (SEM); it showed that the SFME-cellular structure undergoes significant modifications compared to the conventional HD residual solid. Comparison between hydrodistillation and SFME presented numerous distinctions. Several advantages with SFME were observed: faster kinetics and higher efficiency with similar yields: 0.32% dry basis, in 30 min as against 180 min for HD. PMID:22606003

  10. Total Oil Content and Fatty Acid Profile of some Almond (Amygdalus Communis L. Cultivars

    Directory of Open Access Journals (Sweden)

    Yildirim Adnan Nurhan

    2016-07-01

    Full Text Available This study was conducted to determine the total oil contents and fatty acid compositions of some commercial almond cultivars. The total oil contents changed significantly (p<0.05 by year in all cultivars with the exception of cultivar Ferrastar. Total oil contents were changed from 50.90% (Picantili to 62.01% (Supernova in 2008 and from 52.44% (Lauranne to 63.18% (Cristomorto in 2009. While predominant unsaturated fatty acids were oleic and linoleic acids, predominant saturated fatty acid was palmitic acid. The highest amount of oleic acid was obtained in Glorieta in both 2008 (83.35% and 2009 (72.74%. Linoleic acid content varied by year and the highest content was recorded in Picantili (26.08% in 2008 and Yaltinski (30.01% in 2009. The highest amount of palmitic acid was detected in cultivar Sonora in both years, i.e. as 7.76% in 2008 and 10.11% in 2009. The mean UFA:SFA ratio was 11.73 in 2008 but 7.59 in 2009. Principal component (PC analysis indicated that palmitic acid, palmitoleic acid, stearic acid, oleic acid, arachidic acid, unsaturated fatty acid (UFA, saturated fatty acid (SFA and UFA:SFA ratio were primarily responsible for the separation on PC1

  11. Rhipicephalus sanguineus (Acari: Ixodidae) female ticks exposed to castor oil (Ricinus communis): an ultrastructural overview.

    Science.gov (United States)

    Sampieri, B R; Furquim, K C S; Nunes, P H; Camargo-Mathias, M I

    2013-02-01

    Tick control has been accomplished through the use of synthetic acaricides, which has created resistant individuals, as well as contaminating the environment and nontarget organisms. Substances of plant origin, such as oils and extracts of eucalyptus and neem leaves, have been researched as an alternative to replace the synthetic acaricides. Ricinoleic acid esters from castor oil have recently been shown as a promising alternative in eliminating bacterial contamination during ethanol fermentation, by acting as an effective biocide. The same positive results have been observed when these esters are added to the food given to tick-infested rabbits. This study tested the effect of these substance on the reproductive system of Rhipicephalus sanguineus females, added to rabbit food, more specifically on oogenesis. For this, four groups were established: four control groups (CG1, CG2, CG3, and CG4) and four treatment groups (TG1, TG2, TG3, and TG4) with one rabbit in each (New Zealand White), used as hosts. After full 4 days feeding (semi-engorgement), the females were collected and had their ovaries extracted. In this study, it was observed that R. sanguineus females exposed to esters had their ovaries modified, which was demonstrated through transmission electron microscopy techniques. The addition of ricinoleic esters to the diet of tick-infested rabbits revealed how toxic such substances are for the cytoplasmic organelles of oocytes and pedicel cells. These compounds can change the morphophysiology of germ and somatic cells, consequently influencing their viability and, therefore, confirming that the ricinoleic acid esters from castor oil are a promising substance in the control of R. sanguineus.

  12. Diversity of Castor (Ricinus communis L.) in Ethiopia አህፅርኦት ...

    African Journals Online (AJOL)

    In Ethiopia, Castor grows as annual in the low lands to small tree perennial in the high lands. India, china, Brazil and USA are the major castor producers globally. Castor bears seeds that containing highly valuable industrial oil. Castor oil is unique among vegetable oil because it is the only commercial source of a ...

  13. Polyurethane resins derived from castor oil (Ricinus communis) for tibial crest deviation in dogs

    International Nuclear Information System (INIS)

    Maria, P.P.; Padilha Filho, J.G.; Canola, J.C.; Castro, M.B.

    2004-01-01

    Medial patellar luxation is one of the most common orthopedic problems in small breeds of dogs and tibial crest deviation is a frequent accompaining anatomical abnormality. For that reason, the purpose of this study was to evaluate the behavior of castor oil derived polyurethane implants when apllied to experimental defects created on the medial side of the proximal tibia of normal puppies. Twelve dogs were randomly divided in 3 groups of 4 animals and were submitted to the same treatment. Histopathological study was performed respectively at 30 (GI), 60 (GII) and 90 (GIII) days post-surgery. Evaluations methods included clinical assessment, radiology, gross and macroscopic study, tomography and statistical analysis. Clinically, there were no signs of implant rejection. Radiology revealed intense periosteal reaction and new bone formation. On gross examination, there was thickening and lateral deviation of the tibial crest and new bone neoformation. On microscopic examination, there was fibrous tissue around the polyurethane, periosteal proliferation on the medial side of the tibia and no bone proliferation towards the implant. Cat scans reveled lateral deviation of the tibial crest in eleven animals, which was statistically significant (p [pt

  14. Synthesis and characterization of dialkanolamides from castor oil (Ricinus communis) as nonionic surfactant

    Science.gov (United States)

    Anwar, M.; Wahyuningsih, T. D.

    2017-12-01

    Nonionic surfactant of dialkanolamide derivates was synthesized and characterized from castor oil (Ricinus comunnis). Ricinoleic acid was isolated from castor oil by hydrolysis in alkaline (KOH) condition at 65 °C. Oxidation of ricinoleic acid by dilute potassium permanganate (KMnO4) in alkaline condition at 75-90 °C gave dicarboxylic acid which was then reacted with ethanolamine at 140-160 °C for 6 hours. The product was recrystallized with isopropanol, and the structure elucidation was performed by FTIR, 1HNMR spectrometer, and GC-MS with silylation method. Characterization of surfactants was carried out by surface tension measurement (capillary rise method), Critical Micelle Concentration (CMC) based on turbidity method and calculation of Hydrophilic-Lipophilic Balance (HLB) value with Griffin method and Bancroft rule. The result showed that ricinoleic acid in castor oil is 86.19 % and it is oxidation give an azelaic acid and octanedioic acid in 53.25 %. Amidation of a dicarboxylic acid and ethanolamine at 140-160 °C for 6 hours yielded of N1,N9-bis(2-hydroxyethyl)nona diamide in 49.35 %. Surfactant characterization indicates that dialkanolamide derivates can be used as a surfactant due to its ability to reduce the surface tension of ethanol with CMC at 1.2 g/L, HLB value is 5.58 and can be used as emulsifier water in oil (W/O).

  15. Structural and Spectroscopic Properties of the Peroxodiferric Intermediate of Ricinus communis Soluble Delta(9) Desaturase

    Czech Academy of Sciences Publication Activity Database

    Srnec, Martin; Rokob, Tibor András; Schwartz, J. K.; Kwak, Y.; Rulíšek, Lubomír; Solomon, E. I.

    2012-01-01

    Roč. 51, č. 5 (2012), s. 2806-2820 ISSN 0020-1669 R&D Projects: GA MŠk LC512 Institutional research plan: CEZ:AV0Z40550506 Keywords : diferrous non-heme iron enzyme * QM/MM calculations * delta-9 * desaturase * reaction mechanism Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.593, year: 2012

  16. Short CommuniCationS, noteS and reportS

    African Journals Online (AJOL)

    Lappet-faced Vultures with white feathers hein van Grouw. Curator, Bird Group, Dept. of Zoology, The Natural History Museum, Akeman Street,. Tring, Herts, HP23 6AP, UK. e-mail: h.van-grouw@nhm.ac.uk. Two different Lappet-faced Vultures Torgos tracheliotos with remarkable white feathers over their bodies are seen.

  17. Analisi Kualitas dan Uji Organoleptik Abon Sapi Terhadap Penambahan Buah Keluwih (Arctocarpus communis

    Directory of Open Access Journals (Sweden)

    M. Nasir

    2016-03-01

    Full Text Available ABSTRACT. A study on the effect of addition of kuluwih on quality and organoleptic test of abon sapi conducted at meat and fish processing loboratory and livestock food laboratory of animal husbandry department faculty of agriculture of syiah kuala university, in august 2006. The research design was completely randomized design that consists of 5 treatments with 4 replications. The treatments were; A = 100 % abon sapi; B=abon sapi and 5 % keluwih; C= Abon sapi and 10% keluwih; D = Abon sapi and 15% keluwih; and E= Abon sapi and 20% keluwih. The results showed that there were no significant effect of addition keluwih on abon sapi on quality and organoliptic test. There was also no significant effect of addition keluwih on rot test that the ammoniac yield was relatively low so that the abon sapi was safely consumption.

  18. Effects The N-Hexane Extract Of Castor ( Ricinus Communis ) Seeds ...

    African Journals Online (AJOL)

    Materials and methods: The seeds of Castor plant were obtained, dried, pulverized, and exhaustively soxhlex extracted in N-hexane at 750C for 72 hours. This was dissolved in appropriate volumes of corn oil to make a concentration of 20mg/ml. The extract was administered to twenty –five (25) adult wistar rats at a dose of ...

  19. Short CommuniCationS, noteS and reportS

    African Journals Online (AJOL)

    Tring, Herts, HP23 6AP, UK. e-mail: h.van-grouw@nhm.ac.uk. Two different Lappet-faced Vultures Torgos tracheliotos with remarkable white feathers over their bodies are seen... Lappet-faced Vulture Torgos tracheliotos with very pale plumage, photographed in the. Serengeti. Photograph courtesy of Cysty Massay. January ...

  20. Control of papaya fruits anthracnose by essential oil of Ricinus communis

    Directory of Open Access Journals (Sweden)

    César Luis Siqueira Júnior

    2012-02-01

    Full Text Available The aim of this work was to investigate the potential of castor oil for the control of papaya diseases caused by the fungus Colletotrichum gloeosporioides and the bacterium Pseudomonas caricapapayae. The treatment with 1% castor oil did not significantly affect the fungal growth. The effectiveness of castor oil for the control of anthracnose was shown when 5% and 10% (v/v were used in the assays resulting in reduced mycelial growth. Fungal sporulation was strongly inhibited at 10% (v/v concentration of essential oil. The studies with the fresh fruits treated with 5% (v/v castor oil in aqueous emulsions resulted in effective reduction of pathogen spread in these fruits. No lesion was found in the fruits treated with oil, when compared to the control fruits. Castor oil showed no effect against the P. caricapapayae when tested in vitro. These results suggested the potential use of the castor bean essential oil and its fatty acids constituents for the control of anthracnose in papaya fruits.

  1. Protein (Viridiplantae): 389551 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available nel, putative Ricinus communis MENDPLLPYHSPRKRTPPQLPPILCPLPEDDEVSLPLSISPSELKERLIFGPSPSPNDSTPVFEALTHSLNSPRP...SCSNQEFNFHDSPRHHQQPQSWLIDPNYSWTKTNLHRSKTAPAMAVINDSLNSSHIPKPQFGSQSIVRQAFVLLILYLSFGVV

  2. Understanding biological control of greenhouse whitefly with the parasitoid Encarsia formosa : from individual behaviour to population dynamics

    NARCIS (Netherlands)

    Roermund, van H.J.W.

    1995-01-01

    The greenhouse whitefly, Trialeurodes vaporariorum (Westwood) (Homoptera, Aleyrodidae), is a very common, highly polyphagous pest insect all over the world. Biological control of whiteflies with the parasitoid Encarsia formosa Gahan (Hymenoptera, Aphelinidae) was already applied in the 1920s in

  3. Pop / Tõnu Pedaru

    Index Scriptorium Estoniae

    Pedaru, Tõnu

    2007-01-01

    Heliplaatidest: Ska Factor "Aeg on uus", M83 "Digital Shades. Vol 1", Keyshia Cole "Just Like You", Scandinavian Music Group "Missä Olet Laila?", Mick Jagger "The very best of Mick Jagger", Dave Gahan "Hourglass"

  4. Intraguild predation by the generalist predator Orius majusculus on the parasitoid Encarsia formosa

    DEFF Research Database (Denmark)

    Sohrabi, Fariba; Enkegaard, Annie; Shishehbor, Parviz

    2013-01-01

    Intraguild predation of Orius majusculus (Reuter) (Heteroptera: Anthocoridae) on Encarsia formosa (Gahan) (Hymenoptera: Aphelinidae), both natural enemies of Bemisia tabaci (Gennadius) (Homoptera: Aleyrodidae), was studied under laboratory conditions. The experiments quantified prey consumption b...

  5. Pop / Mart Juur

    Index Scriptorium Estoniae

    Juur, Mart, 1964-

    2003-01-01

    Heliplaatidest: Dave Gahan "Paper Monsters", Paddy McAloon "I Trawl the Megahertz", Jukka Gustavson Organ Fusion Band "Between Fire And Ice", Tanel Ruben & Victoria "A Sentimental Call", Opiate "Sometimes", The Mooney Suzuki "Electric Sweat"

  6. Development of a bioassay to quantify the ricin toxin content of castor bean (Ricinus communis L. seeds=Desenvolvimento de um bioensaio para quantificar o teor da toxina ricina em sementes de mamona (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Dick Auld

    2012-10-01

    Full Text Available In this study, we developed a bioassay to quantify the ricin toxin content of castor bean seeds. Existing quantification methods do not always reflect actual toxicity of the seeds analyzed, which may present lower ricin content even though they are more toxic than seeds presenting a higher content of ricin. This is because these methods actually measure the addition of ricin RCA, which is a compound less toxic than pure ricin. We decided to use in this study, the nematode Caenorhabditis elegans, which has been widely used by the pharmaceutical industry. We tested two strains of C. elegans using different methods in 8 experiments. We examined 4 methods of extracting the ricin complex and 3 methods of exposing the nematodes. Among the nematode strains and ricin extraction methods tested, we concluded that the best strain for testing ricin toxicity was the strain called N2 and that the best method for ricin extraction was a rotating bath followed by centrifugation and exposing the nematodes in 24 well plates with a solution of nematodes extracted from the media with destilated waterexposing the nematodes in 24-well plates This method is inexpensive, quick and adequate for the selection of offspring with lower RIP content.Foi desenvolvido um bioensaio para quantificar o teor de ricina nas sementes de mamona. Os métodos de quantificação existentes não refletem a toxidez real das sementes analizadas, que pode mostrar um resultado de menor teor de ricina e ainda assim ser mais toxico do que as sementes que apresentaram teores maiores. Isto ocorre por que estes métodos medem alem da ricina a RCA, que é um composto menos tóxico que a ricina pura. Foi decidido utilizar neste estudo o nematoide Caenorhabditis elegans, que tem sido amplamente utilizado na industria farmacêutica. Foram testadas duas estirpes de C.elegans usadas em diferentes métodos contando com 8 experimentos distintos. nós examinamos 4 métodos de extração de ricina e 3 métodos de exposição do nematóide à ricina. Foi concluído que a melhor estirpe para testar ricina foram as estirpes chamadas de N2 e o melhor método de extração da toxina foi o do banho maria seguido pela centrifugação e o melhor método de exposição dos nematóides foi o que conta com uma placa de 24 poços onde o nematóide suspenso em água destilada são expostos a toxina. Este é um método barato, rápido e adequado para seleção de materiais com baixo teor de RIP.

  7. Testes de vigor para avaliação do potencial fisiológico de sementes de mamona (Ricinus communis L. Vigor test for the evaluation of the physiology potencial of castor bean (Ricinus communis L. seeds

    Directory of Open Access Journals (Sweden)

    Rita de Cássia Mendes

    2010-02-01

    Full Text Available A qualidade de sementes de mamona tem sido avaliada rotineiramente pelo teste de germinação, cujos resultados, muitas vezes, não são confirmados em campo. Nesse contexto, os testes de vigor são essenciais, pois retratam o comportamento das sementes sob maior amplitude de ambiente. Neste trabalho, objetivou-se avaliar a eficiência de métodos para determinar o potencial fisiológico de sementes de mamona. Para tanto, foram utilizados sete lotes de sementes de mamona, cultivar AL-Guarany, apresentando teor de água de aproximadamente 7% , que foram submetidos aos seguintes testes: germinação, primeira contagem de germinação, frio (a 10ºC/7 dias e a 25ºC/5 dias, porcentagem e velocidade de emergência de plântulas, envelhecimento acelerado a 41ºC e 45ºC e 100% UR, por 48, 72 e 96 horas e condutividade elétrica (25 sementes embebidas em 75 e 100mL de água destilada, a 25ºC, por 2, 4, 6, 8, 24, 48 e 72 horas. Os testes de frio e de envelhecimento acelerado (41ºC/72 horas e 100% UR foram eficientes para avaliação do potencial fisiológico de sementes de mamona, permitindo classificação de lotes quanto ao vigor semelhante à emergência de plântulas em solo. O teste de condutividade elétrica não se mostrou adequado para avaliação do potencial fisiológico das sementes de mamona.This work had the objective to determine the efficiency of different tests for the evaluation of physiological potential of castor bean seeds. Seven seed lots of AL-Guarany cultivar were submitted to the following tests: seed moisture content, standard germination, first count, cold test (10ºC/7 days followed by germination at 25ºC/5 days, seedling emergence, speed emergence index, accelerated aging (at 41ºC and 45ºC and 100% RH, for 48, 72, and 96h and electrical conductivity (25 seeds soaked into 75 and 100mL of distilled water, at 25ºC, for 2, 4, 6, 8, 24, 48, and 72 h. The trial was conducted in randomized completely design, with four replications. The means of treatments were compared by Tukey test at 5% probability. Results showed that cold test and accelerated aging (41ºC/72 hours were efficient to evaluate the physiological potential of castor bean seeds, allowing the classification of lots regarding vigor to be similar to the seedling emergence test. Electrical conductivity test was not adequate for the evaluation of physiological potential of these seeds.

  8. O hodowli in vitro wycinków z łodygi rącznika (Ricinus communis L. i wilczomlecza tyrlicza (Euphorbia lathyris L. [In vitro culture of segment from shoots of Ricinus communis L. and Euphorbia lathyris L.

    Directory of Open Access Journals (Sweden)

    B. Wojciechowska

    2015-01-01

    Full Text Available The influence of certain factors on the growth and differentiation of the material investigated was analysed. Histo- and organogenesis are discussed together with the anatomy of the coalescence of the segments.

  9. Comportamiento fisiológico de la pera variedad Triunfo de Viena (Pyrus communis L. durante el período poscosecha Physiological performance of pears (Pyrus communis L., cv. Triunfo de Viena during postharvest period

    Directory of Open Access Journals (Sweden)

    Alfonso Parra-Coronado

    2006-04-01

    Full Text Available La pera variedad Triunfo de Viena es una fruta producida en Colombia y actualmente no se dispone de una red de frío para su manejo poscosecha. El objetivo de este trabajo fue establecer el comportamiento fisiológico de la pera variedad Triunfo de Viena en tres condiciones de temperatura y humedad relativa: 3ºC y 85%, 11ºC y 80%, 18ºC y 75%. La pera variedad Triunfo de Viena es un fruto climatérico, cuyo punto de máxima intensidad respiratoria puede desplazarse en el tiempo dependiendo de las condiciones de almacenamiento. Para las condiciones estudiadas, el climaterio se presentó en el día 22 (35,87 mg CO2 kg-1 h-1, en el día 36 (28,59 mg CO2 kg-1 h-1 y en el día 93 (15,72 mg CO2 kg-1 h-1 del almacenamiento, para las temperaturas de 18ºC, 11ºC y 3ºC respectivamente. La pérdida de peso presentó una relación lineal y directa respecto al tiempo de almacenamiento, siendo mayor con temperaturas de 18ºC y 11ºC. La acidez titulable y el pH no presentan grandes variaciones durante el almacenamiento. La intensidad respiratoria, la pérdida de peso, la relación SST/AT y la firmeza de la pulpa, son las características que representan mejor la evolución de la madurez de las peras variedad Triunfo de Viena.The pear cv. Triunfo de Viena is a fruit produced in Colombia, but at present time there is no cool chamber to handle it. The objective of this work was to determine the pear's physiological performance under three conditions of temperature and relative humidity: 3ºC and 85%, 11ºC and 80%, 18ºC and 75%. The pear cv. Triunfo de Viena is a climacterically fruit, which its maximum point of respiratory rate could vary according to the storage conditions. For the evaluated conditions, the number of days required to reach the climacteric-like peak was 22 (35,87 mg CO2 kg-1 h-1, 36 (28,59 mg CO2 kg-1 h-1 and 93 (15,72 mg CO2 kg-1 h-1, at temperatures of 18ºC, 11ºC and 3ºC respectively. The weight loss presented a linear and direct relation in regard to the storage period, being greater with temperatures of 18ºC and 11ºC. The titratable acids and pH do not present great variations during the storage. The respiratory rate, the weight loss, the SST/AT relation and the flesh firmness are characteristics that better represent the evolution of the ripening pears cv. Triunfo de Viena.

  10. Decomposição in situ de folhas senescentes de pereira (Pyrus communis L. cv. Rocha In situ decomposition of pear (Pyrus communis L. cv. Rocha senescent leaves

    Directory of Open Access Journals (Sweden)

    C. Neto

    2007-07-01

    Full Text Available Estudou-se a variação da perda de peso e a contribuição das folhas senescentes de pereira (cv. Rocha para a restituição de azoto (N ao solo através da técnica dos sacos de decomposição in situ, colocados em Outubro de 2003 à superfície do solo dum pomar situado no Cadaval (Oeste de Portugal. Os sacos contendo folhas senescentes colhidas em pereiras com um ano de plantação e fertilizadas com três níveis de N (0, 10 e 40 kg N/ha, foram recolhidos em Dezembro de 2003, Janeiro, Fevereiro, Maio, Julho e Outubro de 2004 e Março de 2005. No mesmo pomar enterraram-se, em Outubro de 2003, 12 cilindros de PVC, contendo à superfície folhas senescentes de pereiras com três anos de plantação e fertilizadas com 40 kg N/ha de adubo enriquecido com 10% de átomos de 15N. Os cilindros foram recolhidos em Janeiro, Março, Junho e Novembro de 2004. Determinouse a variação do peso e os teores de N total e enriquecimento em 15N nos resíduos, e nas amostras de terra avaliaram-se os teores de N “total”, N-inorgânico e carbono (C orgânico, bem como os nitratos potencialmente lixiviados e adsorvidos em resinas de troca aniónica, em cada data. A decomposição in situ das folhas senescentes das pereiras ‘Rocha’ jovens variou significativamente com a fertilização azotada após 506 dias. As folhas provenientes da modalidade 0 kg N/ha apresentaram menor peso residual (21% do inicial e menor teor de N (44% do teor inicial de N comparativamente com as folhas resultantes das modalidades adubadas com N, no final do período em estudo. Padrão idêntico de comportamento verificou-se na decomposição in situ das folhas das árvores com três anos, colocada à superfície do solo dos cilindros de PVC enterrados. A mineralização do N destas folhas levou à disponibilização do N para as árvores no início do abrolhamento e a partir de Junho, não se tendo observado lixiviação do N mineral produzido.The weight loss of one year-old ‘Rocha’ pear senescent leaves and their contribution to nitrogen (N cycling in the soil, were studied using litter bags. The leaves were collected from trees fertilized with ammonium nitrate, using three N rates (0, 10 and 40 kg N/ha. The litter bags were installed in October 2003, at the surface of the soil, in an orchard located in Cadaval (Western Portugal. Litter bags were removed from the soil in December 2003, January, February, May, July and October 2004, and March 2005. Leaves were also collected from three-year old ‘Rocha’ pear trees fertilized with 40 kg N/ha using ammonium nitrate, double enriched with 10 atom% 15N. These were placed at the surface of non-disturbed soil cores, from cylinders buried in the same orchard in October 2003. The soil cores were removed from the soil in January, March, June and November 2004, and were analysed for the evolution of leaf weight, leaf N and 15N enrichment. Inorganic and “total” soil N, 15N enrichment, and organic carbon (C in the soil and leached N captured in anion- -exchange resins were also determined at each sampling time. The decomposition of one-year old ‘Rocha’ pear senescent leaves was affected by N applied to the trees, after 506 days of decomposition in the field. The leaves from the 0 kg N/ha plots had less final weight (21% of the initial and leaf N content (44% of leaf initial N content at the end of the studied period, when compared to the leaves from the plots fertilized with N. Decomposition of senescent leaves from three-years-old trees at the soil surface in PVC cylinders showed a similar pattern. N mineralization in these leaves showed the potential availability of inorganic N at the beginning of trees bud break and after June, without nitrate leaching in the soil.

  11. F1 hybrid of cultivated apple (Malus x domestica) and European pear (Pyrus communis) with fertile F2 offspring

    NARCIS (Netherlands)

    Fischer, T.C.; Malnoy, M.; Hofmann, T.; Schwab, W.; Palmieri, L.; Wehrens, H.R.M.J.; Schuch, L.A.; Müller, M.; Schimmelpfeng, H.; Velasco, R.; Martens, S.

    2014-01-01

    The establishment of intergeneric hybrids for horticultural and agricultural crops is still a demanding task for breeding programmes. The aim of such approaches is to introduce new quality and resistance traits and to enlarge the gene pool. Recently, an F1 hybrid between Malus × domestica and Pyrus

  12. Field performance of vegetative form traits of neopolyploids produced by in vitro colchicine treatment in Pyrus communis

    Science.gov (United States)

    The induction of polyploidy to improve agronomically and economically useful characters is a process commonly used in crop plants. Neopolyploids were obtained from pear diploid cultivar ‘Fertility’ by in vitro colchicine treatment. Different ploidy clones were rooted to be transferred to the field...

  13. Descriptores botánicos para caracterizar germoplasmas de Ricinus communis de diferentes zonas de Costa Rica

    Directory of Open Access Journals (Sweden)

    Paola Solera-Steller

    2015-03-01

    Los resultados mostraron valores significativos para la longitud del racimo y el número de frutos por racimo, la razón largo/ancho del fruto, peso del fruto, la razón del largo/ancho de la semilla y el peso de la semilla, con correlaciones superiores a un 45%. Sin embargo, el ACP mostró que existe una alta variabilidad entre los datos, algo muy común entre individuos silvestres, debido principalmente a su forma de dispersión y a la gran cantidad de zonas de vida muestreadas. Para la CJA, se pudieron observar tres grupos ordenados principalmente por las correlaciones entre el tamaño del racimo y el número de frutos, la razón largo/ancho y el peso del fruto y la razón largo/ancho y peso de la semilla, los cuales pueden usarse como indicadores para la caracterización morfológica de la higuerilla proveniente de todo el país.

  14. Extraction, Purification and Thermodynamic Characterization of Almond (Amygdalus communis β-Galactosidase for the Preparation of Delactosed Milk

    Directory of Open Access Journals (Sweden)

    Melita Lobo

    2013-01-01

    Full Text Available Buffer type, pH and ionic strength, as well as the fraction of polyvinylpyrrolidone were optimized for efficient extraction of β-galactosidase from almond seeds. The enzyme was purified up to electrophoretic homogeneity employing (NH42SO4 (15–60 % fractionation, size exclusion and ion-exchange chromatography. Molecular mass of β-galactosidase as estimated by gel filtration and SDS-PAGE was approx. 62 kDa, confirming its monomeric nature. The optimum activity of the enzyme was at pH=5.5, and it was stable within the range of pH=5.0–6.0. Various kinetic parameters of β-galactosidase thermal inactivation were calculated: ΔH°, ΔS° and ΔG° suggested that the enzyme undergoes significant processes of unfolding during denaturation. Using β-galactosidase from almond seed powder, lactose hydrolysis in milk up to approx. 50 % was observed. The findings indicate the potential use of almond seeds for the production of low/delactosed milk for lactose-intolerant population.

  15. The effect of main ecological factors on essence yield percent of myrtus communis in different forest sites of Lorestan province

    Directory of Open Access Journals (Sweden)

    zahra Mirazadi

    2012-09-01

    مواد و روش‌ها: به منظور بررسی تاثیر عوامل اصلی اکولوژیکی موثر بر میزان اسانس درختچه مورد، ازچندین رویشگاه اصلی مورد دراستان لرستان نمونه برداری به عمل آورده و از هر منطقه 40 گرم برگ خشک اسانس گیری شد و درصد بازده اسانس برگ های مناطق مختلف به دست آمد. علاوه بر آن مولفه های اصلی فیزیوگرافیک هر کدام از رویشگاه ها (شیب، جهت دامنه، ارتفاع از سطح دریا نیز اندازه گیری شد. از بین عوامل اکولوژیک قابل اندازه گیری نیز عناصر سدیم، پتاسیم، منیزیوم و کلسیم و میزان اسیدیته و شوری خاک مورد اندازه گیری قرار گرفت.

  16. Comparative GC analyses of ripe fruits, leaves and floral buds essential oils of Tunisian Myrtus communis L.

    Directory of Open Access Journals (Sweden)

    Ahmed Snoussi

    2014-07-01

    Full Text Available The chemical composition of essential oils obtained by hydrodistillation from Tunisian wild growing myrtle ripe fruits, leaves and floral buds was examined by GC and GC-MS. The yields of hydrodistilled oils obtained from different plant parts were: leaves 0.5%, floral buds 0.2% and ripe fruits 0.02%. Significant differences were found in the concentration of main constituents of the oils: α-pinene [48.9% (floral buds, 34.3% (fruits, 23.7% (leaves], 1,8-cineole [15.3% (floral buds, 26.6% (fruits, 61.0% (leaves]. The leaves oil contained less linalool than floral buds and ripe fruits oils. Tunisian myrtle is characterized by the absence of myrtenyl acetate.

  17. HPLC/MS identification of the polyphenols present in an extract of Myrtus communis L. obtained by supercritical fluid extraction

    Directory of Open Access Journals (Sweden)

    Paula Pereira

    2017-12-01

    Full Text Available In this work, we studied an extract obtained by supercritical fluid extraction (SFE using a simpler method of cosolvent (ethanol addition. Instead of using a liquid pump, which is the most common process, the ethanol was directly introduced in the extraction cell, immediately after loading the cell with the plant sample. it was our intent to investigate if this change would have any effect in the composition of the extract obtained. The experimental conditions used were: temperature 48° C, pressure 10 MPa, supercritical fluid (SCF flow rate 130.71dm3h-1 (0.238 kgh-1 and an ethanol volume of 104 cm3. The composition of the extract obtained was different from previous tests, and the compounds identified by HPLC-MS were quinic acid, quinic acid 3,5-di-O-gallate, quinic acid 3,4,5-galloyl, myricetin-galactoside gallate, quercetin-galactoside gallate, quercetin, and myricetin-galactosiderhamnoside.

  18. Studies on the yield and quality characteristics of Myrtle (Myrtus communis L. grown in two different ecologies

    Directory of Open Access Journals (Sweden)

    Halil İbrahim UZUN

    2016-12-01

    Full Text Available Myrtle is a typical Mediterranean plant. Myrtles plants with white colored and large fruit sized are cultivated in southern coasts of Turkey and named as Hambeles. Black myrtles are naturally grown in the forests and they have smaller fruit size when compared to Hambeles. Main objective of this study was to investigate the yield and quality parameters of some newly selected 3 black myrtle ecotypes (Yakup, Yumaklar, Islangıc and one white myrtle cultivar (Hambeles in upland and lowland ecological conditions in Antalya. Yields, physical and chemical characters of fruits and essential oil composition of leaves were recorded for all plants. Two experimental orchards were established in coastal and highland conditions in Antalya. Highest fruit weight of black myrtles was measured as 0.76 g fruit-1 in Yakup ecotypes in highland and as 0.92 g fruit-1 in Yumaklar ecotypes in lowland. There were no differences among ecotypes in terms of fruit removal force. Fruit yield per tree increased up to 9.2 kg in black myrtle in lowland. Highest perfect seed numbers in myrtle plants were measured in Hambeles ecotype as 19.83 seeds fruit-1. Fruit juice yield ranged from 29.6 to 35.0%. Amount of malic acid in fruit was higher than that of other organic acids. α-pinene and 1,8-cineole were main essential oil components of myrtle leaves.

  19. Phloem flow and sugar transport in Ricinus communis L. is inhibited under anoxic conditions of shoot or roots

    NARCIS (Netherlands)

    Peuke, A.D.; Gessler, A.; Trumbore, S.; Windt, C.W.; Homan, N.; Gerkema, E.; As, van H.

    2015-01-01

    Anoxic conditions should hamper the transport of sugar in the phloem, as this is an active process. The canopy is a carbohydrate source and the roots are carbohydrate sinks.By fumigating the shoot with N2 or flooding the rhizosphere, anoxic conditions in the source or sink, respectively, were

  20. UPLC-QTOF/MS for a rapid characterisation of phenolic compounds from leaves of Myrtus communis L.

    Science.gov (United States)

    Taamalli, Amani; Iswaldi, Ihsan; Arráez-Román, David; Segura-Carretero, Antonio; Fernández-Gutiérrez, Alberto; Zarrouk, Mokhtar

    2014-01-01

    Although continuous research has been conducted on the biological activities of myrtle and the characterisation of its essential oil, few studies have focused on its phenolic composition despite major beneficial properties. To carry out a comprehensive characterisation of infusion and methanolic extract from myrtle leaves by UPLC-QTOF/MS. Myrtle-leaf infusions, prepared using deionised water, and the methanolic extracts were analysed by reversed-phase ultra-performance liquid chromatography (UPLC) coupled to electrospray ionisation quadrupole time-of-flight mass spectrometry (ESI/QTOF/MS). The MS and MS/MS experiments were conducted using the negative-ionisation mode, in order to provide molecular-mass information and production spectra of the compounds for structural elucidation. The analytical method applied enabled the characterisation of several compounds such as gallic acid and galloyl derivatives, ellagic acid and derivatives, hexahydroxydiphenolyl and derivatives, flavonoids, lignans and gallomyrtucommulones. Flavonoids, ellagic acid and its derivatives and gallic acid and its derivatives formed the major fractions. UPLC combined with QTOF/MS is a powerful analytical method for characterising infusions and alcoholic extracts from myrtle leaves. Copyright © 2013 John Wiley & Sons, Ltd.

  1. Study on Pollination and Selection of the Most Suitable Pollinizers for Commercial Pear Cultivars (Pyrus communis L. in Iran

    Directory of Open Access Journals (Sweden)

    Tatari Maryam

    2017-12-01

    Full Text Available The cultivated pear is an economically important fruit tree species of genus Pyrus in which often gametophytic self-incompatibility occurs. Therefore, this species need to be pollinated by cross-compatible cultivars that bloom in the same time. Selection of appropriate pollinizers for pear cultivars is very important to produce commercial yield. ‘Sebri’, ‘ Shahmiveh’ and ‘Natanzi’ are the best commercial cultivars in Iran, but the lack of a suitable source of pollen can reduce productivity. In order to select the most suitable pollinizer for these pear cvs, an experiment was conducted in which they were considered as pollen recipients and ‘Coscia’, ‘Bartlett’ and ‘Sardroud’ along with ‘Sebri’, ‘Shahmiveh’ and ‘Natanzi’ were evaluated as pollen donors. This research was conducted as a factorial experiment in randomized complete block design for four years. Recipient and donor cultivars had almost overlapping flowering time. The flower buds on selected branches were emasculated at balloon stage and then were counted and isolated with cotton tissue bags. Pollen grains of these pollinizers were collected in the laboratory. Isolation bags were taken off from the branches and emasculated flowers were pollinated with pollen grains of listed pollinizers during receptibility of stigma. The number of pollinated flowers was counted, and branches were covered again with the bags. The results showed that for ‘Sebri’ the best pollinizer was ‘Coscia’ with 5.7% fruit set, for ‘Shahmiveh’ ‘Bartlett’ cv. with 5.8% of fruit set and for ‘Natanzi’, ‘Shahmiveh’ with 5.5% of fruit set.

  2. Rheological, baking, and sensory properties of composite bread dough with breadfruit (Artocarpus communis Forst) and wheat flours.

    Science.gov (United States)

    Bakare, Adegoke H; Osundahunsi, Oluwatooyin F; Olusanya, Joseph O

    2016-07-01

    The rheological (Pasting, farinograph, and alveograph) properties of wheat flour (WF) replaced with breadfruit four (05-40%) was analyzed. Baking and sensory qualities of the resulting bread were evaluated. Differences in baking properties of loaves produced under laboratory and industrial conditions were analyzed with t-test, whereas ANOVA was used for other analyses. Peak and final viscosities in the composite blends (CB) ranged from 109.20 to 114.06 RVU and 111.86 to 134.40 RVU, respectively. Dough stability decreased from 9.15 to 0.78 min, whereas farinograph water absorption increased 59.7-65.9%. Alveograph curve configuration ratio increased from 1.27 to 7.39, whereas specific volume (Spv) of the loaves decreased from 2.96 to 1.32 cm(3)/g. The Spv of WF loaves were not significantly different (P > 0.05) from that of the 5% CB, whereas production conditions had no significant effects on absorbed water (t = 0.532, df = 18 P = 0.3005), weight loss during baking (t = 0.865, df = 18, P = 0.199), and Spv (t = 0.828, df = 14.17, P = 0.211). The sensory qualities of the 5% blend were not significantly different from the WF.

  3. A review of nutritional and toxicological implications of castor bean (Ricinus communis L.) meal in animal feeding systems.

    Science.gov (United States)

    Akande, T O; Odunsi, A A; Akinfala, E O

    2016-04-01

    The nutrient-rich defatted castor meal has been tested as a potential source of protein in diets of many livestock species but has limitation due to challenges of toxins. This review was conducted to compile the relevant research information on advances in the use of raw and differently processed castor seed meal in animal feed. In this article, distribution and uses of castor and its products were identified. Research findings on the nutrients profile, principal toxins, various detoxification strategies, nutritional value and toxicity on common livestock species were compiled and reviewed. The defatted seed meal had crude protein range of 32-48%, gross energy of about 3200 kcal/kg. Ricin content was 9.3 mg/g seed, and the average RCA content was 9.9 mg/g. The meal had high activity of lectin, which produced agglutination at about 4.70 mg/ml minimum assays. Reports of detoxification strategies showed varying degrees of success but high pH, moist heating and microbial techniques appeared to exert greater effect on deactivating ricin. Detoxification strategy for the allergen component is inconclusive. Tannins and the phenolic contents were present at trace level and did not constitute notable threat. It was concluded that castor seed holds great potential as feedstuff when upgraded but such upgrading must be safe, cost-effective and labour efficient for commercial acceptability. Journal of Animal Physiology and Animal Nutrition © 2015 Blackwell Verlag GmbH.

  4. High-yield production of biodiesel by non-catalytic supercritical methanol transesterification of crude castor oil (Ricinus communis)

    International Nuclear Information System (INIS)

    Román-Figueroa, Celián; Olivares-Carrillo, Pilar; Paneque, Manuel; Palacios-Nereo, Francisco Javier; Quesada-Medina, Joaquín

    2016-01-01

    The synthesis of biodiesel from crude castor oil in a catalyst-free process using supercritical methanol in a batch reactor was investigated, studying the evolution of intermediate products as well as the conversion of triglycerides and the yield of FAMEs (fatty acid methyl esters) (biodiesel). Experiments were carried out in a temperature range of 250–350 °C (10–43 MPa) at reaction times of 15–90 min for a methanol-to-oil molar ratio of 43:1. Maintaining thermal stability of biodiesel is one of the most important concerns in high-yield supercritical biodiesel production. Hence, thermal decomposition degree of FAMEs was also investigated in different reaction conditions. The maximum yield of FAMEs (96.5%) was obtained at 300 °C (21 MPa) and 90 min. Under these conditions, the conversion of triglycerides was complete, the yield of intermediate products was low (3.29 and 1.41% for monoglycerides and diglycerides, respectively), and thermal decomposition of FAMEs did not occur. The maximum degree of thermal decomposition (80.9%) was produced at 350 °C (43 MPa) and 90 min. Methyl ricinoleate, whose fatty acid chain was the most abundant (88.09 mol%) in castor oil, was very unstable above 300 °C and 60 min, leading to low yields of FAMEs under these conditions. - Highlights: • Supercritical synthesis of biodiesel from crude castor oil was investigated. • Supercritical methanolysis of crude castor oil reached a high yield of FAMEs. • Ricinoleic acid methyl ester was very unstable above 300 °C and 60 min reaction.

  5. Effects of sowing dates and different fertilizers on yield, yield components, and oil percentage of castor bean (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    parviz rezvani moghadam

    2009-06-01

    Full Text Available In order to study the effects of sowing dates and different fertilizers on yield, yield components, and oil percentage of castor bean, an experiment was conducted at Experimental station, College of Agriculture, Ferdowsi University of Mashhad, Iran in years 2004-2005. The experimental treatments comprised all combinations of four sowing dates (11 April, 25 April, 8 May and 22 May and three different fertilizers (cow manure (30 tons/ha, compost (30 tons/ha, chemical fertilizers (100 kg/ha N and 250 kg/ha of super phosphate and no fertilizer as control. Different characteristics such as plant height, main inflorescence height, number of inflorescence per plant, number of secondary stems per plant, number of capsules per plant, number of grain per plant, grain weight per plant, 100 seed weight, grain yield, oil percentage and oil yield were recorded. A factorial arrangement based on a randomized complete block design with three replications was used. The results showed by delaying sowing date grain yield, seed oil percentage and oil yield were decreased, but there was no significant differences between 25 April, 8 May and 22 May sowing dates. Harvest index and 100 seed weight did not affect by neither sowing dates nor fertilizer treatments. The highest number of branches per plant, number of fertile inflorescences per plant, number of fertile capsules per plant, number of grain per plant, grain weight per plant and biological yield were obtained at 8 May sowing date on chemical fertilizer. Percentage of seed oil, grain yield and oil yield was higher at the first sowing date (11 April in compost and chemical fertilizer treatments. Keywords: Castor bean, sowing date, fertilizer, grain yield, oil percentage.

  6. Exogenous glutamine increases lipid accumulation in developing seeds of castor bean (Ricinus communis L. cultured in vitro

    Directory of Open Access Journals (Sweden)

    Zhang Yang

    2015-01-01

    Full Text Available This report describes biomass production and compositional changes of developing castor seeds in response to change in the nitrogen resource (glutamine of the medium. During the early developmental period (24-36 days after pollination, oil was found to initially accumulate in the developing seeds. Carbohydrates and oil were inversely related after glutamine provision (35 mM, in the culture medium. [U-14C] sucrose labeling was used to investigate the effect of metabolic fluxes among different storage materials. Addition of glutamine led to a 7% increase of labeling in lipids and an inverse decrease of labeling in carbohydrates. It was postulated that changes in the glutamine concentration in the medium are likely to influence the partitioning of resources between the various storage products, especially carbohydrates and oil. These observations will contribute to a better understanding of assimilate partitioning in developing castor seeds and the development of molecular strategies to improve castor bean seed quality and plant breeding studies.

  7. Iridoids and phenylpropanoid glucosides from Agalinis communis (Cham. & Schlecht) D'Arcy and Scoparia ericacea Cham. (Scrophulariaceae)

    DEFF Research Database (Denmark)

    von Poser, Gilsane Lino; Henriques, Amélia T.; Schripsema, Jan

    1996-01-01

    In this work we report the isolation of iridoid glucosides from two species of Scrophulariaceae. From the aerial parts of Scoparia ericacea geniposidic acid, geniposide, scandoside methylester, shanzhiside methylester, caryoptoside and the phenylpropanoid glucoside verbascoside were isolated...

  8. Toxicity of six plant extracts and two pyridine alkaloids from Ricinus communis against the malaria vector Anopheles gambiae

    Science.gov (United States)

    The African malaria vector, Anopheles gambiae s.s., is known to feed selectively on certain plants for sugar sources. However, the adaptive significance of this behavior especially on how the extracts of such plants impact on the fitness of this vector has not been explored. This study determined th...

  9. Environ: E00417 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available E00417 Phragmites communis rhizome and stem Pharagmitis rhizoma Crude drug Asparag...ine [CPD:C16438], Protein [CPD:C00017] Phragmites communis [TAX:29695] ... Poaceae (grass family) Phragmites communis rhizome and stem (dried) ...

  10. Effect of glycerine and essential oils (Anacardium occidentale and Ricinus communis on animal performance, feed efficiency and carcass characteristics of crossbred bulls finished in a feedlot system

    Directory of Open Access Journals (Sweden)

    Olga Teresa Barreto Cruz

    2014-11-01

    Full Text Available The effect of corn substitution by glycerine and essential oils on animal performance, apparent digestibility and red and white blood cells of crossbred bulls finished in feedlot was evaluated. Thirty bulls with average weight of 311±28.8 kg and 22±2 month-old were allocated in three diets: CON (without glycerine or essential oils, GLY (with glycerine and GEO (with glycerine and essential oils. The bulls were fed a diet of sorghum silage, cracked corn, soybean meal, urea, limestone and mineral salt. Three grams of cashew and castor oil/animal/day were included in GEO diet. Animals were kept in feedlot for 115 days and slaughtered at average weight of 467±40.6 kg. No differences (P<0.05 among diets regarding final body weight, average daily gain and feed conversion were reported. Ether extract intake was higher (P<0.05 in CON diet compared to the others. Dry matter, organic matter and crude protein digestibility was higher (P<0.05 in GLY diet compared to CON. Acid detergent fibre digestibility was higher (P<0.05 in CON compared to GLY diet. Nonfibrous carbohydrate, fibrous carbohydrate and ether extract digestibility were similar (P>0.05 among diets. No effect of glycerine and essential oil addition on total blood cholesterol, triglycerides, haemogram, leukogram and plasmatic proteins was observed. Corn replacement by glycerine and essential oils addition did not affect (P>0.05 carcass weight, dressing and conformation, carcass length and cushion thickness.

  11. Effect of five year storage on total phenolic content and antioxidant capacity of almond (Amygdalus communisL. hull and shell from different genotypes

    Directory of Open Access Journals (Sweden)

    Khadijeh Sadat Moosavi Dolatabadi

    2014-12-01

    Full Text Available Objectives: Almond (Prunus amygdalus hull and shell are agricultural by-products that are a source of phenolic compounds.The processing of almond produce shell and hull, accounts for more than 50% by dry weight of the almond fruits. Recently, more studies have focused on the influence of storage conditions and postharvest handling on the nutritional quality of fruits, especially the antioxidant phenolics. In this study, influence of long-term storage (five years on the total phenolic and antioxidant capacity of almond hull and shell from different genotypes was evaluated. Materials and Methods: The fruits of subjected genotypes were collected and their hull and shell were separated. They were dried and reduced to fine powder. This powder stored at room temperature for five years. The total phenolic content (TPC and bioactivities (antioxidant potential: DPPH and ABTS radical scavenging and reducing power of extracts were evaluated using spectrophotometric methods. Results: It was found that TPC content and bioactivity levels in the stored almond hull and shell were different, compared to the hulls and shells which were evaluated in 2007. S1-4 genotype had the highest TPC and reducing power in its hull and shell.Low correlation coefficient was observed between phenolic content and the DPPH radical scavenging percentage in hull and shell extract. Conclusions: For the first time, results of this investigation showed that storage can influence the antioxidant and antiradical potential of almond hull and shell.

  12. Seeds' physicochemical traits and mucilage protection against aluminum effect during germination and root elongation as important factors in a biofuel seed crop (Ricinus communis).

    Science.gov (United States)

    Silva, Giovanni Eustáquio Alves; Ramos, Flávia Toledo; de Faria, Ana Paula; França, Marcel Giovanni Costa

    2014-10-01

    We determined the length, volume, dry biomass, and density in seeds of five castor bean cultivars and verified notable physicochemical trait differences. Seeds were then subjected to different toxic aluminum (Al) concentrations to evaluate germination, relative root elongation, and the role of root apices' rhizosphere mucilage layer. Seeds' physicochemical traits were associated with Al toxicity responses, and the absence of Al in cotyledons near to the embryo was revealed by Al-hematoxylin staining, indicating that Al did not induce significant germination reduction rates between cultivars. However, in the more sensitive cultivar, Al was found around the embryo, contributing to subsequent growth inhibition. After this, to investigate the role of mucilage in Al tolerance, an assay was conducted using NH4Cl to remove root mucilage before or after exposure to different Al concentrations. Sequentially, the roots were stained with hematoxylin and a quantitative analysis of staining intensity was obtained. These results revealed the significant contribution of the mucilage layer to Al toxicity responses in castor bean seedlings. Root growth elongation under Al toxicity confirmed the role of the mucilage layer, which jointly indicated the differential Al tolerance between cultivars and an efficient Al-exclusion mechanism in the tolerant cultivar.

  13. Eğirdir (Isparta Ekolojisinde Yetiştirilen Erkenci Yerli Armut (Pyrus communis L. Tiplerinin Bazı Meyve Özelliklerinin Belirlenmesi

    Directory of Open Access Journals (Sweden)

    Mehmet POLAT

    2016-08-01

    Full Text Available Bu çalışma, bazı erkenci yerli armut çeşit ve tiplerinin meyve özelliklerinin belirlenmesi amacıyla 2014 yılında Eğirdir’de (Isparta yürütülmüştür. İncelenen genotiplerin meyve ağırlığı 21.57-273.00 g, meyve boyu 25.91-117.33 mm, meyve eni 35.76-73.48 mm, meyvelerin suda çözünebilir kuru madde miktarı %10.58-16.33, titre edilebilir asit içeriği %0.10-0.94, meyve suyu pH’sı 3.21-5.41 arasında belirlenmiştir. Sonuç olarak, bu genotiplerin bazıları (Sarı Armut ve E2470 tipleri meyve ıslahçıları için ümitvar genotipler olarak tavsiye edilebilir.

  14. Estimation of conservation value of myrtle (Myrtus communis using a contingent valuation method: a case study in a Dooreh forest area, Lorestan Province, Iran

    Directory of Open Access Journals (Sweden)

    Neda Amiri

    2015-11-01

    Full Text Available Background: Around 2000 plant species occur naturally in Lorestan Province of which 250 species are medicinal and myrtle is one of them. Myrtle is a shrub whose leaves and fruits have medicinal value and thus, if managed and harvested properly, could produce sustained economic benefits. In recent years, however, over half of the myrtle site areas was destroyed, due to inappropriate management and excessive harvesting practices. Thus, coming up with a practical harvesting approach along with identifying those factors damaging the sites, seems to be very crucial. Methods: In our investigation, we calculated the conservation value per hectare of myrtle in the Dooreh forest area in Lorestan Province. Using the Contingent Valuation (CV and Double Bounded Dichotomous Choice (DBDC methods, we determined the willingness to pay (WTP for myrtle conservation. The WTP was estimated with a logit model for which indices were obtained based on a maximum precision criterion. Results: The results showed that 86.67 per cent of people were willing to pay for the conservation of these myrtle sites. Average monthly WTP per family was calculated as $0.79. The annual conservation value in terms of WTP for the preservation of the myrtle sites in Dooreh was estimated as $102,525. Among the variables of the model presented, education had a positive impact, while the amount proposed for payment and family size had a negative impact on the WTP. Conclusions: Our estimate of the value of myrtle conservation should provide justification for policy makers and decision making bodies of natural resources to implement policies in order to conserve the natural sites of this species more effectively. Keywords: Conservation value, Myrtle, Contingent valuation method, Double Bounded Dichotomous method, Logit model

  15. Growth Performance, Carcass Characteristics, Antibody Titer and Blood Parameters in Broiler Chickens Fed Dietary Myrtle (Myrtus communis Essential Oil as an Alternative to Antibiotic Growth Promoter

    Directory of Open Access Journals (Sweden)

    Mahmoodi Bardzardi M

    2014-03-01

    Full Text Available This experiment was conducted to determine the effects of Myrtle Essential Oil (MEO on growth performance, carcass characteristics, antibody titer and blood parameters of broiler chickens. A total of 200 Ross 308 broiler chickens were allocated to five dietary treatments with four replicates of 10 birds each. Dietary treatments were prepared by formulating a corn-soybean meal-based diet free of antibiotics (Control and supplementing the basal diet with three levels of MEO at 100, 200, 300 mg/Kg or antibiotic Flavophospholipol (FPL at 600 mg/Kg. The results showed that diets supplemented with MEO and FPL increased the feed intake, body weight gain and improved the feed conversion ratio compared to the control treatment (P. The relative carcass weight was significantly increased, whereas the weight of gastrointestinal tract and liver were decreased in broilers fed MEO (P. Supplementing the basal diet with MEO increased the antibody titers against Avian Influenza Virus (AIV and Newcastle disease Virus (NDV, although supplementing diet with 200 mg/Kg of MEO was more effective (P. Broilers fed MEO diets especially at the level of 300 mg/Kg had a lower white blood cells count and heterophil, heterophil to lymphocyte ratio, mean corpuscular volume and mean corpuscular hemoglobin, but a higher lymphocyte and red blood cells count (P. In conclusion, data showed that diet supplemented with MEO improved the growth performance and increased antibody titers against AIV and NDV, especially at the level of 200 mg/Kg, in broiler chickens and could be an adequate alternative to antibiotics.

  16. Effect of Ensiling and Urea Treatment of Wild ‎Reed Phragmites communis on Productive ‎Performance of Awassi Lambs

    Directory of Open Access Journals (Sweden)

    Ali ‎ A. Saeed

    2017-12-01

    Full Text Available This study was conducted using 24 Awassi male lambs at 4-6 months of age and mean initial weight of 20.59 kg, to investigate the effect of ensiling of wild reed and level of urea (0, 1 or 2% on productive performance of lambs. Results revealed that lambs fed reed consumed higher (P˂0.01 amounts of of all nutrients except digestible DM. Whereas, intake of roughage and total nitrogen (N and total digestible N were affected (P˂0.01 by urea treatment. Intake of all nutrients was significantly affected by interaction between ensiling and urea treatment as well. Final weight, total and daily gain were not affected by ensiling and level of urea, corresponding values were, 25.93, 78.86 and 5.52 for lambs fed reed silage vs. 27.18 kg, 86.83 g/day and 6.07 kg for reed respectively. Final weight gain was not affected by interaction between ensiling and level of urea, whereas, lambs fed reed treated with low level of urea gained higher average final and daily gain. Ensiling was significantly superior in feed conversion ratio (FCR estimated on basis of DM intake (7.74 vs, 8.86. Better (P<0.05 FCR was associated with lower level of urea. Lambs fed untreated reed silage recorded better FCR in comparison with other lambs. Ensiling improved digestibility coefficients of most nutrients, whereas, it decreased (P<0.05 CP digestibility, 67.03 and 69.59% for silage and reed, respectively. Digestibility was also affected by urea treatment, where, better values were generally achieved with 1% of urea except those of fiber components, in which, 2% level of urea was superior (P<0.01 in hemicellulose digestibility

  17. Delayed rupture of the extensor hallucis longus and extensor digitorum communis tendons after breaching the anterior capsule with a radiofrequency probe during ankle arthroscopy: a case report.

    Science.gov (United States)

    Tuncer, Serdar; Aksu, Neslihan; Isiklar, Ugur

    2010-01-01

    A 40-year-old man with early arthritis, loose bodies, and anterolateral joint impingement symptoms in his left ankle, which was refractory to noninvasive therapeutic modalities for 1 year, underwent ankle arthroscopy and radiofrequency thermal ablation. The anterior capsule of the ankle joint was breached by the radiofrequency probe while the loose bodies were removed from the anterior recess, exposing the extensor tendons and resulting in a delayed spontaneous rupture of the extensor hallucis longus tendon and extensor tendons to the second and third toes. The extensor hallucis longus tendon was repaired with a semitendinosus tendon graft, and extensor digitorum tendons underwent primary repair. The patient regained full function and was symptom free 1 year after surgery. Copyright 2010 American College of Foot and Ankle Surgeons. Published by Elsevier Inc. All rights reserved.

  18. Qualitative histologic evaluation of the tissue reaction to the polyurethane resin (ricinus communis - based biopolymer implantation assessed by light and scanning electron microscopy

    Directory of Open Access Journals (Sweden)

    Gustavo Campos Belmonte

    2013-01-01

    Full Text Available The tissue reaction of bone tissue accessed by light microscopy and scanning electron microscopy (SEM images after polyurethane resin implantation is presented in this study. Twenty four male rabbits were used, divided into two groups of 12 animals each (experimental group and control group in which full-thickness cranial defect was surgically created. At 30 and 90 days post operation 6 animals of each group were euthanized and bone samples were removed for analysis. The microscopic results indicated no inflammatory foreign body reaction, a perfect union between the polymer and surgical bone bed surface, lack of bone resorption and presence of a thin layer of osteogenic material covering the polymer surface in contact with the surgical bone bed. The SEM images demonstrate the porosity of the resin, with diameters from 120 to 500 µm. This important feature of this polymer is associated with its osteoconductivity, allowing the bone growth inside it, improving the integration between the material and bone tissue. These results confirm that polyurethane resin derived from Ricinuscommunis is an excellent bone substitute for use in repair surgery for great bone losses.

  19. The Relation between Polyaromatic Hydrocarbon Concentration in Sewage Sludge and Its Uptake by Plants: Phragmites communis, Polygonum persicaria and Bidens tripartita

    Science.gov (United States)

    Gworek, Barbara; Klimczak, Katarzyna; Kijeńska, Marta

    2014-01-01

    The aim of the study was to define the relationship between the concentration of PAHs in sewage sludge at a particular location and their amount in various plant materials growing on it. The credibility of the results is enhanced by the fact that sewage sludge from two separate sewage-treatment plants were selected for their influence on the content of PAHs in three plant species growing on them. The investigations were carried out for a period of three years. The results demonstrated unequivocally that the uptake of PAHs by a plant depended on polyaromatic hydrocarbon concentration in the sewage sludge. The correlation between accumulation coefficient of PAH in a plant and the content of the same PAH in the sewage sludge had for three-, four- and five-ring hydrocarbons an exponential character and for six-ring hydrocarbons was of a linear character. The accumulation coefficients calculated for three-ring aromatics were several times higher than for four-ring PAHs; further the coefficient values calculated for five-ring PAHs were several times lower than for four-ring hydrocarbons. Finally, the accumulation coefficient values of six-ring PAHs were the lowest in the series of studied polyaromatic hydrocarbons. PMID:25310699

  20. [Single coronary artery originating from the left pulmonary artery of a "truncus arteriosus communis" in a living 39 year-old-patient (author's transl)].

    Science.gov (United States)

    D'Alessandro, L C; Di Lorenzo, M

    1976-01-01

    Observation of a single coronary artery with origin from left pulmonary artery in a 39 year-old man who was brought to the operating table for correction of a persistent truncus arteriosus is discussed. The anomaly is expectional and has never been described intra vitam. The authors explain the possible formal genesis on the basis of the most accepted embriogenetic theories and they analyze the special physiopathological behaviour which allowed the long survival and the good physical state of the patient which is still only slightly reduced. In this case a precedent cerebral abscess and frequent hemophtysis indicated the surgical treatment of the truncus arteriosus which was nor performed because of the finding of the coronary anomaly not previously seen with angiography. The authors emphasize the necessity of an accurate pre-operative study of the coronary tree in all patients with persistent truncus arteriosus, to avoid the possibility that anomalies of the origin and course of the coronary arteries can make radical surgical treatment difficult or impossible.

  1. Controlled atmosphere pO2 alters ripening dynamics of 1-MCP treated ‘d’Anjou’ pear (Pyrus communis L.) fruit

    Science.gov (United States)

    Ripening and development of physiological disorders and decay were assessed in ‘d’Anjou’ pear fruit following 1-methylcyclopropene (1-MCP) treatment and cold storage in air or controlled atmosphere (CA). Fruit were exposed after harvest to 0 or 12.6 µmol•L-1 1-MCP and then stored at 0.5 oC in air o...

  2. Pithy brown core in ‘d’Anjou’ pear (Pyrus communis L.) fruit developing during controlled atmosphere storage at pO2 determined by monitoring chlorophyll fluorescense

    Science.gov (United States)

    Physiological responses and fruit quality of ‘d’Anjou’ pear fruit from five orchard lots were evaluated after cold storage in air or controlled atmospheres (CA) with the oxygen (O2) concentration based on assessment of fruit chlorophyll fluorescence (CF) or standard conditions (1.5 kPa O2). The pCO2...

  3. Qualidade pós-colheita da pêra (Pyrus communis L. cultivar Carrick submetida a diferentes condições de armazenamento

    Directory of Open Access Journals (Sweden)

    Coutinho Enilton Fick

    2003-01-01

    Full Text Available As pêras européias não alcançam a maturidade de consumo na planta, sendo amadurecidas após a colheita, mediante armazenamento. O presente trabalho objetivou avaliar a qualidade pós-colheita de pêras cv. Carrick sob diferentes condições de armazenamento. As frutas foram armazenadas à temperatura de 0±0,5ºC e umidade relativa (UR de 90-95% e, para simulação da comercialização, temperatura de 20º±1ºC e UR de 75-80%. As frutas foram submetidas aos tratamentos: T1 30 dias a 0 ºC; T2 28 dias a 0ºC + 2 dias a 20ºC; T3 26 dias a 0ºC + 4 dias a 20ºC; T4 24 dias a 0ºC + 6 dias a 20ºC. Após 30 dias, foram analisadas as seguintes variáveis: sólidos solúveis totais (SST; acidez titulável (AT; relação SST/AT; cor; firmeza de polpa e ocorrência de podridão. Foram avaliadas, ainda, as características sensoriais de sabor e textura, com equipe treinada. Os valores de firmeza da polpa variaram de 15,51 a 3,70 libras. As cores amarelo e vermelho da epiderme tornaram-se mais intensas nos tratamentos T3 e T4; a AT e os SST variaram de 0,39 a 0,32% e 13,4 a 13,87°Brix, respectivamente. Os tratamentos T3 e T4 apresentaram melhores características de sabor e qualidade geral, sendo as frutas classificadas de boa a ótima qualidade. As frutas armazenadas sob refrigeração por 24 e 26 dias, e transferidas por 4 a 6 dias para temperatura de 20°C apresentaram melhor qualidade na comercialização e consumo.

  4. Host feeding in insect parasitoids: why destructively feed upon a host that excretes an alternative?

    NARCIS (Netherlands)

    Burger, J.S.M.; Reijnen, T.M.; Van Lenteren, J.C.; Vet, L.E.M.

    2004-01-01

    Host feeding is the consumption of host tissue by the adult female parasitoid. We studied the function of destructive host feeding and its advantage over non-destructive feeding on host-derived honeydew in the whitefly parasitoid Encarsia formosa Gahan (Hymenoptera: Aphelinidae). We allowed

  5. Reproduction now or later: optimal host-handling strategies in the whitefly parasitoid Encarsia formosa

    NARCIS (Netherlands)

    Burger, J.M.S.; Hemerik, L.; Lenteren, van J.C.; Vet, L.E.M.

    2004-01-01

    We developed a dynamic state variable model for studying optimal host-handling strategies in the whitefly parasitoid Encarsia formosa Gahan (Hymenoptera: Aphelinidae). We assumed that (a) the function of host feeding is to gain nutrients that can be matured into eggs, (b) oogenesis is continuous and

  6. Reproduction now or later: optimal host-hanling strategies in the whitefly parasitoid Encarsia formosa

    NARCIS (Netherlands)

    Burger, J.S.M.; Hemerik, L.; Van Lenteren, J.C.; Vet, L.E.M.

    2004-01-01

    We developed a dynamic state variable model for studying optimal host-handling strategies in the whitefly parasitoid Encarsia formosa Gahan (Hymenoptera: Aphelinidae). We assumed that (a) the function of host feeding is to gain nutrients that can be matured into eggs, (b) oögenesis is continuous and

  7. Análise macroscópica e histológica do emprego da poliuretana derivada do óleo de mamona (Ricinus communis aplicada na tíbia de cães em fase de crescimento Macroscopic and histopathologic evaluations of the use of polyurethane resins derived from castor oil (Ricinus communis applied in the tibia of the puppies

    Directory of Open Access Journals (Sweden)

    Patricia Popak Maria

    2003-08-01

    Full Text Available OBJETIVO: Estudar o efeito da poliuretana de mamona aplicada ao osso de cães em crescimento. MÉTODOS: Foram utilizados 12 cães subdivididos aleatoriamente em 3 grupos, os quais receberam o implante de mamona na face medial proximal da tíbia, com análise macroscópica e histopatológica aos 30 (GIII, 60 (GII e 90 (GI dias. RESULTADOS: A poliuretana foi recoberta por uma cápsula conjuntiva fibrosa, não ocorrendo proliferação óssea ao seu redor. CONCLUSÃO: A poliuretana é biocompatível, comportando-se como espaçador biológico em cães. Nesta espécie não ocorre a osteointegração.PURPOSE: To analyze the effects of castor oil derived poliurethane, when applied to bones of puppies. METHODS: Twelve dogs, randomly divided in 3 groups, received a castor oil derived poliurethane at the medial side of the proximal tibia. Gross and histopathologic evaluations were performed at 30 (GIII, 60 (GII and 90 (GI days. RESULTS: The poliurethane was enclosed in a connective fibrous tissue capsule and there was no new bone formation around it. CONCLUSION: The castor oil derived poliurethane is biocompatible and behaves as a biological "stand off" in dogs. Osteointegration does not occur in this species.

  8. Survey of the castor bean production (Ricinus communis L. in a collection of producers from five counties of Bahia State. = Levantamento da produção de mamona (Ricinus communis L. em uma amostra de produtores em cinco municípios do Estado da Bahia.

    Directory of Open Access Journals (Sweden)

    Vicente de Paula Queiroga

    2011-08-01

    Full Text Available The objective of this study was to verify the situation of the culture of castor bean from a collection of producers located in five counties of Bahia state, highlighting the technical conditions of production and commercialization of the product, beyond its social aspects. Twenty-five castor bean producers were interviewed during the 2005 agricultural year by a team of researchers from the Embrapa Cotton. A present questionnaire with 15 variable questions pertaining to agro-economic and social-economic was applied to producers with the objective to diagnose the agricultural social-economic profiles of theproducers of castor bean that are used for the production of berries to be used within the energy market of the Program of Biodiesel and Ricin chemistry. Data analysis concluded that the family farmers of Bahia have the culture of castor oil as, a major source of income, but the cultivation techniques, promising cultivars, and oil content are underutilized. It was shown that a technology gap can be solved by a adopting a differential pricing policy that is based on a feasibility comprehensive recovery program that increases the ricin culture productivity throughout the production chain, reduce costs, and increase the oil content of cultivars.ResumoObjetivou-se com este estudo verificar a situação da cultura da mamona em uma amostra de produtores levantados em cinco municípios localizados no noroeste do estado da Bahia (São Gabriel, Irecê, Lapão, Ibititá e Cafarnaum, destacando-se as condições técnicas de produção e de comercialização do produto, além dos seus aspectos sociais. Um total de 25 produtores de mamona foi entrevistado no ano agrícola de 2005, por uma equipe de pesquisadores da Embrapa Algodão. Um questionário preestabelecido com 15 variáveis agronômicas e socioecononômicas foi aplicado junto aos produtores, visando o diagnóstico do perfil agrossocioeconômico dos produtores de mamona que estão destinando sua produção de bagas para atender o mercado energético do Programa de Biodiesel e de Ricinoquímica. Pela análise dos dados, concluiu-se que os produtores familiares baianos têm na cultura da mamona, uma das principais fontes de renda, cujas técnicas de cultivo, cultivares promissoras e seu teor de óleo, encontram-se subutilizados. Ficou evidenciado um atraso tecnológico que pode ser solucionado mediante uma política de preço diferencial, visando à viabilidade de um amplo programa de recuperação da ricinocultura que contemple aumento de produtividade em toda cadeia de produção, redução de custos e elevação do teor de óleo das cultivares utilizadas.

  9. The Genus Criodion (Audinet-Serville, 1833) (Coleoptera, Cerambycidae): First Record for Panama

    Science.gov (United States)

    Herrera, David Ezequiel; Marin, Margarita; Santos Murgas, Alonso

    2016-01-01

    Abstract Background The Cerambycidae are one of the largest beetle families. Cerambycid beetles are found on all continents, but the tropics are extremely rich in this species. The genus Criodion (Audinet-Serville, 1833) includes 13 species in the Neotropical Region, two of which occur in Central America. Panama has a high biodiversity, yet a small number of sites have been extensively studied. In this contribution, new distributional data are given for C. cinereum (Olivier, 1795) and C. tuberculatum Gahan, 1892. New information Two species of the genus Criodion (Audinet-Serville, 1833) are recorded for first time in Panama, Criodion cinereum (Olivier, 1795) and Criodion tuberculatum Gahan, 1892. Relevant details are presented for each species. PMID:27099560

  10. Fast Detection of Phenolic Compounds in Extracts of Easter Pears (Pyrus communis from the Atacama Desert by Ultrahigh-Performance Liquid Chromatography and Mass Spectrometry (UHPLC–Q/Orbitrap/MS/MS

    Directory of Open Access Journals (Sweden)

    Mario J. Simirgiotis

    2016-01-01

    Full Text Available A small Chilean variety of pears growing in the town of Toconao, an oasis located at the northeastern edge of the Salar de Atacama, northern Chile, was studied by means of modern PDA and high resolution mass spectral data (UHPLC-PDA-HESI-orbitrap-MS/MS. In addition, the antioxidant features of the fruits were compared with the varieties Packhman’s Triumph and Abate Fetel and correlated with the presence of phenolic compounds. The non-pigmented phenolics were fingerprinted and related to the antioxidant capacities measured by the bleaching of the DPPH radical, the ferric reducing antioxidant power (FRAP, the superoxide anion scavenging activity assay (SA, and total content of phenolics and flavonoids measured by spectroscopic methods. The machine allowed a fast separation of 15 min employing a flow rate of 1 mL per minute and could accurately identify 25 compounds, including several isorhamnetin derivatives and phenolic acids, present in the peel and pulps of this Chilean variety for the first time. The compounds were monitored using a wavelength range of 210–800 nm. The native small Chilean pear showed the highest antioxidant activity measured as the bleaching of the DPPH radical, the ferric reducing antioxidant power and superoxide anion scavenging activity (8.61 ± 0.65 μg/mL, 712.63 ± 12.12 micromols trolox equivalents (μmol/TE/100 g FW, and 82.89% ± 2.52% at 100 μg/mL, respectively.

  11. Identification of candidate genes involved in the sugar metabolism and accumulation during pear fruit post-harvest ripening of 'Red Clapp's Favorite' (Pyrus communisL.) by transcriptome analysis.

    Science.gov (United States)

    Wang, Long; Chen, Yun; Wang, Suke; Xue, Huabai; Su, Yanli; Yang, Jian; Li, Xiugen

    2018-01-01

    Pear ( Pyrus spp.) is a popular fruit that is commercially cultivated in most temperate regions. In fruits, sugar metabolism and accumulation are important factors for fruit organoleptic quality. Post-harvest ripening is a special feature of 'Red Clapp's Favorite'. In this study, transcriptome sequencing based on the Illumina platform generated 23.8 - 35.8 million unigenes of nine cDNA libraries constructed using RNAs from the 'Red Clapp's Favorite' pear variety with different treatments, in which 2629 new genes were discovered, and 2121 of them were annotated. A total of 2146 DEGs, 3650 DEGs, 1830 DEGs from each comparison were assembled. Moreover, the gene expression patterns of 8 unigenes related to sugar metabolism revealed by qPCR. The main constituents of soluble sugars were fructose and glucose after pear fruit post-harvest ripening, and five unigenes involved in sugar metabolism were discovered. Our study not only provides a large-scale assessment of transcriptome resources of 'Red Clapp's Favorite' but also lays the foundation for further research into genes correlated with sugar metabolism.

  12. Detección de compuestos inductores de aborto en acículas de enebro (Juniperus communis) y suero de vacas abortadas en los montes de la Rioja

    Science.gov (United States)

    Over recent years, there have been observed in several cattle farms within the region of the Sierra de Cameros (La Rioja) mountains, reproductive alterations consisting of pre-mature births and birth of dead calves or calves of reduced viability. After laboratory examination of several cases with ne...

  13. Evaluación del potencial de promoción del crecimiento vegetal de microorganismos aislados a partir de residuos de higerilla (Recinus communis) en zanahoria (daucus carota)

    OpenAIRE

    Villota, Claudia Patricia

    2013-01-01

    Tesis (Especialista en Microbiología Industrial). Universidad Católica de Manizales, 2013 Las hortalizas representan el 85% del área sembrada en Colombia, entre ellas están la arveja, tomate, cebolla de bulbo, cebolla junca, arracacha, zanahoria, cilantro, habichuela, zapallo y repollo . Al ser atacadas por plagas y enfermedades, el agricultor realiza control químico alterando de esta manera la economía, la salud y el medio ambiente. El indiscriminado uso de fertilizantes y agroquímicos en...

  14. Expressão gênica diferencial em genótipos de mamona (Ricinus communis L. submetidos a déficit hídrico induzido por PEG

    Directory of Open Access Journals (Sweden)

    Patrícia Favoretto Moraes

    2015-03-01

    Full Text Available A mamoneira é uma cultura de relevância econômica e social no Brasil e no mundo. O óleo produzido por suas sementes, composto principalmente pelo ácido ricinoleico, é estratégico para as indústrias de lubrificantes, cosméticos, polímeros, dentre outras. Embora a mamoneira seja considerada tolerante à seca, a ausência de chuvas no período da floração pode reduzir a produtividade da planta. Respostas diferenciais ao déficit hídrico na espécie têm sido observadas em acessos de bancos de germoplasma e entre cultivares comerciais. Com intuito de conhecer melhor os mecanismos fisiológicos de resposta ao déficit hídrico e direcionar programas de melhoramento genético, o objetivo do trabalho foi analisar a expressão diferencial de genes potencialmente relacionados com a tolerância da mamoneira ao déficit hídrico e o comportamento de enzimas do sistema de defesa antioxidante. O estudo foi conduzido com três acessos (China Careca, IAC 2028 e PB 07 submetidos a um ensaio com solução de polietilenoglicol (PEG 6.000 por um período de 24 horas para indução do déficit hídrico. Os genes CAT, APX, SOD-Cu/Zn, SOD-Fe e SOD-Mn tiveram maior expressão diferencial no acesso China Careca. O gene SOD-Cu/Zn foi o mais diferencialmente expresso quanto comparado ao controle (3,57 vezes no acesso China Careca. Análise da atividade de enzimas relacionadas com estresse oxidativo (Catalase – CAT, Ascorbato Peroxidase – APX, Guaiacol Peroxidase – GPOX e Superoxide Dismutase – SOD revelou que os acessos possuem diferentes mecanismos de resposta ao déficit hídrico. Os resultados apontam que o acesso China Careca pode ser considerado de grande importância para programas de melhoramento genético por apresentar característica de precocidade, sistema de defesa antioxidante mais eficiente e resistência ao déficit hídrico.

  15. Potential candidates for biological control of the black bean aphid Aphis fabae in Serbia

    Directory of Open Access Journals (Sweden)

    Stanković, S.S.

    2015-09-01

    Full Text Available The black bean aphid is widely spread aphid species in the Palaearctic, known to attack over 1150 plant species. Because some of the host plants are of great agricultural interest, Aphis fabae represent a very important pest. We assembled all data concerning the presence of this pest and connected it in tritrophic associations. In the period of 24 years investigation on the territory of Serbia it has been recorded in 107 trophic associations. In total there are 145 findings of A. fabae parasitized by 19 taxa of Aphidiinae (Brackonidae from seven genera. The most suitable biocontrol agents for the black bean aphid are Lysiphlebus fabarum, Binodoxys angelicae, Lipolesis gracilis and the introduced species Lysiphlebus testaceipes.

  16. Protein (Viridiplantae): 761564 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available :27 3977:222 ... 235629:222 ... 235880:222 ... 3987:222 ... 3988:222 ... triptychon and cpc, putative Ricinus communis MADFDHSSSNDISVNSTEDISQDSKLDFSEDEETLITRMFNLVGERWSLIAGRIPGRTAEEIEKYWTSRYSTSQ

  17. Protein (Viridiplantae): 761566 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available :27 3977:222 ... 235629:222 ... 235880:222 ... 3987:222 ... 3988:222 ... triptychon and cpc, putative Ricinus communis MDRRRRKQAKITIVESEEVSSIEWEYINMNQQEEDLIYRMYRLVGERWDLIAGRIPGRKAEEIERFWIMRHRKVF

  18. Protein (Viridiplantae): 761565 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available :27 3977:222 ... 235629:222 ... 235880:222 ... 3987:222 ... 3988:222 ... triptychon and cpc, putative Ricinus communis MADSEHSTSDETYMDSQEERNQESKIEFSEDEEALVIRMYNLVGERWSLIAGRIPGRTAEDIEKYWNSRYSTSE

  19. Protein (Viridiplantae): 761563 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available :27 3977:222 ... 235629:222 ... 235880:222 ... 3987:222 ... 3988:222 ... triptychon and cpc, putative Ricinus communis MGDLDHTSNDTDQDTQDVKGDQDYSRPDFSEDEENLIARMFSLVGERWSLIAGRIPGRTAEEIEKYWATKDSSSNEG

  20. Gall production on hawthorns caused by Gymnosporangium spp.in Hatay province, Turkey

    Science.gov (United States)

    Three hawthorn and related rust diseases caused by Gymnosporangium confusum on Crataegus monogyna, G. clavariiforme on C. orientalis, and G. sabinae on Pyrus communis were detected in Hatay province, Turkey. Gymnosporangium confusum was also found causing telial galls on Juniperus communis. Gymnospo...

  1. Essential Oils May Lead α-Synuclein towards Toxic Fibrils Formation

    Directory of Open Access Journals (Sweden)

    Dina Morshedi

    2016-01-01

    Full Text Available α-Synuclein (α-Syn fibrillation links with Parkinson’s disease (PD and several related syndromes. It is believed that exposure to the factors which promote fibrillation may induce and progress such neurodegenerative diseases (NDs. Herein, the effects of some wildly used essential oils including Myrtus communis (M. communis on α-Syn fibrillation were examined. M. communis particularly increased α-Syn fibrillation in a concentration dependent manner. Given that applications of M. communis are very extensive in Asian societies, especially Zoroastrians, this study was extended towards its role on α-Syn fibrillation/cytotoxicity. By using a unilamellar vesicle, it was shown that the aggregated species with tendency to perturb membrane were increased in the presence of M. communis. In this regard, the cytotoxicity of α-Syn on SH-SH5Y cells was also increased significantly. Inappropriately, the effects of fibrillation inhibitors, baicalein and cuminaldehyde, were modulated in the presence of M. communis. However, major components of M. communis did not induce fibrillation and also the effect of M. communis was limited on other fibrinogenic proteins. Assuming that essential oils have the ability to pass through the blood brain barrier (BBB along with the popular attention on aromatherapy for the incurable ND, these findings suggest an implementation of fibrillation tests for essential oils.

  2. Effet du chlorure de sodium sur la germination de graines de ...

    African Journals Online (AJOL)

    Effet du chlorure de sodium sur la germination de graines de Ricinus communis L. B Diallo, SAN Samba, D Sane, T Diop. Abstract. Ricinus communis L (ricin) figure parmi les espèces du Programme biocarburant au Sénégal. Sa culture sur des terrains incultes (terres salées) constitue une alternative pour éviter une ...

  3. Regeneration and propagation of reed grass for large-scale ...

    African Journals Online (AJOL)

    전서범

    2012-01-26

    Jan 26, 2012 ... Phragmites communis Trin. Key words: Phragmites communis Trin, callus, regeneration, propagation, in vitro culture, 2,4-dichlorophenoxy ... important and abundant species among the aquatic macrophytes used for ... Plant regeneration was investigated in the presence or absence of a growth regulator.

  4. Antibacterial activity and composition of the essential oils of ...

    African Journals Online (AJOL)

    ... -caryophyllene (11.55%) and carvacrol (9.05%). Eucalyptol (50.13%) was identified as the main constituent of the essential oil of Myrtus communis L. The other important components were linalool (12.65%), -terpineol (7.57%) and limonene (4.26%). M. communis showed some activity on Gram positive and Gram negative ...

  5. An Ecological Land Survey for Fort Greely, Alaska

    Science.gov (United States)

    2001-02-01

    is absent. Dominant plants include Artemisia frigida, Calamagrostis purpurascens, Juniperus communis, Populus tremuloides, Rhytidium rugosum, and...absent. Common plants include Carex aquatilis, C. rostrata, C. canescens, Eriophorum angustifolium, Equisetum fluviatile, and Hippuris vulgaris . Not mapped... Artemisia frigida, Calamagrostis purpurascens, Juniperus communis, and crustose lichens, whereas less exposed dry sites were dominated by Populus 30

  6. Bio-evaluation of South African plants for insecticidal properties

    CSIR Research Space (South Africa)

    Maharaj, R

    2006-02-01

    Full Text Available curatellifolia Pittosporum viridiflorum Ricinus communis Kigela africana Pittosporum viridiflorum Plantago major Schefflera umbellifera Litogyne gariepina Plantago major Plectranthus laxiflorus Strychnos pungens Lonchocarpus capassa Psiadia punctulata Plumbago... zeylanica Vernonia fastigata Oncosiphon piluliferum Ptaeroxylon obliquum Psiadia punctulata Ziziphus mucronata Parinari curatellifolia Pterocarpus angolensis Ptaeroxylon obliquum Pentzia globosa Ricinus communis Rumex crispus Pterocarpus angolensis Rumex...

  7. Uptake and Phytoaccumulation of Chromium at Seedling Stage in ...

    African Journals Online (AJOL)

    The parts of Ricinus communis showed a very good Cr storage capacity followed by Millittia ferruginea and Eucalyptus camaldulensis. The parts accumulate nearly the same amount of Cr in all the species. With regard to the uptake of Cr, Ricinus communis was the most efficient in its accumulation capacity as it was found in ...

  8. Cortisol in urine and saliva

    DEFF Research Database (Denmark)

    Hurwitz Eller, N; Netterstrøm, B; Hansen, Åse Marie

    2001-01-01

    The objective of the study was to analyse the relations between excretion of cortisol in urine and saliva and the intima media thickness (IMT) of the artery carotis communis.......The objective of the study was to analyse the relations between excretion of cortisol in urine and saliva and the intima media thickness (IMT) of the artery carotis communis....

  9. Densidades y frecuencias de liberación de Encarsia formosa (Hymenoptera: Aphelinidae) sobre Trialeurodes vaporariorum (Homoptera: Aleyrodidae) en tomate

    OpenAIRE

    Tello Paola; Cantor Fernando; Rodríguez Daniel; Cure José Ricardo

    2007-01-01

    La mosca blanca de los invernaderos, Trialeurodes vaporariorum (Westwood) (Homoptera: Aleyrodidae) es una de las plagas más importantes de cultivos de tomate bajo invernadero en la Sabana de Bogotá. Para su control tradicionalmente se acude a la aplicación de insecticidas. Sin embargo, también son contempladas liberaciones del parasitoide Encarsia formosa (Gahan) (Hymenoptera: Aphelinidae). Para estandarizar el proceso de cría mas...

  10. A new record of longicorn beetle, Acanthophorus rugiceps, from India as a root borer on physic nut, Jatropha curcas, with a description of life stages, biology, and seasonal dynamics.

    Science.gov (United States)

    Prabhakar, Mathyam; Prasad, Y G; Rao, G R; Venkateswarlu, B

    2012-01-01

    Longicorn beetle, Acanthophorus rugiceps Gahan (Coleoptera: Cerambycidae), is reported for the first time as a confirmed host on physic nut, Jatropha curcas L. (Malpighiales: Euphorbiaceae), from India, causing extensive damage to roots. Plants of three years age and above were prone to attack by this pest. In a six year study beginning in 2005, about 11.3 percent of plants in a 16.25 acre physic nut plantation were severely damaged by A. rugiceps. Life stages of A. rugiceps, including egg, larvae, pupae, and adult, are described with a note on their habitat, biology, and behavior. Strategies to manage this pest on physic nut are discussed.

  11. New records of fruit flies (Diptera: Tephritidae), wild hosts and parasitoids (Hymenoptera: Braconidae) in the Brazilian Amazon

    Energy Technology Data Exchange (ETDEWEB)

    Jesus, Cristiane R. de; Oliveira, Manoela N. de; Silva, Ricardo A. da [EMBRAPA Amapa, Macapa, AP (Brazil); Pereira, Julia D.B. [Universidade Federal do Amapa, Macapa, AP (Brazil); Souza Filho, Miguel F. [Instituto Biologico, Campinas, SP (Brazil); Costa Neto, Salustiano V. da [Instituto de Pesquisas Cientificas e Tecnologicas do Amapa, Macapa, AP (Brazil); Marinho, Claudia F.; Zucchi, Roberto A. [Escola Superior de Agricultura Luiz de Queiroz (ESALQ/USP), Piracicaba, SP (Brazil). Dept. de Entomologia, Fitopatologia e Zoologia Agricola

    2008-11-15

    Anastrepha anomala Stone was obtained from Parahancornia amapa (Huber) Ducke (Apocynaceae) fruits, and Anastrepha hastata Stone from Cheiloclinium cognatum (Miers.) (Hippocrateaceae) in the State of Amapa, Brazil. Two braconids, Doryctobracon sp. and Opius bellus Gahan, were reared from the latter fruit fl y species. This is the fi rst record of P. amapa as a fruit fl y host. C. cognatum is the fi rst host known to A. hastata. Both braconids are also the fi rst records of parasitoids for this species. (author)

  12. Parasitóides (Hymenoptera: Braconidae de Anastrepha Schiner (Diptera: Tephritidae no estado do Acre Parasitoids (Hymenoptera: Braconidae of Anastrepha Schiner (Diptera: Tephritidae in the state of Acre, Brazil

    Directory of Open Access Journals (Sweden)

    Marcílio José Thomazini

    2009-03-01

    Full Text Available Este trabalho relata a primeira ocorrência de parasitóides em moscas-das-frutas do gênero Anastrepha Schiner no estado do Acre. No município de Bujari foram encontrados os braconídeos Opius bellus Gahan (72,5%, Doryctobracon areolatus (Szépligeti (26,8% e Utetes anastrephae (Viereck (0,7% associados a A. obliqua (Macquart em frutos de taperebá (Spondias mombin L., com parasitismo de 29,5%. No município de Rio Branco, em frutos de goiaba (Psidium guajava L., ocorreu somente D. areolatus em A. obliqua com parasitismo de 2,7%.This paper records the first parasitoids occurrence on Anastrepha Schiner fruit flies in the state of Acre, Brazil. In the Bujari County there occurred the braconids Opius bellus Gahan (72.5%, Doryctobracon areolatus (Szépligeti (26.8% e Utetes anastrephae (Viereck (0.7% associated with A. obliqua (Macquart in tapereba fruits (Spondias mombin L., with parasitism of 29.5%. In guajava fruits (Psidium guajava L. at Rio Branco County, only D. areolatus on A. obliqua occurred, with parasitism of 2.7%.

  13. Accumulation, selection and covariation of amino acids in sieve tube sap of tansy (Tanacetum vulgare) and castor bean (Ricinus communis): evidence for the function of a basic amino acid transporter and the absence of a γ-amino butyric acid transporter.

    Science.gov (United States)

    Bauer, Susanne N; Nowak, Heike; Keller, Frank; Kallarackal, Jose; Hajirezaei, Mohamad-Reza; Komor, Ewald

    2014-09-01

    Sieve tube sap was obtained from Tanacetum by aphid stylectomy and from Ricinus after apical bud decapitation. The amino acids in sieve tube sap were analyzed and compared with those from leaves. Arginine and lysine accumulated in the sieve tube sap of Tanacetum more than 10-fold compared to the leaf extracts and they were, together with asparagine and serine, preferably selected into the sieve tube sap, whereas glycine, methionine/tryptophan and γ-amino butyric acid were partially or completely excluded. The two basic amino acids also showed a close covariation in sieve tube sap. The acidic amino acids also grouped together, but antagonistic to the other amino acids. The accumulation ratios between sieve tube sap and leaf extracts were smaller in Ricinus than in Tanacetum. Arginine, histidine, lysine and glutamine were enriched and preferentially loaded into the phloem, together with isoleucine and valine. In contrast, glycine and methionine/tryptophan were partially and γ-amino butyric acid almost completely excluded from sieve tube sap. The covariation analysis grouped arginine together with several neutral amino acids. The acidic amino acids were loaded under competition with neutral amino acids. It is concluded from comparison with the substrate specificities of already characterized plant amino acid transporters, that an AtCAT1-like transporter functions in phloem loading of basic amino acids, whereas a transporter like AtGAT1 is absent in phloem. Although Tanacetum and Ricinus have different minor vein architecture, their phloem loading specificities for amino acids are relatively similar. © 2014 Scandinavian Plant Physiology Society.

  14. Ecologia de comunidades de insetos bentônicos (Ephemeroptera, Plecoptera e Trichoptera, em córregos do parque ecológico de Goiânia, Goiás, Brasil Ecology of benthic insects communi ites (Ephemeroptera, Plecoptera and Trichoptera in streams at parque ecológico de Goiânia, Goiás, Brazil

    Directory of Open Access Journals (Sweden)

    Leandro Gonçalves Oliveira

    1997-12-01

    Full Text Available Relationships among some abiotic factors (temperature, velocity, flow, conductivity, oxy-reduction potential and pH and the seazonal density of benthic insects (immature forms of the orders Ephemeroptera, Plecoptera and Trichoptera at the Parque Ecológico de Goiânia, Goiás are studied. An area of 1m² was sampled and abiotic factors were recorded in 4 sites from August/1994 to July/1995. The faunistic composition was 75% Ephemeroptera, 1% Plecoptera and 24% Trichoptera. The data suggest the water velocity and flow as the main factors that determined the aquatic insects abundance.

  15. Morphological and pomological traits of almond phenotypes ...

    African Journals Online (AJOL)

    Amygdalus communis L.) and more positive traits than the standard varieties that were cultivated, were identified. Over the period of three years, phenological and pomological research was conducted in situ, along with the observation of vegetative ...

  16. The regional economic impacts of bypasses : a longitudinal study incorporating spatial panel econometrics and multilevel modeling.

    Science.gov (United States)

    2011-09-01

    This paper will describe an integrated approach to documenting and quantifying the impacts of bypasses : on small communities, with a focus on what economic impacts, if any, occur, and how these impacts : change over time. Two similarly sized communi...

  17. Marker list: QM118798 [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available ACTCCCT P128R068T003 x 'Moonglow'|WBC ('Bartlett' consensus map) LG13 ... 10.1371/journal.pone.0077022 24155917 ... QM118798 Pyrus communis Rosaceae NH021a SSR ATCTCAATTTTCTCGGTAACCA CTGATATCTCTCTGC

  18. Marker list: QM118797 [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QM118797 Pyrus communis Rosaceae NH013a SSR GGTTTGAAGAGGAATGAGGAG CATTGACTTTAGGGCA...CATTTC P128R068T003 x 'Moonglow'|WBC ('Bartlett' consensus map) LG_01 ... 10.1371/journal.pone.0077022 24155917

  19. Marker list: QM118793 [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available AATCTCC P128R068T003 x 'Moonglow'|WBC ('Bartlett' consensus map) LG_11 ... 10.1371/journal.pone.0077022 24155917 ... QM118793 Pyrus communis Rosaceae NB105a SSR AAACAACCGACTGAGCAACATC AAAATCTTAGCCCAA

  20. Marker list: QM118783 [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QM118783 Pyrus communis Rosaceae CH04c10 SSR GGGTTAGGTTGTCTTCTCTCCT GCTTCTCGGGTGAG...TTTTTC P128R068T003 x 'Moonglow'|WBC ('Bartlett' consensus map) LG17 ... 10.1371/journal.pone.0077022 24155917

  1. Marker list: QM118780 [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available AGGTGGA P128R068T003 x 'Moonglow'|WBC ('Bartlett' consensus map) LG14 ... 10.1371/journal.pone.0077022 24155917 ... QM118780 Pyrus communis Rosaceae CH03g06 SSR ATCCCACAGCTTCTGTTTTTG TCACAGAGAATCACA

  2. Marker list: QM118786 [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QM118786 Pyrus communis Rosaceae CH05a04 SSR GAAGCGAATTTTGCACGAAT GCTTTTGTTTCATTGA...ATCCCC P128R068T003 x 'Moonglow'|WBC ('Bartlett' consensus map) LG16 ... 10.1371/journal.pone.0077022 24155917

  3. Marker list: QM118800 [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available ATATTAG P128R068T003 x 'Moonglow'|WBC ('Bartlett' consensus map) LG_09 ... 10.1371/journal.pone.0077022 24155917 ... QM118800 Pyrus communis Rosaceae NH029a SSR GAAGAAAACCAGAGCAGGGCA CCTCCCGTCTCCCACC

  4. Marker list: QM118778 [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available ACAAGGC P128R068T003 x 'Moonglow'|WBC ('Bartlett' consensus map) LG12 ... 10.1371/journal.pone.0077022 24155917 ... QM118778 Pyrus communis Rosaceae CH03c02 SSR TCACTATTTACGGGATCAAGCA GTGCAGAGTCTTTG

  5. Marker list: QM118784 [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QM118784 Pyrus communis Rosaceae CH04e05 SSR AGGCTAACAGAAATGTGGTTTG ATGGCTCCTATTGC...CATCAT P128R068T003 x 'Moonglow'|WBC ('Bartlett' consensus map) LG_07 ... 10.1371/journal.pone.0077022 24155917

  6. Low power optical limiting studies on nanocrystalline benzimidazole ...

    Indian Academy of Sciences (India)

    –3 They are the key materials for numer- ous photonic applications like signal processing, switching, frequency generation, optical data storage, optical communi- cation and image processing.4,5 Also, organic materials with large third-order ...

  7. Antioxidant Properties of Methanolic Extracts of some Nigerian ...

    African Journals Online (AJOL)

    Keywords: Nutritional oxidative stress, Reactive oxygen species, Antioxidant activity, Protein deficient diet, .... All experimental protocols were performed within ...... Essential oil composition of Pistacia lentiscus L. and Myrtus communis L.: Evaluation of antioxidant capacity of methanolic extracts. Food Chemistry, 107:.

  8. Nemudzivhadi and Masoko Afr J Tradit Complement Altern Med ...

    African Journals Online (AJOL)

    cadewumi

    ANTIOXIDANT AND ANTIBACTERIAL PROPERTIES OF ZIZIPHUS MUCRONATA AND RICINUS COMMUNIS. LEAVES EXTRACTS. Vhutshilo Nemudzivhadi and Peter Masoko*. Department of Biochemistry, Microbiology and Biotechnology, University of Limpopo, Private Bag X1106, Sovenga,. 0727, South Africa.

  9. The effect of herbivory on temporal and spatial dynamics of foliar nectar production in cotton and castor

    NARCIS (Netherlands)

    Wäckers, F.L.; Zuber, D.; Wunderlin, R.; Keller, F.

    2001-01-01

    The effects of feeding Spodoptera a littoralis (Boisd.) (Lepidoptera: Noctuidae) larvae on the quantity and distribution of extrafloral nectar production by leaves of castor ((Ricinus communis) and cotton (Gossypium herbaceum) were investigated. Following larval feeding, the total volume of nectar

  10. The effect of herbivory on temporal and spatial dynamics of foliar nectar production in cotton and castor

    NARCIS (Netherlands)

    Wäckers, F.L.; Zuber, D.; Wunderlin, R.; Keller, F.

    2001-01-01

    The effects of feeding Spodoptera littoralis(Boisd.) (Lepidoptera: Noctuidae) larvae on the quantity and distribution of extrafloral nectar production by leaves of castor (Ricinus communis) and cotton (Gossypium herbaceum) were investigated. Following larval feeding, the total volume of nectar

  11. Glycine functionalized alumina nanoparticles stabilize collagen in ...

    Indian Academy of Sciences (India)

    Research Initiatives for Waterless Tanning' (RIWT-. CSC0202) is greatly acknowledged. CSIR-CLRI Communi- cation no. 1156. References. [1] Ramachandran G N and Kartha G 1955 Nature 176 593. [2] Usha R and Ramasami T 1999 Thermochim.

  12. A new discovery of Glossopteris in southeastern Mongolia as an argument for distant migration of Gondwanan plants

    Science.gov (United States)

    Naugolnykh, Serge V.; Uranbileg, L.

    2018-04-01

    Well-preserved leaves conforming to the fossil genus Glossopteris are found in the Permian deposits of southeastern Gobi, Khatan-Bulag locality, Mongolia. These leaves have many features in common with Glossopteris communis Feistmantel described from India. The locality Khatan-Bulag belongs to Sulinkheer nappe-fold tectonic megazone. The Glossopteris sp. cf. G. communis specimens from the Khatan-Bulag suggest that there was effective migration gateway between Gondwana and southern regions of Asia in the mid-Permian.

  13. Decaimiento de los enebros en los parques naturales del Macizo del Penyagolosa y Puebla de San Miguel

    OpenAIRE

    Olivares Tormo, Amparo

    2017-01-01

    Se comunica la infección masiva de Juniperus oxycedrus y J. communis por Arceuthobium oxycedri, que está produciendo una elevada mortandad de los enebros en los parques naturales de alta montaña valencianos. Study about juniper disease owing to a massive infection of Juniperus communis and Juniperus oxycedrus by Arceuthobium oxycedri that is producing a high mortality of junipers in High Mountain of Natural Parks in Valencian Community

  14. Genome Wide Identification, Evolutionary, and Expression Analysis of VQ Genes from Two Pyrus Species.

    Science.gov (United States)

    Cao, Yunpeng; Meng, Dandan; Abdullah, Muhammad; Jin, Qing; Lin, Yi; Cai, Yongping

    2018-04-23

    The VQ motif-containing gene, a member of the plant-specific genes, is involved in the plant developmental process and various stress responses. The VQ motif-containing gene family has been studied in several plants, such as rice ( Oryza sativa ), maize ( Zea mays ), and Arabidopsis ( Arabidopsis thaliana ). However, no systematic study has been performed in Pyrus species, which have important economic value. In our study, we identified 41 and 28 VQ motif-containing genes in Pyrus bretschneideri and Pyrus communis , respectively. Phylogenetic trees were calculated using A. thaliana and O. sativa VQ motif-containing genes as a template, allowing us to categorize these genes into nine subfamilies. Thirty-two and eight paralogous of VQ motif-containing genes were found in P. bretschneideri and P. communis , respectively, showing that the VQ motif-containing genes had a more remarkable expansion in P. bretschneideri than in P. communis . A total of 31 orthologous pairs were identified from the P. bretschneideri and P. communis VQ motif-containing genes. Additionally, among the paralogs, we found that these duplication gene pairs probably derived from segmental duplication/whole-genome duplication (WGD) events in the genomes of P. bretschneideri and P. communis , respectively. The gene expression profiles in both P. bretschneideri and P. communis fruits suggested functional redundancy for some orthologous gene pairs derived from a common ancestry, and sub-functionalization or neo-functionalization for some of them. Our study provided the first systematic evolutionary analysis of the VQ motif-containing genes in Pyrus , and highlighted the diversification and duplication of VQ motif-containing genes in both P. bretschneideri and P. communis .

  15. Additions to the Encyrtidae and Mymaridae (Chalcidoidea of India with new distribution and host records for some species

    Directory of Open Access Journals (Sweden)

    A. Rameshkumar

    2015-06-01

    Results and conclusions. A total of 961 specimens were collected, from which 883 COI sequences were obtained. The sequences generated corresponded to 289 barcoding species and 30 identified genera. The most speciose genera were Heterospilus Haliday (170 spp., Ecphylus Förster (19 spp., Allorhogas Gahan (15 spp. and Callihormius Ashmead (14 spp.. Addition of previously collected material increased the diversity of the subfamily in the region to 34 genera and 290 species. Paraphyly of Heterospilus with respect to Neoheterospilus and Heterospathius was again recovered. Twenty new species and two new genera (Sabinita Belokobylskij, Zaldívar-Riverón et Martínez, Ficobolus Martínez, Belokobylskij et Zaldívar-Riverón have been described so far from the material collected in this work.

  16. How industries change.

    Science.gov (United States)

    McGahan, Anita M

    2004-10-01

    It's fairly obvious: To make intelligent investments within your organization, you need to understand how your whole industry is changing. But such knowledge is not always easy to come by. Companies misread clues and arrive at false conclusions all the time. To truly understand where your industry is headed, you have to take a long-term, high-level look at the context in which you do business, says Boston University professor Anita McGahan. She studied a variety of businesses from a cross section of industries over a ten-year period, examining how industry structure affects business profitability and investor returns. Her research suggests that industries evolve along one of four distinct trajectories--radical, progressive, creative, and intermediating--that set boundaries on what will generate profits in a business. These four trajectories are defined by two types of threats. The first is when new, outside alternatives threaten to weaken or make obsolete core activities that have historically generated profits for an industry. The second is when an industry's core assets--its resources, knowledge, and brand capital--fail to generate value as they once did. Industries undergo radical change when core assets and core activities are both threatened with obsolescence; they experience progressive change when neither are jeopardized. Creative change occurs when core assets are under threat but core activities are stable, and intermediating change happens when core activities are threatened while core assets retain their capacity to create value. If your company's innovation strategy is not aligned with your industry's change trajectory, your plan for achieving returns on invested capital cannot succeed, McGahan says. But if you understand which path you're on, you can determine which strategies will succeed and which will backfire.

  17. Mixed Wastewater Coupled with CO2 for Microalgae Culturing and Nutrient Removal.

    Directory of Open Access Journals (Sweden)

    Lili Yao

    Full Text Available Biomass, nutrient removal capacity, lipid productivity and morphological changes of Chlorella sorokiniana and Desmodesmus communis were investigated in mixed wastewaters with different CO2 concentrations. Under optimal condition, which was 1:3 ratio of swine wastewater to second treated municipal wastewater with 5% CO2, the maximum biomass concentrations were 1.22 g L-1 and 0.84 g L-1 for C. sorokiniana and D. communis, respectively. Almost all of the ammonia and phosphorus were removed, the removal rates of total nitrogen were 88.05% for C. sorokiniana and 83.18% for D. communis. Lipid content reached 17.04% for C. sorokiniana and 20.37% for D. communis after 10 days culture. CO2 aeration increased intracellular particle numbers of both microalgae and made D. communis tend to be solitary. The research suggested the aeration of CO2 improve the tolerance of microalgae to high concentration of NH4-N, and nutrient excess stress could induce lipid accumulation of microalgae.

  18. Mixed Wastewater Coupled with CO2 for Microalgae Culturing and Nutrient Removal

    Science.gov (United States)

    Yao, Lili; Shi, Jianye; Miao, Xiaoling

    2015-01-01

    Biomass, nutrient removal capacity, lipid productivity and morphological changes of Chlorella sorokiniana and Desmodesmus communis were investigated in mixed wastewaters with different CO2 concentrations. Under optimal condition, which was 1:3 ratio of swine wastewater to second treated municipal wastewater with 5% CO2, the maximum biomass concentrations were 1.22 g L-1 and 0.84 g L-1 for C. sorokiniana and D. communis, respectively. Almost all of the ammonia and phosphorus were removed, the removal rates of total nitrogen were 88.05% for C. sorokiniana and 83.18% for D. communis. Lipid content reached 17.04% for C. sorokiniana and 20.37% for D. communis after 10 days culture. CO2 aeration increased intracellular particle numbers of both microalgae and made D. communis tend to be solitary. The research suggested the aeration of CO2 improve the tolerance of microalgae to high concentration of NH4-N, and nutrient excess stress could induce lipid accumulation of microalgae. PMID:26418261

  19. Identification of top-down forces regulating cotton aphid population growth in transgenic Bt cotton in central China.

    Directory of Open Access Journals (Sweden)

    Peng Han

    Full Text Available The cotton aphid Aphis gossypii Glover is the main aphid pest in cotton fields in the Yangtze River Valley Cotton-planting Zone (YRZ in central China. Various natural enemies may attack the cotton aphid in Bt cotton fields but no studies have identified potential specific top-down forces that could help manage this pest in the YRZ in China. In order to identify possibilities for managing the cotton aphid, we monitored cotton aphid population dynamics and identified the effect of natural enemies on cotton aphid population growth using various exclusion cages in transgenic Cry1Ac (Bt+CpTI (Cowpea trypsin inhibitor cotton field in 2011. The aphid population growth in the open field (control was significantly lower than those protected or restricted from exposure to natural enemies in the various exclusion cage types tested. The ladybird predator Propylaea japonica Thunberg represented 65% of Coccinellidae predators, and other predators consisted mainly of syrphids (2.1% and spiders (1.5%. The aphid parasitoids Aphidiines represented 76.7% of the total count of the natural enemy guild (mainly Lysiphlebia japonica Ashmead and Binodoxys indicus Subba Rao & Sharma. Our results showed that P. japonica can effectively delay the establishment and subsequent population growth of aphids during the cotton growing season. Aphidiines could also reduce aphid density although their impact may be shadowed by the presence of coccinellids in the open field (likely both owing to resource competition and intraguild predation. The implications of these results are discussed in a framework of the compatibility of transgenic crops and top-down forces exerted by natural enemy guild.

  20. Myrtus comunis and Eucalyptus camaldulensis cytotoxicity on breast cancer cells

    Directory of Open Access Journals (Sweden)

    Hrubik Jelena D.

    2012-01-01

    Full Text Available In vitro cytotoxicity of methanol, ethyl acetate, n-buthanol, and water extracts of Myrtus communis L. and Eucalyptus camaldulensis Dehnh. was examined against two human breast cancer cell lines (MCF 7 and MDA-MB-231 using MTT and SRB assays. The results showed significant cytotoxic potential of examined extracts, with IC50 values ranging from 7 to 138 μg/ml for M. communis and 3-250 μg/ml for E. camaldulensis. The two plants generally expressed similar activity, and no significant difference in cell line’s sensitivity towards extracts was observed. The results indicate to M. communis and E. camaldulensis as candidates for thorough chemical analyses for identification of active compounds, and eventually for attention in the process of discovery of new natural products in the control of cancer. [Projekat Ministarstva nauke Republike Srbije, br. 173037 i br. 172058

  1. Taste receptor plasticity in relation to feeding history in two congeneric species of Papilionidae (Lepidoptera).

    Science.gov (United States)

    Sollai, Giorgia; Biolchini, Maurizio; Crnjar, Roberto

    2018-02-15

    In the peripheral taste system of insects, the responsiveness of gustatory receptor neurons (GRNs) depends on several factors, such as larval instar, feeding history, physiological state and time of day. To study the role of the feeding history, the spike activity of the maxillary taste chemosensilla in the larvae of two related species of Lepidoptera (Papilio machaon L. and Papilio hospiton Géné) raised on different host plants, was recorded with electrophysiological techniques after stimulation with simple stimuli (sugars, bitters and inorganic salt) and host plant saps, with the aim of cross-comparing their response patterns and evaluating any effects of different feeding histories. For this purpose the larvae were raised each on their preferential host plant and, in addition, P. machaon larvae was also raised on Ferula communis, the host plant preferred by P. hospiton. The GRN spike activity of the lateral and medial sensilla of each test group was measured in response to simple and complex stimuli. The taste discrimination capabilities and modalities of the two species were measured and cross-compared with the aim of studying convergence and/or divergence linked to the insect feeding history. The results show that: a) the GRN responsiveness of both sensilla in P. machaon raised on Fe. communis differs significantly from that of P. machaon on Foeniculum vulgare, but is not different from P. hospiton on Fe. communis; b) P. machaon larvae raised on Fe. communis exhibit response spectra somewhat intermediate between those of P. machaon on fennel and of P. hospiton on Fe. communis, the latter two exhibiting a wider difference from each other; c) the pattern of GRNs activity generated by each plant sap in both sensilla of P. machaon raised on Fe. communis is different from that generated when raised on Fo. vulgare, while no difference is observed with P. hospiton. The data support the hypothesis that diet-related factors may influence peripheral chemosensitivity

  2. Volatile chemical composition and bioactivity of six essential oils against the stored food insect Sitophilus zeamais Motsch. (Coleoptera Dryophthoridae).

    Science.gov (United States)

    Bertoli, Alessandra; Conti, Barbara; Mazzoni, Valerio; Meini, Laura; Pistelli, Luisa

    2012-01-01

    Essential oils (EOs) of Achillea millefolium, Myrtus communis, Rosmarinus officinalis, Helichrysum italicum, Foeniculum vulgare and Lavandula angustifolia were analysed with GC-FID and GC-MS in order to define their aromatic profiles and then their toxicity and repellent activity against Sitophilus zeamais Motsch. (Coleoptera Dryophthoridae) with specific bioassays were evaluated. Results from topical applications on insects showed that all EOs had variable and significant insecticidal activity. Mortality rate never exceeded 76%. Results of repellency tests are indicated for M. communis and L. angustifolia EOs, displaying high repellent activity to S. zeamais adults.

  3. Equilibrium Sorption studies of Fe, Cu and Co ions in aqueous ...

    African Journals Online (AJOL)

    Recinius Communis Linn a commonly found herbal plant was used to prepare activated carbon by physicochemical activation method. The sorption capacity of this bio-resource material to remove Fe(III), Cu(II) and Co(II) from aqueous solutions was determined by batch tests. The influences of important parameters such as ...

  4. Location and timing of the deposition of egg strands by perch (Perca fluviatilis L.): the roles of lake hydrology, spawning substrate and female size

    Czech Academy of Sciences Publication Activity Database

    Čech, Martin; Peterka, Jiří; Říha, Milan; Muška, Milan; Hejzlar, Josef; Kubečka, Jan

    -, č. 403 (2011), 08p1-08p12 ISSN 1961-9502 R&D Projects: GA ČR(CZ) GP206/09/P266 Institutional research plan: CEZ:AV0Z60170517 Keywords : SCUBA diving * aquatic vegetation * lake management * common stonewort Chara vulgaris * common reed Phragmites communis Subject RIV: EG - Zoology Impact factor: 1.520, year: 2011

  5. Antibacterial activity and composition of the essential oils of ...

    African Journals Online (AJOL)

    ONOS

    2010-01-25

    Jan 25, 2010 ... Full Length Research Paper ... Water-distilled essential oils from leaves of Eucalyptus camaldulensis Dehn. and Myrtus communis L., ... Eucalyptus is one of the world's important and most widely planted genera. Among its main uses is the production of essen- tial oils, which are used for medicinal and ...

  6. Obecný smysl u Arendtové a Kantův zdravý rozum

    Czech Academy of Sciences Publication Activity Database

    Glombíček, Petr

    2011-01-01

    Roč. 59, č. 3 (2011), s. 351-376 ISSN 0015-1831 R&D Projects: GA AV ČR(CZ) KJB900090704 Institutional research plan: CEZ:AV0Z90090514 Keywords : sensus communis * communal sense * judgement Subject RIV: AA - Philosophy ; Religion

  7. Book notice

    African Journals Online (AJOL)

    beginning of a long involvement with prisons and prisoners. Not surprisingly, what one finds ... detainees; the supply of food and medicine to inmates; the establishment of communi- cation channels with the ... matic figure of 'Noriega' the prison warder and the temporary loss of a sensitive file. For all the forcefulness with ...

  8. Isolation and expression analysis of LEA genes in peanut (Arachis ...

    Indian Academy of Sciences (India)

    AAC49859, PvLEA-18 [Phaseolus vulgaris]; AAF81194, LEA-18 [Phaseolus vulgaris]; AAS47599, At2g33690 [Arabidopsis thaliana];. CAN76778, hypothetical protein [Vitis vinifera]; EEF29227, conserved hypothetical protein [Ricinus communis]; NP_179892, At2g23110. [Arabidopsis thaliana]; Q9S7N8 Seed maturation ...

  9. Common elbow conditions

    African Journals Online (AJOL)

    2011-09-02

    Sep 2, 2011 ... Anatomy. The tendons of extensor carpi radialis longus, extensor carpi radialis brevis (ECRB), extensor digitorum communis and the extensor carpi ulnaris make ... Pain is sited over the lateral epicondyle and radiates down the forearm along the ... Pain may also occur with passive pronation of the forearm.

  10. Antibacterial and antioxidant activities of the essential oils and ...

    African Journals Online (AJOL)

    The present study deals with the evaluation of the in vitro antioxidant and antibacterial activity of phenolic extracts and essential oils of two medicinal and aromatic plants Zygophyllum album and Myrtus communis by using the 2,2- diphenyl-2-picrylhydrazyl radical, total antioxidant power and agar diffusion methods and ...

  11. Potentials for Use of Medicinal Plants in Female Reproductive ...

    African Journals Online (AJOL)

    USER

    canadensis L.), and Chaste tree fruits (Vitex agnus- castus L.) are listed in the U. S. Pharmacopoeia and are available as dietary supplements to be used for premenstrual stress syndrome, as emmenagogue agents, and for gynaecological problems. Castor oil (Ricinus communis L.)18 and cotton bark root (Gossypium.

  12. Cenoses of phototrophic algae of ultrasaline lakes in the Kulunda steppe (Altai krai, Russian Federation)

    Science.gov (United States)

    Sapozhnikov, Ph. V.; Kalinina, O. Yu.; Nikitin, M. A.; Samylina, O. S.

    2016-01-01

    In 2012, expeditions of the Institute of Microbiology, Russian Academy of Sciences, delivered samples of algo-bacterial mats from Kulunda steppe alkaline lakes (Petukhovskoe alkaline lake, Tanatar VI, and Gorchina III). The filamentous alga Ctenocladus circinnatus (Chlorophyta) acted as an edificator of the mats. The composition of cenoses algocomponents also included chlorophytes Dunaliella viridis and Picocystis salinarum as well as diatoms Anomeoneis sphaerophora, Brachysira brebissonii, B. zellensis, Mastogloia pusilla var. subcapitata, Nitzschia amphibia, N. cf. communis, and Nitzschia sp. 1. The composition and structure of phototrophic algae cenoses (including diatom taxocenes) were described for the investigated lakes for the first time. For the period from 2011 to 2012, the total mineralization significantly increased in lakes. This involved sensible alterations of cenoses. B. zellensis was the most permanent component of diatom taxocenes in both seasons. In the summer of 2011, it was often accompanied by A. sphaerophora and B. brebissonii. In the summer of 2012, A. sphaerophora was found only singularly in Lake Gorchina III, and some biotopes of Lake Tanatar VI were massively inhabited by N. cf. communis, including colonies that had not been previously described for the species. The genetic analysis of three diatoms, which are markedly different from each other in their appearance and were sampled from different lakes but were all determined as Nitzschia cf. communis, showed their complete similarity to each other with the 18S rRNA gene fragment and the highest similarity of all the three diatoms with the species Nitzschia communis.

  13. MRI in soils: determination of water concent changes due to root water uptake by means of a multi-slice-multi-echo sequence (MSME)

    NARCIS (Netherlands)

    Pohlmeier, A.; Vergeldt, F.; Gerkema, E.; As, van H.; Dusschoten, van D.; Vereecken, H.

    2010-01-01

    Root water uptake by ricinus communis (castor bean) in fine sand was investigated using MRI with multiecho sampling. Before starting the experiments the plants germinated and grew for 3 weeks in a cylindrical container with a diameter of 9 cm. Immediately before the MRI experiments started, the

  14. Scope of neonatal care services in major Nigerian hospitals

    African Journals Online (AJOL)

    2015-10-12

    Oct 12, 2015 ... This definition is adapted from the AAP guidelines to meet with available resources in a developing commu- nity. This standard of tiered level of neonatal services as contained in the policy statement of the American Acad- emy of Pediatrics8 and utilized in developed communi- ties is yet to be applied in ...

  15. 8th BEST EN Think Tank on Sustaining Quality of Life through Tourism

    DEFF Research Database (Denmark)

    2008-01-01

    The BEST EN Think Tank VIII acknowledges that tourism is a well-known tool to facilitate regeneration and economic development and enhance the quality of life of visitors and host communities. The theme reflects the fact that finding the right balance between the welfare of tourists, host communi...

  16. Communicating Information

    Indian Academy of Sciences (India)

    There was a mathematical theory of information and communication .... Theory of Communi- cation first published in 1948." [5]. GENERAL I ARTICLE that longer' the encoding more the time and expense needed to send it across, let us look at the question of ... the probability that a random consumer would choose to send ...

  17. Trans-American Security: What’s Missing? Strategic Forum, Number 228, September 2007

    Science.gov (United States)

    2007-09-01

    lation growth accompanied by the communi- cations and democratic revolutions virtually invited social rupture. Poverty and inequal- ity that might have...remarkably similar set of points is made by the former commander of the Chilean army, General Juan Emilio Cheyre, in “ Seguridad hemisferica: ‘un desafio

  18. African Journal of Biotechnology - Vol 11, No 18 (2012)

    African Journals Online (AJOL)

    Activity of the main fatty acid components of the hexane leaf extract of Ricinus communis against Spodoptera frugiperda · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. MA Ramos-López, MM González-Chávez, NC Cárdenas-Orteg, MA Zavala-Sánchez, S Pérez G ...

  19. Optical Computing

    Indian Academy of Sciences (India)

    (For example, the Japanese Earth Simu- lator, a computer system developed by NEC, uses a ..... quite similar to the one shown in Figure 1, except that the phthalocyanine film was replaced by a hollow fiber ... and hence funds were provided accordingly. The areas of space exploration, earth resource utilization, communi-.

  20. Ethiopian Pharmaceutical Journal - Vol 29, No 1 (2011)

    African Journals Online (AJOL)

    The Essential Oil of Myrtus communis L. Produces a Non-Sedating Anxiolytic Effect in Mice Models of Anxiety · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. E Hailu, E Engidawork, K Asres, 1-12. http://dx.doi.org/10.4314/epj.v29i1.1 ...

  1. First Report of Cadophora luteo-olivacea Causing Side Rot on ‘Conference’ Pears in the Netherlands

    NARCIS (Netherlands)

    Wenneker, M.; Pham, K.T.K.; Lemmers, M.E.C.; Boer, de Astrid; Leeuwen, van Paul; Hollinger, T.C.; Haas, de B.H.; Köhl, J.

    2016-01-01

    Pear (Pyrus communis) is an important fruit crop in the Netherlands. Symptoms of side rot disease of pear fruits were first observed in 2008 on cv. Conference in storage in the Netherlands. Typical round to oval, dark-brown, and slightly sunken spots (size 0.5 to 1.0 cm in diameter) appeared after

  2. African Journal of Biotechnology - Vol 14, No 42 (2015)

    African Journals Online (AJOL)

    Toxic effects of Ricinus communis non-protein trypsin inhibitor on Spodoptera frugiperda (J. E. Smith) (Lepidoptera:Noctuidae) · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Gislaine A. Carvalho, Custódio D. dos Santos, Dejane S. Alves, Geraldo A. Carvalho, ...

  3. Variability of crossreactivity of IgE antibodies to group I and V allergens in eight grass pollen species

    NARCIS (Netherlands)

    van Ree, R.; Driessen, M. N.; van Leeuwen, W. A.; Stapel, S. O.; Aalberse, R. C.

    1992-01-01

    Crossreactivity to Dactylis glomerata, Festuca rubra, Phleum pratense, Anthoxanthum odoratum, Secale cereale, Zea mays, and Phragmites communis of IgE antibodies against Lol p I or Lol p V was investigated by means of RAST-inhibition. Within a group of sera the degree of crossreactivity was

  4. Physicochemical characteristics of castor oil from local wild castor ...

    African Journals Online (AJOL)

    Physicochemical characteristics of castor oil from seeds of the local wild castor plant (Ricinus communis) found in Ghana were determined to evaluate its suitability for exploitation for industrial purposes. The castor seeds were found to be rich in oil, containing 57 per cent castor oil of which 37 per cent was easily expressed ...

  5. Bioactivity of plant extracts on the larval and pupal stages of Aedes aegypti (Diptera, Culicidea

    Directory of Open Access Journals (Sweden)

    Lafayette Pereira Candido

    2013-07-01

    Full Text Available Introduction Aedes aegypti is responsible for the transmission of the dengue and yellow fever viruses. This study evaluated the effects of extracts from Cnidosculos phyllacanthus, Ricinus communis, and Coutarea hexandra on the developmental periods of A.aegypti larvae and pupae. Crude extracts of C. phyllacanthus and C. hexandra and oil from R. communis and C. phyllacanthus were used. Methods Bioassays of the larvicidal and pupicidal effects of these products at different concentrations and times of exposure were evaluated. The lethal and sublethal effects were determined using different concentrations in larvicidal tests. Mortality data were evaluated by Probit analysis to determine the LC50 and LC90 values. Results The vegetable oils from C. phyllacanthus and R. communis demonstrated greater efficiency for larval control with an LC50=0.28µl/mL and an LC90=1.48µl/mL and LC50=0.029µl/mL and a LC90=0.26µl/mL, respectively. In pupal tests toxic effects for all insects were verified after exposure to the products at significant LC50 and LC90 values for 24 and 48h. The effects of sublethal concentrations of C. phyllacanthus (oil were more effective on the insects. Conclusions The vegetables oils from C. phyllacanthus and R. communis demonstrated greater potential from the control of different developmental periods in the life cycle of this insect.

  6. Author Details

    African Journals Online (AJOL)

    Aboderin, AA. Vol 20, No 1 (2008) - Articles Lectins, Mitogenicity and Seed Germination: A Comparative Study with the Seeds of Telfairia occidentalis (Hook, F.) (Curcurbitaceae), Carica papaya (Linn) (Caricaceae) and Artocarpus communis (J.R. & G. Forst) (Moraceae) Abstract PDF. ISSN: 0795-8080. AJOL African ...

  7. Short Communications Fruit selection in the olive thrush: the ...

    African Journals Online (AJOL)

    1996-03-05

    Mar 5, 1996 ... When offered pieces of dyed pear. Pyrus communis, the thrushes preferentially selected orange pieces, followed by red and black pieces. Green pieces were never eaten. The results indicated that olive thrushes selected fruit on the basis of fruit colour, and that colour preferences differed between the two ...

  8. Forensic assays of ricin: development of snp assays to generate precise genetic signatures for mixed genotypes found in ricin preparations

    Energy Technology Data Exchange (ETDEWEB)

    Jackson, Paul J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Hill, Karen K. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2009-11-09

    The results outlined in this report provide the information for needed to apply a SNP-based forensic analysis to diverse ricin preparations. The same methods could be useful in castor breeding programs that seek to reduce or eliminate ricin in oil-producing R. communis cultivars.

  9. Author Details

    African Journals Online (AJOL)

    Kabele-Toge, BB. Vol 3, No 2 (2006) - Articles Formulation studies on the seeds of Ricinus Communis Linn. fam. Euphorbiaceae Abstract · Vol 9, No 1 (2012) - Articles Formulation Studies on the Water Extract of the Antidiabetic Herbal Drug, Vernonia Amygdalina: I – Granule and Some Capsule Properties Abstract.

  10. Lectins, Mitogenicity and Seed Germination: A Comparative Study ...

    African Journals Online (AJOL)

    The fate of lectins contained in the seeds of T. occidentalis, C. papaya and A. communis have been followed during the germinative process. Under the same culture conditions, the emergence of both the radicle and the plumule (the 3rd and 5th day; 18th and 20th and 12th and the 15th day respectively for T. occidentalis, C.

  11. Metabolic profiling variations within D’Anjou pear fruit from different canopy positions

    Science.gov (United States)

    The characteristics of fruit ripening can contribute to the overall quality of the final product. European pear (Pyrus communis L.) ripening is impacted by a combination of cultural practices and storage conditions. One of the main pre-harvest factors affecting fruit maturity and ripening is fruit...

  12. Evaluation of the safety and efficacy of Lesquerella fendleri seed and oils as poultry feed additives

    Science.gov (United States)

    Lesquerella (Lesquerella fendleri (Gray) Wats) is an oil seed plant capable of growth over a large geographic area of the southwestern U.S. The seed oil contains hydroxyfatty acids, useful in a variety of industrial products, and can replace imported castor bean oil (Ricinus communis L.). Lesquere...

  13. Effect of Root Pruning and Irrigation Regimes on Yield and Physiology of Pear Trees

    DEFF Research Database (Denmark)

    Wang, Yufei

    Clara Frijs’ is the dominant pear (Pyrus communis L.) cultivar in Denmark. It is vigorous with long annual shoots, and therefore can be difficult to prune. Root pruning has been widely used to control the canopy size of fruit trees including pears. However, root pruned trees are more likely to su...

  14. Virtual Reality Technologies and the Creative Arts in the Areas of Disability, Therapy, Health, and Rehabilitation

    DEFF Research Database (Denmark)

    Cobb, S. V. G.; Brooks, Anthony Lewis; Sharkey, P. M.

    2013-01-01

    A key theme in the ArtAbilitation conferences is the relationship between 6 sound, movement, and art, and how these can be used for rehabilitation and/or 7 expression by individuals who may have limited access to conventional communi- 8 cation. The development of VR environments and interactive t...

  15. Chemical, Functional and Sensory Properties of Instant Yam ...

    African Journals Online (AJOL)

    Chemical, Functional and Sensory Properties of Instant Yam - Breadfruit Flour. AA Adebowale, SA Sanni, FO Oladapo. Abstract. Yam (Dioscorea rotundata) tubers and breadfruits (Artocarpus communis) were processed separately into instant flour and mixed at different proportions (100% yam flour; 100% breadfruit flour; ...

  16. Genetic linkage maps of Japanese and European pears aligned to the apple consensus map

    NARCIS (Netherlands)

    Yamamoto, T.; Kimura, T.; Saito, T.; Kotobuki, K.; Matsuta, N.; Liebhard, R.; Gessler, C.; Weg, van de W.E.; Hayashi, T.

    2004-01-01

    Genetic linkage maps of the Japanese pear (Pyrus pyrifolia Nakai) cultivar `Housui¿ and the European pear (Pyrus communis L.) cultivar `Bartlett¿ were constructed based on Amplified Fragment Length Polymorphism markers (AFLPs), Simple Sequence Repeat markers (SSRs) (from pear, apple and Prunus),

  17. Jatropha curcasand Ricinus communisdisplay contrasting photosynthetic mechanisms in response to environmental conditions

    Directory of Open Access Journals (Sweden)

    Milton Costa Lima Neto

    2015-06-01

    Full Text Available Higher plants display different adaptive strategies in photosynthesis to cope with abiotic stress. In this study, photosynthetic mechanisms and water relationships displayed byJatropha curcasL. (physic nuts andRicinus communisL. (castor bean, in response to variations in environmental conditions, were assessed.R. communis showed higher CO2 assimilation, stomatal and mesophyll conductance thanJ. curcas as light intensity and intercellular CO2 pressure increased. On the other hand,R. communis was less effective in stomatal control in response to adverse environmental factors such as high temperature, water deficit and vapor pressure deficit, indicating lower water use efficiency. Conversely,J. curcas exhibited higher photosynthetic efficiency (gas exchange and photochemistry and water use efficiency under these adverse environmental conditions.R. communisdisplayed higher potential photosynthesis, but exhibited a lowerin vivo Rubisco carboxylation rate (Vcmax and maximum electron transport rate (Jmax. During the course of a typical day, in a semiarid environment, with high irradiation, high temperature and high vapor pressure deficit, but exposed to well-watered conditions, the two studied species presented similar photosynthesis. Losing potential photosynthesis, but maintaining favorable water status and increasing non-photochemical quenching to avoid photoinhibition, are important acclimation mechanisms developed byJ. curcas to cope with dry and hot conditions. We suggest thatJ. curcas is more tolerant to hot and dry environments thanR. communis but the latter species displays higher photosynthetic efficiency under well-watered and non-stressful conditions.

  18. A Preliminary Investigation On Suspected Plant Poisoning In The ...

    African Journals Online (AJOL)

    they have been reported before to have toxic effects. These were botanically identified as Ranunculus multifidus Forsk, Cassia didymobotrya Fres, Ricinus communis L., Datura stramonium L. and Momordica foetida Schum. It is concluded that some of these plants may be responsible for the poisoning and further studies on ...

  19. Invasive alien plant species used for the treatment of various ...

    African Journals Online (AJOL)

    Results: The study revealed that Schinus molle L., Catharanthus roseus (L.), Datura stramonium L., Opuntia stricta (Haw.) Haw., Opuntia ficus- indica, Sambucus canadensis L., Ricinus communis L., Melia azedarch L., Argemone ochroleuca and Eriobotrya japonica are used for treatment of various diseases such as chest ...

  20. The millipede genus Orthomorpha Bollman, 1893 in Laos (Diplopoda, Polydesmida, Paradoxosomatidae, with descriptions of new species

    Directory of Open Access Journals (Sweden)

    Natdanai Likhitrakarn

    2014-01-01

    Full Text Available The genus Orthomorpha is currently represented in Laos by nine species, including three, O. paviei Brölemann, 1896, O. communis Likhitrakarn, Golovatch & Panha, 2011 and O. cambodjana (Attems, 1953, which are new to the fauna of the country, and further three new to science: O. suberectoides sp. n., O.gladiata sp. n. and O. sutchariti sp. n.

  1. Human-Computer Interaction Software: Lessons Learned, Challenges Ahead

    Science.gov (United States)

    1989-01-01

    domain communi- Iatelligent s t s s Me cation. Users familiar with problem Inteligent support systes. High-func- anddomains but inxperienced with comput...8217i. April 1987, pp. 7.3-78. His research interests include artificial intel- Creating better HCI softw-are will have a 8. S.K Catrd. I.P. Moran. arid

  2. Lectins, Mitogenicity and Seed Germination: A Comparative Study ...

    African Journals Online (AJOL)

    Dr J. T. Ekanem

    2007-05-24

    May 24, 2007 ... generally, e. g. Lactose, but also by Galactose. Secondly, the seeds of A. communis, a plant belonging to the family Moraceae contain a mitogenic haemagglutinin (Artocarpin) that is specifically inhibited by the Melibiose, (6-O-α-. D-galactopyranosyl-D-glucose), but neither by. Lactose nor Galactose4.

  3. Valorisation du lentisque «Pistacia lentiscus L.»: Étude ...

    African Journals Online (AJOL)

    SARAH

    28 févr. 2015 ... Essential Oil Composition of Pistacia Lentiscus L. And Myrtus. Communis L.: Évaluation of Antioxidant. Capacity of Methanolic Extracts. Food chemistry : Vol. 107, No. 3, 1120-1130. Gupta VK., Roy A., Nigam V.K., Mukherjee K, 2010. Antimicrobial Activity of Spondias Pinnata. Resin. J. Med. Plants Res : Vol.

  4. Ethiopian Pharmaceutical Journal - Vol 25, No 1 (2007)

    African Journals Online (AJOL)

    Evaluation of Antimicrobial Activity of the Essential Oil of Myrtus communis L. and Its Formulation into Gum Paint · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. N Akalu, A Endale, K Asres, 72-76. http://dx.doi.org/10.4314/epj.v25i1.35117 ...

  5. Author Details

    African Journals Online (AJOL)

    Akalu, N. Vol 25, No 1 (2007) - Articles Evaluation of Antimicrobial Activity of the Essential Oil of Myrtus communis L. and Its Formulation into Gum Paint Abstract. ISSN: 1029-5933. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners ...

  6. Direction des Publications

    African Journals Online (AJOL)

    Synthese

    Link), Arbustus unedo (L.), Myrtus communis (L.), etc… - Montainous zone, homogeneous zone, formed of Quercus faginea (Lam.) (reaching middle height of 20 m about) and located to an altitude of 850 to 1000 m. Arbustiveous and herbaceous strata are very dense and very varied. The prospected zones are represented ...

  7. ORIGNAL ARTICLE

    African Journals Online (AJOL)

    negerog

    and 13% Eugenyl acetate and Myrtus communis contain. 56% α-pinene and 33% 1,8-cineole as a major component, which were mainly responsible for their antimicrobial activity (14,15). Besides these major components, the variation in antimicrobial activity of the essential oils of the same plant in different formulation as.

  8. flowers

    African Journals Online (AJOL)

    Administrator

    2011-06-08

    Jun 8, 2011 ... Infrastructure Construction Project of Jiangsu Province. (BM2010590). REFERENCES. Ammar AH, Zagrouba F, Romdhane M (2010). Optimization of operating conditions of Tunisian myrtle (Myrtus communis L.) essential oil extraction by a hydrodistillation process using a 2(4) complete factorial design.

  9. Environmental Pollution

    International Development Research Centre (IDRC) Digital Library (Canada)

    In the district of Molango, Mexico, rich natural deposits of manganese have been mined since ... results and promote excellence in research. Eco- health projects also seek to empower communi- ties to take charge of their own environment and health through the research activities. a community of practice gains momentum.

  10. Stroke subtypes and factors associated with ischemic stroke in ...

    African Journals Online (AJOL)

    Stroke subtypes assessed four OCSP (Oxfordshire Communi-. African Health Sciences Vol 15 Issue 1, March 2015. 68. 69 ty Stroke Project Classification) subtypes classification. 13 was used with lacunar circulation infarct (LACI) and total anterior (TACI), partial anterior (PACI), posterior. (POCI) circulation infarcts as non ...

  11. Prerequisites for biocrops Up-Scaling I: An assessment of seed ...

    African Journals Online (AJOL)

    Investigation was based on assessment of seed germination capacity, rooting ability and seedling growth rate of six selected plant species Telfairia pedata, Jatropha curcas, Excoecaria bussei, Croton macrostachyus, Croton megalocarpus and Ricinus communis. Completely randomized design (CRD) was adopted for this ...

  12. Untitled

    Indian Academy of Sciences (India)

    crack-formation, etc., of the black cotton soil of Poona and have shown that sodium carbonate solutions of low concentrations cause a pronounced swelling in the soil rendering it impermeable to Water. In a recent communi- cation they have also shown that the soil thus treated is impermeable to water while a solution of ...

  13. Establishment of proteome spot profiles and comparative analysis of ...

    African Journals Online (AJOL)

    The 'Bon Rouge' pear (Pyrus communis L.) cultivar is characterized by high levels of anthocyanins, the pigments responsible for the red leaf and red fruit skin phenotype. Branches of 'Bon Rouge' pear trees planted in commercial orchards often revert to the original green phenotype. The study aimed at establishing ...

  14. NATO Countering the Hybrid Threat

    Science.gov (United States)

    2011-09-01

    information access, communi- cation, and transportation. The organizations, both state and nonstate, that operate in the nether networks of illicit commerce...in the nether networks of illicit commerce, terror- ism, and insurgency have proven adaptable, innovative, and entrepreneurial as they have

  15. Comparison between in situ dry matter degradation and in vitro gas ...

    African Journals Online (AJOL)

    Dry matter (DM) degradation of Glycrrhiza glabra L, Arbutus andrachne, Juniperus communis, and Pistica lentiscus was determined using two different techniques: (i) the in vitro gas production and (ii) the in situ nylon bag degradability technique. Samples were incubated in situ and in vitro for 3, 6, 12, 24, 48, 72 and 96 h.

  16. National Language and Terminology Policies — A South African ...

    African Journals Online (AJOL)

    rbr

    activity of regulating and improving existing languages or creating new com- mon regional, national or international .... secondary school level and tertiary level), and a language of communi- cation (e.g. media), and ... mentally political outlook both in its composition, function and relation. These. Boards were linked to ...

  17. Long-term effects of scrub clearance and litter removal on the re-establishment of dry alvar grassland species

    NARCIS (Netherlands)

    Bakker, Jan P.; Rosen, Eje; Ozinga, Wim A.; Bretfeld, Mario; Feldt, Tobias; Stahl, Julia

    2012-01-01

    Many characteristic dry alvar grassland species disappear after cessation of livestock grazing as a result of encroachment by Juniperus communis. We studied the re-establishment of these species after scrub clearance with and without the removal of the layer of litter and mosses in long-term (14

  18. Evaluation of Source of Messages on AIDS by College Students

    African Journals Online (AJOL)

    tor's expert ability: the higher the opinion the more effective the message. Others have also stated that there is more attitude change when the communi- cation possesses high credibility rather than low credibility 2, and the communicator who is trusted produces more attitude change than one who is not . Thus more attitude ...

  19. Intensive Cultural Resource Inventory of Selected Recreation Areas in the West Portion of Lake Sakakawea, Dunn, McKenzie, Mountrail and Williams Counties, North Dakota. Volume 1.

    Science.gov (United States)

    1983-01-01

    woody and herbaceous vegetation. Cottonwoods (Populus deltoides ), junipers (Salix interior and Juniperus communis), are examples of woody plants...Woods (Mother). She was born in 1865 and lived to be 62 years old. She died on July 17, 1927 of acute yellow atrophy of the liver. Burial was the same

  20. Histopathology of gill, liver, muscle and brain of Cyprinus carpio ...

    African Journals Online (AJOL)

    Histological studies in organs like gill, liver, muscle and brain of Cyprinus carpio communis were made to assess tissue damage due to sublethal concentration of heavy metals lead and cadmium after 28 days of exposure. In lead treated gill, disintegration and fusion of primary lamellae, extensive vacuolization with ...

  1. Evaluation of some bioagents and botanicals in in vitro control of ...

    African Journals Online (AJOL)

    SERVER

    2008-04-03

    Apr 3, 2008 ... culture with the pathogen to monitor antagonistic effect. In another experiment, botanicals of tobacco. (Nicotiana tabacum) and castor plant (Ricinus communis) were incorporated as poison in a growth media. Of all the four bio-agents used, only P. fluorescens was able to inhibit the growth of the pathogen.

  2. Inventory and Assessment of Aquatic Plant Management Methodologies.

    Science.gov (United States)

    1983-01-01

    spicatumi L.) Hydrilla (Hydrilla verticillata SAM (L.f.) Royle) Glyphosate Giant reed (Phragmites communis SACS (Roundup) (Trin.) Rud.) No chemical -- NCS...and 2,4-D ( BEE ) and (DMA) used for treatment of Eurasian watermilfoil. SWT 2,4-D ( BEE ) in granular form (20 percent or higher, as necessary; active

  3. Extensor Tendon Instability Due to Sagittal Band Injury in a Martial Arts Athlete: A Case Report.

    Science.gov (United States)

    Kochevar, Andrew; Rayan, Ghazi

    2017-03-01

    A Taekwondo participant sustained a hand injury from punching an opponent that resulted in painful instability of the ring finger extensor digitorum communis tendon due to sagittal band damage. His symptoms resolved after reconstructive surgery on the sagittal band (SB) with stabilization of the extensor tendon over the metacarpophalangeal joint.

  4. Potential for Introduction of Invasive Species into Louisiana from Illinois River Dredged Material

    Science.gov (United States)

    2008-06-01

    over time for seedling germination (J. Marlin, personal communication). Only 9 of the 13 core locations had seed germination. The total number of...Prickly Lettuce * FAC Lapsana communis Nipplewort * UPL Lindernia dubia False Pimpernel * OBL ▪ Melilotus alba* White Sweet Clover...alismoides Duck lettuce Plants Panicum repens Torpedo grass Plants Pistia stratiotes Water lettuce Plants Polygonum cuspidatum Japanese knotweed Plants

  5. Biotechnology for improved hHydroxy fatty acid production in oilseed lesquerella

    Science.gov (United States)

    The conventional source of hydroxy fatty acid (HFA) is from castor (Ricinus communis), 90% of castor oil is ricinoleic acid (18:1OH). Ricinoleic acid and its derivatives are used as raw materials for numerous industrial products, such as lubricants, plasticizers and surfactants. The production of ca...

  6. Marker list: QM118806 [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QM118806 Pyrus communis Rosaceae Md-Exp 7 SSR FCATAGAAGGTGGCATGAGCA TTTCTCCTCACACC...CAAACC P128R068T003 x 'Moonglow'|Passe Crassane x Harrow Sweet LG_01 ... 10.1371/journal.pone.0077022 24155917

  7. Marker list: QM118785 [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available AACCCAC P128R068T003 x 'Moonglow'|WBC ('Bartlett' consensus map) LG08, LG15|LG_08 ... 10.1371/journal.pone.0077022 24155917 ... QM118785 Pyrus communis Rosaceae CH05a02 SSR GTTGCAAGAGTTGCATGTTAGC TTTTGACCCCATAA

  8. Intuition at the heart of Intercultural Management – on the self-conception of Intercultural Managers

    OpenAIRE

    Vogler, Petra

    2012-01-01

    Nowadays management in organisations and companies has become first and foremost a „management of intercultural complexity“ (Mahadevan 2008a). Intercultural management competence subsequently moves in and between the five dimensions having of experience, sensitivity, skill, knowledge and meta skill intuition in intercultural action contexts and therefore presents itself as strategic competence in international organisational settings. Keywords: intercultural management, intercultural communi...

  9. Untitled

    Indian Academy of Sciences (India)

    mandibular valve (Pl. XV, Fig. 5). The pharynx is made up of mucosa, submucosa and muscularis (Pl. 1,. Fig. 6). Currey (1939) deals with the pharyngeal region of the Carp,. Cyprinus capio communis, elaborately dividing it into anterior and posterior regions on histological differences. In Tilapia mossambica the tunics are.

  10. Globalisation and the internationalisation of higher education in sub ...

    African Journals Online (AJOL)

    He points out that the first industrial revolution reduced dependence on human muscle and now the information revolution is reducing dependence on our eyes, ears, and brains. ... Fourth, normal cost/benefit analysis cannot be applied to information and communi- cation technologies. Fifth, the high failure rate of ...

  11. Inheritance of Plant Height in two Ethiopian Castor Varieties

    African Journals Online (AJOL)

    The green revolution in Asia was led by the semi dwarf varieties of wheat and rice during the 1960s. Nowadays ... Castor (Racinnus communis L.) is an industrial non edible oil seed that originated in East. Africa probably Ethiopia ... At the fourth generation single plants from each inbred line were reciprocally crossed to ...

  12. The effect of the process parameters in the planing processes on the ...

    African Journals Online (AJOL)

    In this study, the effects of the process parameters in the planing processes on the surface roughness were investigated. For this purpose, the experimental samples of cherry (Prunus avium L.) and pear (Pirus communis L.) wood species, which are commonly used in the Turkish decoration industry, were prepared.

  13. Role of polyamines and ethylene as modulators of plant senescence

    Indian Academy of Sciences (India)

    Unknown

    They suggested that both, salicylic acid and PAs may specifically regulate ethylene biosynthesis at the level of ACC synthase transcript accumulation. No rela- tion between endogenous PAs levels and ethylene were observed during post bloom period in Pyrus communis flowers (Crisosto et al 1992). In contrast to the usual.

  14. Danquah et al

    African Journals Online (AJOL)

    PUBLICATIONS1

    The upsurge of real estate housing within Accra has resulted in all manner of gated communi- ties springing up across the city scape ... sessment from the occupants in order to check the performance of real estate developers. INTRODUCTION. Housing demand in .... lowest in August (Ghana Meteoro- logical Agency, 2014).

  15. Lipase Activity in Fermented Oil Seeds of Africa Locust Bean ...

    African Journals Online (AJOL)

    acer

    Lipase Activity in Fermented Oil Seeds of Africa Locust Bean, (Parkia Biglobosa),. Castor Seeds (Ricinu Communis) and African Oil Bean (Pentaclethra Macrophylla). A.A. Liman*, P. Egwin, M.A. Vunchi and C. Ayansi. Department of Science Laboratory Technology, School of Applied Arts and Sciences. Federal Polytechnic ...

  16. Effects of graded levels of dehulled and cooked caster oil bean ...

    African Journals Online (AJOL)

    Anak strain) were used in an experiment to investigate the effects of dehulled and cooked castor oil bean (Ricinus communis L) meal supplemented with L-lysine on growth performance and certain blood parameters of broiler finishers. The birds ...

  17. (11) EFFECT OF POWDERED CASTOR BEAN

    African Journals Online (AJOL)

    Adeyinka Odunsi

    A study was carried out at the Toxicology laboratory of the Department of Crop and Environmental protection,. Ladoke Akintola University of Technology Ogbomoso, to determine the effects of powdered castor oil seed. (Ricinus communis L.Euphorbiaceae) on kidney, liver, spleen of albino rats. The rats were in five groups, ...

  18. Allelopathic effect of aqueous extract of fresh leaf castor beans ...

    African Journals Online (AJOL)

    Allelopathy defines the production of specific biomolecules (allelochemical) by a plant that can induce positive or negative impacts on another culture. The crop of castor beans (Ricinus communis L.) is being economically valued and receiving attention, mainly by the biodiesel production, castor oil and animal feeding.

  19. Effect of plant and row spacing on the yield and oil contents of castor ...

    African Journals Online (AJOL)

    Castor (Ricinus communis L.) is an industrial non edible oilseed adapted to drier areas. An experiment was conducted in the Central Rift Valley of Ethiopia to determine optimum plant population of castor variety Hiruy. Four plant (50, 60, 70 and 80 cm) and four row spacing (60,80,100 and 120 cm) were arranged in factorial ...

  20. Untitled

    Indian Academy of Sciences (India)

    their lipase content with a view to get cheap and active lipase on a large scale. The lipases are prepared from the following oilseeds according to. Longnecker and Haly's method and the different factors which control the activity of these lipases are studied--(1) Castor (Ricinus communis);. (2) Groundnut (Arachis hypogea); ...

  1. Effect of thermal processing methods on the proximate composition ...

    African Journals Online (AJOL)

    The nutritive value of raw and thermal processed castor oil seed (Ricinus communis) was investigated using the following parameters; proximate composition, gross energy, mineral constituents and ricin content. Three thermal processing methods; toasting, boiling and soaking-and-boiling were used in the processing of the ...

  2. Acute Toxicity of Castor Oil Bean Extract and Tolerance Level of ...

    African Journals Online (AJOL)

    The experiment was carried out to determine the acute toxicity of raw castor oil bean (Ricinus communis) extract and the tolerance level of raw castor oil bean by broilers. The seeds were ground, defatted with petroleum ether and the residue was subjected to extraction with phosphate-buffered saline. The extract volume ...

  3. against Spodoptera frugiperda (Lepidoptera: Noctuidae)

    African Journals Online (AJOL)

    STORAGESEVER

    2010-03-01

    Mar 1, 2010 ... However, its activity against Spodoptera frugiperda is unclear. Therefore, to determinate the insecticidal and insectistatic activities of methanol, hexane and ethyl acetate extracts of the seeds and leaves of R. communis, castor oil and ricinine were tested at different concentrations against S. frugiperda.

  4. Amelioration of Anti-Nutritive Effects of Castor Oil Seed ( Ricinus ...

    African Journals Online (AJOL)

    Three hundred and twenty (320) day old male broilers were used to investigate the amelioration of anti-nutritive effects of castor oil seed (Ricinus communis) meal in broilers' ration using natural fermentation and DL-Methionine supplementation. The experimental designed was a 4 × 2 factorial arrangement of dietary ...

  5. The Relationship between Social Factors and the Poverty ...

    African Journals Online (AJOL)

    Ada Global

    The nutritive value of raw and thermal processed castor oil seed (Ricinus communis) was investigated using the following parameters; proximate composition, gross energy, mineral constituents and ricin content. Three thermal processing methods; toasting, boiling and soaking-and-boiling were used in the processing of the ...

  6. Allelopathic effect of aqueous extract of fresh leaf castor beans ...

    African Journals Online (AJOL)

    Rukevwe S. Abraka

    2016-12-07

    Dec 7, 2016 ... Allelopathy defines the production of specific biomolecules (allelochemical) by a plant that can induce positive or negative impacts on another culture. The crop of castor beans (Ricinus communis L.) is being economically valued and receiving attention, mainly by the biodiesel production, castor oil and.

  7. Efficacy of vegetable oils against dry bean beetles Acanthoscelides ...

    African Journals Online (AJOL)

    Acanthoscelides obtectus (Say) is a major pest of stored dry beans (Phaseolus vulgaris L.) and other legumes world wide. The objective of this study was to assess the efficacy of castor (Ricinus communis L.) and cottonseed (Gossypium hirsutum) oils against A. obtectus on stored dry beans under laboratory conditions.

  8. Screening of spontaneous castor bean accesses for genetic ...

    African Journals Online (AJOL)

    ... discriminant power between the castor bean accesses, being the multivariate analysis efficient in this process. The castor bean accesses ACS-001 CRSP and ACS-001-MASP are promising for introduction in genetic improvement programs of this culture. Keywords: Ricinus communis L., genotype, multivariate statistics, ...

  9. Studies of teh phytotoxicity of the seed of phytochemical screening ...

    African Journals Online (AJOL)

    The phytotoxicity of the seed and phytochemical screening of the leaf of Ricinus communis were investigated. The secondary metabolites in the leaf were screened and identified. The leaves were sun dried, pulverized and sieved. The resulting powdered extract was subjected to phytochemical tests. A proximate analysis ...

  10. Glyoxalase I expression pattern in Hevea brasiliensis seedlings ...

    African Journals Online (AJOL)

    Glyoxalase I from Ricinus communis had the highest nucleotide sequence homology (90%) compared to the amplified gene. BLASTP analysis also showed high homology between the deduced protein sequence of the amplified gene and glyoxalases from other species. Our results suggest that the multi-stress inducibility ...

  11. Nutritive value and biochemical changes in broiler chickens fed ...

    African Journals Online (AJOL)

    Castor bean (Ricinus communis Linn.) is an important oilseed rich in protein but rarely used as livestock feed due to antinutritional factors. Castor seed was detoxified using combined processing techniques of moist heating and fermentation (5 and 7- day) or lye treatment and fed to150 day-old Anak 2000 broiler chicks at ...

  12. The phytochemical, antibacterial and antioxidant activity of five ...

    African Journals Online (AJOL)

    Leaf extracts of Senna italica, Ricinus communis, Lantana camara, Lippia javanica and Ziziphus mucronata were screened for biological activity against bacteria which infect wounds. The leaves were extracted using different solvents of varying polarity (hexane, dichloromethane, acetone and methanol). Phytochemical ...

  13. Author Details

    African Journals Online (AJOL)

    Antioxidant and antibacterial properties of Ziziphus mucronata and Ricinus communis leaves extracts. Abstract PDF · Vol 12, No 3 (2015) - Articles In vitro immune-modulatory potential of crude extract of leaf of Albizia gummifera against stimulated peripheral blood mononuclear and raw cells. Abstract PDF. ISSN: 0189-6016.

  14. Fulltext PDF

    Indian Academy of Sciences (India)

    Administrator

    2.1 Materials and methods. Undec-10-enioc (purity 98%) and (Z)-octadec-9- enoic (97%) acids were purchased from Fluka Chemi- cals (Bucks, Switzerland). (Z)-12-hydroxyoctadec-9- enoic acid (ricinolic acid, 98%) and (Z)-9-hydroxy- octadec-12-enoic acid (isoricinolic acid, 98%) were isolated from Ricinus communis and ...

  15. prerequisites for biocrops up-scaling ii: an assessment of the ...

    African Journals Online (AJOL)

    nb

    ABSTRACT. The rooting ability of hardwood cuttings from six selected non- edible oilferous plant species with potential for biodiesel production namely Telfairia pedata, Jatropha curcas, Excoecaria bussei,. Croton macrostachyus, Croton megalocarpus and Ricinus communis was assessed on 4 different potting media i.e. ...

  16. Construction of a full-length cDNA library and analysis of expressed ...

    African Journals Online (AJOL)

    ... in the GenBank databases. Cluster analysis allowed the identification of 61 unique sequences. These genes were classified into six types by Gene Ontology (GO) annotation. The results also indicated that unigenes of C. capsularis have higher homology to Populus trichocarpa, Ricinus communis and Corchorus olitorius.

  17. Study on Biodiesel plants growth performance and tolerance to ...

    African Journals Online (AJOL)

    Abstract. In this research, we studied the growth performance and tolerance of three biodiesel plants namely; Jatropha curcas, Moringa oleifera and Ricinus communis to water stress. Research conducted on the three different soils from Kaita, Jibiya and Mai'adua in the semi-desert environments of Katsina State, Nigeria.

  18. Antioxidant activities of the selected plants from the family ...

    African Journals Online (AJOL)

    USER

    2010-02-15

    Feb 15, 2010 ... were found in n-butanol extract of Ricinus communis. Antioxidant activities of these extracts were evaluated through DPPH• radical scavenging, phosphomolybdate and ferric thiocyanate (FTC) methods. Methanolic extract of Cinnamomum zeylanicum and Cinnamomum tamala showed highest antiradical.

  19. Haematological and biochemical evaluation of the n -hexane extract ...

    African Journals Online (AJOL)

    The study undertook to evaluate the sub-chronic toxicological profile of the seed of Ricinus communis var. minor (RICOM-1013-J), widely used as anticonceptive agent among Bassa people of Plateau State, Nigeria, on haematological and biochemical parameters in adult rats. Thirty-six (36) adult female rats were divided ...

  20. Performance of isobaric and isotopic labeling in quantitative plant proteomics

    DEFF Research Database (Denmark)

    Nogueira, Fábio C S; Palmisano, Giuseppe; Schwämmle, Veit

    2012-01-01

    , and quantitation. In the present work, we have used LC-MS to compare an isotopic (ICPL) and isobaric (iTRAQ) chemical labeling technique to quantify proteins in the endosperm of Ricinus communis seeds at three developmental stages (IV, VI, and X). Endosperm proteins of each stage were trypsin-digested in...